3HSAA

Crystal structure of pleckstrin homology domain (yp_926556.1) from shewanella amazonensis sb2b at 1.99 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
114
Chain Sequence
MGFLDALMGNASEVDLGLAAELSPILGDNEELQLAYMVRDLFVFTSRLILIDQGVTGVSYHSIPYAIVHFQVETAGTFDMDAELLWISGQHEPLVELRGTDVVGIQTIARYALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Shewanella amazonensis sb2b
molecule tags Structural genomics, unknown function
molecule keywords pleckstrin homology domain
total genus 21
structure length 114
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08000 bPH_1 Bacterial PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3hsaA00
3HSAA 3B77A 3DCXA
chains in the Genus database with same CATH superfamily
1MI1A 2OTXA 1KZGA 5KCVA 2NMBA 2VKIA 2YF0A 4D6WA 2D9XA 2GJYA 4GN1A 5M4YB 1EF1A 1BTKA 1FOEA 3G9WA 5JP4A 2QKMA 2J0JA 1N3HA 1DROA 4KHBA 1TQZA 2W2WA 3NWFA 3WYFB 2D9YA 2GS0A 3NSUA 4ZRKA 3ULCA 4QXAB 3HQCA 1UNPA 2LULA 3DXCA 3ODOA 2RRFA 3SO6A 4OSNA 4MK0A 2RNRB 3B77A 3D8DA 2CY5A 1WJ1A 1I2HA 4A6HA 2R09A 3ULBA 2YT2A 1XKEA 2M38A 1EGXA 5DHAB 5C6RA 1P3RA 3DCXA 1V5UA 5I2SA 3PVLA 2ELAA 1ZM0A 1NI2A 2EMSA 4L1RA 4F7GA 3PG7A 3VIAA 2D11A 2DYNA 2NZ8B 2VRWB 5J3YA 1Q67A 3N7CA 2GCJA 2Z4DA 5C16A 2D9VA 1M7RA 4IFSA 2E2XA 2ROZB 2CRFA 3PZDA 3MDBC 4K2PA 4XWXA 4IOYX 1X11A 2YRYA 3KSYA 2Z0QA 2FJLA 2YT0A 4QJ4B 2RLOA 4HB4B 4K2OA 4YONA 4BBKA 2DHJA 2R2YA 2I5CA 2I1KA 2YT1A 2DHKA 2UZRA 2YS3A 5C5BA 4Z2MB 3SYXA 3FSSA 3WA0A 1WGUA 2QKLA 4QJ3B 2OQBA 2COCA 1ISNA 1WGQA 2EJ8A 3ODXA 2P0HA 3HSAA 3ODWA 1W1DA 2D4QA 3U8ZA 2L2IA 4EMOA 2MFQA 2DN6A 1MK9B 2DKPA 3MPXA 4GZUA 4HAUB 2J59M 3CIKA 2RVBB 4MY6A 3V5WA 2KIEA 3PVWA 4IAPA 1P6SA 2J0KA 2JP2A 1X1GA 4KHBB 1BTNA 1UPQA 3OHMB 1T77A 1V5PA 5HE2A 1TXDA 4L6EA 1MKEA 3FM8C 4GPTB 1SGHA 4HAVB 2ZKMX 4K81A 2I1JA 3U12A 5D3YA 2N0YA 2K49A 2ROVA 1PFJA 2CY4A 5D3WA 1U2BA 5HE0A 1EAZA 1V88A 2LKOA 4K17A 2KGXB 5LG4B 3QWMA 2DX5A 2MKRA 2CAYA 3D8EA 1PMSA 2AL6A 4HB3B 5FI0A 4H8SA 2YSZA 3PSCA 1MIZB 2Z14A 4KHOA 4KHAA 1OY2A 1FHWA 1MPHA 3D8FA 4YL8A 3U7DA 3T06A 1W1GA 4CHJA 1B55A 1U5FA 4HAYB 3NWDA 5KQ1A 1IRSA 2D9ZA 3GYOA 2MWNB 1FGYA 2EMTA 2UVMA 4CHMA 4DBBA 4ZRJA 2DX1A 1J0WA 3M1IB 1X1FA 1Y19B 2L1CA 1XD4A 2NBVA 5D27A 3BJIA 1H4RA 4NY0A 2R0DA 3HIEA 2Z13A 4CYEA 2YS5A 2DHIA 1XODA 2PZ1A 1U5DA 1GC6A 1XX0A 1BWNA 1ZC3B 3HK0A 4HSIA 1Z87A 3KRWA 4GOUA 2GCLA 4DIXA 3F5RA 3DXEA 5J3QA 2Y8FA 4HAWB 4HHVA 2G35A 4TKNA 4F7UP 1FGZA 2V76A 3TFMA 1MIXA 4F7HA 1AQCA 1QC6A 2ADZA 3RCPA 4CSQA 1W1HA 4EJNA 3P6AA 1V5MA 5I2MA 1LB1A 1WG7A 2H7EA 2XQNM 5C79A 5KQ4A 1RJ2A 2FJUB 3P7ZA 2DA0A 1H10A 3AU4A 3FEHA 2HTHB 1WJMA 1XCGA 1ZC4B 5EFXA 1EVHA 2D9WA 4GXBA 3HW2B 1FAOA 4EKUA 5C5BB 1ZYIA 3FVCA 4DX8A 4HAXB 1SHCA 4NSWA 2COAA 2UZSA 3KRXA 2KCJA 1AWEA 3A8QA 3NWAA 4WJ7A 3QIJA 3TCAA 1X05A 1LW3A 2M14A 3PEGA 4PQ0A 1DDMA 1K5DB 5HE1A 4C0AA 2DLWA 2KUPA 1WI1A 3LJUX 1V89A 4KVGB 4HB2B 3A58A 4DXAB 5DH9B 5LOPB 1J19A 2Q13A 3PP2A 5GOWB 1DDWA 1Y5OA 1U5EA 2RUKB 2Z0PA 3KY9A 1XR0B 1E5WA 2Z59A 2Z0OA 2COFA 4B6HA 1FB8A 2ELBA 5CLQB 4A6FA 2YVCA 1OMWA 3VOQA 4WVFB 1UNQA 2HE7A 2X18A 3TW1A 5JLJB 5JHHA 2CODA 4WSFA 2P0DA 2KIGA 2LOXA 2Y8GA 4TYZA 1V61A 4GMXB 1K5GB 3F0WA 5DI9B 3TVVA 2K2JA 2J0MA 2K8EA 3IVFA 1PLSA 4HB0B 1DDVA 4A5KA 2GUMA 2P0FA 2LYDA 1TJ6A 1X86A 5LONB 3BINA 3ZDTA 4P7IA 5CLLB 1I7AA 1MK7B 4HAZB 2P8VA 4MT7A 2DFKA 2KUQA 4A6FB 1KZ7A 2I5FA 2W2XC 3ML4A 4HATB 5D3XA 1ZVRA 4OT1A 3AU5A 5JHGA 3SV1A 4HDQA 2YS1A 2Y7BA 2VSZA 5HE3A 4PNKA 2W2XD 3CXBB 2K2UA 2AEHA 4GNKB 3GYPA 5FI1A 1GG3A 1NTVA 2H7DA 2DYQA 2RSGA 2LOZA 1DYNA 4HDOA 4D0NB 1M7EA 3TO1A 1OQNA 1FHXA 1WVHA 2D2QA 1U27A 2N23A 2IYBA 4ZRIA 3NW8A 1P5TA 1U5GA 1QQGA 3ZVRA 3UZTA 1U29A 5DIFB 2K00A 4Y94A 1NU2A 2KR0A 4A6KA 4DX90 4KAXB 2ZPYA 1KI1B 3A98B 3PVUA 4Z2NA 5J3TA 2BCJA 3SNHA 3X23A 2LG1A 5D3VA 1GC7A 1ZSQA 2DKQA 1RRPB 1DBHA 2MDXA 1UEFA 3SUZA 2RGNB 3QBVB 3OANA 3KZ1A 2EC1A 5IRSA 3O96A 1NTYA 4GMVA 5L81A 1BAKA 3DXDA 1UNRA 5DHFB 1FHOA 1MAIA 3AJ4A 2IFSA 2DTCA 4QJ5B 2D10A 3A8PA 1UPRA
chains in the Genus database with same CATH topology
3HSAA 3B77A 3DCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSA A;  3B77 A;  3DCX A; 
#chains in the Genus database with same CATH topology
 1MI1 A;  2OTX A;  1KZG A;  5KCV A;  2NMB A;  2VKI A;  2YF0 A;  4D6W A;  2D9X A;  2GJY A;  4GN1 A;  5M4Y B;  1EF1 A;  1BTK A;  1FOE A;  3G9W A;  5JP4 A;  2QKM A;  2J0J A;  1N3H A;  1DRO A;  4KHB A;  1TQZ A;  2W2W A;  3NWF A;  3WYF B;  2D9Y A;  2GS0 A;  3NSU A;  4ZRK A;  3ULC A;  4QXA B;  3HQC A;  1UNP A;  2LUL A;  3DXC A;  3ODO A;  2RRF A;  3SO6 A;  4OSN A;  4MK0 A;  2RNR B;  3B77 A;  3D8D A;  2CY5 A;  1WJ1 A;  1I2H A;  4A6H A;  2R09 A;  3ULB A;  2YT2 A;  1XKE A;  2M38 A;  1EGX A;  5DHA B;  5C6R A;  1P3R A;  3DCX A;  1V5U A;  5I2S A;  3PVL A;  2ELA A;  1ZM0 A;  1NI2 A;  2EMS A;  4L1R A;  4F7G A;  3PG7 A;  3VIA A;  2D11 A;  2DYN A;  2NZ8 B;  2VRW B;  5J3Y A;  1Q67 A;  3N7C A;  2GCJ A;  2Z4D A;  5C16 A;  2D9V A;  1M7R A;  4IFS A;  2E2X A;  2ROZ B;  2CRF A;  3PZD A;  3MDB C;  4K2P A;  4XWX A;  4IOY X;  1X11 A;  2YRY A;  3KSY A;  2Z0Q A;  2FJL A;  2YT0 A;  4QJ4 B;  2RLO A;  4HB4 B;  4K2O A;  4YON A;  4BBK A;  2DHJ A;  2R2Y A;  2I5C A;  2I1K A;  2YT1 A;  2DHK A;  2UZR A;  2YS3 A;  5C5B A;  4Z2M B;  3SYX A;  3FSS A;  3WA0 A;  1WGU A;  2QKL A;  4QJ3 B;  2OQB A;  2COC A;  1ISN A;  1WGQ A;  2EJ8 A;  3ODX A;  2P0H A;  3HSA A;  3ODW A;  1W1D A;  2D4Q A;  3U8Z A;  2L2I A;  4EMO A;  2MFQ A;  2DN6 A;  1MK9 B;  2DKP A;  3MPX A;  4GZU A;  4HAU B;  2J59 M;  3CIK A;  2RVB B;  4MY6 A;  3V5W A;  2KIE A;  3PVW A;  4IAP A;  1P6S A;  2J0K A;  2JP2 A;  1X1G A;  4KHB B;  1BTN A;  1UPQ A;  3OHM B;  1T77 A;  1V5P A;  5HE2 A;  1TXD A;  4L6E A;  1MKE A;  3FM8 C;  4GPT B;  1SGH A;  4HAV B;  2ZKM X;  4K81 A;  2I1J A;  3U12 A;  5D3Y A;  2N0Y A;  2K49 A;  2ROV A;  1PFJ A;  2CY4 A;  5D3W A;  1U2B A;  5HE0 A;  1EAZ A;  1V88 A;  2LKO A;  4K17 A;  2KGX B;  5LG4 B;  3QWM A;  2DX5 A;  2MKR A;  2CAY A;  3D8E A;  1PMS A;  2AL6 A;  4HB3 B;  5FI0 A;  4H8S A;  2YSZ A;  3PSC A;  1MIZ B;  2Z14 A;  4KHO A;  4KHA A;  1OY2 A;  1FHW A;  1MPH A;  3D8F A;  4YL8 A;  3U7D A;  3T06 A;  1W1G A;  4CHJ A;  1B55 A;  1U5F A;  4HAY B;  3NWD A;  5KQ1 A;  1IRS A;  2D9Z A;  3GYO A;  2MWN B;  1FGY A;  2EMT A;  2UVM A;  4CHM A;  4DBB A;  4ZRJ A;  2DX1 A;  1J0W A;  3M1I B;  1X1F A;  1Y19 B;  2L1C A;  1XD4 A;  2NBV A;  5D27 A;  3BJI A;  1H4R A;  4NY0 A;  2R0D A;  3HIE A;  2Z13 A;  4CYE A;  2YS5 A;  2DHI A;  1XOD A;  2PZ1 A;  1U5D A;  1GC6 A;  1XX0 A;  1BWN A;  1ZC3 B;  3HK0 A;  4HSI A;  1Z87 A;  3KRW A;  4GOU A;  2GCL A;  4DIX A;  3F5R A;  3DXE A;  5J3Q A;  2Y8F A;  4HAW B;  4HHV A;  2G35 A;  4TKN A;  4F7U P;  1FGZ A;  2V76 A;  3TFM A;  1MIX A;  4F7H A;  1AQC A;  1QC6 A;  2ADZ A;  3RCP A;  4CSQ A;  1W1H A;  4EJN A;  3P6A A;  1V5M A;  5I2M A;  1LB1 A;  1WG7 A;  2H7E A;  2XQN M;  5C79 A;  5KQ4 A;  1RJ2 A;  2FJU B;  3P7Z A;  2DA0 A;  1H10 A;  3AU4 A;  3FEH A;  2HTH B;  1WJM A;  1XCG A;  1ZC4 B;  5EFX A;  1EVH A;  2D9W A;  4GXB A;  3HW2 B;  1FAO A;  4EKU A;  5C5B B;  1ZYI A;  3FVC A;  4DX8 A;  4HAX B;  1SHC A;  4NSW A;  2COA A;  2UZS A;  3KRX A;  2KCJ A;  1AWE A;  3A8Q A;  3NWA A;  4WJ7 A;  3QIJ A;  3TCA A;  1X05 A;  1LW3 A;  2M14 A;  3PEG A;  4PQ0 A;  1DDM A;  1K5D B;  5HE1 A;  4C0A A;  2DLW A;  2KUP A;  1WI1 A;  3LJU X;  1V89 A;  4KVG B;  4HB2 B;  3A58 A;  4DXA B;  5DH9 B;  5LOP B;  1J19 A;  2Q13 A;  3PP2 A;  5GOW B;  1DDW A;  1Y5O A;  1U5E A;  2RUK B;  2Z0P A;  3KY9 A;  1XR0 B;  1E5W A;  2Z59 A;  2Z0O A;  2COF A;  4B6H A;  1FB8 A;  2ELB A;  5CLQ B;  4A6F A;  2YVC A;  1OMW A;  3VOQ A;  4WVF B;  1UNQ A;  2HE7 A;  2X18 A;  3TW1 A;  5JLJ B;  5JHH A;  2COD A;  4WSF A;  2P0D A;  2KIG A;  2LOX A;  2Y8G A;  4TYZ A;  1V61 A;  4GMX B;  1K5G B;  3F0W A;  5DI9 B;  3TVV A;  2K2J A;  2J0M A;  2K8E A;  3IVF A;  1PLS A;  4HB0 B;  1DDV A;  4A5K A;  2GUM A;  2P0F A;  2LYD A;  1TJ6 A;  1X86 A;  5LON B;  3BIN A;  3ZDT A;  4P7I A;  5CLL B;  1I7A A;  1MK7 B;  4HAZ B;  2P8V A;  4MT7 A;  2DFK A;  2KUQ A;  4A6F B;  1KZ7 A;  2I5F A;  2W2X C;  3ML4 A;  4HAT B;  5D3X A;  1ZVR A;  4OT1 A;  3AU5 A;  5JHG A;  3SV1 A;  4HDQ A;  2YS1 A;  2Y7B A;  2VSZ A;  5HE3 A;  4PNK A;  2W2X D;  3CXB B;  2K2U A;  2AEH A;  4GNK B;  3GYP A;  5FI1 A;  1GG3 A;  1NTV A;  2H7D A;  2DYQ A;  2RSG A;  2LOZ A;  1DYN A;  4HDO A;  4D0N B;  1M7E A;  3TO1 A;  1OQN A;  1FHX A;  1WVH A;  2D2Q A;  1U27 A;  2N23 A;  2IYB A;  4ZRI A;  3NW8 A;  1P5T A;  1U5G A;  1QQG A;  3ZVR A;  3UZT A;  1U29 A;  5DIF B;  2K00 A;  4Y94 A;  1NU2 A;  2KR0 A;  4A6K A;  4DX9 0;  4KAX B;  2ZPY A;  1KI1 B;  3A98 B;  3PVU A;  4Z2N A;  5J3T A;  2BCJ A;  3SNH A;  3X23 A;  2LG1 A;  5D3V A;  1GC7 A;  1ZSQ A;  2DKQ A;  1RRP B;  1DBH A;  2MDX A;  1UEF A;  3SUZ A;  2RGN B;  3QBV B;  3OAN A;  3KZ1 A;  2EC1 A;  5IRS A;  3O96 A;  1NTY A;  4GMV A;  5L81 A;  1BAK A;  3DXD A;  1UNR A;  5DHF B;  1FHO A;  1MAI A;  3AJ4 A;  2IFS A;  2DTC A;  4QJ5 B;  2D10 A;  3A8P A;  1UPR A; 
#chains in the Genus database with same CATH homology
 3HSA A;  3B77 A;  3DCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...