3HSAA

Crystal structure of pleckstrin homology domain (yp_926556.1) from shewanella amazonensis sb2b at 1.99 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
125
structure length
114
Chain Sequence
MGFLDALMGNASEVDLGLAAELSPILGDNEELQLAYMVRDLFVFTSRLILIDQGVTGVSYHSIPYAIVHFQVETAGTFDMDAELLWISGQHEPLVELRGTDVVGIQTIARYALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pleckstrin homology domain
publication title Bacterial pleckstrin homology domains: a prokaryotic origin for the PH domain.
pubmed doi rcsb
source organism Shewanella amazonensis sb2b
molecule tags Structural genomics, unknown function
total genus 21
structure length 114
sequence length 125
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08000 bPH_1 Bacterial PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.50 Mainly Beta Roll PH-domain like Bacterial Pleckstrin homology domain 3hsaA00
3HSAA 3B77A 3DCXA
chains in the Genus database with same CATH superfamily
1XCGA 2DKPA 5J3YA 1SGHA 4HAVB 3U7DA 5LG4B 1MAIA 4KHAA 2BCJA 1U5DA 1W1DA 2W2WA 2UZRA 3F5RA 1V5MA 4KVGB 4ZRIA 2D9YA 4DX8A 1OY2A 2Z4DA 1ISNA 1XODA 5LOPB 4L1RA 3KSYA 4Y94A 4KHOA 2L2IA 3OANA 5M4YB 4BBKA 3IVFA 1X1GA 2YS1A 5JHGA 3WA0A 1M7EA 3VIAA 4F7UP 2ZKMX 1GC7A 5DHAB 2ROVA 3ODWA 5DIFB 4KHBB 2AEHA 1SHCA 1GC6A 3NWAA 4A6FA 1RJ2A 1H10A 2QKMA 2EJ8A 3PSCA 4HHVA 2RSGA 4Z2NA 1DROA 3SYXA 2Z14A 2P8VA 1X11A 3WYFB 4HSIA 2I1KA 2Z59A 2N0YA 5CLLB 4DX90 1WVHA 1KI1B 2KR0A 3QWMA 1U5EA 4YL8A 2CY5A 2PZ1A 3F0WA 2Z0PA 4EKUA 2V76A 1NTYA 1XR0B 2P0DA 5J3QA 5D3YA 1U5GA 5HE3A 1MPHA 4HB0B 2FJUB 2YVCA 1KZ7A 2R0DA 4GZUA 3SNHA 2DYQA 2CODA 3PP2A 4K2OA 2IYBA 2J0KA 2X18A 3SUZA 3TW1A 4QXAB 1WGUA 5KQ4A 2VKIA 3AU5A 2KCJA 3P7ZA 2YRYA 1FHWA 3DXDA 1AWEA 4A5KA 5C16A 3A8PA 2RUKB 2KIGA 3FVCA 2K00A 3P6AA 1NI2A 2COAA 1X1FA 2HE7A 3X23A 3TVVA 5CLQB 4OSNA 5J3TA 1LW3A 2Z13A 1UNRA 5JLJB 4P7IA 4WJ7A 3NWDA 4L6EA 1IRSA 2VRWB 1V89A 2RGNB 1MIXA 1TJ6A 1XX0A 3A98B 3D8FA 3VOQA 1UPRA 2G35A 2KUPA 4WVFB 5D3WA 1UNPA 1FHXA 5I2MA 4HB3B 1M7RA 4GXBA 5KQ1A 4D0NB 1P6SA 4CSQA 2D9WA 3KRXA 2M14A 1FGYA 2DLWA 1E5WA 3KZ1A 4WSFA 2YS3A 2E2XA 5C5BB 3G9WA 2UZSA 5FI1A 4DIXA 1EF1A 5FI0A 2L1CA 1Q67A 4K17A 1DYNA 3UZTA 3HIEA 1GG3A 4CYEA 2DKQA 2YS5A 4QJ4B 4DXAB 4TKNA 3RCPA 1J19A 1B55A 1OQNA 4IFSA 2YT1A 4Z2MB 2LULA 3ML4A 4A6HA 5GOWB 1DDVA 2NMBA 2DFKA 1W1GA 1FHOA 3MDBC 2MFQA 3BINA 3PVLA 5JHHA 3PVUA 2RVBB 2Z0QA 2K2UA 1V61A 5D3XA 3FSSA 1AQCA 5C79A 2GJYA 1U27A 3PZDA 4PQ0A 2Q13A 5KCVA 4F7GA 2EMSA 3D8DA 1BWNA 3ZVRA 1BTNA 3A58A 1KZGA 2KUQA 3ODXA 4MY6A 4CHJA 4MK0A 2I5FA 4HB4B 3ULCA 2H7EA 5L81A 2Y8FA 1X86A 2ELBA 1FOEA 3CIKA 3TFMA 5C6RA 1EGXA 1T77A 2EC1A 1RRPB 4D6WA 3PEGA 3AJ4A 3SO6A 4HB2B 1W1HA 2GUMA 2NZ8B 4HAUB 3ODOA 4KHBA 3DXCA 2I5CA 2J0JA 4QJ3B 1ZSQA 2DX5A 5HE1A 1U2BA 1PLSA 3KRWA 3FEHA 2K49A 2LOXA 2Z0OA 4A6KA 2D11A 4H8SA 2P0FA 3V5WA 1P5TA 2EMTA 4GNKB 2DX1A 5JP4A 1FB8A 1QQGA 2RRFA 4K2PA 2ZPYA 3HK0A 1N3HA 3DXEA 2ELAA 2LYDA 1DBHA 5HE0A 1EAZA 4DBBA 2K8EA 2D9ZA 5DI9B 2DHIA 2K2JA 2DYNA 2GS0A 3PVWA 2J0MA 1PFJA 4TYZA 2YT0A 3T06A 4HDOA 3QIJA 3PG7A 4YONA 2COFA 2W2XC 4HAXB 1WI1A 1H4RA 4XWXA 3HQCA 1LB1A 4GMXB 2LOZA 4NSWA 2KIEA 2JP2A 2KGXB 2YT2A 1ZYIA 4IOYX 2Y7BA 2MDXA 4A6FB 1BTKA 3M1IB 2IFSA 1ZC4B 3TCAA 2RLOA 1V5PA 2LKOA 2MKRA 1WJMA 3U8ZA 4KAXB 2D2QA 1NU2A 1WGQA 2I1JA 1PMSA 2Y8GA 3A8QA 4NY0A 2D4QA 4OT1A 4MT7A 4CHMA 4ZRJA 4GN1A 1U29A 3SV1A 3DCXA 1P3RA 3NWFA 2CRFA 1FGZA 3B77A 5DH9B 2HTHB 2GCLA 3NW8A 2CY4A 4IAPA 1U5FA 2NBVA 1ZC3B 1V88A 1I2HA 2QKLA 3FM8C 1ZM0A 4GOUA 2FJLA 1XKEA 2W2XD 2YF0A 1MKEA 1TQZA 2DA0A 5HE2A 1BAKA 1ZVRA 2N23A 5D3VA 1V5UA 1TXDA 2OTXA 2YSZA 1MK7B 4PNKA 5C5BA 1X05A 1K5GB 2UVMA 1OMWA 3BJIA 1MI1A 2H7DA 4GPTB 3N7CA 2RNRB 2LG1A 1Y5OA 2J59M 3GYPA 4ZRKA 2DHJA 1J0WA 1NTVA 1Y19B 4C0AA 2XQNM 4HDQA 4GMVA 1QC6A 5EFXA 5DHFB 3U12A 3LJUX 2CAYA 2D9XA 2R09A 4B6HA 3HSAA 2MWNB 3TO1A 4QJ5B 2D9VA 1WG7A 3OHMB 2ADZA 5I2SA 3HW2B 1EVHA 5D27A 3ULBA 2P0HA 3QBVB 1I7AA 5LONB 3CXBB 3MPXA 3AU4A 1MK9B 2VSZA 2COCA 1UEFA 1XD4A 4EJNA 4EMOA 1FAOA 1UNQA 5IRSA 2AL6A 2R2YA 3KY9A 4HATB 1DDMA 2DHKA 1DDWA 4HAWB 4F7HA 1MIZB 3O96A 2ROZB 2D10A 3ZDTA 2GCJA 1UPQA 2DN6A 3NSUA 1Z87A 3D8EA 1K5DB 2OQBA 4HAYB 4HAZB 2DTCA 2M38A 1WJ1A 4K81A 3GYOA
chains in the Genus database with same CATH topology
3HSAA 3B77A 3DCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSA A;  3B77 A;  3DCX A; 
#chains in the Genus database with same CATH topology
 1XCG A;  2DKP A;  5J3Y A;  1SGH A;  4HAV B;  3U7D A;  5LG4 B;  1MAI A;  4KHA A;  2BCJ A;  1U5D A;  1W1D A;  2W2W A;  2UZR A;  3F5R A;  1V5M A;  4KVG B;  4ZRI A;  2D9Y A;  4DX8 A;  1OY2 A;  2Z4D A;  1ISN A;  1XOD A;  5LOP B;  4L1R A;  3KSY A;  4Y94 A;  4KHO A;  2L2I A;  3OAN A;  5M4Y B;  4BBK A;  3IVF A;  1X1G A;  2YS1 A;  5JHG A;  3WA0 A;  1M7E A;  3VIA A;  4F7U P;  2ZKM X;  1GC7 A;  5DHA B;  2ROV A;  3ODW A;  5DIF B;  4KHB B;  2AEH A;  1SHC A;  1GC6 A;  3NWA A;  4A6F A;  1RJ2 A;  1H10 A;  2QKM A;  2EJ8 A;  3PSC A;  4HHV A;  2RSG A;  4Z2N A;  1DRO A;  3SYX A;  2Z14 A;  2P8V A;  1X11 A;  3WYF B;  4HSI A;  2I1K A;  2Z59 A;  2N0Y A;  5CLL B;  4DX9 0;  1WVH A;  1KI1 B;  2KR0 A;  3QWM A;  1U5E A;  4YL8 A;  2CY5 A;  2PZ1 A;  3F0W A;  2Z0P A;  4EKU A;  2V76 A;  1NTY A;  1XR0 B;  2P0D A;  5J3Q A;  5D3Y A;  1U5G A;  5HE3 A;  1MPH A;  4HB0 B;  2FJU B;  2YVC A;  1KZ7 A;  2R0D A;  4GZU A;  3SNH A;  2DYQ A;  2COD A;  3PP2 A;  4K2O A;  2IYB A;  2J0K A;  2X18 A;  3SUZ A;  3TW1 A;  4QXA B;  1WGU A;  5KQ4 A;  2VKI A;  3AU5 A;  2KCJ A;  3P7Z A;  2YRY A;  1FHW A;  3DXD A;  1AWE A;  4A5K A;  5C16 A;  3A8P A;  2RUK B;  2KIG A;  3FVC A;  2K00 A;  3P6A A;  1NI2 A;  2COA A;  1X1F A;  2HE7 A;  3X23 A;  3TVV A;  5CLQ B;  4OSN A;  5J3T A;  1LW3 A;  2Z13 A;  1UNR A;  5JLJ B;  4P7I A;  4WJ7 A;  3NWD A;  4L6E A;  1IRS A;  2VRW B;  1V89 A;  2RGN B;  1MIX A;  1TJ6 A;  1XX0 A;  3A98 B;  3D8F A;  3VOQ A;  1UPR A;  2G35 A;  2KUP A;  4WVF B;  5D3W A;  1UNP A;  1FHX A;  5I2M A;  4HB3 B;  1M7R A;  4GXB A;  5KQ1 A;  4D0N B;  1P6S A;  4CSQ A;  2D9W A;  3KRX A;  2M14 A;  1FGY A;  2DLW A;  1E5W A;  3KZ1 A;  4WSF A;  2YS3 A;  2E2X A;  5C5B B;  3G9W A;  2UZS A;  5FI1 A;  4DIX A;  1EF1 A;  5FI0 A;  2L1C A;  1Q67 A;  4K17 A;  1DYN A;  3UZT A;  3HIE A;  1GG3 A;  4CYE A;  2DKQ A;  2YS5 A;  4QJ4 B;  4DXA B;  4TKN A;  3RCP A;  1J19 A;  1B55 A;  1OQN A;  4IFS A;  2YT1 A;  4Z2M B;  2LUL A;  3ML4 A;  4A6H A;  5GOW B;  1DDV A;  2NMB A;  2DFK A;  1W1G A;  1FHO A;  3MDB C;  2MFQ A;  3BIN A;  3PVL A;  5JHH A;  3PVU A;  2RVB B;  2Z0Q A;  2K2U A;  1V61 A;  5D3X A;  3FSS A;  1AQC A;  5C79 A;  2GJY A;  1U27 A;  3PZD A;  4PQ0 A;  2Q13 A;  5KCV A;  4F7G A;  2EMS A;  3D8D A;  1BWN A;  3ZVR A;  1BTN A;  3A58 A;  1KZG A;  2KUQ A;  3ODX A;  4MY6 A;  4CHJ A;  4MK0 A;  2I5F A;  4HB4 B;  3ULC A;  2H7E A;  5L81 A;  2Y8F A;  1X86 A;  2ELB A;  1FOE A;  3CIK A;  3TFM A;  5C6R A;  1EGX A;  1T77 A;  2EC1 A;  1RRP B;  4D6W A;  3PEG A;  3AJ4 A;  3SO6 A;  4HB2 B;  1W1H A;  2GUM A;  2NZ8 B;  4HAU B;  3ODO A;  4KHB A;  3DXC A;  2I5C A;  2J0J A;  4QJ3 B;  1ZSQ A;  2DX5 A;  5HE1 A;  1U2B A;  1PLS A;  3KRW A;  3FEH A;  2K49 A;  2LOX A;  2Z0O A;  4A6K A;  2D11 A;  4H8S A;  2P0F A;  3V5W A;  1P5T A;  2EMT A;  4GNK B;  2DX1 A;  5JP4 A;  1FB8 A;  1QQG A;  2RRF A;  4K2P A;  2ZPY A;  3HK0 A;  1N3H A;  3DXE A;  2ELA A;  2LYD A;  1DBH A;  5HE0 A;  1EAZ A;  4DBB A;  2K8E A;  2D9Z A;  5DI9 B;  2DHI A;  2K2J A;  2DYN A;  2GS0 A;  3PVW A;  2J0M A;  1PFJ A;  4TYZ A;  2YT0 A;  3T06 A;  4HDO A;  3QIJ A;  3PG7 A;  4YON A;  2COF A;  2W2X C;  4HAX B;  1WI1 A;  1H4R A;  4XWX A;  3HQC A;  1LB1 A;  4GMX B;  2LOZ A;  4NSW A;  2KIE A;  2JP2 A;  2KGX B;  2YT2 A;  1ZYI A;  4IOY X;  2Y7B A;  2MDX A;  4A6F B;  1BTK A;  3M1I B;  2IFS A;  1ZC4 B;  3TCA A;  2RLO A;  1V5P A;  2LKO A;  2MKR A;  1WJM A;  3U8Z A;  4KAX B;  2D2Q A;  1NU2 A;  1WGQ A;  2I1J A;  1PMS A;  2Y8G A;  3A8Q A;  4NY0 A;  2D4Q A;  4OT1 A;  4MT7 A;  4CHM A;  4ZRJ A;  4GN1 A;  1U29 A;  3SV1 A;  3DCX A;  1P3R A;  3NWF A;  2CRF A;  1FGZ A;  3B77 A;  5DH9 B;  2HTH B;  2GCL A;  3NW8 A;  2CY4 A;  4IAP A;  1U5F A;  2NBV A;  1ZC3 B;  1V88 A;  1I2H A;  2QKL A;  3FM8 C;  1ZM0 A;  4GOU A;  2FJL A;  1XKE A;  2W2X D;  2YF0 A;  1MKE A;  1TQZ A;  2DA0 A;  5HE2 A;  1BAK A;  1ZVR A;  2N23 A;  5D3V A;  1V5U A;  1TXD A;  2OTX A;  2YSZ A;  1MK7 B;  4PNK A;  5C5B A;  1X05 A;  1K5G B;  2UVM A;  1OMW A;  3BJI A;  1MI1 A;  2H7D A;  4GPT B;  3N7C A;  2RNR B;  2LG1 A;  1Y5O A;  2J59 M;  3GYP A;  4ZRK A;  2DHJ A;  1J0W A;  1NTV A;  1Y19 B;  4C0A A;  2XQN M;  4HDQ A;  4GMV A;  1QC6 A;  5EFX A;  5DHF B;  3U12 A;  3LJU X;  2CAY A;  2D9X A;  2R09 A;  4B6H A;  3HSA A;  2MWN B;  3TO1 A;  4QJ5 B;  2D9V A;  1WG7 A;  3OHM B;  2ADZ A;  5I2S A;  3HW2 B;  1EVH A;  5D27 A;  3ULB A;  2P0H A;  3QBV B;  1I7A A;  5LON B;  3CXB B;  3MPX A;  3AU4 A;  1MK9 B;  2VSZ A;  2COC A;  1UEF A;  1XD4 A;  4EJN A;  4EMO A;  1FAO A;  1UNQ A;  5IRS A;  2AL6 A;  2R2Y A;  3KY9 A;  4HAT B;  1DDM A;  2DHK A;  1DDW A;  4HAW B;  4F7H A;  1MIZ B;  3O96 A;  2ROZ B;  2D10 A;  3ZDT A;  2GCJ A;  1UPQ A;  2DN6 A;  3NSU A;  1Z87 A;  3D8E A;  1K5D B;  2OQB A;  4HAY B;  4HAZ B;  2DTC A;  2M38 A;  1WJ1 A;  4K81 A;  3GYO A; 
#chains in the Genus database with same CATH homology
 3HSA A;  3B77 A;  3DCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...