3HSAA

Crystal structure of pleckstrin homology domain (yp_926556.1) from shewanella amazonensis sb2b at 1.99 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
114
Chain Sequence
b'MGFLDALMGNASEVDLGLAAELSPILGDNEELQLAYMVRDLFVFTSRLILIDQGVTGVSYHSIPYAIVHFQVETAGTFDMDAELLWISGQHEPLVELRGTDVVGIQTIARYALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pleckstrin homology domain
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Shewanella amazonensis sb2b
molecule tags Structural genomics, unknown function
total genus 21
structure length 114
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08000 bPH_1 Bacterial PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3hsaA00
3DCXA 3HSAA 3B77A
chains in the Genus database with same CATH superfamily
1K5DB 4CHMA 4QJ4B 4L6EA 4F7HA 1TQZA 2UVMA 2CODA 2M38A 2NBVA 1FHXA 2ZKMX 1SGHA 2ZPYA 2J0MA 5L81A 1OMWA 5C79A 4HHVA 1I7AA 1NI2A 2LG1A 3A98B 2DKQA 1WJMA 4HDOA 3FVCA 5LG4B 2FJUB 2Z59A 3ODWA 2W2XC 3NSUA 1H4RA 2MKRA 3CIKA 1WJ1A 3B77A 5J3QA 2OQBA 5JHGA 1B55A 2Y7BA 2NMBA 3F5RA 2D4QA 3ODOA 4HDQA 4NY0A 1MI1A 4WVFB 2K8EA 3DXDA 1M7RA 4HB4B 4HAXB 3FM8C 1U5GA 4C0AA 3A8QA 2Z0PA 1BTKA 2Z4DA 4ZRKA 5I2MA 5CLQB 2YS5A 4WSFA 3BJIA 2QKLA 3DCXA 2COAA 4DBBA 3FEHA 4K81A 2GCJA 3M1IB 1IRSA 1XKEA 2RRFA 3KRXA 3U8ZA 3GYOA 2KUPA 3PVUA 2L2IA 3MPXA 4D0NB 1DDVA 3T06A 3PZDA 1P6SA 3CXBB 1FHOA 3IVFA 2RUKB 1XR0B 1UPRA 3NWAA 3VOQA 2ELBA 3BINA 1V5UA 1WGQA 2GS0A 5C5BA 2E2XA 4HAWB 2D9XA 1PFJA 2Q13A 2DTCA 1UEFA 3KZ1A 3P7ZA 2IYBA 1FGYA 5C6RA 3UZTA 2R0DA 1FB8A 2N0YA 1X05A 2I5FA 1SHCA 1Y19B 2V76A 2MDXA 4P7IA 1FAOA 3KY9A 2QKMA 2VSZA 2CY5A 1QQGA 2KCJA 2LKOA 3ULBA 1KI1B 4A5KA 1EGXA 3D8FA 4GMXB 1V89A 1GG3A 1GC6A 1KZGA 1LB1A 5C16A 3OHMB 1MIXA 2KUQA 2DX5A 3PP2A 2LOXA 1UNRA 2LYDA 3PVLA 1W1DA 5DIFB 2DFKA 1TXDA 4GZUA 1ZSQA 1MKEA 3SYXA 5JHHA 5FI0A 1UNQA 2D2QA 3A58A 2BCJA 1XD4A 2KIGA 2CAYA 3SNHA 2MWNB 2D9ZA 4XWXA 5FI1A 4IFSA 2P8VA 2RGNB 5C5BB 1DYNA 2DKPA 5LONB 3LJUX 4PNKA 1AWEA 3D8EA 3MDBC 1ZC3B 2DYQA 5J3TA 1OQNA 4MT7A 4BBKA 5M4YB 2D9YA 2DN6A 1WGUA 2DHIA 2RVBB 4EKUA 4KHBA 1X86A 2M14A 4CYEA 4DX8A 4OT1A 3TO1A 2K2UA 2H7DA 5HE3A 3PVWA 4CHJA 5DHFB 4A6KA 1H10A 5D3XA 4Z2MB 1OY2A 2YSZA 2EMSA 3U7DA 2DHJA 4Y94A 2P0DA 1DDMA 2DYNA 2GCLA 1BTNA 1Y5OA 2YT0A 1UPQA 5HE1A 2KIEA 1P3RA 5DH9B 3ZVRA 3F0WA 3N7CA 1FGZA 4H8SA 2JP2A 2D9VA 2YT1A 1X11A 1EF1A 4HB0B 1U5DA 5JLJB 4CSQA 1PMSA 3HIEA 4HAVB 3ULCA 1XODA 2YT2A 4B6HA 3AJ4A 3AU4A 1RJ2A 3X23A 1XX0A 1U5EA 5IRSA 2IFSA 1ISNA 4GPTB 5LOPB 2Z0OA 3NWDA 4GNKB 2YRYA 2DLWA 3HK0A 4KHBB 2GJYA 4OSNA 1MK9B 1BAKA 3QIJA 4DXAB 2ROVA 1UNPA 2NZ8B 3NW8A 1E5WA 2UZSA 1V5PA 4HB2B 2LULA 1ZYIA 3RCPA 4WJ7A 1FOEA 2P0FA 4D6WA 1WG7A 5HE0A 2YS1A 1ZM0A 1V61A 4MY6A 2D11A 4K2PA 5I2SA 2X18A 2D10A 2ROZB 3DXEA 1RRPB 1GC7A 2Y8GA 3TCAA 2UZRA 4IOYX 1M7EA 2FJLA 4EMOA 4ZRIA 3TVVA 3A8PA 1MK7B 2AL6A 1W1GA 1X1GA 3HQCA 3NWFA 2CY4A 2RLOA 3U12A 2Z0QA 1P5TA 1FHWA 2COFA 2EJ8A 2Z13A 2MFQA 4KHOA 2J59M 2K00A 2YF0A 5KQ4A 1DBHA 3DXCA 5HE2A 2YS3A 2K49A 5KQ1A 2K2JA 3D8DA 1LW3A 2EMTA 4MK0A 5DHAB 2J0KA 2RNRB 1MPHA 3ML4A 3PEGA 5DI9B 1NU2A 1EVHA 2COCA 3PG7A 4PQ0A 4YL8A 2HTHB 2VRWB 5D3WA 2VKIA 2AEHA 2Z14A 3TFMA 1KZ7A 2CRFA 1XCGA 2DX1A 5CLLB 1QC6A 2ADZA 3GYPA 3O96A 2HE7A 1TJ6A 3KRWA 4F7GA 4DX90 4GOUA 2W2XD 5EFXA 1BWNA 1K5GB 2G35A 4IAPA 2N23A 4GXBA 2GUMA 1NTYA 1J0WA 1NTVA 5D27A 2L1CA 2Y8FA 1WVHA 3P6AA 3WA0A 4A6FA 2RSGA 1ZVRA 4YONA 3ODXA 3AU5A 2KGXB 3VIAA 2J0JA 5JP4A 1X1FA 4QJ3B 1V88A 2PZ1A 4KAXB 3FSSA 4Z2NA 1U5FA 1W1HA 4NSWA 3PSCA 4GN1A 2XQNM 4HAUB 1J19A 4QXAB 4F7UP 5D3VA 1MAIA 2W2WA 4DIXA 2P0HA 2DA0A 3HSAA 1Z87A 2OTXA 2DHKA 2I1KA 2YVCA 3SO6A 4K2OA 4QJ5B 1WI1A 5J3YA 3ZDTA 1U27A 3TW1A 2R09A 2I1JA 4K17A 4EJNA 4TKNA 4L1RA 1V5MA 4HAZB 1EAZA 2H7EA 4A6HA 1AQCA 1DDWA 3QWMA 5D3YA 3V5WA 3WYFB 1U2BA 1I2HA 4KHAA 2LOZA 4HB3B 2R2YA 3SUZA 1U29A 1N3HA 3OANA 2I5CA 1ZC4B 4KVGB 2ELAA 4HAYB 3G9WA 4A6FB 3QBVB 3HW2B 2KR0A 3KSYA 2D9WA 1Q67A 2EC1A 4HSIA 1DROA 4GMVA 1MIZB 5KCVA 4TYZA 1T77A 4ZRJA 5GOWB 3SV1A 4HATB 1PLSA
chains in the Genus database with same CATH topology
3DCXA 3HSAA 3B77A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DCX A;  3HSA A;  3B77 A; 
#chains in the Genus database with same CATH topology
 1K5D B;  4CHM A;  4QJ4 B;  4L6E A;  4F7H A;  1TQZ A;  2UVM A;  2COD A;  2M38 A;  2NBV A;  1FHX A;  2ZKM X;  1SGH A;  2ZPY A;  2J0M A;  5L81 A;  1OMW A;  5C79 A;  4HHV A;  1I7A A;  1NI2 A;  2LG1 A;  3A98 B;  2DKQ A;  1WJM A;  4HDO A;  3FVC A;  5LG4 B;  2FJU B;  2Z59 A;  3ODW A;  2W2X C;  3NSU A;  1H4R A;  2MKR A;  3CIK A;  1WJ1 A;  3B77 A;  5J3Q A;  2OQB A;  5JHG A;  1B55 A;  2Y7B A;  2NMB A;  3F5R A;  2D4Q A;  3ODO A;  4HDQ A;  4NY0 A;  1MI1 A;  4WVF B;  2K8E A;  3DXD A;  1M7R A;  4HB4 B;  4HAX B;  3FM8 C;  1U5G A;  4C0A A;  3A8Q A;  2Z0P A;  1BTK A;  2Z4D A;  4ZRK A;  5I2M A;  5CLQ B;  2YS5 A;  4WSF A;  3BJI A;  2QKL A;  3DCX A;  2COA A;  4DBB A;  3FEH A;  4K81 A;  2GCJ A;  3M1I B;  1IRS A;  1XKE A;  2RRF A;  3KRX A;  3U8Z A;  3GYO A;  2KUP A;  3PVU A;  2L2I A;  3MPX A;  4D0N B;  1DDV A;  3T06 A;  3PZD A;  1P6S A;  3CXB B;  1FHO A;  3IVF A;  2RUK B;  1XR0 B;  1UPR A;  3NWA A;  3VOQ A;  2ELB A;  3BIN A;  1V5U A;  1WGQ A;  2GS0 A;  5C5B A;  2E2X A;  4HAW B;  2D9X A;  1PFJ A;  2Q13 A;  2DTC A;  1UEF A;  3KZ1 A;  3P7Z A;  2IYB A;  1FGY A;  5C6R A;  3UZT A;  2R0D A;  1FB8 A;  2N0Y A;  1X05 A;  2I5F A;  1SHC A;  1Y19 B;  2V76 A;  2MDX A;  4P7I A;  1FAO A;  3KY9 A;  2QKM A;  2VSZ A;  2CY5 A;  1QQG A;  2KCJ A;  2LKO A;  3ULB A;  1KI1 B;  4A5K A;  1EGX A;  3D8F A;  4GMX B;  1V89 A;  1GG3 A;  1GC6 A;  1KZG A;  1LB1 A;  5C16 A;  3OHM B;  1MIX A;  2KUQ A;  2DX5 A;  3PP2 A;  2LOX A;  1UNR A;  2LYD A;  3PVL A;  1W1D A;  5DIF B;  2DFK A;  1TXD A;  4GZU A;  1ZSQ A;  1MKE A;  3SYX A;  5JHH A;  5FI0 A;  1UNQ A;  2D2Q A;  3A58 A;  2BCJ A;  1XD4 A;  2KIG A;  2CAY A;  3SNH A;  2MWN B;  2D9Z A;  4XWX A;  5FI1 A;  4IFS A;  2P8V A;  2RGN B;  5C5B B;  1DYN A;  2DKP A;  5LON B;  3LJU X;  4PNK A;  1AWE A;  3D8E A;  3MDB C;  1ZC3 B;  2DYQ A;  5J3T A;  1OQN A;  4MT7 A;  4BBK A;  5M4Y B;  2D9Y A;  2DN6 A;  1WGU A;  2DHI A;  2RVB B;  4EKU A;  4KHB A;  1X86 A;  2M14 A;  4CYE A;  4DX8 A;  4OT1 A;  3TO1 A;  2K2U A;  2H7D A;  5HE3 A;  3PVW A;  4CHJ A;  5DHF B;  4A6K A;  1H10 A;  5D3X A;  4Z2M B;  1OY2 A;  2YSZ A;  2EMS A;  3U7D A;  2DHJ A;  4Y94 A;  2P0D A;  1DDM A;  2DYN A;  2GCL A;  1BTN A;  1Y5O A;  2YT0 A;  1UPQ A;  5HE1 A;  2KIE A;  1P3R A;  5DH9 B;  3ZVR A;  3F0W A;  3N7C A;  1FGZ A;  4H8S A;  2JP2 A;  2D9V A;  2YT1 A;  1X11 A;  1EF1 A;  4HB0 B;  1U5D A;  5JLJ B;  4CSQ A;  1PMS A;  3HIE A;  4HAV B;  3ULC A;  1XOD A;  2YT2 A;  4B6H A;  3AJ4 A;  3AU4 A;  1RJ2 A;  3X23 A;  1XX0 A;  1U5E A;  5IRS A;  2IFS A;  1ISN A;  4GPT B;  5LOP B;  2Z0O A;  3NWD A;  4GNK B;  2YRY A;  2DLW A;  3HK0 A;  4KHB B;  2GJY A;  4OSN A;  1MK9 B;  1BAK A;  3QIJ A;  4DXA B;  2ROV A;  1UNP A;  2NZ8 B;  3NW8 A;  1E5W A;  2UZS A;  1V5P A;  4HB2 B;  2LUL A;  1ZYI A;  3RCP A;  4WJ7 A;  1FOE A;  2P0F A;  4D6W A;  1WG7 A;  5HE0 A;  2YS1 A;  1ZM0 A;  1V61 A;  4MY6 A;  2D11 A;  4K2P A;  5I2S A;  2X18 A;  2D10 A;  2ROZ B;  3DXE A;  1RRP B;  1GC7 A;  2Y8G A;  3TCA A;  2UZR A;  4IOY X;  1M7E A;  2FJL A;  4EMO A;  4ZRI A;  3TVV A;  3A8P A;  1MK7 B;  2AL6 A;  1W1G A;  1X1G A;  3HQC A;  3NWF A;  2CY4 A;  2RLO A;  3U12 A;  2Z0Q A;  1P5T A;  1FHW A;  2COF A;  2EJ8 A;  2Z13 A;  2MFQ A;  4KHO A;  2J59 M;  2K00 A;  2YF0 A;  5KQ4 A;  1DBH A;  3DXC A;  5HE2 A;  2YS3 A;  2K49 A;  5KQ1 A;  2K2J A;  3D8D A;  1LW3 A;  2EMT A;  4MK0 A;  5DHA B;  2J0K A;  2RNR B;  1MPH A;  3ML4 A;  3PEG A;  5DI9 B;  1NU2 A;  1EVH A;  2COC A;  3PG7 A;  4PQ0 A;  4YL8 A;  2HTH B;  2VRW B;  5D3W A;  2VKI A;  2AEH A;  2Z14 A;  3TFM A;  1KZ7 A;  2CRF A;  1XCG A;  2DX1 A;  5CLL B;  1QC6 A;  2ADZ A;  3GYP A;  3O96 A;  2HE7 A;  1TJ6 A;  3KRW A;  4F7G A;  4DX9 0;  4GOU A;  2W2X D;  5EFX A;  1BWN A;  1K5G B;  2G35 A;  4IAP A;  2N23 A;  4GXB A;  2GUM A;  1NTY A;  1J0W A;  1NTV A;  5D27 A;  2L1C A;  2Y8F A;  1WVH A;  3P6A A;  3WA0 A;  4A6F A;  2RSG A;  1ZVR A;  4YON A;  3ODX A;  3AU5 A;  2KGX B;  3VIA A;  2J0J A;  5JP4 A;  1X1F A;  4QJ3 B;  1V88 A;  2PZ1 A;  4KAX B;  3FSS A;  4Z2N A;  1U5F A;  1W1H A;  4NSW A;  3PSC A;  4GN1 A;  2XQN M;  4HAU B;  1J19 A;  4QXA B;  4F7U P;  5D3V A;  1MAI A;  2W2W A;  4DIX A;  2P0H A;  2DA0 A;  3HSA A;  1Z87 A;  2OTX A;  2DHK A;  2I1K A;  2YVC A;  3SO6 A;  4K2O A;  4QJ5 B;  1WI1 A;  5J3Y A;  3ZDT A;  1U27 A;  3TW1 A;  2R09 A;  2I1J A;  4K17 A;  4EJN A;  4TKN A;  4L1R A;  1V5M A;  4HAZ B;  1EAZ A;  2H7E A;  4A6H A;  1AQC A;  1DDW A;  3QWM A;  5D3Y A;  3V5W A;  3WYF B;  1U2B A;  1I2H A;  4KHA A;  2LOZ A;  4HB3 B;  2R2Y A;  3SUZ A;  1U29 A;  1N3H A;  3OAN A;  2I5C A;  1ZC4 B;  4KVG B;  2ELA A;  4HAY B;  3G9W A;  4A6F B;  3QBV B;  3HW2 B;  2KR0 A;  3KSY A;  2D9W A;  1Q67 A;  2EC1 A;  4HSI A;  1DRO A;  4GMV A;  1MIZ B;  5KCV A;  4TYZ A;  1T77 A;  4ZRJ A;  5GOW B;  3SV1 A;  4HAT B;  1PLS A; 
#chains in the Genus database with same CATH homology
 3DCX A;  3HSA A;  3B77 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...