3HSFA

Heat shock transcription factor (hsf)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined solution structure and dynamics of the DNA-binding domain of the heat shock factor from Kluyveromyces lactis.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription regulation
molecule keywords HEAT SHOCK TRANSCRIPTION FACTOR
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1995-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hsfA00
3GFJA 4O5VA 1U5TC 3WG9A 5J6XA 4PDKA 2IPQX 4KYWA 3TOAA 3F8NA 1R5HA 4BXUA 2B0LA 1IF1A 2QBYA 3U9GA 1BBYA 2NNYA 3GYHX 1EH7A 2M45A 2H09A 1DPRA 2YX4A 3IWZA 1O7FA 3BJAA 3ZQ7A 1USTA 3WU1B 1K79A 1P92A 2QYOA 2HGCA 3RKYA 2DPUA 1XD7A 2W25A 4HQEA 1ZRDA 1KQ9A 2HS5A 2OA4A 5D5WB 2RGVA 3WTSC 5AIPA 3L00A 3RKWA 3I58A 4ASNA 1JGSA 3I59B 2FBKA 1IXRC 1XSXA 3L9FA 3F3XA 1IRFA 1MZBA 4EM1A 4PCQA 3NRVA 4ZH4F 5ILSA 5L3GA 3DKWA 4RGXA 2PMHA 5HDNA 4IRHA 1FBUA 1S7AA 4LB5A 1TQPA 2XRNA 2E7XA 2XAHA 3L7WA 2H94A 3I64A 4S04A 4WF2A 2STWA 1TQMA 2OZUA 4PGGA 1HSJA 2RC4A 4JBAA 5DCMB 1ZH5A 1YQAA 1KU9A 1DP7P 3BROA 3P9KA 1D5VA 5CYVA 2UXXA 4KIGA 1B1BA 1Q1HA 2XV4S 3M1EA 4LK0F 5HLIA 3R6SA 4YIFA 1U78A 3NQOA 2HKOA 4KN7X 1ULYA 1LDJA 2V79A 1T2KA 3I4PA 3RI4A 2FRHA 3BZ6A 3V8JA 5DUKA 1S6LA 1SAXA 1MGTA 3FMSA 1BC7C 2DK8A 1G3WA 3MZHA 2VONA 4WXDA 3WE2A 5K1YA 3ML6A 3ZP5A 2X4HA 4P9FA 1YYVA 4OMZA 1SD4A 3O2PE 2MC3A 4I98B 4KIFA 4UHTA 1FBSA 5HVQC 1ZARA 1O3RA 5JHUA 1ZHFA 3SQNA 2XAGA 1J75A 1UHWA 1WKMA 5LGUA 2DQRA 3M8EA 3KZYA 4FX4A 2DT5A 2A6HF 1XB4A 3T8RA 1WRJA 3I0TA 1G3SA 1XGOA 4A0XA 1BJAA 5ICFA 1ZG5A 1QZZA 3BWGA 3JAMK 2KIFA 1U3EM 4A6DA 4ESBA 4OIPF 2JTVA 1HXDA 1K78A 3R0AA 2CO5A 4IF4A 2QVOA 4L9NA 3T1BA 1TQIA 4Q48A 1BI1A 5ICCA 4RB2C 4I01A 4BQAA 1YLFA 4UUVA 2M5WA 3MAJA 5K5QA 4HX8A 4Q5SF 3ZMSA 4Z2YA 3R4KA 2VBWA 4K2EA 1JHFA 1FPQA 2Q8KA 5K5RA 2K86A 1FT9A 3WTTC 2UZKA 2XIGA 4M72A 2V1UA 3K1MA 3WTXC 1OKRA 3OOPA 5E8IA 4ENMA 1YFHA 1HKSA 1U5TA 1W5SA 3MEXA 3TO9A 3JW4A 3ECHA 2XAJA 3L09A 4KMFA 1SD7A 1Z9CA 5HLGA 3I59A 1TLHB 2DBBA 2HWVA 5FFXA 3JSPA 3HRTA 5D6FA 2OU2A 4LGWA 1T98A 4L0YB 3VEPA 2C6YA 1YO5C 1T0FA 1OPCA 5JI6A 1RI7A 4YFNF 5CVVA 5FD5A 4YIIA 3J81K 2D45A 1REPC 4XRFA 2A68F 2QENA 1D8KA 1O3QA 3BJ6A 2BV6A 1QGPA 2V9VA 2VE9A 4KNYA 2P7CB 1Z7UA 4WX9A 1BM9A 4ENJA 4BYYA 1CF7B 4B09A 3Q9SA 3T0YA 2FNPA 4Y15A 5H6RA 3J7AO 1OYWA 2VN2A 1MKMA 1R23A 3CJNA 4BAYA 3E5XA 2O8XA 2PI0A 4ZYGA 1X3UA 4WXCA 4HF2A 3HRMA 1KU7A 2HEOA 3V7CA 3WTZA 5KVRA 2MLGA 3CTAA 2EFNA 3K69A 3U2RA 4Q4ZF 2JRTA 3EETA 2WV0A 3TO7A 2WWYA 4MTEA 2YPRA 3FX3A 3W6KB 4IHTA 3BDDA 4R79A 1EH6A 3QP6A 4WK8F 2HTJA 2LDUA 2HOEA 3EDPA 3FM5A 4M71A 3VODA 1LDDA 4L9VA 3IKTA 3MQ0A 3QU3A 2UXNA 3EYYA 3E6DA 2EV5A 5CJ9A 1J5YA 3LAPA 2ZMEA 3KLOA 3KP2A 1YW9A 4FT8A 1RIOH 3COAC 4H0EA 1FY7A 2OZ6A 3I53A 2KJCA 5L3EA 1HW2A 1Z6RA 5L3BA 2CFXA 1I1GA 3F6VA 2F5DA 5HLHA 3KZZA 2EFQA 1DUXC 1R5GA 2FMLA 2H6BA 3ERED 2CG4A 3DPLC 3ZMVA 3HUGA 5TRDA 4XLNF 3E97A 1PDNC 2P8TA 3F8MA 1IW7F 2RQPA 3IHUA 4I02A 3ABTA 2ESHA 2V6CA 2HR3A 3HHGA 1TNSA 1WSUA 1K78B 2XKOA 4XBFA 1TNTA 4MHGA 3O3KA 4U7DA 1ON2A 1S3JA 3C3WA 1IUYA 4LK1F 4MGRA 4AWXB 5LEKA 5BS6A 4N9HA 2RVCA 1LVAA 2MA3A 4EJWA 1J9IA 3RDIA 5JFRA 2Y48A 4B8XA 1E2XA 3FXUA 1FZPB 4G7OF 3P7NA 4MEXF 3GFIA 3Q9VA 5ERIA 4CXFA 1D3YA 2JSCA 3ZMZA 4R1HA 3SFZA 1RNLA 4HDUA 2GQQA 1OMIA 2LNBA 5E18F 4HX7A 1G6NA 1JHHA 1TW3A 4RGUA 3U1DA 4I09A 1G3TA 1HKQA 4I0BA 1XDUA 3HSEA 3M7GA 1ZG1A 3QRFF 1MJBA 4LG0A 2XAFA 4A5MA 1BIAA 2EV6A 3E5QA 5E17F 1FOKA 2PJPA 1ON1A 4EVIA 3SHFA 4IHSA 1FSHA 1R1UA 1LDKB 3C1DA 2QQBA 3IRRA 2Z33A 3E5UA 5E1XA 2M1BA 3EQLF 3T5XA 1TBXA 1JXSA 1FYKA 2QLZA 5J8FA 3CUOA 3REOA 2CGPA 4UV8A 3CO6C 3ZPLA 4DQ2A 2PMUA 3HHHA 3HRUA 2ZFWA 3KLNA 1VTNC 3QPTA 2AXLA 1SFEA 5L3DA 2L54A 1P4AA 3MWMA 2HYFA 2RNJA 5L3FA 4MQVA 2NAZA 1BI0A 2O61A 2FBIA 2W84A 3HOSA 3WTYC 2PFBA 5BPDA 3O6BB 5F64A 1ZGAA 4RAZA 5FO5A 4UVAA 2IP2A 2NYXA 1GVJA 2F5EA 4BHCA 1LQ1A 5A2QZ 1W7PD 3HSRA 2VOPA 1SFXA 2OBPA 2WC2A 5D5VB 2Q0OA 5DD4A 5DD8A 3FM3A 3B73A 3VB2A 3KEQA 1ONVA 5D4SA 2DPDA 1UB9A 1ZREA 2KKOA 4KUMA 1IN7A 4RB1A 4M9SA 1XSDA 3V7SA 2M87A 3JAMZ 4L9TA 4D0PA 1E17A 5HOOA 1HW5A 2EWNA 2EK5A 3QPHA 5HS8A 2PEXA 2GXBA 2L01A 1O3TA 2ZNYA 1U8RA 2BBYA 1KU2A 3HTUA 2IJLA 2OQGA 2HFHA 2ADUA 1F1ZA 2L3DA 1L0OC 3F22A 3FHZA 2HTSA 1KYZA 4WCGA 1YW8A 2W24A 3R61A 3MZYA 4BHBA 4M73A 4ZYHA 3CUQA 1FP2A 1S8NA 5H20A 2LSOA 2ZO4A 2RN7A 4XSZF 1OYYA 1XGNA 4CZZA 2ISZA 4HX4A 5A2QK 2VODA 2L02A 3WGHA 2K4JA 2F5FA 2XKPA 1IN4A 4L0ZB 2F5CA 3LA3A 5AIQA 4UNOA 2O03A 4I7HA 3GF2A 1I27A 2P5VA 3ZN1A 2JPCA 1LB2A 2O3FA 3WODF 2FSWA 2ZXJA 2GA1A 2FBHA 3F8BA 4N0BA 5LHGA 4FX0A 5LLQA 2PQ8A 2VBXA 2EFPA 4QWQA 1UFMA 1ZN2A 3HRSA 3H3UA 1ODDA 3E6CC 4L5IA 2NS0A 5LEJA 1GXQA 5LHIA 5KK1A 4A0YA 4MTDA 2Y75A 5FLXK 2FMYA 3HTSB 4HF0A 4EV0A 1SFUA 5HS7A 2VC1A 3EUHA 3WTWC 4LLNA 1FYMA 1OYIA 1XMAA 1PP8F 1FSEA 4ESFA 4KICA 5FB2A 4AVPA 4EJUA 1F4KA 2MLKA 3D5LA 4G6DA 2FOKA 3GX4X 2QQAA 4RS8A 4F7ZA 1QPMA 3RPQA 4HF1A 1RUOA 3E3VA 4MEYF 2QZ8A 3PQKA 2FF4A 1TTYA 5ED4A 4AIKA 1IRGA 3EYIA 2GAUA 5DEQA 3T8TA 3TDZC 3BPXA 4KDPA 1I1SA 3IC7A 2P6TA 3B02A 5K5OA 5CVRA 4EJVA 2QWWA 3HSFA 2ZCWA 3KFWX 2DQLA 1I5ZA 2BEOA 5HDKA 2DU9A 5DCFA 3WE3A 3JTHA 3F21A 1B59A 2DLLA 1SD6A 4WWCA 2LF8A 2GXGA 1YIOA 1KQ8A 2A07F 3SZPA 1MDMA 4HZFA 2UWMA 4ETSA 1BN5A 3BOQA 2DK5A 4M6YA 2D1HA 2HQRA 4EGZA 1IZ1A 3ABUA 2Z9OA 2ZNZA 3R0JA 5D8KB 2E1NA 1B6AA 2EFOA 4N9IA 3RYPA 1H9GA 4FHTA 4GGGA 2R7DA 1ZLJA 1UHMA 4EGYA 2MH2A 1F9NA 4KIBA 4IPAA 3M9AA 4G9YA 1B9MA 5EEHA 1H9TA 1U6GA 5BQTA 2D2WA 1FLIA 5ILUA 3LQRA 5EEGA 4A12A 3DPTA 2A3SA 1SMYF 4HLYA 4M9XA 3F6OA 3DFGA 4G7HF 2XAQA 3CUQC 1R58A 5DUIA 4U0WA 3GFMA 2DAOA 2K7LA 4U0VA 5DCMA 5ICEA 1PP7U 1IXCA 1HKTA 2FE3A 3DV8A 3F8FA 2HDCA 2O6GE 1UCRA 2P4WA 2GIVA 2W85A 3GVAA 1B9NA 5ICGA 4OMYA 2A6EF 1MD0A 4HYEA 4XLPF 2KJBA 3QP5A 2BGCA 3TKYA 3ULQB 2YSRA 1RUNA 4L5JA 4Q47A 5E1ZB 1LJ9A 4KT5C 3FZVA 2STTA 1LEBA 5AONA 1MDMB 3QAHA 3Q5FA 3FMQA 1F5TA 5BMZA 1W7PA 4U0YA 3RTRA 2EFWA 4G8XA 1J0RA 1DDNA 2ZJ2A 5CVJA 2RDPA 3ZN0A 2ZKZA 4M6XA 1ZLKA 4LD5A 2VOOA 3KP4A 4HBLA 2EA4A 4EQQA 1J7KA 1IAWA 1FYLA 4G94A 2LKPA 4KN4X 4L9JA 5LRRA 5FLXZ 1KGSA 3GW2A 3MCZA 1HW1A 1LNWA 3FXQA 4ON0A 2MBFA 1Z05A 1R36A 2QBYB 1MJ9A 2K02A 4YG2F 4HLXA 1I6XA 3DP7A 3L2CA 1O57A 3RKXA 3FF5A 1XMKA 6PAXA 3CO7C 4OU0A 3N4MA 1XGSA 3N97A 3IL2A 2VBZA 1HSTA 4PGHA 1D8JA 3VFZA 2R3SA 1QO0D 1STZA 3LFKA 1YW7A 4HAMA 1JE8A 5D5XB 2G7UA 4LMYA 2QM3A 3JSOA 4PZJA 2YX7A 3TGNA 4QLCU 2DTRA 4S05A 4UVCA 5E8GA 2G9WA 4GO1A 2AS5F 2J5OA 5E20A 2MH9A 4NB5A 4RGRA 4P5OA 3BP8A 5BOXA 1IN8A 4O6JA 1P4WA 4MQ9F 3MFKA 4HQMA 2W57A 1H0MA 2CYYA 2FEZA 1QNTA 5CVUA 2X0LA 4RAYA 1GXPA 3P9CA 2DFIA 2YR2A 3DEUA 4HOBA 4LB6B 4O3MA 5E1WA 3M8FA 2ELHA 1KU3A 1L3LA 1S29A 4CICA 4EM2A 5LGNA 4OINF 3RJPA 3GZ5A 2VT3A 2KIMA 4OIQF 1V4RA 1BOAA 1GHCA 3CUQB 3WTVC 2H27A 4NQWA 3WU0A 3CLOA 1IXSB 2COMA 1FWZA 3LA2A 4KA4A 2O0YA 2OAZA 1PUEE 3V4GA 5BPIA 1NHAA 3FMRA 1ZG3A 4HA8A 4EM0B 4RB3C 4YFKF 1V3FA 1HBXG 1R7JA 3CDHA 1SD5A 3SZTA 2J5PA 2HYGD 1U5TB 4MNUA 2NRAC 4RGSA 4TV7A 2H6CA 2D1VA 2FNAA 4M74A 5HS9A 1FC3A 1XGMA 2XROA 1G3YA 3K1PA 2DI3A 3ISPA 5L3CA 3VOEA 2E7WA 2E1CA 3P9IA 3TQNA 2KRFA 1AOYA 1FNNA 5IT9Z 2HQNA 2VXZA 3TO6A 3W6JB 2IW5A 3K0LA 1K7AA 3LA7A 4OIRF 4YFXF 4JK1X 3GFLA 2RKHA 4WXHA 1BIBA 1P2FA 3K9TA 4U7BA 3KCCA 4LLLA 2F2EA 3FXRA 3ROUA 1S7OA 2Z99A 3KP6A 3I71A 4UV9A 5FFZA 2Z3YA 3GLXA 2IVMA 5TJJA 1W5TA 1EV7A 2VC0A 2XUBA 4M9ZA 1ZRFA 4XSXF 1ZYRF 1A04A 5D8LB 1T6SA 2VE8A 4EMSA 3V8LA 2OQRA 3KEOA 5JR3A 3K1NA 4CDGA 4IRIA 2ZBKA 5LBQA 3LAJA 2L4MA 1BC8C 5LHHA 4HW0A 3GEZA 5CVIA 1Y0UA 1WQ2A 3S2WA 2Z5UA 2YU3A 3K2ZA 4UVBA 3V7RA 3I54A 4JQFA 3J81Z 4KMUX 5JVTA 4LLGF 1KYWA 5D4RA 2EA2A 3KP3A 5FD6A 3C18A 3E6MA 3IRQA 1XN7A 2Y0MA 2XGXA 5H6QA 2IRFG 1KA8A 2G7HA 3G3ZA 5LGTA 3WGIA 2PN6A 5J8CA 5LRSA 3DF8A 1OR7A 4HV5A 1T39A 3FWEA 3QOPA 2CWEA 2EV0A 2XHKA 3V8KA 3HYIA 4A0ZA 3IWFA 2FA5A 2TDXA 1BI2A 4Y17A 3SXYA 4GYIA 4G6QA 1EH8A 2IA0A 1J2XA 4L18B 1CF7A 4AIHA 2P6SA 5D6EA 3LWFA 3BPVA 3H3ZA 4BH9A 3RYRA 2Q2EA 2GA2A 3J80K 4GXOA 2VT2A 4G7ZF 4DNCA 5FGMA 2WTEA 3KE2A 4E70A 1J59A 2M30A 2ZMEB 3AAFA 3ECOA 4A2UA 1ZAOA 3G73A 2XASA 5DV5A 3BJOA 3C7JA 1U2WA 4ENKA 2CW0F 3WGGA 1RZ4A 1WWXA 5D5UB 1W7PB 1IN6A 1SMTA 2GWRA 3F23A 2CQKA 3DQVC 2GZWA 2ISYA 3BY6A 1R22A 1BI3A 2IA1A 5HDGA 4ESJA 2EB7A 3DXJF 2A69F 4R8HA 1R1VA 3OV8A 2JT1A 4ENNA 4EJOA 2EJRA 2KIUA 2P7VB 2ETHA 4P96A 2PLYA 3GWZA 2FQ3A 1XCBA 2XVCA 1XDSA 1Z1DA 1FP1D 1WI9A 2R7FA 4HV6A 2VBYA 2QUFA 3I5UA 1YTYA 1R1TA 4CYDA 4OOIA 4IXAA 4ZYDA 3KP5A 4KFCA 2K27A 2ACJA 2M8EA 3RIRA 2QQ9A 2NNNA 4IRGA 3F8CA 3H92A 3TOBA 4AIJA 4LJZF 3PQJA 1B4AA 5F6FA 3ZMDA 1Z91A 5DDGA 1QQIA 4ZZLA 4NHJA 4I2OA 4CHUA 4P9UA 1YG2A 4OIOF 4EJTA 2PG4A 2ESNA 5ILVA 3R60A 3HIFA 4ZYEA 1DPUA 3LQQA 1USSA 4AD9A 3PFIA 2BYVE 1IN5A 2DW4A 1G4DA 3QU6A 1R00A 1QBJA 4GCVA 2OD5A 3GXOA 2P5LC 2PBIA 1O7LA 1YS6A 2FXAA 4IJAA 1P4XA 4U88A 3RPUA 1C0WA 2BE5F 1MJAA 1HQCA 1XSVA 2P5KA 4IVNA 4UXNA 2RV8A 5DYMA 2LF7A 2JZYA 1FBQA 4ZZDA 4RB0A 3E6BA 3ZMUA 1AWCA 4GYGA 4LFUA 2HZTA 5F1RA 1YS7A 2A61A 3D0SA 2IA2A 2DO7A 1CGPA 4HDVA 1LEAA 4A6EA 5IT9K 2HKXA 5IT3A 2V1XA 1Z6TA 3ZMTA 3GZ6A 2L4AA 4A5NA 3GUDA 3KETA 2V1DA 4Y13A 2FU4A 4CGZA 4I0AA 3WTUC 3J80Z 4LG0B 1KQ0A 1ZGJA 3GO5A 2JPBA 3KP7A 1W4MA 1ZRCA 2MD5A 1T38A 3F72A 3ELKA 4BNCA 2A5YB 3IKVA 3JTGA 3HOTA 4BHPA 3NEUA 1P6RA 5CLSA 1O3SA 2CSOA 1TW2A 4P55A 1K6OA 3TDUC 4CO8A 2K4BA 3LSTA 1XCVA 2IT0A 1FX7A 1QZYA
chains in the Genus database with same CATH superfamily
3C2HA 3GFJA 1DU6A 1IV8A 3G1LA 2IS6A 1JKQC 2DOAA 3PNYA 4O5VA 3W2AA 3I56I 1U5TC 2KZVA 3WG9A 3BLYA 5J6XA 3CMAI 4PDKA 2LREA 2IPQX 4KYWA 4NDLA 1PJRA 2DA1A 3TOAA 4E7SA 1NG7A 3F8NA 4BL0B 1R5HA 4BXUA 3GTPJ 1W5CC 2B0LA 1IF1A 3HXLA 2QCOA 2QBYA 1MMAA 2F5VA 3VYSB 3U9GA 3UKGA 1BBYA 3HOVJ 3A0BC 3GYHX 2NNYA 1EH7A 2M45A 3M3YJ 2H09A 1DPRA 2YX4A 3IWZA 4XN3A 1E0EA 1O7FA 1PYVA 3GTLJ 3JR9A 1P7JA 3BJAA 2R4GA 2R7WA 4XM3A 3MKLA 2VJJA 3ZQ7A 1USTA 3WU1B 1K79A 2XGCA 1P92A 4AUXA 2QYOA 2HGCA 2Q1ZB 2R93J 3HOZJ 3OS2A 2X51A 3BT9A 3RKYA 2DPUA 1XD7A 2W25A 2H8WA 4B47A 4HQEA 4J00A 1ZRDA 3OYFA 4BGDA 1GV5A 1VQ4I 1KQ9A 2HS5A 5EYRA 4DJAA 3JRFA 2OA4A 3HEFA 5D5WB 2V7FA 2RGVA 3WTSC 5AIPA 3VWBA 5HNHA 3L00A 3RKWA 3I58A 4ASNA 2ZMEC 5K7HA 1JGSA 3I59B 5IP6A 3OYGA 4IKFA 3LSRA 2JA5J 3DEEA 2FBKA 4RA2A 1IXRC 1XSXA 3L2UA 3L9FA 2MYSA 2E1OA 3F3XA 3IH3A 2DFFA 2FQ4A 3SFIA 1IRFA 1MZBA 4EM1A 4PCQA 5GAHJ 3NARA 3ZGKA 3NRVA 2WADA 2X6WA 4BE1A 4ZH4F 4M6VA 2BY3A 2HU9A 5ILSA 2COBA 3KPHA 4IEJA 5L3GA 2ZJRF 5IP9J 3DKWA 3QYFA 4RGXA 4IOCF 2PMHA 5HDNA 4IRHA 4RLFA 1FBUA 1S7AA 1FOXA 2EZIA 2X6XA 4LB5A 5EGOB 1TQPA 1Y0NA 2UV1A 2XRNA 2E7XA 2QKMB 2XAHA 3L7WA 4FASD 4Y7NJ 3SJMA 3IH4A 2H94A 2KP6A 3I64A 4S04A 4WF2A 2STWA 1TQMA 4LIUA 3L2WA 2OZUA 4PGGA 3CF5F 1HSJA 2DMQA 2WB1N 2RC4A 4JBAA 5GAGJ 2JSPA 5DCMB 4PK4A 3EUAA 3TP0A 3UR3C 1ZH5A 3BTLA 1YQAA 3DKXA 1KU9A 3BROA 1DP7P 3P9KA 1D5VA 1W1WE 5CYVA 2UXXA 4GFBA 3ASOH 2EQRA 4KIGA 1B1BA 1S5LC 1IG7A 1Q1HA 4N4NB 1LPQA 2XV4S 1BL0A 3M1EA 4LK0F 5HLIA 3R6SA 4YIFA 4CYCA 4A3LJ 1U78A 2EZLA 1CQTA 3K4KA 3NQOA 1HDPA 2HKOA 3JCUC 2W4SA 4AC0A 4KN7X 1ULYA 1LDJA 2V79A 3QWLA 1T2KA 3I4PA 1A36A 3RI4A 4II3A 2VJ5A 3LMMA 2FRHA 2VASA 3BZ6A 3CJTB 3V8JA 5DUKA 4D5FA 1S6LA 2CRGA 2R7QA 3KYLA 1SAXA 3HOWJ 3HOXJ 1MGTA 3FMSA 1BC7C 3S1QJ 2DK8A 1G3WA 3MZHA 2VONA 3OYIA 4WXDA 1MW7A 2ZSIB 3WE2A 5K1YA 1TT5B 1SANA 3J7ZI 2EH3A 1U0JA 3ML6A 3ZP5A 4AM3A 2X4HA 2ZXHA 3FXLA 4P9FA 5B1AH 1YYVA 2ELJA 4LIVA 1WJCA 2OTJI 2QSFX 1RR8C 4OMZA 4BEHA 1SD4A 3O2PE 2LY2A 2MC3A 3CC7I 4I98B 4KIFA 4UHTA 1FBSA 5HVQC 1ZARA 2ZJPF 1X19A 5E79C 5JHUA 2K5CA 1LFUP 1O3RA 2H8RA 2DOFA 2IGOA 4IQJA 1ZHFA 3SQNA 2KRHA 4F3QA 3BG7A 1Y8QB 2XAGA 1J75A 1NK3P 1UHWA 4EATA 3CJQB 3D5SC 1WKMA 1JJ8C 5LGUA 2DQRA 3M8EA 2E34A 3KZYA 2VPLA 3EPZA 4FX4A 2LY9A 4UB6C 1JKOC 2LMDA 2DT5A 1HLVA 1ZTRA 3MZ8A 2A6HF 1YIJI 1XB4A 2QA4I 3T8RA 1WRJA 3I0TA 1G3SA 1XGOA 4A0XA 1BJAA 5ICFA 1ZG5A 2E1MC 4NC7A 1QZZA 3BWGA 3JAMK 2B9SA 2KIFA 3GTQJ 1U3EM 4A6DA 4ESBA 4OIPF 2JTVA 1HXDA 1K78A 3OSFA 3R0AA 2DOEA 1SFOJ 4PSXA 2CO5A 4IF4A 1MMNA 2A05A 2EILH 2QVOA 1FMVA 1JGGA 4XK4A 2GXAA 4L9NA 3T1BA 1YHQI 5DTDA 1TQIA 5J1RA 2DYSH 3K4NA 4Q48A 1BI1A 5ICCA 3AG2H 4M3BA 4RB2C 1M1EB 4I01A 1VF9A 4BQAA 1YLFA 2HDWA 4UUVA 2M5WA 2DA3A 2DA5A 4HNVA 3CD6I 4OAZA 3MAJA 4P1WA 5K5QA 4HX8A 3KZIC 5FRMA 4Q5SF 1YX5A 1JJ6C 3ZMSA 4Z2YA 3R4KA 2VBWA 4K2EA 1I50J 2K3PA 1JHFA 3CCEI 3S3OA 3RZOJ 5FLMJ 1FPQA 2VI6A 2BVMA 3CCMI 4C9YA 2Q8KA 5K5RA 2K86A 3CQZJ 1OCRH 5F0FA 1FT9A 1MH4A 2E1MB 4MLOA 3CCLI 3WTTC 2UZKA 2XIGA 4M72A 2V1UA 4JYKA 3K1MA 5E3OA 3WTXC 1OKRA 1S9HA 3OOPA 1FEXA 5E8IA 4ENMA 1YFHA 1HKSA 4BY7J 1U5TA 2ZFUA 5EZGA 3SZGA 2XAUA 1W5SA 1B72A 4B44A 4L5EA 3GBGA 4KJZA 3MEXA 3TO9A 1ETQA 1MBKA 3JW4A 3ECHA 2CUJA 2KISA 2XAJA 2DJNA 2I5UA 4Z6YA 1A6QA 3L09A 3DEWA 4KMFA 2FUG2 4CA0A 1SD7A 2CU7A 4A3IJ 2X9DA 1Z9CA 5HLGA 3M4OJ 3DU6A 1HOMA 1ENHA 3I59A 1TLHB 4C30A 2DBBA 2HWVA 2M0CA 5FFXA 5F1JA 3HRTA 3JSPA 5D6FA 2F6CA 2K85A 2OU2A 4LGWA 1XMXA 1T98A 1HC8A 4L0YB 3BG9A 3VEPA 1TL8A 5FRNA 2C6YA 1YO5C 1T0FA 1RRJA 1MSFC 3OWTA 3KEYA 1OPCA 2HQ5A 5JI6A 1RI7A 3CZ6A 4PFOA 4YFNF 2M0MA 2ECBA 5CVVA 3NWSA 1ZQ3P 4XKVA 1ETOA 5FD5A 4YIIA 1MNDA 2K3FA 2GIZA 3J81K 2E2HJ 2D45A 1REPC 4XRFA 2DXIA 2A68F 2R7OA 3SYTA 2QENA 4CCLA 1D8KA 2TRTA 1O4XA 4YIRX 1E3OC 3BCAA 1MBGA 4PJLA 1O3QA 2WAEA 4XL9A 5EZHA 3BJ6A 2BV6A 1QGPA 2V9VA 1EKEA 5IOZA 5DM7F 2VE9A 2HVQA 3CMEI 2HXOA 3B6AA 2P7CB 4KNYA 1N78A 2RNGA 1Z7UA 2X1EA 4WX9A 1BM9A 3BCBA 3WHBA 4ENJA 4BYYA 1CF7B 3L2QA 4F55A 4B09A 3Q9SA 4BBSJ 4BE0A 3T0YA 1W36C 2FNPA 3HB9A 5E3LA 1Z77A 1IV6A 4Y15A 2PMZN 2VKDA 5H6RA 2O9LA 2E2JJ 1OYWA 4BY1J 3J7AO 2VN2A 1MKMA 2VPRA 1FTZA 1R23A 3CJNA 5M5WJ 1JT6A 4BAYA 3OYAA 3E5XA 1MNEA 4QTRA 2O8XA 3GMEA 1Z0XA 3KYDB 3DU5A 2PI0A 2JMWA 4ZYGA 1X3UA 3I4MJ 2IS2A 4BKXA 4WXCA 2WA0A 2Y31A 2KPMA 5LD2C 4HF2A 2LLKA 2XB0X 4XN0A 3HRMA 3BTIA 1KU7A 2HEOA 3V7CA 1WI3A 3WTZA 5FKNA 2K9SA 5HODA 2KHMA 1AA7A 5KVRA 3C2GA 2MLGA 3CTAA 2L0KA 2EFNA 3K69A 3U2RA 4Q4ZF 4NNJA 2JRTA 3EETA 2WV0A 3TO7A 3JREA 3BZKA 2WWYA 4MTEA 2YPRA 3FX3A 3W6KB 4XIDA 4IHTA 3BDDA 1S72I 4R79A 3CC4I 1EH6A 3QP6A 4WK8F 1QA6A 2HQAA 2HTJA 1J09A 2LK2A 2LDUA 2HOEA 2QF7A 3EDPA 3FM5A 3AFHA 4M71A 3VODA 1LDDA 4L9VA 2MW8A 3ZQGA 3IKTA 4BEHB 2JA8J 3S8PA 3A03A 3MQ0A 2DMUA 3QU3A 2UXNA 3EYYA 4GRIA 3JRHA 2CFOA 2NVTJ 3E6DA 2EV5A 5IYCJ 5CJ9A 1J5YA 1DQUA 3LAPA 2F4IA 3FXKA 4XKWA 2HZDA 1X1PA 4PJ0C 2ZMEA 3KLOA 3KP2A 4J01A 2XB5A 3HDDA 1YW9A 5DM6F 1H88C 1WGXA 4FT8A 2QSGX 1ITYA 1RIOH 1E3HA 3COAC 4H0EA 3K4CA 1FY7A 2OZ6A 3I53A 4EEFG 2KJCA 5L3EA 3K70C 2EBIA 1GV2A 2OPTA 4XLHA 1YOVB 1TZLA 1HW2A 4F93B 1Z6RA 5L3BA 4UUSB 4C2UA 2JA2A 2Y0SA 4LOCA 4NBQA 5C3EJ 2CFXA 1I1GA 5F04A 3F6VA 2F5DA 3MN2A 5HLHA 3ZQCA 2LG4A 3RQIA 3KZZA 2MABA 2EFQA 4PJMA 1DUXC 1R71A 3K4BA 1R5GA 2FMLA 2LVSA 4UY8I 5C4XJ 2H6BA 3ERED 2CG4A 3DPLC 3ZMVA 2V6EA 2VQGA 5BNGA 1QHGA 4Y33A 3HUGA 2LH9A 5TRDA 4XLNF 3E97A 1PDNC 2P8TA 4E7ZA 3OL3A 3MD2A 1YE9A 3F8MA 1IW7F 2RQPA 3JRBA 3E7LA 2E60A 3IAM2 3IHUA 2X6YA 4I02A 2EIMH 1WZ2A 3ABTA 1YRNA 2ESHA 2V6CA 3H9JA 1NH3A 1K6YA 2HR3A 3HHGA 1TNSA 5C4JJ 1WSUA 1K78B 2XKOA 3BTJA 2A6TA 4XBFA 4FETA 3FIWA 1TNTA 4MHGA 3O3KA 3K4MA 4U7DA 2FX0A 2XGEA 1ON2A 1S3JA 1WFXA 3C3WA 2BZTA 5H2FC 2Y69H 1IUYA 4LK1F 3D5RC 4MGRA 4AWXB 1MBJA 3CCRI 5LEKA 1ETKA 5BS6A 4N9HA 2RVCA 2LOOA 1WJEA 1LVAA 1X2NA 3JRIA 2EINH 2F4MB 2MA3A 2VJ4A 1RESA 4M3EA 4EJWA 1N77A 4KT6A 3RDIA 2CQXA 3S1NJ 1J9IA 2X1CA 1Z21A 5JFRA 2Y48A 2W00A 4B8XA 4IHVA 1E2XA 2L7MP 2VKHA 4DBRA 3FXUA 4DW6A 1FZPB 3HJEA 4G7OF 3I55I 3P7NA 1AU7A 3FKJA 3HM5A 3MVPA 1GVDA 4MEXF 5KAIC 3GFIA 4M3GA 3Q9VA 5ERIA 4CXFA 2R5YA 1D3YA 1VQLI 4A3MJ 2JSCA 3ZMZA 4YRVA 2HOTA 4R1HA 1WCMJ 2LKSA 3U21A 4D9JA 2V26A 3SFZA 1RNLA 2P0WA 3X2QH 4FISA 4D7NA 5F0HA 2IGKA 2R7UA 4HDUA 1ZKGA 4CYCB 1MH3A 2LNBA 1OMIA 2GQQA 5E18F 4HX7A 1G6NA 1JHHA 1TW3A 4RGUA 4BJ6C 3U1DA 3S14J 3P5JA 2WAFA 5JHFA 1WJAA 5E3NA 4I09A 3H5NA 1YJ9I 1G3TA 4MFEA 3ZOBA 2M4KA 3QYEA 3L2RA 2XSDC 1HKQA 5IP7J 4I0BA 1XDUA 2DA6A 3HSEA 3M7GA 1I39A 1ZG1A 3QRFF 2ELKA 2OF7A 1MJBA 2JVGA 1KONA 4C2TA 4LG0A 5EDNA 1Y39A 4X6AJ 2XAFA 2O7OA 4F91B 5JLXA 3N05A 3OOUA 4A5MA 3ZQLA 1BIAA 2EV6A 3E5QA 1B72B 2K9MA 5CPRB 3ABKH 1R6RA 5E17F 5IYDJ 2ZC2A 1FOKA 3S1MJ 4IHXA 2PJPA 1ON1A 4EVIA 5M5YJ 3HOYJ 3SHFA 4XQFA 4IHSA 1FSHA 1R1UA 1VNDA 3PNVA 1LDKB 3C1DA 2VJIA 2XRLA 2QQBA 3IRRA 2Z33A 3Q0UA 5J3LA 3I4NJ 1X1BA 3E5UA 5E1XA 2M1BA 3EQLF 2R92J 3T5XA 2LRDA 2R7RA 1R49A 1VQPI 2ID6A 4D5CA 1TBXA 3H3VK 3ZQFA 2LC2A 1JXSA 1FYKA 3DKYA 2QLZA 5J8FA 3H0DA 3CUOA 5FKMA 3REOA 2CGPA 3K4LA 1JKPC 3DBRB 4UV8A 2CMPA 4V19K 1JTXA 3OS0A 3CO6C 1VQ8I 3ZPLA 4DQ2A 3BG3A 2V9PA 3HHHA 2PMUA 3HRUA 2ZFWA 5KAFC 4QIWN 2DA2A 4V2GA 1HDDC 3KLNA 2NVUB 1T08B 1VTNC 3AL0B 3S15J 3QPTA 2CUZA 4HG2A 2LR8A 1T0FC 2AXLA 1SFEA 1X3WB 5L3DA 3LSHA 2L54A 1IDZA 1Z3YA 2M4GA 1P4AA 3FK7A 2M2EA 3MWMA 2HVSA 2HYFA 3AG4H 2RNJA 2NVYJ 5L3FA 2HYJA 4I76A 2LBFB 3SDGA 4MQVA 1UAAA 2NAZA 2E71A 1BI0A 2EIJH 1XG1A 3NWTA 2EIKH 3ZCOA 1XPXA 2O61A 2Z1DA 2FBIA 2JUCA 2XF5A 2W84A 3HOSA 1R5ID 3WTYC 2PFBA 5BPDA 3O6BB 5F64A 1ZGAA 4RAZA 5FO5A 4UVAA 1V5EA 4JOMA 2IP2A 2NYXA 1GVJA 2F5EA 4BHCA 3LSIA 1LQ1A 5FLVA 2QSHX 1WH5A 1RR7A 2M7BA 5A2QZ 1W7PD 2NVQJ 2JRMA 3GTMJ 3HSRA 3SEQA 2VOPA 1GUUA 1SFXA 2ECCA 2OBPA 2WC2A 5D5VB 4M3FA 2Q0OA 1APLC 1XS9A 5DD4A 5DD8A 1B8IB 2BXZA 2NS8A 1F36A 2HPMA 3Q3SA 4UUTA 3FM3A 3B73A 3VB2A 3KEQA 1ERDA 2G0EA 1ONVA 5D4SA 2DPDA 1OFCX 1UB9A 1ZREA 4MIMA 2KKOA 2MD0A 4KUMA 1IN7A 3BTCA 5DS9A 4M9SA 4RB1A 4A3KJ 1XSDA 4ITVA 3V7SA 3MKYB 5JLWA 4B43A 2AHQA 2M87A 3VSKA 1XX5A 2X1DA 3JAMZ 3JRCA 4L9TA 4D0PA 1E17A 4IO9F 3K6GA 1V5GA 1SC7A 5CQEA 5HOOA 3LFUA 2FD5A 1HW5A 2EWNA 2EK5A 3QPHA 4NUBA 5HS8A 4QSHA 2FJ1A 2PEXA 1K61A 1IJWC 2GXBA 2L01A 2L7ZA 1O3TA 1X58A 1T8IA 2ZNYA 1BW5A 1U8RA 4ANJA 2Y2ZA 3PUFA 1LVKA 2BBYA 1KU2A 3HTUA 2Y30A 2IJLA 2OQGA 2HFHA 3TEDA 4AVZA 2ADUA 3HC7A 1F1ZA 2L3DA 4ZDOA 1L0OC 2OCCH 2HPIA 3F22A 1XTAA 1TWGJ 3FHZA 2Q2EB 4FE4A 4PJNA 2HTSA 2K9QA 1KYZA 2BHYA 4WCGA 1YW8A 3M1CA 2W24A 3R61A 5C44J 3ERMA 2CH0A 3ZR8X 3HUGB 3MZYA 4BHBA 3MKZA 4M73A 4ZYHA 2M7AA 5KNLA 2JWTA 3CUQA 2DYRH 1FP2A 1S8NA 2O5RA 3A01A 1SVLA 1MMDA 5H20A 2QEXI 4KISA 2LSOA 2X48A 2OC6A 5B66C 4AU7A 2ZO4A 5B5EC 1F43A 5LFAA 2RN7A 3S17J 2KZGA 4XSZF 1OYYA 1VQKI 1XGNA 4CZZA 1T33A 1UJ8A 2ISZA 4HX4A 5CQGA 3S2HJ 5A2QK 1P9QC 2VODA 2W48A 3OYDA 3S3MA 2L02A 2OUMA 5F0CA 2K4JA 3LSGA 3WGHA 2F5FA 2XKPA 1IN4A 4L0ZB 1Y56A 2R7SA 1SFKA 4C3IJ 1ACIA 4OWRB 1U9OA 2F5CA 1SEUA 3OYJA 3LA3A 5AIQA 3ZQQA 4UNOA 2X85A 2O03A 1VQ7I 3GTOJ 4I7HA 3GF2A 1I27A 4RM3A 2P5VA 3G1OA 3ZN1A 5IY5H 1T56A 2JPCA 1LB2A 1SVMA 2KQRA 3DCFA 2O3FA 3WODF 2FSWA 2B7EA 4BQOA 3VPRA 4F92B 2ZXJA 2GA1A 3H5AA 2FBHA 3F8BA 3LSMA 4N0BA 4D1QA 3IP4B 4FX0A 2DMTA 5LLQA 2PQ8A 2VBXA 5LHGA 2EFPA 3OYCA 3C2BA 4NQWB 1X2MA 2M3AA 4BJ5C 2V1NA 2LP0A 4MFDA 4QWQA 1UFMA 1ZN2A 1GDTA 3HRSA 3H3UA 1ODDA 3E6CC 4L5IA 2NS0A 5LEJA 2B63J 1GXQA 3H9GA 5LHIA 5KK1A 4A0YA 4MTDA 3K10A 2Y75A 5FLXK 2FMYA 2DODA 1I6HJ 3HTSB 4HF0A 4EV0A 3S93A 1SFUA 3SEZA 5HS7A 1NTCA 2R5YB 2VC1A 2R7ZJ 3EUHA 3WTWC 2XPWA 4LLNA 2PMZA 1FYMA 1OYIA 1LE8A 2DA4A 5GP9A 1XMAA 3PM1A 1PP8F 1FSEA 4XKBA 4ESFA 4A93J 3I9V2 4KICA 5J4VA 5FB2A 4AVPA 4EJUA 1F4KA 2HXIA 2DMPA 2BY0A 2MLKA 1WJBA 3D5LA 4G6DA 2FOKA 2KIQA 2LKXA 3OYNA 3GX4X 1YRNB 1VZ0A 2QQAA 4RS8A 4F7ZA 1QPMA 3HL2A 1BA5A 3RPQA 1QRYA 1JUPA 4HF1A 4IHYA 1GT0C 4JX5A 1RUOA 3S32A 3QQAA 4CCOA 3E3VA 5GPAA 1NG6A 3TMOA 4MEYF 5J40A 4BS9A 3CCUI 2QZ8A 3DTKA 2Y9ZA 3PQKA 2VQCA 3DTEA 3HKZN 2FF4A 1V5FA 1ETWA 1TTYA 5ED4A 4AIKA 4CCJA 4E7IA 1IGNA 1HCRA 1IRGA 4F52A 5J1YA 3EYIA 2GAUA 5DEQA 3KX2A 3T8TA 3TDZC 3PJRA 3BPXA 4KDPA 4II2A 4PUSA 4D7MA 1I1SA 2HVRA 3G2BA 3IC7A 5J47A 2P6TA 1PUFB 2QQ8A 3B02A 5K5OA 5M3FJ 5CVRA 4A3GJ 3LOCA 4EJVA 2QWWA 3HSFA 2ZCWA 4B1RA 3KFWX 4CCMA 4PJJA 3PSIA 1BJZA 2DQLA 1I5ZA 2L9SA 1Q1VA 1UG0A 2BEOA 4DYRA 5HDKA 3ESWB 2DU9A 2F4OB 3PUBA 5DCFA 3WE3A 1ORKA 3DLAA 3JTHA 3F21A 4ZYAA 3BR1A 1TWHJ 3VYUB 5K7ZA 4JX4A 3A1YA 1B59A 2CQNA 1VQ9I 2DLLA 4ZDLA 2A5WA 1SD6A 5KHDA 4WWCA 2LF8A 2GXGA 1YIOA 1KQ8A 2A07F 3PNTA 1W36D 4N4OB 3O8GA 3SZPA 1MDMA 1VFCA 4HZFA 4XOPA 3ZQHA 1E3PA 2UWMA 4RAFA 1DGRM 3ZQIA 4IQ4A 4ETSA 1BN5A 4BXXJ 3BOQA 3BR6A 2DK5A 5HLTA 4M6YA 2D1HA 2HQRA 4EGZA 1IZ1A 3CDLA 3ABUA 2Z9OA 3CJRB 2JQ7A 2ZNZA 4B3AA 1EJ9A 5FKOA 3R0JA 5D8KB 3OYMA 4BQQA 1OLTA 2E1NA 2BHZA 1U9NA 1B6AA 2Y0SN 2H1KA 1XC5A 4UUSA 3A02A 2EFOA 4AYBN 3PSFA 4BDZA 4ZC3A 2L9RA 4N9IA 3RYPA 1UZCA 1H9GA 2LTPA 4FHTA 1VQ5I 2M34A 4GGGA 2R7DA 1ZLJA 1VI0A 1UHMA 1D0XA 3OYEA 4EGYA 2MH2A 4XICA 4XOTA 3AKZA 2HNHA 1FTTA 1F9NA 4KIBA 2ME6A 3S2DJ 4IPAA 3M9AA 4G9YA 1I3AA 4XLFA 1B9MA 5EEHA 1H9TA 1U6GA 1QZEA 5BQTA 1B8IA 2D2WA 1FLIA 2CW8A 2K9LA 5ILUA 4C2MJ 3LQRA 5EEGA 4A12A 3DPTA 2A3SA 1SMYF 4HLYA 2UUZA 4M9XA 1TWAJ 3F6OA 3DFGA 4G7HF 2O8KA 1IRZA 4BDYA 1OCCH 3GTJJ 2IS4A 2XAQA 3CUQC 3VYRB 2ME0A 4A3DJ 1R58A 5DUIA 4U0WA 4XR6A 2VKVA 3GFMA 2JJ7A 2DAOA 1H89C 2L2OA 3QODA 2K7LA 2HOAA 4U0VA 4XRSA 5DCMA 2E2IJ 5ICEA 1PP7U 1IXCA 1HKTA 2MSYA 3S3NA 2FE3A 3DV8A 3F8FA 2HDCA 1IUFA 2O6GE 3PL8A 1UCRA 2P4WA 2IGNA 2GBYA 3GVAA 2GIVA 2W85A 1TP4A 1B9NA 2EZHA 5ICGA 3Q0VA 4OMYA 2A6EF 2EZKA 3E0JB 4I6ZA 1MD0A 3GZNB 4B3XA 4HYEA 4XLPF 1ZR2A 2KJBA 1A35A 4FCYA 3QP5A 3CCJI 1RETA 2BGCA 3H1CA 3TKYA 1ZR4A 3ULQB 1ZK8A 4W97A 2YSRA 1RUNA 4L5JA 4Q47A 2HOSA 2IGMA 5E1ZB 1LJ9A 4KT5C 1TWCJ 5GAEJ 3FZVA 3KYCB 1UELB 2STTA 2KRCA 2CW7A 3LSJA 4M3DA 3TP3A 5AONA 1LEBA 1WJ5A 1MDMB 3SDBA 4A3JJ 2E35A 2I10A 3HPHA 3QAHA 4CCNA 4XLEA 3Q5FA 3FMQA 1F5TA 1D5YA 5BMZA 5E3MA 1IC8A 2H1LA 2XPVA 1W7PA 2NVXJ 4U0YA 1OCTC 3QOEA 3RTRA 2WY8Q 2EFWA 4G8XA 3ABLH 1J0RA 1DDNA 2HDDA 2ZJ2A 3OIPA 1TT0A 5CVJA 2RDPA 4B48A 2DCEA 3ZN0A 5IYBJ 3H5RA 2ZKZA 4GDFA 1WVRA 3H9QA 3RPUD 4M6XA 4LD5A 1ZLKA 1PVEA 2VOOA 3KP4A 4PFPA 4HBLA 5K7FA 2EA4A 4EQQA 1J7KA 1YJNI 1IAWA 1FYLA 4G94A 2LKPA 1AKHA 4KN4X 4L9JA 2DFHA 5LRRA 1KGSA 5FLXZ 4NC8A 3GW2A 3MCZA 2WAQN 1HW1A 4BE2A 1BR4A 3H0GJ 1LNWA 4ZTFA 1N25A 3FXQA 4G12A 4PSWA 4ON0A 4E7KA 2MBFA 1HA8A 2QKLB 1Z05A 1ZGWA 2XSJC 2VB6A 1R36A 2DDBA 1MJ9A 4OAYA 2QBYB 2K02A 5TGTA 3CCVI 3TW6A 4YG2F 2JUGA 3H36A 4HLXA 4C3JJ 4HSRA 1I6XA 3DP7A 5GADJ 3L2CA 1O57A 3RKXA 2Y9YA 3FF5A 2CV2A 1XMKA 3AG1H 6PAXA 3CO7C 1G2HA 3CCQI 4OU0A 3N4MA 1XGSA 3N97A 3IL2A 2VBZA 1HSTA 1V55H 3ONQA 3UNGC 2RQQA 4PGHA 1D8JA 2XDVA 3VFZA 3NAUA 4A69C 4BU2A 2R3SA 1AKHB 1QO0D 1JTYA 1STZA 1OR7C 1WHUA 2BY2A 3FHNA 3IAS2 3LFKA 2OCEA 3OIOA 4V2FA 1A31A 3FISA 3BC8A 1YW7A 3QPLA 4HAMA 2DT7B 1JE8A 5D5XB 1I3QJ 1FOYA 3K2AA 3PO2J 2G7UA 4LMYA 2CQ7A 4E7LA 2QM3A 4XRMA 3HGYA 3JSOA 4PZJA 2YX7A 2AQEA 3TGNA 4MO7A 3K70D 4QLCU 1OCZH 2DTRA 4S05A 4UVCA 1QVTA 5E8GA 2G9WA 4DYQA 2LYCA 1SVOA 3OYBA 3HOUJ 2ZJQF 4GO1A 4DIQA 2LFBA 2AS5F 2J5OA 5E20A 2MH9A 4NB5A 4RGRA 4P5OA 3PFYA 3HZJA 1LKXA 5GTHC 2BW3B 3BP8A 4CUGA 5BOXA 2GOXB 1IN8A 4O6JA 1P4WA 3OYLA 4MQ9F 3MFKA 1UMQA 3M07A 2W57A 4HQMA 1YI2I 1H0MA 4BQNA 2W7NA 1KZHA 2R7XA 2CYYA 1WPKA 2FEZA 2L5QA 1RC9A 2IXSA 1QNTA 5CVUA 4X0GA 2ID3A 2BW3A 2X0LA 4RAYA 1GXPA 3P9CA 2DFIA 3OYKA 2YR2A 3DEUA 4DYCA 4HOBA 4S0HB 1QPIA 4XMYA 4LB6B 4QPOA 4O3MA 5E1WA 2P81A 3M8FA 1POGA 2ELHA 1MMSA 1KU3A 1L3LA 1S29A 4CICA 4EM2A 3G71I 4Y52J 3ZXSA 5LGNA 4OINF 5GTIC 3RJPA 3VDXA 3GZ5A 3S16J 2VT3A 2KIMA 3LSKA 4Y3OA 3JRAA 2CJJA 4OIQF 1GLNA 1V4RA 1BOAA 1GHCA 4X1EA 3CUQB 3W2WA 1DU0A 3WTVC 4XONA 2H27A 4NQWA 5F08A 2EPFA 3WU0A 4A3BJ 3CLOA 1R4NB 1IXSB 2COMA 3EUKL 1FWZA 5IOYA 2RAEA 3LA2A 2MFZA 2JN6A 2O0YA 4KA4A 1LFPA 2OAZA 1PUEE 1BOBA 3V4GA 5BPIA 3CP2A 1NHAA 2YUSA 3FMRA 1VQOI 1ZG3A 3CP8A 3JRDA 2CV1A 2PX9A 3PIOF 4HA8A 2DTZA 4EM0B 2R5ZA 1DGWY 2IAIA 2TCTA 2KMUA 3BQYA 4RB3C 4YFKF 1V3FA 3V42A 4RM2A 1HBXG 4HSTA 1LFBA 1K4TA 1R7JA 5EF6A 1MSEC 1R4MB 3CDHA 4NC6A 3L2VA 1SD5A 2R7VA 1MBFA 3WHCA 3E1SA 3SZTA 2J5PA 2HYGD 2KLOA 1U5TB 1P7IA 3HBLA 2X6OA 4MNUA 4CH7A 1EA3A 2NRAC 3FDYA 4RGSA 2IEKA 4TV7A 3LNQA 2H6CA 2D1VA 2FNAA 2CV0A 4M74A 4FTHA 1ETXA 5HS9A 1FC3A 1XGMA 2XROA 4H4KC 5JVGF 3QPSA 1G3YA 1NK2P 2YU9J 4A3CJ 3K1PA 2DI3A 4RAGA 2QGUA 3ISPA 5L3CA 3VOEA 2E7WA 3A2KA 3P9IA 2E1CA 1MIJA 3TQNA 2KRFA 1AOYA 1FNNA 5B3SH 3J7AY 5IT9Z 3KIOA 4DGWB 4ABZA 2HQNA 1K4SA 1S7EA 2VXZA 3TO6A 4QPQA 3W6JB 2IW5A 1QU3A 5GPCA 3K0LA 4G6TB 3J7YJ 1FJLA 2OV7A 3GTGJ 1K7AA 3A01B 2ZXIA 3LA7A 1Z7LA 4OIRF 4YFXF 4HNTA 2LY1A 2MG4A 4JK1X 3GFLA 2RKHA 2XGDA 4WXHA 1BIBA 1P2FA 3FXOA 2DDAA 3K9TA 4E4HA 4U7BA 2R0QC 2GLOA 3B6CA 3CC2I 4RMNA 2BXYA 3KCCA 3HG9A 4LLLA 5M3MJ 2F2EA 3TW7A 3FXRA 3ABMH 4CCKA 3DPUA 4A3FJ 2AXTC 3DBLB 1JKRC 1WJDA 3OR2C 4IOAF 5EGOA 1IDYA 3ROUA 1S7OA 2YS9A 1SAUA 2Z99A 3I71A 3KP6A 4E6KG 4UV9A 5FFZA 2Z3YA 2KL4A 2M9HA 2OJED 2IVMA 1G8XA 3GLXA 5TJJA 1W5TA 1EV7A 2VC0A 2DFEA 1MBEA 2ICWG 5FKLA 4E7JA 2CUFA 2RREA 4XLCA 2DJIA 4BXFA 2WB1A 2XUBA 3RKQA 2XC7A 4M9ZA 1ZRFA 1V54H 2ZB9A 4XSXF 2E36A 1ZYRF 1OISA 1A04A 3GTKJ 5D8LB 1T6SA 1UHSA 2VE8A 4EMSA 3V8LA 1FMWA 3U1KA 3PIPF 5F27A 4YELA 4J19A 2OQRA 3KEOA 1BR1A 5JR3A 3K1NA 4CDGA 4IRIA 2ZBKA 5M5XJ 5EEAA 2R7TA 5LBQA 1WH7A 3LAJA 2L4MA 2WBMA 1BC8C 5LHHA 4HW0A 3CCSI 3GEZA 1LE8B 5CVIA 4DZJA 1Y0UA 1WQ2A 4XLAA 5B1BH 2N8GA 1EF4A 3S2WA 3CMYA 2Z5UA 2YU3A 3K2ZA 4UVBA 4CSWA 3V7RA 3I54A 4JQFA 2Z16A 3J81Z 1OQYA 4KMUX 5JVTA 4I99C 4LLGF 3MMYB 1KYWA 5D4RA 2EA2A 2CQQA 1X1CA 1FIPA 3KP3A 3OS1A 5FD6A 3C18A 3E6MA 3HKZA 3IRQA 1AHDP 2L9NA 1XN7A 2Y0MA 2XGXA 4B4CA 5H6QA 4RDUA 2IRFG 1KA8A 2HI3A 3OYHA 3DTIA 2G7HA 4XKCA 3ZRGA 2I8DA 3G3ZA 3OY9A 3OIQA 2WY7Q 2K40A 1MNMC 2Z2SB 1W0TA 2W1OA 5LGTA 3WGIA 2PN6A 4YEJA 2AO9A 1IO2A 3AG3H 5J8CA 3CCYA 3RQ4A 5LRSA 3DF8A 1OR7A 1X1AA 3IV5A 2KDZA 5TISC 4HV5A 1T39A 1T95A 3TL4X 3FWEA 1BR2A 3QOPA 2CWEA 2EV0A 2XHKA 3V8KA 1R9TJ 2DN0A 4RBOA 4JX6A 3DLLF 2JVHA 3HYIA 2NS7A 4A0ZA 4E7HA 3IWFA 2PJRA 4LITA 2NOGA 2FA5A 2TDXA 1BI2A 1LUJB 2BOLA 4Y17A 3SXYA 4GYIA 2M8GX 1G59A 5FJ8J 3CMMA 4G6QA 1EH8A 2IA0A 1J2XA 4L18B 1CF7A 2CUEA 4ZDPA 4AIHA 2P6SA 2L9VA 5D6EA 3LWFA 1D1CA 2PJRB 3BPVA 3MKWB 1D0ZA 1H8AC 3H3ZA 4BH9A 1VQMI 3RYRA 3I3LA 4ZTJA 2Q2EA 2GA2A 3J80K 4AYBA 1ETVA 4GXOA 2VT2A 4G7ZF 4DNCA 2CS3A 5FGMA 2WTEA 4RLQA 3KE2A 2MGQA 1X3ZB 4E70A 1J59A 3EUHC 3GCMA 2M30A 2ZMEB 4HRIA 3AAFA 2KT0A 3ECOA 4A2UA 1ZAOA 3G73A 2XASA 2VL8A 3CF2A 3O8HA 3A4CA 4UB8C 3BR2A 2WV1A 5DV5A 1JI8A 3BJOA 2BY1A 3C7JA 3A0HC 2VXDA 1U2WA 4ENKA 3CDIA 2W82A 2CW0F 3WGGA 1RZ4A 4C3HJ 3FKIJ 1WWXA 2VKEA 5D5UB 1W7PB 3S1RJ 3AL0C 3LL7A 1IN6A 1SMTA 2GWRA 3F23A 4DZPA 2CQKA 3DQVC 2GZWA 3OMYA 2ISYA 3BY6A 5FKKA 1OJLA 4CZCA 1R22A 2MC4A 1D0YA 1BI3A 1BW6A 2IA1A 5HDGA 4ESJA 2EB7A 3DXJF 1Y1WJ 1OCOH 2A69F 4R8HA 3OL4A 2IS1A 1R1VA 3OV8A 3OR1C 3IUOA 2JT1A 3W6VA 4ENNA 4EJOA 2EJRA 2KIUA 4KITB 1MMGA 3H35A 2P7VB 4U87A 5FROA 2K9NA 4HEA2 2ETHA 4P96A 2BVLA 4BACA 3G1MA 2KFDA 2PLYA 3GWZA 4AIDA 2FQ3A 1XCBA 3WU2C 2D5VA 1A5JA 2XVCA 1XDSA 1Z1DA 1FP1D 1PUFA 1WI9A 2R7FA 1YJWI 4HV6A 3D1NI 5J1UA 2VBYA 2QUFA 3I5UA 5CKTA 1R1TA 1YTYA 4CYDA 4OOIA 3Q0WA 4IXAA 2LBFA 4IL6C 5EG0A 3KP5A 4ZYDA 4XNFA 1RKWA 4KFCA 2K27A 4BJTA 2M8EA 3RIRA 2ACJA 1VQNI 3QYBA 2QQ9A 3GLLA 2NNNA 4IRGA 3BR5A 3F8CA 4HNUA 3W3CA 3H92A 3LSPA 3FBNB 2V4JC 3TOBA 1VQ6I 2FOWA 4AIJA 3HPGA 4LJZF 3PQJA 1A6IA 1B4AA 2XPUA 5EG0B 5IPAA 2ZSHB 5F6FA 3F0CA 3ASNH 3K7AJ 4DOZA 3G4SI 3ZMDA 1Z91A 1MBHA 4HPQA 5DDGA 2V9KA 1QQIA 4XORA 4XRSG 4ZZLA 4NHJA 1ETYA 1X4PA 4I2OA 4CHUA 1Y8RB 2DA7A 3BQZA 3CLQA 3WG7H 3BG6A 1YG2A 4P9UA 4OIOF 4EJTA 2PG4A 2ESNA 5ILVA 3R60A 1YITI 3HIFA 4ZYEA 1DPUA 2E5NA 3LQQA 1USSA 4AD9A 2WAQA 1N75A 2BYVE 3PFIA 1IN5A 2L7FP 2DW4A 1G4DA 1RPWA 3DWLE 3QU6A 1R00A 2VUMJ 1TWFJ 1QBJA 4GCVA 3VYTB 9ANTA 3BZCA 2ZXWH 3RSNA 2JA7J 2OD5A 3GXOA 3G6EI 2P5LC 2PBIA 1O7LA 1YS6A 2FXAA 4IJAA 1P4XA 2JA6J 4U88A 4BUPA 1HF0A 1Z3XA 3PO3J 3VSLA 4A3EJ 3BR3A 4IZZA 1U8BA 2VQHA 4LG3A 3W2VA 3RPUA 1C0WA 2BE5F 1MJAA 3FBIB 3M8JA 1HQCA 1XSVA 1X1DA 2P5KA 5HNFA 3FK6A 4IVNA 1Z67A 3CESA 4UXNA 2RV8A 5DYMA 2LF7A 2JZYA 4W1UA 1FBQA 2AQFA 4ZZDA 4RB0A 3E6BA 1Y6IA 1WJFA 2L7KA 3ZMUA 1AWCA 4IHWA 2GOMA 4GYGA 4LFUA 2HZTA 2XF7A 2VIXA 5F1RA 2LD5A 1YS7A 2A61A 1D1BA 4ZJZA 3BG5A 2F48A 2IA2A 2NXNB 1JUMA 3D0SA 3FXJA 2DO7A 1CGPA 4HDVA 4Y4RA 1LEAA 1FIAA 1FOWA 1RKTA 4FQGA 3F9KA 4A6EA 2HKXA 2KDOA 5IT9K 2DMNA 5IT3A 4DBQA 2V1XA 2NOJB 4JP0A 1Z6TA 2VQLA 3ZMTA 2R5ZB 3RZDJ 1ZELA 3GZ6A 2L4AA 1QVUA 1JUSA 4A5NA 3GUDA 3KETA 3TBIA 2V1DA 4BBRJ 1JT0A 4Y13A 2FU4A 4CGZA 4I0AA 3WTUC 1QHHD 3J80Z 4LG0B 1KQ0A 1ZGJA 3GO5A 2JPBA 4IX7A 2XF6A 1X4OA 3L1PA 3BR0A 3IH2A 1IRXA 1OCPA 3KP7A 1UG2A 1W4MA 1Y1VJ 1ZRCA 2MD5A 1T38A 2IBDA 3F72A 3ELKA 2OTLI 2JK3A 4BNCA 1DP3A 3FXMA 2A5YB 1W0UA 2VLAA 3IKVA 3JTGA 2E5ZA 3OSGA 1D1AA 3DBHB 4FE7A 3HOTA 4BHPA 1TC3C 3JRGA 3NEUA 1P6RA 5CLSA 1O3SA 2CSOA 5KCMA 1TW2A 4P55A 1K6OA 2GM4A 3RCOA 3TDUC 5J4YA 3HGGA 4CO8A 2K4BA 3LSTA 3K4JA 1XCVA 2E19A 5EJCA 1K83J 2IT0A 1FX7A 1QZYA 1YX3A 2DT6A
chains in the Genus database with same CATH topology
3GFJA 4O5VA 1U5TC 3WG9A 5J6XA 4PDKA 2IPQX 4KYWA 3TOAA 3F8NA 1R5HA 4BXUA 2B0LA 1IF1A 2QBYA 3U9GA 1BBYA 2NNYA 3GYHX 1EH7A 2M45A 2H09A 1DPRA 2YX4A 3IWZA 1O7FA 3BJAA 3ZQ7A 1USTA 3WU1B 1K79A 1P92A 2QYOA 2HGCA 3RKYA 2DPUA 1XD7A 2W25A 4HQEA 1ZRDA 1KQ9A 2HS5A 2OA4A 5D5WB 2RGVA 3WTSC 5AIPA 3L00A 3RKWA 3I58A 4ASNA 1JGSA 3I59B 2FBKA 1IXRC 1XSXA 3L9FA 3F3XA 1IRFA 1MZBA 4EM1A 4PCQA 3NRVA 4ZH4F 5ILSA 5L3GA 3DKWA 4RGXA 2PMHA 5HDNA 4IRHA 1FBUA 1S7AA 4LB5A 1TQPA 2XRNA 2E7XA 2XAHA 3L7WA 2H94A 3I64A 4S04A 4WF2A 2STWA 1TQMA 2OZUA 4PGGA 1HSJA 2RC4A 4JBAA 5DCMB 1ZH5A 1YQAA 1KU9A 1DP7P 3BROA 3P9KA 1D5VA 5CYVA 2UXXA 4KIGA 1B1BA 1Q1HA 2XV4S 3M1EA 4LK0F 5HLIA 3R6SA 4YIFA 1U78A 3NQOA 2HKOA 4KN7X 1ULYA 1LDJA 2V79A 1T2KA 3I4PA 3RI4A 2FRHA 3BZ6A 3V8JA 5DUKA 1S6LA 1SAXA 1MGTA 3FMSA 1BC7C 2DK8A 1G3WA 3MZHA 2VONA 4WXDA 3WE2A 5K1YA 3ML6A 3ZP5A 2X4HA 4P9FA 1YYVA 4OMZA 1SD4A 3O2PE 2MC3A 4I98B 4KIFA 4UHTA 1FBSA 5HVQC 1ZARA 1O3RA 5JHUA 1ZHFA 3SQNA 2XAGA 1J75A 1UHWA 1WKMA 5LGUA 2DQRA 3M8EA 3KZYA 4FX4A 2DT5A 2A6HF 1XB4A 3T8RA 1WRJA 3I0TA 1G3SA 1XGOA 4A0XA 1BJAA 5ICFA 1ZG5A 1QZZA 3BWGA 3JAMK 2KIFA 1U3EM 4A6DA 4ESBA 4OIPF 2JTVA 1HXDA 1K78A 3R0AA 2CO5A 4IF4A 2QVOA 4L9NA 3T1BA 1TQIA 4Q48A 1BI1A 5ICCA 4RB2C 4I01A 4BQAA 1YLFA 4UUVA 2M5WA 3MAJA 5K5QA 4HX8A 4Q5SF 3ZMSA 4Z2YA 3R4KA 2VBWA 4K2EA 1JHFA 1FPQA 2Q8KA 5K5RA 2K86A 1FT9A 3WTTC 2UZKA 2XIGA 4M72A 2V1UA 3K1MA 3WTXC 1OKRA 3OOPA 5E8IA 4ENMA 1YFHA 1HKSA 1U5TA 1W5SA 3MEXA 3TO9A 3JW4A 3ECHA 2XAJA 3L09A 4KMFA 1SD7A 1Z9CA 5HLGA 3I59A 1TLHB 2DBBA 2HWVA 5FFXA 3JSPA 3HRTA 5D6FA 2OU2A 4LGWA 1T98A 4L0YB 3VEPA 2C6YA 1YO5C 1T0FA 1OPCA 5JI6A 1RI7A 4YFNF 5CVVA 5FD5A 4YIIA 3J81K 2D45A 1REPC 4XRFA 2A68F 2QENA 1D8KA 1O3QA 3BJ6A 2BV6A 1QGPA 2V9VA 2VE9A 4KNYA 2P7CB 1Z7UA 4WX9A 1BM9A 4ENJA 4BYYA 1CF7B 4B09A 3Q9SA 3T0YA 2FNPA 4Y15A 5H6RA 3J7AO 1OYWA 2VN2A 1MKMA 1R23A 3CJNA 4BAYA 3E5XA 2O8XA 2PI0A 4ZYGA 1X3UA 4WXCA 4HF2A 3HRMA 1KU7A 2HEOA 3V7CA 3WTZA 5KVRA 2MLGA 3CTAA 2EFNA 3K69A 3U2RA 4Q4ZF 2JRTA 3EETA 2WV0A 3TO7A 2WWYA 4MTEA 2YPRA 3FX3A 3W6KB 4IHTA 3BDDA 4R79A 1EH6A 3QP6A 4WK8F 2HTJA 2LDUA 2HOEA 3EDPA 3FM5A 4M71A 3VODA 1LDDA 4L9VA 3IKTA 3MQ0A 3QU3A 2UXNA 3EYYA 3E6DA 2EV5A 5CJ9A 1J5YA 3LAPA 2ZMEA 3KLOA 3KP2A 1YW9A 4FT8A 1RIOH 3COAC 4H0EA 1FY7A 2OZ6A 3I53A 2KJCA 5L3EA 1HW2A 1Z6RA 5L3BA 2CFXA 1I1GA 3F6VA 2F5DA 5HLHA 3KZZA 2EFQA 1DUXC 1R5GA 2FMLA 2H6BA 3ERED 2CG4A 3DPLC 3ZMVA 3HUGA 5TRDA 4XLNF 3E97A 1PDNC 2P8TA 3F8MA 1IW7F 2RQPA 3IHUA 4I02A 3ABTA 2ESHA 2V6CA 2HR3A 3HHGA 1TNSA 1WSUA 1K78B 2XKOA 4XBFA 1TNTA 4MHGA 3O3KA 4U7DA 1ON2A 1S3JA 3C3WA 1IUYA 4LK1F 4MGRA 4AWXB 5LEKA 5BS6A 4N9HA 2RVCA 1LVAA 2MA3A 4EJWA 1J9IA 3RDIA 5JFRA 2Y48A 4B8XA 1E2XA 3FXUA 1FZPB 4G7OF 3P7NA 4MEXF 3GFIA 3Q9VA 5ERIA 4CXFA 1D3YA 2JSCA 3ZMZA 4R1HA 3SFZA 1RNLA 4HDUA 2GQQA 1OMIA 2LNBA 5E18F 4HX7A 1G6NA 1JHHA 1TW3A 4RGUA 3U1DA 4I09A 1G3TA 1HKQA 4I0BA 1XDUA 3HSEA 3M7GA 1ZG1A 3QRFF 1MJBA 4LG0A 2XAFA 4A5MA 1BIAA 2EV6A 3E5QA 5E17F 1FOKA 2PJPA 1ON1A 4EVIA 3SHFA 4IHSA 1FSHA 1R1UA 1LDKB 3C1DA 2QQBA 3IRRA 2Z33A 3E5UA 5E1XA 2M1BA 3EQLF 3T5XA 1TBXA 1JXSA 1FYKA 2QLZA 5J8FA 3CUOA 3REOA 2CGPA 4UV8A 3CO6C 3ZPLA 4DQ2A 2PMUA 3HHHA 3HRUA 2ZFWA 3KLNA 1VTNC 3QPTA 2AXLA 1SFEA 5L3DA 2L54A 1P4AA 3MWMA 2HYFA 2RNJA 5L3FA 4MQVA 2NAZA 1BI0A 2O61A 2FBIA 2W84A 3HOSA 3WTYC 2PFBA 5BPDA 3O6BB 5F64A 1ZGAA 4RAZA 5FO5A 4UVAA 2IP2A 2NYXA 1GVJA 2F5EA 4BHCA 1LQ1A 5A2QZ 1W7PD 3HSRA 2VOPA 1SFXA 2OBPA 2WC2A 5D5VB 2Q0OA 5DD4A 5DD8A 3FM3A 3B73A 3VB2A 3KEQA 1ONVA 5D4SA 2DPDA 1UB9A 1ZREA 2KKOA 4KUMA 1IN7A 4RB1A 4M9SA 1XSDA 3V7SA 2M87A 3JAMZ 4L9TA 4D0PA 1E17A 5HOOA 1HW5A 2EWNA 2EK5A 3QPHA 5HS8A 2PEXA 2GXBA 2L01A 1O3TA 2ZNYA 1U8RA 2BBYA 1KU2A 3HTUA 2IJLA 2OQGA 2HFHA 2ADUA 1F1ZA 2L3DA 1L0OC 3F22A 3FHZA 2HTSA 1KYZA 4WCGA 1YW8A 2W24A 3R61A 3MZYA 4BHBA 4M73A 4ZYHA 3CUQA 1FP2A 1S8NA 5H20A 2LSOA 2ZO4A 2RN7A 4XSZF 1OYYA 1XGNA 4CZZA 2ISZA 4HX4A 5A2QK 2VODA 2L02A 3WGHA 2K4JA 2F5FA 2XKPA 1IN4A 4L0ZB 2F5CA 3LA3A 5AIQA 4UNOA 2O03A 4I7HA 3GF2A 1I27A 2P5VA 3ZN1A 2JPCA 1LB2A 2O3FA 3WODF 2FSWA 2ZXJA 2GA1A 2FBHA 3F8BA 4N0BA 5LHGA 4FX0A 5LLQA 2PQ8A 2VBXA 2EFPA 4QWQA 1UFMA 1ZN2A 3HRSA 3H3UA 1ODDA 3E6CC 4L5IA 2NS0A 5LEJA 1GXQA 5LHIA 5KK1A 4A0YA 4MTDA 2Y75A 5FLXK 2FMYA 3HTSB 4HF0A 4EV0A 1SFUA 5HS7A 2VC1A 3EUHA 3WTWC 4LLNA 1FYMA 1OYIA 1XMAA 1PP8F 1FSEA 4ESFA 4KICA 5FB2A 4AVPA 4EJUA 1F4KA 2MLKA 3D5LA 4G6DA 2FOKA 3GX4X 2QQAA 4RS8A 4F7ZA 1QPMA 3RPQA 4HF1A 1RUOA 3E3VA 4MEYF 2QZ8A 3PQKA 2FF4A 1TTYA 5ED4A 4AIKA 1IRGA 3EYIA 2GAUA 5DEQA 3T8TA 3TDZC 3BPXA 4KDPA 1I1SA 3IC7A 2P6TA 3B02A 5K5OA 5CVRA 4EJVA 2QWWA 3HSFA 2ZCWA 3KFWX 2DQLA 1I5ZA 2BEOA 5HDKA 2DU9A 5DCFA 3WE3A 3JTHA 3F21A 1B59A 2DLLA 1SD6A 4WWCA 2LF8A 2GXGA 1YIOA 1KQ8A 2A07F 3SZPA 1MDMA 4HZFA 2UWMA 4ETSA 1BN5A 3BOQA 2DK5A 4M6YA 2D1HA 2HQRA 4EGZA 1IZ1A 3ABUA 2Z9OA 2ZNZA 3R0JA 5D8KB 2E1NA 1B6AA 2EFOA 4N9IA 3RYPA 1H9GA 4FHTA 4GGGA 2R7DA 1ZLJA 1UHMA 4EGYA 2MH2A 1F9NA 4KIBA 4IPAA 3M9AA 4G9YA 1B9MA 5EEHA 1H9TA 1U6GA 5BQTA 2D2WA 1FLIA 5ILUA 3LQRA 5EEGA 4A12A 3DPTA 2A3SA 1SMYF 4HLYA 4M9XA 3F6OA 3DFGA 4G7HF 2XAQA 3CUQC 1R58A 5DUIA 4U0WA 3GFMA 2DAOA 2K7LA 4U0VA 5DCMA 5ICEA 1PP7U 1IXCA 1HKTA 2FE3A 3DV8A 3F8FA 2HDCA 2O6GE 1UCRA 2P4WA 2GIVA 2W85A 3GVAA 1B9NA 5ICGA 4OMYA 2A6EF 1MD0A 4HYEA 4XLPF 2KJBA 3QP5A 2BGCA 3TKYA 3ULQB 2YSRA 1RUNA 4L5JA 4Q47A 5E1ZB 1LJ9A 4KT5C 3FZVA 2STTA 1LEBA 5AONA 1MDMB 3QAHA 3Q5FA 3FMQA 1F5TA 5BMZA 1W7PA 4U0YA 3RTRA 2EFWA 4G8XA 1J0RA 1DDNA 2ZJ2A 5CVJA 2RDPA 3ZN0A 2ZKZA 4M6XA 1ZLKA 4LD5A 2VOOA 3KP4A 4HBLA 2EA4A 4EQQA 1J7KA 1IAWA 1FYLA 4G94A 2LKPA 4KN4X 4L9JA 5LRRA 5FLXZ 1KGSA 3GW2A 3MCZA 1HW1A 1LNWA 3FXQA 4ON0A 2MBFA 1Z05A 1R36A 2QBYB 1MJ9A 2K02A 4YG2F 4HLXA 1I6XA 3DP7A 3L2CA 1O57A 3RKXA 3FF5A 1XMKA 6PAXA 3CO7C 4OU0A 3N4MA 1XGSA 3N97A 3IL2A 2VBZA 1HSTA 4PGHA 1D8JA 3VFZA 2R3SA 1QO0D 1STZA 3LFKA 1YW7A 4HAMA 1JE8A 5D5XB 2G7UA 4LMYA 2QM3A 3JSOA 4PZJA 2YX7A 3TGNA 4QLCU 2DTRA 4S05A 4UVCA 5E8GA 2G9WA 4GO1A 2AS5F 2J5OA 5E20A 2MH9A 4NB5A 4RGRA 4P5OA 3BP8A 5BOXA 1IN8A 4O6JA 1P4WA 4MQ9F 3MFKA 4HQMA 2W57A 1H0MA 2CYYA 2FEZA 1QNTA 5CVUA 2X0LA 4RAYA 1GXPA 3P9CA 2DFIA 2YR2A 3DEUA 4HOBA 4LB6B 4O3MA 5E1WA 3M8FA 2ELHA 1KU3A 1L3LA 1S29A 4CICA 4EM2A 5LGNA 4OINF 3RJPA 3GZ5A 2VT3A 2KIMA 4OIQF 1V4RA 1BOAA 1GHCA 3CUQB 3WTVC 2H27A 4NQWA 3WU0A 3CLOA 1IXSB 2COMA 1FWZA 3LA2A 4KA4A 2O0YA 2OAZA 1PUEE 3V4GA 5BPIA 1NHAA 3FMRA 1ZG3A 4HA8A 4EM0B 4RB3C 4YFKF 1V3FA 1HBXG 1R7JA 3CDHA 1SD5A 3SZTA 2J5PA 2HYGD 1U5TB 4MNUA 2NRAC 4RGSA 4TV7A 2H6CA 2D1VA 2FNAA 4M74A 5HS9A 1FC3A 1XGMA 2XROA 1G3YA 3K1PA 2DI3A 3ISPA 5L3CA 3VOEA 2E7WA 2E1CA 3P9IA 3TQNA 2KRFA 1AOYA 1FNNA 5IT9Z 2HQNA 2VXZA 3TO6A 3W6JB 2IW5A 3K0LA 1K7AA 3LA7A 4OIRF 4YFXF 4JK1X 3GFLA 2RKHA 4WXHA 1BIBA 1P2FA 3K9TA 4U7BA 3KCCA 4LLLA 2F2EA 3FXRA 3ROUA 1S7OA 2Z99A 3KP6A 3I71A 4UV9A 5FFZA 2Z3YA 3GLXA 2IVMA 5TJJA 1W5TA 1EV7A 2VC0A 2XUBA 4M9ZA 1ZRFA 4XSXF 1ZYRF 1A04A 5D8LB 1T6SA 2VE8A 4EMSA 3V8LA 2OQRA 3KEOA 5JR3A 3K1NA 4CDGA 4IRIA 2ZBKA 5LBQA 3LAJA 2L4MA 1BC8C 5LHHA 4HW0A 3GEZA 5CVIA 1Y0UA 1WQ2A 3S2WA 2Z5UA 2YU3A 3K2ZA 4UVBA 3V7RA 3I54A 4JQFA 3J81Z 4KMUX 5JVTA 4LLGF 1KYWA 5D4RA 2EA2A 3KP3A 5FD6A 3C18A 3E6MA 3IRQA 1XN7A 2Y0MA 2XGXA 5H6QA 2IRFG 1KA8A 2G7HA 3G3ZA 5LGTA 3WGIA 2PN6A 5J8CA 5LRSA 3DF8A 1OR7A 4HV5A 1T39A 3FWEA 3QOPA 2CWEA 2EV0A 2XHKA 3V8KA 3HYIA 4A0ZA 3IWFA 2FA5A 2TDXA 1BI2A 4Y17A 3SXYA 4GYIA 4G6QA 1EH8A 2IA0A 1J2XA 4L18B 1CF7A 4AIHA 2P6SA 5D6EA 3LWFA 3BPVA 3H3ZA 4BH9A 3RYRA 2Q2EA 2GA2A 3J80K 4GXOA 2VT2A 4G7ZF 4DNCA 5FGMA 2WTEA 3KE2A 4E70A 1J59A 2M30A 2ZMEB 3AAFA 3ECOA 4A2UA 1ZAOA 3G73A 2XASA 5DV5A 3BJOA 3C7JA 1U2WA 4ENKA 2CW0F 3WGGA 1RZ4A 1WWXA 5D5UB 1W7PB 1IN6A 1SMTA 2GWRA 3F23A 2CQKA 3DQVC 2GZWA 2ISYA 3BY6A 1R22A 1BI3A 2IA1A 5HDGA 4ESJA 2EB7A 3DXJF 2A69F 4R8HA 1R1VA 3OV8A 2JT1A 4ENNA 4EJOA 2EJRA 2KIUA 2P7VB 2ETHA 4P96A 2PLYA 3GWZA 2FQ3A 1XCBA 2XVCA 1XDSA 1Z1DA 1FP1D 1WI9A 2R7FA 4HV6A 2VBYA 2QUFA 3I5UA 1YTYA 1R1TA 4CYDA 4OOIA 4IXAA 4ZYDA 3KP5A 4KFCA 2K27A 2ACJA 2M8EA 3RIRA 2QQ9A 2NNNA 4IRGA 3F8CA 3H92A 3TOBA 4AIJA 4LJZF 3PQJA 1B4AA 5F6FA 3ZMDA 1Z91A 5DDGA 1QQIA 4ZZLA 4NHJA 4I2OA 4CHUA 4P9UA 1YG2A 4OIOF 4EJTA 2PG4A 2ESNA 5ILVA 3R60A 3HIFA 4ZYEA 1DPUA 3LQQA 1USSA 4AD9A 3PFIA 2BYVE 1IN5A 2DW4A 1G4DA 3QU6A 1R00A 1QBJA 4GCVA 2OD5A 3GXOA 2P5LC 2PBIA 1O7LA 1YS6A 2FXAA 4IJAA 1P4XA 4U88A 3RPUA 1C0WA 2BE5F 1MJAA 1HQCA 1XSVA 2P5KA 4IVNA 4UXNA 2RV8A 5DYMA 2LF7A 2JZYA 1FBQA 4ZZDA 4RB0A 3E6BA 3ZMUA 1AWCA 4GYGA 4LFUA 2HZTA 5F1RA 1YS7A 2A61A 3D0SA 2IA2A 2DO7A 1CGPA 4HDVA 1LEAA 4A6EA 5IT9K 2HKXA 5IT3A 2V1XA 1Z6TA 3ZMTA 3GZ6A 2L4AA 4A5NA 3GUDA 3KETA 2V1DA 4Y13A 2FU4A 4CGZA 4I0AA 3WTUC 3J80Z 4LG0B 1KQ0A 1ZGJA 3GO5A 2JPBA 3KP7A 1W4MA 1ZRCA 2MD5A 1T38A 3F72A 3ELKA 4BNCA 2A5YB 3IKVA 3JTGA 3HOTA 4BHPA 3NEUA 1P6RA 5CLSA 1O3SA 2CSOA 1TW2A 4P55A 1K6OA 3TDUC 4CO8A 2K4BA 3LSTA 1XCVA 2IT0A 1FX7A 1QZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GFJ A;  4O5V A;  1U5T C;  3WG9 A;  5J6X A;  4PDK A;  2IPQ X;  4KYW A;  3TOA A;  3F8N A;  1R5H A;  4BXU A;  2B0L A;  1IF1 A;  2QBY A;  3U9G A;  1BBY A;  2NNY A;  3GYH X;  1EH7 A;  2M45 A;  2H09 A;  1DPR A;  2YX4 A;  3IWZ A;  1O7F A;  3BJA A;  3ZQ7 A;  1UST A;  3WU1 B;  1K79 A;  1P92 A;  2QYO A;  2HGC A;  3RKY A;  2DPU A;  1XD7 A;  2W25 A;  4HQE A;  1ZRD A;  1KQ9 A;  2HS5 A;  2OA4 A;  5D5W B;  2RGV A;  3WTS C;  5AIP A;  3L00 A;  3RKW A;  3I58 A;  4ASN A;  1JGS A;  3I59 B;  2FBK A;  1IXR C;  1XSX A;  3L9F A;  3F3X A;  1IRF A;  1MZB A;  4EM1 A;  4PCQ A;  3NRV A;  4ZH4 F;  5ILS A;  5L3G A;  3DKW A;  4RGX A;  2PMH A;  5HDN A;  4IRH A;  1FBU A;  1S7A A;  4LB5 A;  1TQP A;  2XRN A;  2E7X A;  2XAH A;  3L7W A;  2H94 A;  3I64 A;  4S04 A;  4WF2 A;  2STW A;  1TQM A;  2OZU A;  4PGG A;  1HSJ A;  2RC4 A;  4JBA A;  5DCM B;  1ZH5 A;  1YQA A;  1KU9 A;  1DP7 P;  3BRO A;  3P9K A;  1D5V A;  5CYV A;  2UXX A;  4KIG A;  1B1B A;  1Q1H A;  2XV4 S;  3M1E A;  4LK0 F;  5HLI A;  3R6S A;  4YIF A;  1U78 A;  3NQO A;  2HKO A;  4KN7 X;  1ULY A;  1LDJ A;  2V79 A;  1T2K A;  3I4P A;  3RI4 A;  2FRH A;  3BZ6 A;  3V8J A;  5DUK A;  1S6L A;  1SAX A;  1MGT A;  3FMS A;  1BC7 C;  2DK8 A;  1G3W A;  3MZH A;  2VON A;  4WXD A;  3WE2 A;  5K1Y A;  3ML6 A;  3ZP5 A;  2X4H A;  4P9F A;  1YYV A;  4OMZ A;  1SD4 A;  3O2P E;  2MC3 A;  4I98 B;  4KIF A;  4UHT A;  1FBS A;  5HVQ C;  1ZAR A;  1O3R A;  5JHU A;  1ZHF A;  3SQN A;  2XAG A;  1J75 A;  1UHW A;  1WKM A;  5LGU A;  2DQR A;  3M8E A;  3KZY A;  4FX4 A;  2DT5 A;  2A6H F;  1XB4 A;  3T8R A;  1WRJ A;  3I0T A;  1G3S A;  1XGO A;  4A0X A;  1BJA A;  5ICF A;  1ZG5 A;  1QZZ A;  3BWG A;  3JAM K;  2KIF A;  1U3E M;  4A6D A;  4ESB A;  4OIP F;  2JTV A;  1HXD A;  1K78 A;  3R0A A;  2CO5 A;  4IF4 A;  2QVO A;  4L9N A;  3T1B A;  1TQI A;  4Q48 A;  1BI1 A;  5ICC A;  4RB2 C;  4I01 A;  4BQA A;  1YLF A;  4UUV A;  2M5W A;  3MAJ A;  5K5Q A;  4HX8 A;  4Q5S F;  3ZMS A;  4Z2Y A;  3R4K A;  2VBW A;  4K2E A;  1JHF A;  1FPQ A;  2Q8K A;  5K5R A;  2K86 A;  1FT9 A;  3WTT C;  2UZK A;  2XIG A;  4M72 A;  2V1U A;  3K1M A;  3WTX C;  1OKR A;  3OOP A;  5E8I A;  4ENM A;  1YFH A;  1HKS A;  1U5T A;  1W5S A;  3MEX A;  3TO9 A;  3JW4 A;  3ECH A;  2XAJ A;  3L09 A;  4KMF A;  1SD7 A;  1Z9C A;  5HLG A;  3I59 A;  1TLH B;  2DBB A;  2HWV A;  5FFX A;  3JSP A;  3HRT A;  5D6F A;  2OU2 A;  4LGW A;  1T98 A;  4L0Y B;  3VEP A;  2C6Y A;  1YO5 C;  1T0F A;  1OPC A;  5JI6 A;  1RI7 A;  4YFN F;  5CVV A;  5FD5 A;  4YII A;  3J81 K;  2D45 A;  1REP C;  4XRF A;  2A68 F;  2QEN A;  1D8K A;  1O3Q A;  3BJ6 A;  2BV6 A;  1QGP A;  2V9V A;  2VE9 A;  4KNY A;  2P7C B;  1Z7U A;  4WX9 A;  1BM9 A;  4ENJ A;  4BYY A;  1CF7 B;  4B09 A;  3Q9S A;  3T0Y A;  2FNP A;  4Y15 A;  5H6R A;  3J7A O;  1OYW A;  2VN2 A;  1MKM A;  1R23 A;  3CJN A;  4BAY A;  3E5X A;  2O8X A;  2PI0 A;  4ZYG A;  1X3U A;  4WXC A;  4HF2 A;  3HRM A;  1KU7 A;  2HEO A;  3V7C A;  3WTZ A;  5KVR A;  2MLG A;  3CTA A;  2EFN A;  3K69 A;  3U2R A;  4Q4Z F;  2JRT A;  3EET A;  2WV0 A;  3TO7 A;  2WWY A;  4MTE A;  2YPR A;  3FX3 A;  3W6K B;  4IHT A;  3BDD A;  4R79 A;  1EH6 A;  3QP6 A;  4WK8 F;  2HTJ A;  2LDU A;  2HOE A;  3EDP A;  3FM5 A;  4M71 A;  3VOD A;  1LDD A;  4L9V A;  3IKT A;  3MQ0 A;  3QU3 A;  2UXN A;  3EYY A;  3E6D A;  2EV5 A;  5CJ9 A;  1J5Y A;  3LAP A;  2ZME A;  3KLO A;  3KP2 A;  1YW9 A;  4FT8 A;  1RIO H;  3COA C;  4H0E A;  1FY7 A;  2OZ6 A;  3I53 A;  2KJC A;  5L3E A;  1HW2 A;  1Z6R A;  5L3B A;  2CFX A;  1I1G A;  3F6V A;  2F5D A;  5HLH A;  3KZZ A;  2EFQ A;  1DUX C;  1R5G A;  2FML A;  2H6B A;  3ERE D;  2CG4 A;  3DPL C;  3ZMV A;  3HUG A;  5TRD A;  4XLN F;  3E97 A;  1PDN C;  2P8T A;  3F8M A;  1IW7 F;  2RQP A;  3IHU A;  4I02 A;  3ABT A;  2ESH A;  2V6C A;  2HR3 A;  3HHG A;  1TNS A;  1WSU A;  1K78 B;  2XKO A;  4XBF A;  1TNT A;  4MHG A;  3O3K A;  4U7D A;  1ON2 A;  1S3J A;  3C3W A;  1IUY A;  4LK1 F;  4MGR A;  4AWX B;  5LEK A;  5BS6 A;  4N9H A;  2RVC A;  1LVA A;  2MA3 A;  4EJW A;  1J9I A;  3RDI A;  5JFR A;  2Y48 A;  4B8X A;  1E2X A;  3FXU A;  1FZP B;  4G7O F;  3P7N A;  4MEX F;  3GFI A;  3Q9V A;  5ERI A;  4CXF A;  1D3Y A;  2JSC A;  3ZMZ A;  4R1H A;  3SFZ A;  1RNL A;  4HDU A;  2GQQ A;  1OMI A;  2LNB A;  5E18 F;  4HX7 A;  1G6N A;  1JHH A;  1TW3 A;  4RGU A;  3U1D A;  4I09 A;  1G3T A;  1HKQ A;  4I0B A;  1XDU A;  3HSE A;  3M7G A;  1ZG1 A;  3QRF F;  1MJB A;  4LG0 A;  2XAF A;  4A5M A;  1BIA A;  2EV6 A;  3E5Q A;  5E17 F;  1FOK A;  2PJP A;  1ON1 A;  4EVI A;  3SHF A;  4IHS A;  1FSH A;  1R1U A;  1LDK B;  3C1D A;  2QQB A;  3IRR A;  2Z33 A;  3E5U A;  5E1X A;  2M1B A;  3EQL F;  3T5X A;  1TBX A;  1JXS A;  1FYK A;  2QLZ A;  5J8F A;  3CUO A;  3REO A;  2CGP A;  4UV8 A;  3CO6 C;  3ZPL A;  4DQ2 A;  2PMU A;  3HHH A;  3HRU A;  2ZFW A;  3KLN A;  1VTN C;  3QPT A;  2AXL A;  1SFE A;  5L3D A;  2L54 A;  1P4A A;  3MWM A;  2HYF A;  2RNJ A;  5L3F A;  4MQV A;  2NAZ A;  1BI0 A;  2O61 A;  2FBI A;  2W84 A;  3HOS A;  3WTY C;  2PFB A;  5BPD A;  3O6B B;  5F64 A;  1ZGA A;  4RAZ A;  5FO5 A;  4UVA A;  2IP2 A;  2NYX A;  1GVJ A;  2F5E A;  4BHC A;  1LQ1 A;  5A2Q Z;  1W7P D;  3HSR A;  2VOP A;  1SFX A;  2OBP A;  2WC2 A;  5D5V B;  2Q0O A;  5DD4 A;  5DD8 A;  3FM3 A;  3B73 A;  3VB2 A;  3KEQ A;  1ONV A;  5D4S A;  2DPD A;  1UB9 A;  1ZRE A;  2KKO A;  4KUM A;  1IN7 A;  4RB1 A;  4M9S A;  1XSD A;  3V7S A;  2M87 A;  3JAM Z;  4L9T A;  4D0P A;  1E17 A;  5HOO A;  1HW5 A;  2EWN A;  2EK5 A;  3QPH A;  5HS8 A;  2PEX A;  2GXB A;  2L01 A;  1O3T A;  2ZNY A;  1U8R A;  2BBY A;  1KU2 A;  3HTU A;  2IJL A;  2OQG A;  2HFH A;  2ADU A;  1F1Z A;  2L3D A;  1L0O C;  3F22 A;  3FHZ A;  2HTS A;  1KYZ A;  4WCG A;  1YW8 A;  2W24 A;  3R61 A;  3MZY A;  4BHB A;  4M73 A;  4ZYH A;  3CUQ A;  1FP2 A;  1S8N A;  5H20 A;  2LSO A;  2ZO4 A;  2RN7 A;  4XSZ F;  1OYY A;  1XGN A;  4CZZ A;  2ISZ A;  4HX4 A;  5A2Q K;  2VOD A;  2L02 A;  3WGH A;  2K4J A;  2F5F A;  2XKP A;  1IN4 A;  4L0Z B;  2F5C A;  3LA3 A;  5AIQ A;  4UNO A;  2O03 A;  4I7H A;  3GF2 A;  1I27 A;  2P5V A;  3ZN1 A;  2JPC A;  1LB2 A;  2O3F A;  3WOD F;  2FSW A;  2ZXJ A;  2GA1 A;  2FBH A;  3F8B A;  4N0B A;  5LHG A;  4FX0 A;  5LLQ A;  2PQ8 A;  2VBX A;  2EFP A;  4QWQ A;  1UFM A;  1ZN2 A;  3HRS A;  3H3U A;  1ODD A;  3E6C C;  4L5I A;  2NS0 A;  5LEJ A;  1GXQ A;  5LHI A;  5KK1 A;  4A0Y A;  4MTD A;  2Y75 A;  5FLX K;  2FMY A;  3HTS B;  4HF0 A;  4EV0 A;  1SFU A;  5HS7 A;  2VC1 A;  3EUH A;  3WTW C;  4LLN A;  1FYM A;  1OYI A;  1XMA A;  1PP8 F;  1FSE A;  4ESF A;  4KIC A;  5FB2 A;  4AVP A;  4EJU A;  1F4K A;  2MLK A;  3D5L A;  4G6D A;  2FOK A;  3GX4 X;  2QQA A;  4RS8 A;  4F7Z A;  1QPM A;  3RPQ A;  4HF1 A;  1RUO A;  3E3V A;  4MEY F;  2QZ8 A;  3PQK A;  2FF4 A;  1TTY A;  5ED4 A;  4AIK A;  1IRG A;  3EYI A;  2GAU A;  5DEQ A;  3T8T A;  3TDZ C;  3BPX A;  4KDP A;  1I1S A;  3IC7 A;  2P6T A;  3B02 A;  5K5O A;  5CVR A;  4EJV A;  2QWW A;  3HSF A;  2ZCW A;  3KFW X;  2DQL A;  1I5Z A;  2BEO A;  5HDK A;  2DU9 A;  5DCF A;  3WE3 A;  3JTH A;  3F21 A;  1B59 A;  2DLL A;  1SD6 A;  4WWC A;  2LF8 A;  2GXG A;  1YIO A;  1KQ8 A;  2A07 F;  3SZP A;  1MDM A;  4HZF A;  2UWM A;  4ETS A;  1BN5 A;  3BOQ A;  2DK5 A;  4M6Y A;  2D1H A;  2HQR A;  4EGZ A;  1IZ1 A;  3ABU A;  2Z9O A;  2ZNZ A;  3R0J A;  5D8K B;  2E1N A;  1B6A A;  2EFO A;  4N9I A;  3RYP A;  1H9G A;  4FHT A;  4GGG A;  2R7D A;  1ZLJ A;  1UHM A;  4EGY A;  2MH2 A;  1F9N A;  4KIB A;  4IPA A;  3M9A A;  4G9Y A;  1B9M A;  5EEH A;  1H9T A;  1U6G A;  5BQT A;  2D2W A;  1FLI A;  5ILU A;  3LQR A;  5EEG A;  4A12 A;  3DPT A;  2A3S A;  1SMY F;  4HLY A;  4M9X A;  3F6O A;  3DFG A;  4G7H F;  2XAQ A;  3CUQ C;  1R58 A;  5DUI A;  4U0W A;  3GFM A;  2DAO A;  2K7L A;  4U0V A;  5DCM A;  5ICE A;  1PP7 U;  1IXC A;  1HKT A;  2FE3 A;  3DV8 A;  3F8F A;  2HDC A;  2O6G E;  1UCR A;  2P4W A;  2GIV A;  2W85 A;  3GVA A;  1B9N A;  5ICG A;  4OMY A;  2A6E F;  1MD0 A;  4HYE A;  4XLP F;  2KJB A;  3QP5 A;  2BGC A;  3TKY A;  3ULQ B;  2YSR A;  1RUN A;  4L5J A;  4Q47 A;  5E1Z B;  1LJ9 A;  4KT5 C;  3FZV A;  2STT A;  1LEB A;  5AON A;  1MDM B;  3QAH A;  3Q5F A;  3FMQ A;  1F5T A;  5BMZ A;  1W7P A;  4U0Y A;  3RTR A;  2EFW A;  4G8X A;  1J0R A;  1DDN A;  2ZJ2 A;  5CVJ A;  2RDP A;  3ZN0 A;  2ZKZ A;  4M6X A;  1ZLK A;  4LD5 A;  2VOO A;  3KP4 A;  4HBL A;  2EA4 A;  4EQQ A;  1J7K A;  1IAW A;  1FYL A;  4G94 A;  2LKP A;  4KN4 X;  4L9J A;  5LRR A;  5FLX Z;  1KGS A;  3GW2 A;  3MCZ A;  1HW1 A;  1LNW A;  3FXQ A;  4ON0 A;  2MBF A;  1Z05 A;  1R36 A;  2QBY B;  1MJ9 A;  2K02 A;  4YG2 F;  4HLX A;  1I6X A;  3DP7 A;  3L2C A;  1O57 A;  3RKX A;  3FF5 A;  1XMK A;  6PAX A;  3CO7 C;  4OU0 A;  3N4M A;  1XGS A;  3N97 A;  3IL2 A;  2VBZ A;  1HST A;  4PGH A;  1D8J A;  3VFZ A;  2R3S A;  1QO0 D;  1STZ A;  3LFK A;  1YW7 A;  4HAM A;  1JE8 A;  5D5X B;  2G7U A;  4LMY A;  2QM3 A;  3JSO A;  4PZJ A;  2YX7 A;  3TGN A;  4QLC U;  2DTR A;  4S05 A;  4UVC A;  5E8G A;  2G9W A;  4GO1 A;  2AS5 F;  2J5O A;  5E20 A;  2MH9 A;  4NB5 A;  4RGR A;  4P5O A;  3BP8 A;  5BOX A;  1IN8 A;  4O6J A;  1P4W A;  4MQ9 F;  3MFK A;  4HQM A;  2W57 A;  1H0M A;  2CYY A;  2FEZ A;  1QNT A;  5CVU A;  2X0L A;  4RAY A;  1GXP A;  3P9C A;  2DFI A;  2YR2 A;  3DEU A;  4HOB A;  4LB6 B;  4O3M A;  5E1W A;  3M8F A;  2ELH A;  1KU3 A;  1L3L A;  1S29 A;  4CIC A;  4EM2 A;  5LGN A;  4OIN F;  3RJP A;  3GZ5 A;  2VT3 A;  2KIM A;  4OIQ F;  1V4R A;  1BOA A;  1GHC A;  3CUQ B;  3WTV C;  2H27 A;  4NQW A;  3WU0 A;  3CLO A;  1IXS B;  2COM A;  1FWZ A;  3LA2 A;  4KA4 A;  2O0Y A;  2OAZ A;  1PUE E;  3V4G A;  5BPI A;  1NHA A;  3FMR A;  1ZG3 A;  4HA8 A;  4EM0 B;  4RB3 C;  4YFK F;  1V3F A;  1HBX G;  1R7J A;  3CDH A;  1SD5 A;  3SZT A;  2J5P A;  2HYG D;  1U5T B;  4MNU A;  2NRA C;  4RGS A;  4TV7 A;  2H6C A;  2D1V A;  2FNA A;  4M74 A;  5HS9 A;  1FC3 A;  1XGM A;  2XRO A;  1G3Y A;  3K1P A;  2DI3 A;  3ISP A;  5L3C A;  3VOE A;  2E7W A;  2E1C A;  3P9I A;  3TQN A;  2KRF A;  1AOY A;  1FNN A;  5IT9 Z;  2HQN A;  2VXZ A;  3TO6 A;  3W6J B;  2IW5 A;  3K0L A;  1K7A A;  3LA7 A;  4OIR F;  4YFX F;  4JK1 X;  3GFL A;  2RKH A;  4WXH A;  1BIB A;  1P2F A;  3K9T A;  4U7B A;  3KCC A;  4LLL A;  2F2E A;  3FXR A;  3ROU A;  1S7O A;  2Z99 A;  3KP6 A;  3I71 A;  4UV9 A;  5FFZ A;  2Z3Y A;  3GLX A;  2IVM A;  5TJJ A;  1W5T A;  1EV7 A;  2VC0 A;  2XUB A;  4M9Z A;  1ZRF A;  4XSX F;  1ZYR F;  1A04 A;  5D8L B;  1T6S A;  2VE8 A;  4EMS A;  3V8L A;  2OQR A;  3KEO A;  5JR3 A;  3K1N A;  4CDG A;  4IRI A;  2ZBK A;  5LBQ A;  3LAJ A;  2L4M A;  1BC8 C;  5LHH A;  4HW0 A;  3GEZ A;  5CVI A;  1Y0U A;  1WQ2 A;  3S2W A;  2Z5U A;  2YU3 A;  3K2Z A;  4UVB A;  3V7R A;  3I54 A;  4JQF A;  3J81 Z;  4KMU X;  5JVT A;  4LLG F;  1KYW A;  5D4R A;  2EA2 A;  3KP3 A;  5FD6 A;  3C18 A;  3E6M A;  3IRQ A;  1XN7 A;  2Y0M A;  2XGX A;  5H6Q A;  2IRF G;  1KA8 A;  2G7H A;  3G3Z A;  5LGT A;  3WGI A;  2PN6 A;  5J8C A;  5LRS A;  3DF8 A;  1OR7 A;  4HV5 A;  1T39 A;  3FWE A;  3QOP A;  2CWE A;  2EV0 A;  2XHK A;  3V8K A;  3HYI A;  4A0Z A;  3IWF A;  2FA5 A;  2TDX A;  1BI2 A;  4Y17 A;  3SXY A;  4GYI A;  4G6Q A;  1EH8 A;  2IA0 A;  1J2X A;  4L18 B;  1CF7 A;  4AIH A;  2P6S A;  5D6E A;  3LWF A;  3BPV A;  3H3Z A;  4BH9 A;  3RYR A;  2Q2E A;  2GA2 A;  3J80 K;  4GXO A;  2VT2 A;  4G7Z F;  4DNC A;  5FGM A;  2WTE A;  3KE2 A;  4E70 A;  1J59 A;  2M30 A;  2ZME B;  3AAF A;  3ECO A;  4A2U A;  1ZAO A;  3G73 A;  2XAS A;  5DV5 A;  3BJO A;  3C7J A;  1U2W A;  4ENK A;  2CW0 F;  3WGG A;  1RZ4 A;  1WWX A;  5D5U B;  1W7P B;  1IN6 A;  1SMT A;  2GWR A;  3F23 A;  2CQK A;  3DQV C;  2GZW A;  2ISY A;  3BY6 A;  1R22 A;  1BI3 A;  2IA1 A;  5HDG A;  4ESJ A;  2EB7 A;  3DXJ F;  2A69 F;  4R8H A;  1R1V A;  3OV8 A;  2JT1 A;  4ENN A;  4EJO A;  2EJR A;  2KIU A;  2P7V B;  2ETH A;  4P96 A;  2PLY A;  3GWZ A;  2FQ3 A;  1XCB A;  2XVC A;  1XDS A;  1Z1D A;  1FP1 D;  1WI9 A;  2R7F A;  4HV6 A;  2VBY A;  2QUF A;  3I5U A;  1YTY A;  1R1T A;  4CYD A;  4OOI A;  4IXA A;  4ZYD A;  3KP5 A;  4KFC A;  2K27 A;  2ACJ A;  2M8E A;  3RIR A;  2QQ9 A;  2NNN A;  4IRG A;  3F8C A;  3H92 A;  3TOB A;  4AIJ A;  4LJZ F;  3PQJ A;  1B4A A;  5F6F A;  3ZMD A;  1Z91 A;  5DDG A;  1QQI A;  4ZZL A;  4NHJ A;  4I2O A;  4CHU A;  4P9U A;  1YG2 A;  4OIO F;  4EJT A;  2PG4 A;  2ESN A;  5ILV A;  3R60 A;  3HIF A;  4ZYE A;  1DPU A;  3LQQ A;  1USS A;  4AD9 A;  3PFI A;  2BYV E;  1IN5 A;  2DW4 A;  1G4D A;  3QU6 A;  1R00 A;  1QBJ A;  4GCV A;  2OD5 A;  3GXO A;  2P5L C;  2PBI A;  1O7L A;  1YS6 A;  2FXA A;  4IJA A;  1P4X A;  4U88 A;  3RPU A;  1C0W A;  2BE5 F;  1MJA A;  1HQC A;  1XSV A;  2P5K A;  4IVN A;  4UXN A;  2RV8 A;  5DYM A;  2LF7 A;  2JZY A;  1FBQ A;  4ZZD A;  4RB0 A;  3E6B A;  3ZMU A;  1AWC A;  4GYG A;  4LFU A;  2HZT A;  5F1R A;  1YS7 A;  2A61 A;  3D0S A;  2IA2 A;  2DO7 A;  1CGP A;  4HDV A;  1LEA A;  4A6E A;  5IT9 K;  2HKX A;  5IT3 A;  2V1X A;  1Z6T A;  3ZMT A;  3GZ6 A;  2L4A A;  4A5N A;  3GUD A;  3KET A;  2V1D A;  4Y13 A;  2FU4 A;  4CGZ A;  4I0A A;  3WTU C;  3J80 Z;  4LG0 B;  1KQ0 A;  1ZGJ A;  3GO5 A;  2JPB A;  3KP7 A;  1W4M A;  1ZRC A;  2MD5 A;  1T38 A;  3F72 A;  3ELK A;  4BNC A;  2A5Y B;  3IKV A;  3JTG A;  3HOT A;  4BHP A;  3NEU A;  1P6R A;  5CLS A;  1O3S A;  2CSO A;  1TW2 A;  4P55 A;  1K6O A;  3TDU C;  4CO8 A;  2K4B A;  3LST A;  1XCV A;  2IT0 A;  1FX7 A;  1QZY A; 
#chains in the Genus database with same CATH topology
 3C2H A;  3GFJ A;  1DU6 A;  1IV8 A;  3G1L A;  2IS6 A;  1JKQ C;  2DOA A;  3PNY A;  4O5V A;  3W2A A;  3I56 I;  1U5T C;  2KZV A;  3WG9 A;  3BLY A;  5J6X A;  3CMA I;  4PDK A;  2LRE A;  2IPQ X;  4KYW A;  4NDL A;  1PJR A;  2DA1 A;  3TOA A;  4E7S A;  1NG7 A;  3F8N A;  4BL0 B;  1R5H A;  4BXU A;  3GTP J;  1W5C C;  2B0L A;  1IF1 A;  3HXL A;  2QCO A;  2QBY A;  1MMA A;  2F5V A;  3VYS B;  3U9G A;  3UKG A;  1BBY A;  3HOV J;  3A0B C;  3GYH X;  2NNY A;  1EH7 A;  2M45 A;  3M3Y J;  2H09 A;  1DPR A;  2YX4 A;  3IWZ A;  4XN3 A;  1E0E A;  1O7F A;  1PYV A;  3GTL J;  3JR9 A;  1P7J A;  3BJA A;  2R4G A;  2R7W A;  4XM3 A;  3MKL A;  2VJJ A;  3ZQ7 A;  1UST A;  3WU1 B;  1K79 A;  2XGC A;  1P92 A;  4AUX A;  2QYO A;  2HGC A;  2Q1Z B;  2R93 J;  3HOZ J;  3OS2 A;  2X51 A;  3BT9 A;  3RKY A;  2DPU A;  1XD7 A;  2W25 A;  2H8W A;  4B47 A;  4HQE A;  4J00 A;  1ZRD A;  3OYF A;  4BGD A;  1GV5 A;  1VQ4 I;  1KQ9 A;  2HS5 A;  5EYR A;  4DJA A;  3JRF A;  2OA4 A;  3HEF A;  5D5W B;  2V7F A;  2RGV A;  3WTS C;  5AIP A;  3VWB A;  5HNH A;  3L00 A;  3RKW A;  3I58 A;  4ASN A;  2ZME C;  5K7H A;  1JGS A;  3I59 B;  5IP6 A;  3OYG A;  4IKF A;  3LSR A;  2JA5 J;  3DEE A;  2FBK A;  4RA2 A;  1IXR C;  1XSX A;  3L2U A;  3L9F A;  2MYS A;  2E1O A;  3F3X A;  3IH3 A;  2DFF A;  2FQ4 A;  3SFI A;  1IRF A;  1MZB A;  4EM1 A;  4PCQ A;  5GAH J;  3NAR A;  3ZGK A;  3NRV A;  2WAD A;  2X6W A;  4BE1 A;  4ZH4 F;  4M6V A;  2BY3 A;  2HU9 A;  5ILS A;  2COB A;  3KPH A;  4IEJ A;  5L3G A;  2ZJR F;  5IP9 J;  3DKW A;  3QYF A;  4RGX A;  4IOC F;  2PMH A;  5HDN A;  4IRH A;  4RLF A;  1FBU A;  1S7A A;  1FOX A;  2EZI A;  2X6X A;  4LB5 A;  5EGO B;  1TQP A;  1Y0N A;  2UV1 A;  2XRN A;  2E7X A;  2QKM B;  2XAH A;  3L7W A;  4FAS D;  4Y7N J;  3SJM A;  3IH4 A;  2H94 A;  2KP6 A;  3I64 A;  4S04 A;  4WF2 A;  2STW A;  1TQM A;  4LIU A;  3L2W A;  2OZU A;  4PGG A;  3CF5 F;  1HSJ A;  2DMQ A;  2WB1 N;  2RC4 A;  4JBA A;  5GAG J;  2JSP A;  5DCM B;  4PK4 A;  3EUA A;  3TP0 A;  3UR3 C;  1ZH5 A;  3BTL A;  1YQA A;  3DKX A;  1KU9 A;  3BRO A;  1DP7 P;  3P9K A;  1D5V A;  1W1W E;  5CYV A;  2UXX A;  4GFB A;  3ASO H;  2EQR A;  4KIG A;  1B1B A;  1S5L C;  1IG7 A;  1Q1H A;  4N4N B;  1LPQ A;  2XV4 S;  1BL0 A;  3M1E A;  4LK0 F;  5HLI A;  3R6S A;  4YIF A;  4CYC A;  4A3L J;  1U78 A;  2EZL A;  1CQT A;  3K4K A;  3NQO A;  1HDP A;  2HKO A;  3JCU C;  2W4S A;  4AC0 A;  4KN7 X;  1ULY A;  1LDJ A;  2V79 A;  3QWL A;  1T2K A;  3I4P A;  1A36 A;  3RI4 A;  4II3 A;  2VJ5 A;  3LMM A;  2FRH A;  2VAS A;  3BZ6 A;  3CJT B;  3V8J A;  5DUK A;  4D5F A;  1S6L A;  2CRG A;  2R7Q A;  3KYL A;  1SAX A;  3HOW J;  3HOX J;  1MGT A;  3FMS A;  1BC7 C;  3S1Q J;  2DK8 A;  1G3W A;  3MZH A;  2VON A;  3OYI A;  4WXD A;  1MW7 A;  2ZSI B;  3WE2 A;  5K1Y A;  1TT5 B;  1SAN A;  3J7Z I;  2EH3 A;  1U0J A;  3ML6 A;  3ZP5 A;  4AM3 A;  2X4H A;  2ZXH A;  3FXL A;  4P9F A;  5B1A H;  1YYV A;  2ELJ A;  4LIV A;  1WJC A;  2OTJ I;  2QSF X;  1RR8 C;  4OMZ A;  4BEH A;  1SD4 A;  3O2P E;  2LY2 A;  2MC3 A;  3CC7 I;  4I98 B;  4KIF A;  4UHT A;  1FBS A;  5HVQ C;  1ZAR A;  2ZJP F;  1X19 A;  5E79 C;  5JHU A;  2K5C A;  1LFU P;  1O3R A;  2H8R A;  2DOF A;  2IGO A;  4IQJ A;  1ZHF A;  3SQN A;  2KRH A;  4F3Q A;  3BG7 A;  1Y8Q B;  2XAG A;  1J75 A;  1NK3 P;  1UHW A;  4EAT A;  3CJQ B;  3D5S C;  1WKM A;  1JJ8 C;  5LGU A;  2DQR A;  3M8E A;  2E34 A;  3KZY A;  2VPL A;  3EPZ A;  4FX4 A;  2LY9 A;  4UB6 C;  1JKO C;  2LMD A;  2DT5 A;  1HLV A;  1ZTR A;  3MZ8 A;  2A6H F;  1YIJ I;  1XB4 A;  2QA4 I;  3T8R A;  1WRJ A;  3I0T A;  1G3S A;  1XGO A;  4A0X A;  1BJA A;  5ICF A;  1ZG5 A;  2E1M C;  4NC7 A;  1QZZ A;  3BWG A;  3JAM K;  2B9S A;  2KIF A;  3GTQ J;  1U3E M;  4A6D A;  4ESB A;  4OIP F;  2JTV A;  1HXD A;  1K78 A;  3OSF A;  3R0A A;  2DOE A;  1SFO J;  4PSX A;  2CO5 A;  4IF4 A;  1MMN A;  2A05 A;  2EIL H;  2QVO A;  1FMV A;  1JGG A;  4XK4 A;  2GXA A;  4L9N A;  3T1B A;  1YHQ I;  5DTD A;  1TQI A;  5J1R A;  2DYS H;  3K4N A;  4Q48 A;  1BI1 A;  5ICC A;  3AG2 H;  4M3B A;  4RB2 C;  1M1E B;  4I01 A;  1VF9 A;  4BQA A;  1YLF A;  2HDW A;  4UUV A;  2M5W A;  2DA3 A;  2DA5 A;  4HNV A;  3CD6 I;  4OAZ A;  3MAJ A;  4P1W A;  5K5Q A;  4HX8 A;  3KZI C;  5FRM A;  4Q5S F;  1YX5 A;  1JJ6 C;  3ZMS A;  4Z2Y A;  3R4K A;  2VBW A;  4K2E A;  1I50 J;  2K3P A;  1JHF A;  3CCE I;  3S3O A;  3RZO J;  5FLM J;  1FPQ A;  2VI6 A;  2BVM A;  3CCM I;  4C9Y A;  2Q8K A;  5K5R A;  2K86 A;  3CQZ J;  1OCR H;  5F0F A;  1FT9 A;  1MH4 A;  2E1M B;  4MLO A;  3CCL I;  3WTT C;  2UZK A;  2XIG A;  4M72 A;  2V1U A;  4JYK A;  3K1M A;  5E3O A;  3WTX C;  1OKR A;  1S9H A;  3OOP A;  1FEX A;  5E8I A;  4ENM A;  1YFH A;  1HKS A;  4BY7 J;  1U5T A;  2ZFU A;  5EZG A;  3SZG A;  2XAU A;  1W5S A;  1B72 A;  4B44 A;  4L5E A;  3GBG A;  4KJZ A;  3MEX A;  3TO9 A;  1ETQ A;  1MBK A;  3JW4 A;  3ECH A;  2CUJ A;  2KIS A;  2XAJ A;  2DJN A;  2I5U A;  4Z6Y A;  1A6Q A;  3L09 A;  3DEW A;  4KMF A;  2FUG 2;  4CA0 A;  1SD7 A;  2CU7 A;  4A3I J;  2X9D A;  1Z9C A;  5HLG A;  3M4O J;  3DU6 A;  1HOM A;  1ENH A;  3I59 A;  1TLH B;  4C30 A;  2DBB A;  2HWV A;  2M0C A;  5FFX A;  5F1J A;  3HRT A;  3JSP A;  5D6F A;  2F6C A;  2K85 A;  2OU2 A;  4LGW A;  1XMX A;  1T98 A;  1HC8 A;  4L0Y B;  3BG9 A;  3VEP A;  1TL8 A;  5FRN A;  2C6Y A;  1YO5 C;  1T0F A;  1RRJ A;  1MSF C;  3OWT A;  3KEY A;  1OPC A;  2HQ5 A;  5JI6 A;  1RI7 A;  3CZ6 A;  4PFO A;  4YFN F;  2M0M A;  2ECB A;  5CVV A;  3NWS A;  1ZQ3 P;  4XKV A;  1ETO A;  5FD5 A;  4YII A;  1MND A;  2K3F A;  2GIZ A;  3J81 K;  2E2H J;  2D45 A;  1REP C;  4XRF A;  2DXI A;  2A68 F;  2R7O A;  3SYT A;  2QEN A;  4CCL A;  1D8K A;  2TRT A;  1O4X A;  4YIR X;  1E3O C;  3BCA A;  1MBG A;  4PJL A;  1O3Q A;  2WAE A;  4XL9 A;  5EZH A;  3BJ6 A;  2BV6 A;  1QGP A;  2V9V A;  1EKE A;  5IOZ A;  5DM7 F;  2VE9 A;  2HVQ A;  3CME I;  2HXO A;  3B6A A;  2P7C B;  4KNY A;  1N78 A;  2RNG A;  1Z7U A;  2X1E A;  4WX9 A;  1BM9 A;  3BCB A;  3WHB A;  4ENJ A;  4BYY A;  1CF7 B;  3L2Q A;  4F55 A;  4B09 A;  3Q9S A;  4BBS J;  4BE0 A;  3T0Y A;  1W36 C;  2FNP A;  3HB9 A;  5E3L A;  1Z77 A;  1IV6 A;  4Y15 A;  2PMZ N;  2VKD A;  5H6R A;  2O9L A;  2E2J J;  1OYW A;  4BY1 J;  3J7A O;  2VN2 A;  1MKM A;  2VPR A;  1FTZ A;  1R23 A;  3CJN A;  5M5W J;  1JT6 A;  4BAY A;  3OYA A;  3E5X A;  1MNE A;  4QTR A;  2O8X A;  3GME A;  1Z0X A;  3KYD B;  3DU5 A;  2PI0 A;  2JMW A;  4ZYG A;  1X3U A;  3I4M J;  2IS2 A;  4BKX A;  4WXC A;  2WA0 A;  2Y31 A;  2KPM A;  5LD2 C;  4HF2 A;  2LLK A;  2XB0 X;  4XN0 A;  3HRM A;  3BTI A;  1KU7 A;  2HEO A;  3V7C A;  1WI3 A;  3WTZ A;  5FKN A;  2K9S A;  5HOD A;  2KHM A;  1AA7 A;  5KVR A;  3C2G A;  2MLG A;  3CTA A;  2L0K A;  2EFN A;  3K69 A;  3U2R A;  4Q4Z F;  4NNJ A;  2JRT A;  3EET A;  2WV0 A;  3TO7 A;  3JRE A;  3BZK A;  2WWY A;  4MTE A;  2YPR A;  3FX3 A;  3W6K B;  4XID A;  4IHT A;  3BDD A;  1S72 I;  4R79 A;  3CC4 I;  1EH6 A;  3QP6 A;  4WK8 F;  1QA6 A;  2HQA A;  2HTJ A;  1J09 A;  2LK2 A;  2LDU A;  2HOE A;  2QF7 A;  3EDP A;  3FM5 A;  3AFH A;  4M71 A;  3VOD A;  1LDD A;  4L9V A;  2MW8 A;  3ZQG A;  3IKT A;  4BEH B;  2JA8 J;  3S8P A;  3A03 A;  3MQ0 A;  2DMU A;  3QU3 A;  2UXN A;  3EYY A;  4GRI A;  3JRH A;  2CFO A;  2NVT J;  3E6D A;  2EV5 A;  5IYC J;  5CJ9 A;  1J5Y A;  1DQU A;  3LAP A;  2F4I A;  3FXK A;  4XKW A;  2HZD A;  1X1P A;  4PJ0 C;  2ZME A;  3KLO A;  3KP2 A;  4J01 A;  2XB5 A;  3HDD A;  1YW9 A;  5DM6 F;  1H88 C;  1WGX A;  4FT8 A;  2QSG X;  1ITY A;  1RIO H;  1E3H A;  3COA C;  4H0E A;  3K4C A;  1FY7 A;  2OZ6 A;  3I53 A;  4EEF G;  2KJC A;  5L3E A;  3K70 C;  2EBI A;  1GV2 A;  2OPT A;  4XLH A;  1YOV B;  1TZL A;  1HW2 A;  4F93 B;  1Z6R A;  5L3B A;  4UUS B;  4C2U A;  2JA2 A;  2Y0S A;  4LOC A;  4NBQ A;  5C3E J;  2CFX A;  1I1G A;  5F04 A;  3F6V A;  2F5D A;  3MN2 A;  5HLH A;  3ZQC A;  2LG4 A;  3RQI A;  3KZZ A;  2MAB A;  2EFQ A;  4PJM A;  1DUX C;  1R71 A;  3K4B A;  1R5G A;  2FML A;  2LVS A;  4UY8 I;  5C4X J;  2H6B A;  3ERE D;  2CG4 A;  3DPL C;  3ZMV A;  2V6E A;  2VQG A;  5BNG A;  1QHG A;  4Y33 A;  3HUG A;  2LH9 A;  5TRD A;  4XLN F;  3E97 A;  1PDN C;  2P8T A;  4E7Z A;  3OL3 A;  3MD2 A;  1YE9 A;  3F8M A;  1IW7 F;  2RQP A;  3JRB A;  3E7L A;  2E60 A;  3IAM 2;  3IHU A;  2X6Y A;  4I02 A;  2EIM H;  1WZ2 A;  3ABT A;  1YRN A;  2ESH A;  2V6C A;  3H9J A;  1NH3 A;  1K6Y A;  2HR3 A;  3HHG A;  1TNS A;  5C4J J;  1WSU A;  1K78 B;  2XKO A;  3BTJ A;  2A6T A;  4XBF A;  4FET A;  3FIW A;  1TNT A;  4MHG A;  3O3K A;  3K4M A;  4U7D A;  2FX0 A;  2XGE A;  1ON2 A;  1S3J A;  1WFX A;  3C3W A;  2BZT A;  5H2F C;  2Y69 H;  1IUY A;  4LK1 F;  3D5R C;  4MGR A;  4AWX B;  1MBJ A;  3CCR I;  5LEK A;  1ETK A;  5BS6 A;  4N9H A;  2RVC A;  2LOO A;  1WJE A;  1LVA A;  1X2N A;  3JRI A;  2EIN H;  2F4M B;  2MA3 A;  2VJ4 A;  1RES A;  4M3E A;  4EJW A;  1N77 A;  4KT6 A;  3RDI A;  2CQX A;  3S1N J;  1J9I A;  2X1C A;  1Z21 A;  5JFR A;  2Y48 A;  2W00 A;  4B8X A;  4IHV A;  1E2X A;  2L7M P;  2VKH A;  4DBR A;  3FXU A;  4DW6 A;  1FZP B;  3HJE A;  4G7O F;  3I55 I;  3P7N A;  1AU7 A;  3FKJ A;  3HM5 A;  3MVP A;  1GVD A;  4MEX F;  5KAI C;  3GFI A;  4M3G A;  3Q9V A;  5ERI A;  4CXF A;  2R5Y A;  1D3Y A;  1VQL I;  4A3M J;  2JSC A;  3ZMZ A;  4YRV A;  2HOT A;  4R1H A;  1WCM J;  2LKS A;  3U21 A;  4D9J A;  2V26 A;  3SFZ A;  1RNL A;  2P0W A;  3X2Q H;  4FIS A;  4D7N A;  5F0H A;  2IGK A;  2R7U A;  4HDU A;  1ZKG A;  4CYC B;  1MH3 A;  2LNB A;  1OMI A;  2GQQ A;  5E18 F;  4HX7 A;  1G6N A;  1JHH A;  1TW3 A;  4RGU A;  4BJ6 C;  3U1D A;  3S14 J;  3P5J A;  2WAF A;  5JHF A;  1WJA A;  5E3N A;  4I09 A;  3H5N A;  1YJ9 I;  1G3T A;  4MFE A;  3ZOB A;  2M4K A;  3QYE A;  3L2R A;  2XSD C;  1HKQ A;  5IP7 J;  4I0B A;  1XDU A;  2DA6 A;  3HSE A;  3M7G A;  1I39 A;  1ZG1 A;  3QRF F;  2ELK A;  2OF7 A;  1MJB A;  2JVG A;  1KON A;  4C2T A;  4LG0 A;  5EDN A;  1Y39 A;  4X6A J;  2XAF A;  2O7O A;  4F91 B;  5JLX A;  3N05 A;  3OOU A;  4A5M A;  3ZQL A;  1BIA A;  2EV6 A;  3E5Q A;  1B72 B;  2K9M A;  5CPR B;  3ABK H;  1R6R A;  5E17 F;  5IYD J;  2ZC2 A;  1FOK A;  3S1M J;  4IHX A;  2PJP A;  1ON1 A;  4EVI A;  5M5Y J;  3HOY J;  3SHF A;  4XQF A;  4IHS A;  1FSH A;  1R1U A;  1VND A;  3PNV A;  1LDK B;  3C1D A;  2VJI A;  2XRL A;  2QQB A;  3IRR A;  2Z33 A;  3Q0U A;  5J3L A;  3I4N J;  1X1B A;  3E5U A;  5E1X A;  2M1B A;  3EQL F;  2R92 J;  3T5X A;  2LRD A;  2R7R A;  1R49 A;  1VQP I;  2ID6 A;  4D5C A;  1TBX A;  3H3V K;  3ZQF A;  2LC2 A;  1JXS A;  1FYK A;  3DKY A;  2QLZ A;  5J8F A;  3H0D A;  3CUO A;  5FKM A;  3REO A;  2CGP A;  3K4L A;  1JKP C;  3DBR B;  4UV8 A;  2CMP A;  4V19 K;  1JTX A;  3OS0 A;  3CO6 C;  1VQ8 I;  3ZPL A;  4DQ2 A;  3BG3 A;  2V9P A;  3HHH A;  2PMU A;  3HRU A;  2ZFW A;  5KAF C;  4QIW N;  2DA2 A;  4V2G A;  1HDD C;  3KLN A;  2NVU B;  1T08 B;  1VTN C;  3AL0 B;  3S15 J;  3QPT A;  2CUZ A;  4HG2 A;  2LR8 A;  1T0F C;  2AXL A;  1SFE A;  1X3W B;  5L3D A;  3LSH A;  2L54 A;  1IDZ A;  1Z3Y A;  2M4G A;  1P4A A;  3FK7 A;  2M2E A;  3MWM A;  2HVS A;  2HYF A;  3AG4 H;  2RNJ A;  2NVY J;  5L3F A;  2HYJ A;  4I76 A;  2LBF B;  3SDG A;  4MQV A;  1UAA A;  2NAZ A;  2E71 A;  1BI0 A;  2EIJ H;  1XG1 A;  3NWT A;  2EIK H;  3ZCO A;  1XPX A;  2O61 A;  2Z1D A;  2FBI A;  2JUC A;  2XF5 A;  2W84 A;  3HOS A;  1R5I D;  3WTY C;  2PFB A;  5BPD A;  3O6B B;  5F64 A;  1ZGA A;  4RAZ A;  5FO5 A;  4UVA A;  1V5E A;  4JOM A;  2IP2 A;  2NYX A;  1GVJ A;  2F5E A;  4BHC A;  3LSI A;  1LQ1 A;  5FLV A;  2QSH X;  1WH5 A;  1RR7 A;  2M7B A;  5A2Q Z;  1W7P D;  2NVQ J;  2JRM A;  3GTM J;  3HSR A;  3SEQ A;  2VOP A;  1GUU A;  1SFX A;  2ECC A;  2OBP A;  2WC2 A;  5D5V B;  4M3F A;  2Q0O A;  1APL C;  1XS9 A;  5DD4 A;  5DD8 A;  1B8I B;  2BXZ A;  2NS8 A;  1F36 A;  2HPM A;  3Q3S A;  4UUT A;  3FM3 A;  3B73 A;  3VB2 A;  3KEQ A;  1ERD A;  2G0E A;  1ONV A;  5D4S A;  2DPD A;  1OFC X;  1UB9 A;  1ZRE A;  4MIM A;  2KKO A;  2MD0 A;  4KUM A;  1IN7 A;  3BTC A;  5DS9 A;  4M9S A;  4RB1 A;  4A3K J;  1XSD A;  4ITV A;  3V7S A;  3MKY B;  5JLW A;  4B43 A;  2AHQ A;  2M87 A;  3VSK A;  1XX5 A;  2X1D A;  3JAM Z;  3JRC A;  4L9T A;  4D0P A;  1E17 A;  4IO9 F;  3K6G A;  1V5G A;  1SC7 A;  5CQE A;  5HOO A;  3LFU A;  2FD5 A;  1HW5 A;  2EWN A;  2EK5 A;  3QPH A;  4NUB A;  5HS8 A;  4QSH A;  2FJ1 A;  2PEX A;  1K61 A;  1IJW C;  2GXB A;  2L01 A;  2L7Z A;  1O3T A;  1X58 A;  1T8I A;  2ZNY A;  1BW5 A;  1U8R A;  4ANJ A;  2Y2Z A;  3PUF A;  1LVK A;  2BBY A;  1KU2 A;  3HTU A;  2Y30 A;  2IJL A;  2OQG A;  2HFH A;  3TED A;  4AVZ A;  2ADU A;  3HC7 A;  1F1Z A;  2L3D A;  4ZDO A;  1L0O C;  2OCC H;  2HPI A;  3F22 A;  1XTA A;  1TWG J;  3FHZ A;  2Q2E B;  4FE4 A;  4PJN A;  2HTS A;  2K9Q A;  1KYZ A;  2BHY A;  4WCG A;  1YW8 A;  3M1C A;  2W24 A;  3R61 A;  5C44 J;  3ERM A;  2CH0 A;  3ZR8 X;  3HUG B;  3MZY A;  4BHB A;  3MKZ A;  4M73 A;  4ZYH A;  2M7A A;  5KNL A;  2JWT A;  3CUQ A;  2DYR H;  1FP2 A;  1S8N A;  2O5R A;  3A01 A;  1SVL A;  1MMD A;  5H20 A;  2QEX I;  4KIS A;  2LSO A;  2X48 A;  2OC6 A;  5B66 C;  4AU7 A;  2ZO4 A;  5B5E C;  1F43 A;  5LFA A;  2RN7 A;  3S17 J;  2KZG A;  4XSZ F;  1OYY A;  1VQK I;  1XGN A;  4CZZ A;  1T33 A;  1UJ8 A;  2ISZ A;  4HX4 A;  5CQG A;  3S2H J;  5A2Q K;  1P9Q C;  2VOD A;  2W48 A;  3OYD A;  3S3M A;  2L02 A;  2OUM A;  5F0C A;  2K4J A;  3LSG A;  3WGH A;  2F5F A;  2XKP A;  1IN4 A;  4L0Z B;  1Y56 A;  2R7S A;  1SFK A;  4C3I J;  1ACI A;  4OWR B;  1U9O A;  2F5C A;  1SEU A;  3OYJ A;  3LA3 A;  5AIQ A;  3ZQQ A;  4UNO A;  2X85 A;  2O03 A;  1VQ7 I;  3GTO J;  4I7H A;  3GF2 A;  1I27 A;  4RM3 A;  2P5V A;  3G1O A;  3ZN1 A;  5IY5 H;  1T56 A;  2JPC A;  1LB2 A;  1SVM A;  2KQR A;  3DCF A;  2O3F A;  3WOD F;  2FSW A;  2B7E A;  4BQO A;  3VPR A;  4F92 B;  2ZXJ A;  2GA1 A;  3H5A A;  2FBH A;  3F8B A;  3LSM A;  4N0B A;  4D1Q A;  3IP4 B;  4FX0 A;  2DMT A;  5LLQ A;  2PQ8 A;  2VBX A;  5LHG A;  2EFP A;  3OYC A;  3C2B A;  4NQW B;  1X2M A;  2M3A A;  4BJ5 C;  2V1N A;  2LP0 A;  4MFD A;  4QWQ A;  1UFM A;  1ZN2 A;  1GDT A;  3HRS A;  3H3U A;  1ODD A;  3E6C C;  4L5I A;  2NS0 A;  5LEJ A;  2B63 J;  1GXQ A;  3H9G A;  5LHI A;  5KK1 A;  4A0Y A;  4MTD A;  3K10 A;  2Y75 A;  5FLX K;  2FMY A;  2DOD A;  1I6H J;  3HTS B;  4HF0 A;  4EV0 A;  3S93 A;  1SFU A;  3SEZ A;  5HS7 A;  1NTC A;  2R5Y B;  2VC1 A;  2R7Z J;  3EUH A;  3WTW C;  2XPW A;  4LLN A;  2PMZ A;  1FYM A;  1OYI A;  1LE8 A;  2DA4 A;  5GP9 A;  1XMA A;  3PM1 A;  1PP8 F;  1FSE A;  4XKB A;  4ESF A;  4A93 J;  3I9V 2;  4KIC A;  5J4V A;  5FB2 A;  4AVP A;  4EJU A;  1F4K A;  2HXI A;  2DMP A;  2BY0 A;  2MLK A;  1WJB A;  3D5L A;  4G6D A;  2FOK A;  2KIQ A;  2LKX A;  3OYN A;  3GX4 X;  1YRN B;  1VZ0 A;  2QQA A;  4RS8 A;  4F7Z A;  1QPM A;  3HL2 A;  1BA5 A;  3RPQ A;  1QRY A;  1JUP A;  4HF1 A;  4IHY A;  1GT0 C;  4JX5 A;  1RUO A;  3S32 A;  3QQA A;  4CCO A;  3E3V A;  5GPA A;  1NG6 A;  3TMO A;  4MEY F;  5J40 A;  4BS9 A;  3CCU I;  2QZ8 A;  3DTK A;  2Y9Z A;  3PQK A;  2VQC A;  3DTE A;  3HKZ N;  2FF4 A;  1V5F A;  1ETW A;  1TTY A;  5ED4 A;  4AIK A;  4CCJ A;  4E7I A;  1IGN A;  1HCR A;  1IRG A;  4F52 A;  5J1Y A;  3EYI A;  2GAU A;  5DEQ A;  3KX2 A;  3T8T A;  3TDZ C;  3PJR A;  3BPX A;  4KDP A;  4II2 A;  4PUS A;  4D7M A;  1I1S A;  2HVR A;  3G2B A;  3IC7 A;  5J47 A;  2P6T A;  1PUF B;  2QQ8 A;  3B02 A;  5K5O A;  5M3F J;  5CVR A;  4A3G J;  3LOC A;  4EJV A;  2QWW A;  3HSF A;  2ZCW A;  4B1R A;  3KFW X;  4CCM A;  4PJJ A;  3PSI A;  1BJZ A;  2DQL A;  1I5Z A;  2L9S A;  1Q1V A;  1UG0 A;  2BEO A;  4DYR A;  5HDK A;  3ESW B;  2DU9 A;  2F4O B;  3PUB A;  5DCF A;  3WE3 A;  1ORK A;  3DLA A;  3JTH A;  3F21 A;  4ZYA A;  3BR1 A;  1TWH J;  3VYU B;  5K7Z A;  4JX4 A;  3A1Y A;  1B59 A;  2CQN A;  1VQ9 I;  2DLL A;  4ZDL A;  2A5W A;  1SD6 A;  5KHD A;  4WWC A;  2LF8 A;  2GXG A;  1YIO A;  1KQ8 A;  2A07 F;  3PNT A;  1W36 D;  4N4O B;  3O8G A;  3SZP A;  1MDM A;  1VFC A;  4HZF A;  4XOP A;  3ZQH A;  1E3P A;  2UWM A;  4RAF A;  1DGR M;  3ZQI A;  4IQ4 A;  4ETS A;  1BN5 A;  4BXX J;  3BOQ A;  3BR6 A;  2DK5 A;  5HLT A;  4M6Y A;  2D1H A;  2HQR A;  4EGZ A;  1IZ1 A;  3CDL A;  3ABU A;  2Z9O A;  3CJR B;  2JQ7 A;  2ZNZ A;  4B3A A;  1EJ9 A;  5FKO A;  3R0J A;  5D8K B;  3OYM A;  4BQQ A;  1OLT A;  2E1N A;  2BHZ A;  1U9N A;  1B6A A;  2Y0S N;  2H1K A;  1XC5 A;  4UUS A;  3A02 A;  2EFO A;  4AYB N;  3PSF A;  4BDZ A;  4ZC3 A;  2L9R A;  4N9I A;  3RYP A;  1UZC A;  1H9G A;  2LTP A;  4FHT A;  1VQ5 I;  2M34 A;  4GGG A;  2R7D A;  1ZLJ A;  1VI0 A;  1UHM A;  1D0X A;  3OYE A;  4EGY A;  2MH2 A;  4XIC A;  4XOT A;  3AKZ A;  2HNH A;  1FTT A;  1F9N A;  4KIB A;  2ME6 A;  3S2D J;  4IPA A;  3M9A A;  4G9Y A;  1I3A A;  4XLF A;  1B9M A;  5EEH A;  1H9T A;  1U6G A;  1QZE A;  5BQT A;  1B8I A;  2D2W A;  1FLI A;  2CW8 A;  2K9L A;  5ILU A;  4C2M J;  3LQR A;  5EEG A;  4A12 A;  3DPT A;  2A3S A;  1SMY F;  4HLY A;  2UUZ A;  4M9X A;  1TWA J;  3F6O A;  3DFG A;  4G7H F;  2O8K A;  1IRZ A;  4BDY A;  1OCC H;  3GTJ J;  2IS4 A;  2XAQ A;  3CUQ C;  3VYR B;  2ME0 A;  4A3D J;  1R58 A;  5DUI A;  4U0W A;  4XR6 A;  2VKV A;  3GFM A;  2JJ7 A;  2DAO A;  1H89 C;  2L2O A;  3QOD A;  2K7L A;  2HOA A;  4U0V A;  4XRS A;  5DCM A;  2E2I J;  5ICE A;  1PP7 U;  1IXC A;  1HKT A;  2MSY A;  3S3N A;  2FE3 A;  3DV8 A;  3F8F A;  2HDC A;  1IUF A;  2O6G E;  3PL8 A;  1UCR A;  2P4W A;  2IGN A;  2GBY A;  3GVA A;  2GIV A;  2W85 A;  1TP4 A;  1B9N A;  2EZH A;  5ICG A;  3Q0V A;  4OMY A;  2A6E F;  2EZK A;  3E0J B;  4I6Z A;  1MD0 A;  3GZN B;  4B3X A;  4HYE A;  4XLP F;  1ZR2 A;  2KJB A;  1A35 A;  4FCY A;  3QP5 A;  3CCJ I;  1RET A;  2BGC A;  3H1C A;  3TKY A;  1ZR4 A;  3ULQ B;  1ZK8 A;  4W97 A;  2YSR A;  1RUN A;  4L5J A;  4Q47 A;  2HOS A;  2IGM A;  5E1Z B;  1LJ9 A;  4KT5 C;  1TWC J;  5GAE J;  3FZV A;  3KYC B;  1UEL B;  2STT A;  2KRC A;  2CW7 A;  3LSJ A;  4M3D A;  3TP3 A;  5AON A;  1LEB A;  1WJ5 A;  1MDM B;  3SDB A;  4A3J J;  2E35 A;  2I10 A;  3HPH A;  3QAH A;  4CCN A;  4XLE A;  3Q5F A;  3FMQ A;  1F5T A;  1D5Y A;  5BMZ A;  5E3M A;  1IC8 A;  2H1L A;  2XPV A;  1W7P A;  2NVX J;  4U0Y A;  1OCT C;  3QOE A;  3RTR A;  2WY8 Q;  2EFW A;  4G8X A;  3ABL H;  1J0R A;  1DDN A;  2HDD A;  2ZJ2 A;  3OIP A;  1TT0 A;  5CVJ A;  2RDP A;  4B48 A;  2DCE A;  3ZN0 A;  5IYB J;  3H5R A;  2ZKZ A;  4GDF A;  1WVR A;  3H9Q A;  3RPU D;  4M6X A;  4LD5 A;  1ZLK A;  1PVE A;  2VOO A;  3KP4 A;  4PFP A;  4HBL A;  5K7F A;  2EA4 A;  4EQQ A;  1J7K A;  1YJN I;  1IAW A;  1FYL A;  4G94 A;  2LKP A;  1AKH A;  4KN4 X;  4L9J A;  2DFH A;  5LRR A;  1KGS A;  5FLX Z;  4NC8 A;  3GW2 A;  3MCZ A;  2WAQ N;  1HW1 A;  4BE2 A;  1BR4 A;  3H0G J;  1LNW A;  4ZTF A;  1N25 A;  3FXQ A;  4G12 A;  4PSW A;  4ON0 A;  4E7K A;  2MBF A;  1HA8 A;  2QKL B;  1Z05 A;  1ZGW A;  2XSJ C;  2VB6 A;  1R36 A;  2DDB A;  1MJ9 A;  4OAY A;  2QBY B;  2K02 A;  5TGT A;  3CCV I;  3TW6 A;  4YG2 F;  2JUG A;  3H36 A;  4HLX A;  4C3J J;  4HSR A;  1I6X A;  3DP7 A;  5GAD J;  3L2C A;  1O57 A;  3RKX A;  2Y9Y A;  3FF5 A;  2CV2 A;  1XMK A;  3AG1 H;  6PAX A;  3CO7 C;  1G2H A;  3CCQ I;  4OU0 A;  3N4M A;  1XGS A;  3N97 A;  3IL2 A;  2VBZ A;  1HST A;  1V55 H;  3ONQ A;  3UNG C;  2RQQ A;  4PGH A;  1D8J A;  2XDV A;  3VFZ A;  3NAU A;  4A69 C;  4BU2 A;  2R3S A;  1AKH B;  1QO0 D;  1JTY A;  1STZ A;  1OR7 C;  1WHU A;  2BY2 A;  3FHN A;  3IAS 2;  3LFK A;  2OCE A;  3OIO A;  4V2F A;  1A31 A;  3FIS A;  3BC8 A;  1YW7 A;  3QPL A;  4HAM A;  2DT7 B;  1JE8 A;  5D5X B;  1I3Q J;  1FOY A;  3K2A A;  3PO2 J;  2G7U A;  4LMY A;  2CQ7 A;  4E7L A;  2QM3 A;  4XRM A;  3HGY A;  3JSO A;  4PZJ A;  2YX7 A;  2AQE A;  3TGN A;  4MO7 A;  3K70 D;  4QLC U;  1OCZ H;  2DTR A;  4S05 A;  4UVC A;  1QVT A;  5E8G A;  2G9W A;  4DYQ A;  2LYC A;  1SVO A;  3OYB A;  3HOU J;  2ZJQ F;  4GO1 A;  4DIQ A;  2LFB A;  2AS5 F;  2J5O A;  5E20 A;  2MH9 A;  4NB5 A;  4RGR A;  4P5O A;  3PFY A;  3HZJ A;  1LKX A;  5GTH C;  2BW3 B;  3BP8 A;  4CUG A;  5BOX A;  2GOX B;  1IN8 A;  4O6J A;  1P4W A;  3OYL A;  4MQ9 F;  3MFK A;  1UMQ A;  3M07 A;  2W57 A;  4HQM A;  1YI2 I;  1H0M A;  4BQN A;  2W7N A;  1KZH A;  2R7X A;  2CYY A;  1WPK A;  2FEZ A;  2L5Q A;  1RC9 A;  2IXS A;  1QNT A;  5CVU A;  4X0G A;  2ID3 A;  2BW3 A;  2X0L A;  4RAY A;  1GXP A;  3P9C A;  2DFI A;  3OYK A;  2YR2 A;  3DEU A;  4DYC A;  4HOB A;  4S0H B;  1QPI A;  4XMY A;  4LB6 B;  4QPO A;  4O3M A;  5E1W A;  2P81 A;  3M8F A;  1POG A;  2ELH A;  1MMS A;  1KU3 A;  1L3L A;  1S29 A;  4CIC A;  4EM2 A;  3G71 I;  4Y52 J;  3ZXS A;  5LGN A;  4OIN F;  5GTI C;  3RJP A;  3VDX A;  3GZ5 A;  3S16 J;  2VT3 A;  2KIM A;  3LSK A;  4Y3O A;  3JRA A;  2CJJ A;  4OIQ F;  1GLN A;  1V4R A;  1BOA A;  1GHC A;  4X1E A;  3CUQ B;  3W2W A;  1DU0 A;  3WTV C;  4XON A;  2H27 A;  4NQW A;  5F08 A;  2EPF A;  3WU0 A;  4A3B J;  3CLO A;  1R4N B;  1IXS B;  2COM A;  3EUK L;  1FWZ A;  5IOY A;  2RAE A;  3LA2 A;  2MFZ A;  2JN6 A;  2O0Y A;  4KA4 A;  1LFP A;  2OAZ A;  1PUE E;  1BOB A;  3V4G A;  5BPI A;  3CP2 A;  1NHA A;  2YUS A;  3FMR A;  1VQO I;  1ZG3 A;  3CP8 A;  3JRD A;  2CV1 A;  2PX9 A;  3PIO F;  4HA8 A;  2DTZ A;  4EM0 B;  2R5Z A;  1DGW Y;  2IAI A;  2TCT A;  2KMU A;  3BQY A;  4RB3 C;  4YFK F;  1V3F A;  3V42 A;  4RM2 A;  1HBX G;  4HST A;  1LFB A;  1K4T A;  1R7J A;  5EF6 A;  1MSE C;  1R4M B;  3CDH A;  4NC6 A;  3L2V A;  1SD5 A;  2R7V A;  1MBF A;  3WHC A;  3E1S A;  3SZT A;  2J5P A;  2HYG D;  2KLO A;  1U5T B;  1P7I A;  3HBL A;  2X6O A;  4MNU A;  4CH7 A;  1EA3 A;  2NRA C;  3FDY A;  4RGS A;  2IEK A;  4TV7 A;  3LNQ A;  2H6C A;  2D1V A;  2FNA A;  2CV0 A;  4M74 A;  4FTH A;  1ETX A;  5HS9 A;  1FC3 A;  1XGM A;  2XRO A;  4H4K C;  5JVG F;  3QPS A;  1G3Y A;  1NK2 P;  2YU9 J;  4A3C J;  3K1P A;  2DI3 A;  4RAG A;  2QGU A;  3ISP A;  5L3C A;  3VOE A;  2E7W A;  3A2K A;  3P9I A;  2E1C A;  1MIJ A;  3TQN A;  2KRF A;  1AOY A;  1FNN A;  5B3S H;  3J7A Y;  5IT9 Z;  3KIO A;  4DGW B;  4ABZ A;  2HQN A;  1K4S A;  1S7E A;  2VXZ A;  3TO6 A;  4QPQ A;  3W6J B;  2IW5 A;  1QU3 A;  5GPC A;  3K0L A;  4G6T B;  3J7Y J;  1FJL A;  2OV7 A;  3GTG J;  1K7A A;  3A01 B;  2ZXI A;  3LA7 A;  1Z7L A;  4OIR F;  4YFX F;  4HNT A;  2LY1 A;  2MG4 A;  4JK1 X;  3GFL A;  2RKH A;  2XGD A;  4WXH A;  1BIB A;  1P2F A;  3FXO A;  2DDA A;  3K9T A;  4E4H A;  4U7B A;  2R0Q C;  2GLO A;  3B6C A;  3CC2 I;  4RMN A;  2BXY A;  3KCC A;  3HG9 A;  4LLL A;  5M3M J;  2F2E A;  3TW7 A;  3FXR A;  3ABM H;  4CCK A;  3DPU A;  4A3F J;  2AXT C;  3DBL B;  1JKR C;  1WJD A;  3OR2 C;  4IOA F;  5EGO A;  1IDY A;  3ROU A;  1S7O A;  2YS9 A;  1SAU A;  2Z99 A;  3I71 A;  3KP6 A;  4E6K G;  4UV9 A;  5FFZ A;  2Z3Y A;  2KL4 A;  2M9H A;  2OJE D;  2IVM A;  1G8X A;  3GLX A;  5TJJ A;  1W5T A;  1EV7 A;  2VC0 A;  2DFE A;  1MBE A;  2ICW G;  5FKL A;  4E7J A;  2CUF A;  2RRE A;  4XLC A;  2DJI A;  4BXF A;  2WB1 A;  2XUB A;  3RKQ A;  2XC7 A;  4M9Z A;  1ZRF A;  1V54 H;  2ZB9 A;  4XSX F;  2E36 A;  1ZYR F;  1OIS A;  1A04 A;  3GTK J;  5D8L B;  1T6S A;  1UHS A;  2VE8 A;  4EMS A;  3V8L A;  1FMW A;  3U1K A;  3PIP F;  5F27 A;  4YEL A;  4J19 A;  2OQR A;  3KEO A;  1BR1 A;  5JR3 A;  3K1N A;  4CDG A;  4IRI A;  2ZBK A;  5M5X J;  5EEA A;  2R7T A;  5LBQ A;  1WH7 A;  3LAJ A;  2L4M A;  2WBM A;  1BC8 C;  5LHH A;  4HW0 A;  3CCS I;  3GEZ A;  1LE8 B;  5CVI A;  4DZJ A;  1Y0U A;  1WQ2 A;  4XLA A;  5B1B H;  2N8G A;  1EF4 A;  3S2W A;  3CMY A;  2Z5U A;  2YU3 A;  3K2Z A;  4UVB A;  4CSW A;  3V7R A;  3I54 A;  4JQF A;  2Z16 A;  3J81 Z;  1OQY A;  4KMU X;  5JVT A;  4I99 C;  4LLG F;  3MMY B;  1KYW A;  5D4R A;  2EA2 A;  2CQQ A;  1X1C A;  1FIP A;  3KP3 A;  3OS1 A;  5FD6 A;  3C18 A;  3E6M A;  3HKZ A;  3IRQ A;  1AHD P;  2L9N A;  1XN7 A;  2Y0M A;  2XGX A;  4B4C A;  5H6Q A;  4RDU A;  2IRF G;  1KA8 A;  2HI3 A;  3OYH A;  3DTI A;  2G7H A;  4XKC A;  3ZRG A;  2I8D A;  3G3Z A;  3OY9 A;  3OIQ A;  2WY7 Q;  2K40 A;  1MNM C;  2Z2S B;  1W0T A;  2W1O A;  5LGT A;  3WGI A;  2PN6 A;  4YEJ A;  2AO9 A;  1IO2 A;  3AG3 H;  5J8C A;  3CCY A;  3RQ4 A;  5LRS A;  3DF8 A;  1OR7 A;  1X1A A;  3IV5 A;  2KDZ A;  5TIS C;  4HV5 A;  1T39 A;  1T95 A;  3TL4 X;  3FWE A;  1BR2 A;  3QOP A;  2CWE A;  2EV0 A;  2XHK A;  3V8K A;  1R9T J;  2DN0 A;  4RBO A;  4JX6 A;  3DLL F;  2JVH A;  3HYI A;  2NS7 A;  4A0Z A;  4E7H A;  3IWF A;  2PJR A;  4LIT A;  2NOG A;  2FA5 A;  2TDX A;  1BI2 A;  1LUJ B;  2BOL A;  4Y17 A;  3SXY A;  4GYI A;  2M8G X;  1G59 A;  5FJ8 J;  3CMM A;  4G6Q A;  1EH8 A;  2IA0 A;  1J2X A;  4L18 B;  1CF7 A;  2CUE A;  4ZDP A;  4AIH A;  2P6S A;  2L9V A;  5D6E A;  3LWF A;  1D1C A;  2PJR B;  3BPV A;  3MKW B;  1D0Z A;  1H8A C;  3H3Z A;  4BH9 A;  1VQM I;  3RYR A;  3I3L A;  4ZTJ A;  2Q2E A;  2GA2 A;  3J80 K;  4AYB A;  1ETV A;  4GXO A;  2VT2 A;  4G7Z F;  4DNC A;  2CS3 A;  5FGM A;  2WTE A;  4RLQ A;  3KE2 A;  2MGQ A;  1X3Z B;  4E70 A;  1J59 A;  3EUH C;  3GCM A;  2M30 A;  2ZME B;  4HRI A;  3AAF A;  2KT0 A;  3ECO A;  4A2U A;  1ZAO A;  3G73 A;  2XAS A;  2VL8 A;  3CF2 A;  3O8H A;  3A4C A;  4UB8 C;  3BR2 A;  2WV1 A;  5DV5 A;  1JI8 A;  3BJO A;  2BY1 A;  3C7J A;  3A0H C;  2VXD A;  1U2W A;  4ENK A;  3CDI A;  2W82 A;  2CW0 F;  3WGG A;  1RZ4 A;  4C3H J;  3FKI J;  1WWX A;  2VKE A;  5D5U B;  1W7P B;  3S1R J;  3AL0 C;  3LL7 A;  1IN6 A;  1SMT A;  2GWR A;  3F23 A;  4DZP A;  2CQK A;  3DQV C;  2GZW A;  3OMY A;  2ISY A;  3BY6 A;  5FKK A;  1OJL A;  4CZC A;  1R22 A;  2MC4 A;  1D0Y A;  1BI3 A;  1BW6 A;  2IA1 A;  5HDG A;  4ESJ A;  2EB7 A;  3DXJ F;  1Y1W J;  1OCO H;  2A69 F;  4R8H A;  3OL4 A;  2IS1 A;  1R1V A;  3OV8 A;  3OR1 C;  3IUO A;  2JT1 A;  3W6V A;  4ENN A;  4EJO A;  2EJR A;  2KIU A;  4KIT B;  1MMG A;  3H35 A;  2P7V B;  4U87 A;  5FRO A;  2K9N A;  4HEA 2;  2ETH A;  4P96 A;  2BVL A;  4BAC A;  3G1M A;  2KFD A;  2PLY A;  3GWZ A;  4AID A;  2FQ3 A;  1XCB A;  3WU2 C;  2D5V A;  1A5J A;  2XVC A;  1XDS A;  1Z1D A;  1FP1 D;  1PUF A;  1WI9 A;  2R7F A;  1YJW I;  4HV6 A;  3D1N I;  5J1U A;  2VBY A;  2QUF A;  3I5U A;  5CKT A;  1R1T A;  1YTY A;  4CYD A;  4OOI A;  3Q0W A;  4IXA A;  2LBF A;  4IL6 C;  5EG0 A;  3KP5 A;  4ZYD A;  4XNF A;  1RKW A;  4KFC A;  2K27 A;  4BJT A;  2M8E A;  3RIR A;  2ACJ A;  1VQN I;  3QYB A;  2QQ9 A;  3GLL A;  2NNN A;  4IRG A;  3BR5 A;  3F8C A;  4HNU A;  3W3C A;  3H92 A;  3LSP A;  3FBN B;  2V4J C;  3TOB A;  1VQ6 I;  2FOW A;  4AIJ A;  3HPG A;  4LJZ F;  3PQJ A;  1A6I A;  1B4A A;  2XPU A;  5EG0 B;  5IPA A;  2ZSH B;  5F6F A;  3F0C A;  3ASN H;  3K7A J;  4DOZ A;  3G4S I;  3ZMD A;  1Z91 A;  1MBH A;  4HPQ A;  5DDG A;  2V9K A;  1QQI A;  4XOR A;  4XRS G;  4ZZL A;  4NHJ A;  1ETY A;  1X4P A;  4I2O A;  4CHU A;  1Y8R B;  2DA7 A;  3BQZ A;  3CLQ A;  3WG7 H;  3BG6 A;  1YG2 A;  4P9U A;  4OIO F;  4EJT A;  2PG4 A;  2ESN A;  5ILV A;  3R60 A;  1YIT I;  3HIF A;  4ZYE A;  1DPU A;  2E5N A;  3LQQ A;  1USS A;  4AD9 A;  2WAQ A;  1N75 A;  2BYV E;  3PFI A;  1IN5 A;  2L7F P;  2DW4 A;  1G4D A;  1RPW A;  3DWL E;  3QU6 A;  1R00 A;  2VUM J;  1TWF J;  1QBJ A;  4GCV A;  3VYT B;  9ANT A;  3BZC A;  2ZXW H;  3RSN A;  2JA7 J;  2OD5 A;  3GXO A;  3G6E I;  2P5L C;  2PBI A;  1O7L A;  1YS6 A;  2FXA A;  4IJA A;  1P4X A;  2JA6 J;  4U88 A;  4BUP A;  1HF0 A;  1Z3X A;  3PO3 J;  3VSL A;  4A3E J;  3BR3 A;  4IZZ A;  1U8B A;  2VQH A;  4LG3 A;  3W2V A;  3RPU A;  1C0W A;  2BE5 F;  1MJA A;  3FBI B;  3M8J A;  1HQC A;  1XSV A;  1X1D A;  2P5K A;  5HNF A;  3FK6 A;  4IVN A;  1Z67 A;  3CES A;  4UXN A;  2RV8 A;  5DYM A;  2LF7 A;  2JZY A;  4W1U A;  1FBQ A;  2AQF A;  4ZZD A;  4RB0 A;  3E6B A;  1Y6I A;  1WJF A;  2L7K A;  3ZMU A;  1AWC A;  4IHW A;  2GOM A;  4GYG A;  4LFU A;  2HZT A;  2XF7 A;  2VIX A;  5F1R A;  2LD5 A;  1YS7 A;  2A61 A;  1D1B A;  4ZJZ A;  3BG5 A;  2F48 A;  2IA2 A;  2NXN B;  1JUM A;  3D0S A;  3FXJ A;  2DO7 A;  1CGP A;  4HDV A;  4Y4R A;  1LEA A;  1FIA A;  1FOW A;  1RKT A;  4FQG A;  3F9K A;  4A6E A;  2HKX A;  2KDO A;  5IT9 K;  2DMN A;  5IT3 A;  4DBQ A;  2V1X A;  2NOJ B;  4JP0 A;  1Z6T A;  2VQL A;  3ZMT A;  2R5Z B;  3RZD J;  1ZEL A;  3GZ6 A;  2L4A A;  1QVU A;  1JUS A;  4A5N A;  3GUD A;  3KET A;  3TBI A;  2V1D A;  4BBR J;  1JT0 A;  4Y13 A;  2FU4 A;  4CGZ A;  4I0A A;  3WTU C;  1QHH D;  3J80 Z;  4LG0 B;  1KQ0 A;  1ZGJ A;  3GO5 A;  2JPB A;  4IX7 A;  2XF6 A;  1X4O A;  3L1P A;  3BR0 A;  3IH2 A;  1IRX A;  1OCP A;  3KP7 A;  1UG2 A;  1W4M A;  1Y1V J;  1ZRC A;  2MD5 A;  1T38 A;  2IBD A;  3F72 A;  3ELK A;  2OTL I;  2JK3 A;  4BNC A;  1DP3 A;  3FXM A;  2A5Y B;  1W0U A;  2VLA A;  3IKV A;  3JTG A;  2E5Z A;  3OSG A;  1D1A A;  3DBH B;  4FE7 A;  3HOT A;  4BHP A;  1TC3 C;  3JRG A;  3NEU A;  1P6R A;  5CLS A;  1O3S A;  2CSO A;  5KCM A;  1TW2 A;  4P55 A;  1K6O A;  2GM4 A;  3RCO A;  3TDU C;  5J4Y A;  3HGG A;  4CO8 A;  2K4B A;  3LST A;  3K4J A;  1XCV A;  2E19 A;  5EJC A;  1K83 J;  2IT0 A;  1FX7 A;  1QZY A;  1YX3 A;  2DT6 A; 
#chains in the Genus database with same CATH homology
 3GFJ A;  4O5V A;  1U5T C;  3WG9 A;  5J6X A;  4PDK A;  2IPQ X;  4KYW A;  3TOA A;  3F8N A;  1R5H A;  4BXU A;  2B0L A;  1IF1 A;  2QBY A;  3U9G A;  1BBY A;  2NNY A;  3GYH X;  1EH7 A;  2M45 A;  2H09 A;  1DPR A;  2YX4 A;  3IWZ A;  1O7F A;  3BJA A;  3ZQ7 A;  1UST A;  3WU1 B;  1K79 A;  1P92 A;  2QYO A;  2HGC A;  3RKY A;  2DPU A;  1XD7 A;  2W25 A;  4HQE A;  1ZRD A;  1KQ9 A;  2HS5 A;  2OA4 A;  5D5W B;  2RGV A;  3WTS C;  5AIP A;  3L00 A;  3RKW A;  3I58 A;  4ASN A;  1JGS A;  3I59 B;  2FBK A;  1IXR C;  1XSX A;  3L9F A;  3F3X A;  1IRF A;  1MZB A;  4EM1 A;  4PCQ A;  3NRV A;  4ZH4 F;  5ILS A;  5L3G A;  3DKW A;  4RGX A;  2PMH A;  5HDN A;  4IRH A;  1FBU A;  1S7A A;  4LB5 A;  1TQP A;  2XRN A;  2E7X A;  2XAH A;  3L7W A;  2H94 A;  3I64 A;  4S04 A;  4WF2 A;  2STW A;  1TQM A;  2OZU A;  4PGG A;  1HSJ A;  2RC4 A;  4JBA A;  5DCM B;  1ZH5 A;  1YQA A;  1KU9 A;  1DP7 P;  3BRO A;  3P9K A;  1D5V A;  5CYV A;  2UXX A;  4KIG A;  1B1B A;  1Q1H A;  2XV4 S;  3M1E A;  4LK0 F;  5HLI A;  3R6S A;  4YIF A;  1U78 A;  3NQO A;  2HKO A;  4KN7 X;  1ULY A;  1LDJ A;  2V79 A;  1T2K A;  3I4P A;  3RI4 A;  2FRH A;  3BZ6 A;  3V8J A;  5DUK A;  1S6L A;  1SAX A;  1MGT A;  3FMS A;  1BC7 C;  2DK8 A;  1G3W A;  3MZH A;  2VON A;  4WXD A;  3WE2 A;  5K1Y A;  3ML6 A;  3ZP5 A;  2X4H A;  4P9F A;  1YYV A;  4OMZ A;  1SD4 A;  3O2P E;  2MC3 A;  4I98 B;  4KIF A;  4UHT A;  1FBS A;  5HVQ C;  1ZAR A;  1O3R A;  5JHU A;  1ZHF A;  3SQN A;  2XAG A;  1J75 A;  1UHW A;  1WKM A;  5LGU A;  2DQR A;  3M8E A;  3KZY A;  4FX4 A;  2DT5 A;  2A6H F;  1XB4 A;  3T8R A;  1WRJ A;  3I0T A;  1G3S A;  1XGO A;  4A0X A;  1BJA A;  5ICF A;  1ZG5 A;  1QZZ A;  3BWG A;  3JAM K;  2KIF A;  1U3E M;  4A6D A;  4ESB A;  4OIP F;  2JTV A;  1HXD A;  1K78 A;  3R0A A;  2CO5 A;  4IF4 A;  2QVO A;  4L9N A;  3T1B A;  1TQI A;  4Q48 A;  1BI1 A;  5ICC A;  4RB2 C;  4I01 A;  4BQA A;  1YLF A;  4UUV A;  2M5W A;  3MAJ A;  5K5Q A;  4HX8 A;  4Q5S F;  3ZMS A;  4Z2Y A;  3R4K A;  2VBW A;  4K2E A;  1JHF A;  1FPQ A;  2Q8K A;  5K5R A;  2K86 A;  1FT9 A;  3WTT C;  2UZK A;  2XIG A;  4M72 A;  2V1U A;  3K1M A;  3WTX C;  1OKR A;  3OOP A;  5E8I A;  4ENM A;  1YFH A;  1HKS A;  1U5T A;  1W5S A;  3MEX A;  3TO9 A;  3JW4 A;  3ECH A;  2XAJ A;  3L09 A;  4KMF A;  1SD7 A;  1Z9C A;  5HLG A;  3I59 A;  1TLH B;  2DBB A;  2HWV A;  5FFX A;  3JSP A;  3HRT A;  5D6F A;  2OU2 A;  4LGW A;  1T98 A;  4L0Y B;  3VEP A;  2C6Y A;  1YO5 C;  1T0F A;  1OPC A;  5JI6 A;  1RI7 A;  4YFN F;  5CVV A;  5FD5 A;  4YII A;  3J81 K;  2D45 A;  1REP C;  4XRF A;  2A68 F;  2QEN A;  1D8K A;  1O3Q A;  3BJ6 A;  2BV6 A;  1QGP A;  2V9V A;  2VE9 A;  4KNY A;  2P7C B;  1Z7U A;  4WX9 A;  1BM9 A;  4ENJ A;  4BYY A;  1CF7 B;  4B09 A;  3Q9S A;  3T0Y A;  2FNP A;  4Y15 A;  5H6R A;  3J7A O;  1OYW A;  2VN2 A;  1MKM A;  1R23 A;  3CJN A;  4BAY A;  3E5X A;  2O8X A;  2PI0 A;  4ZYG A;  1X3U A;  4WXC A;  4HF2 A;  3HRM A;  1KU7 A;  2HEO A;  3V7C A;  3WTZ A;  5KVR A;  2MLG A;  3CTA A;  2EFN A;  3K69 A;  3U2R A;  4Q4Z F;  2JRT A;  3EET A;  2WV0 A;  3TO7 A;  2WWY A;  4MTE A;  2YPR A;  3FX3 A;  3W6K B;  4IHT A;  3BDD A;  4R79 A;  1EH6 A;  3QP6 A;  4WK8 F;  2HTJ A;  2LDU A;  2HOE A;  3EDP A;  3FM5 A;  4M71 A;  3VOD A;  1LDD A;  4L9V A;  3IKT A;  3MQ0 A;  3QU3 A;  2UXN A;  3EYY A;  3E6D A;  2EV5 A;  5CJ9 A;  1J5Y A;  3LAP A;  2ZME A;  3KLO A;  3KP2 A;  1YW9 A;  4FT8 A;  1RIO H;  3COA C;  4H0E A;  1FY7 A;  2OZ6 A;  3I53 A;  2KJC A;  5L3E A;  1HW2 A;  1Z6R A;  5L3B A;  2CFX A;  1I1G A;  3F6V A;  2F5D A;  5HLH A;  3KZZ A;  2EFQ A;  1DUX C;  1R5G A;  2FML A;  2H6B A;  3ERE D;  2CG4 A;  3DPL C;  3ZMV A;  3HUG A;  5TRD A;  4XLN F;  3E97 A;  1PDN C;  2P8T A;  3F8M A;  1IW7 F;  2RQP A;  3IHU A;  4I02 A;  3ABT A;  2ESH A;  2V6C A;  2HR3 A;  3HHG A;  1TNS A;  1WSU A;  1K78 B;  2XKO A;  4XBF A;  1TNT A;  4MHG A;  3O3K A;  4U7D A;  1ON2 A;  1S3J A;  3C3W A;  1IUY A;  4LK1 F;  4MGR A;  4AWX B;  5LEK A;  5BS6 A;  4N9H A;  2RVC A;  1LVA A;  2MA3 A;  4EJW A;  1J9I A;  3RDI A;  5JFR A;  2Y48 A;  4B8X A;  1E2X A;  3FXU A;  1FZP B;  4G7O F;  3P7N A;  4MEX F;  3GFI A;  3Q9V A;  5ERI A;  4CXF A;  1D3Y A;  2JSC A;  3ZMZ A;  4R1H A;  3SFZ A;  1RNL A;  4HDU A;  2GQQ A;  1OMI A;  2LNB A;  5E18 F;  4HX7 A;  1G6N A;  1JHH A;  1TW3 A;  4RGU A;  3U1D A;  4I09 A;  1G3T A;  1HKQ A;  4I0B A;  1XDU A;  3HSE A;  3M7G A;  1ZG1 A;  3QRF F;  1MJB A;  4LG0 A;  2XAF A;  4A5M A;  1BIA A;  2EV6 A;  3E5Q A;  5E17 F;  1FOK A;  2PJP A;  1ON1 A;  4EVI A;  3SHF A;  4IHS A;  1FSH A;  1R1U A;  1LDK B;  3C1D A;  2QQB A;  3IRR A;  2Z33 A;  3E5U A;  5E1X A;  2M1B A;  3EQL F;  3T5X A;  1TBX A;  1JXS A;  1FYK A;  2QLZ A;  5J8F A;  3CUO A;  3REO A;  2CGP A;  4UV8 A;  3CO6 C;  3ZPL A;  4DQ2 A;  2PMU A;  3HHH A;  3HRU A;  2ZFW A;  3KLN A;  1VTN C;  3QPT A;  2AXL A;  1SFE A;  5L3D A;  2L54 A;  1P4A A;  3MWM A;  2HYF A;  2RNJ A;  5L3F A;  4MQV A;  2NAZ A;  1BI0 A;  2O61 A;  2FBI A;  2W84 A;  3HOS A;  3WTY C;  2PFB A;  5BPD A;  3O6B B;  5F64 A;  1ZGA A;  4RAZ A;  5FO5 A;  4UVA A;  2IP2 A;  2NYX A;  1GVJ A;  2F5E A;  4BHC A;  1LQ1 A;  5A2Q Z;  1W7P D;  3HSR A;  2VOP A;  1SFX A;  2OBP A;  2WC2 A;  5D5V B;  2Q0O A;  5DD4 A;  5DD8 A;  3FM3 A;  3B73 A;  3VB2 A;  3KEQ A;  1ONV A;  5D4S A;  2DPD A;  1UB9 A;  1ZRE A;  2KKO A;  4KUM A;  1IN7 A;  4RB1 A;  4M9S A;  1XSD A;  3V7S A;  2M87 A;  3JAM Z;  4L9T A;  4D0P A;  1E17 A;  5HOO A;  1HW5 A;  2EWN A;  2EK5 A;  3QPH A;  5HS8 A;  2PEX A;  2GXB A;  2L01 A;  1O3T A;  2ZNY A;  1U8R A;  2BBY A;  1KU2 A;  3HTU A;  2IJL A;  2OQG A;  2HFH A;  2ADU A;  1F1Z A;  2L3D A;  1L0O C;  3F22 A;  3FHZ A;  2HTS A;  1KYZ A;  4WCG A;  1YW8 A;  2W24 A;  3R61 A;  3MZY A;  4BHB A;  4M73 A;  4ZYH A;  3CUQ A;  1FP2 A;  1S8N A;  5H20 A;  2LSO A;  2ZO4 A;  2RN7 A;  4XSZ F;  1OYY A;  1XGN A;  4CZZ A;  2ISZ A;  4HX4 A;  5A2Q K;  2VOD A;  2L02 A;  3WGH A;  2K4J A;  2F5F A;  2XKP A;  1IN4 A;  4L0Z B;  2F5C A;  3LA3 A;  5AIQ A;  4UNO A;  2O03 A;  4I7H A;  3GF2 A;  1I27 A;  2P5V A;  3ZN1 A;  2JPC A;  1LB2 A;  2O3F A;  3WOD F;  2FSW A;  2ZXJ A;  2GA1 A;  2FBH A;  3F8B A;  4N0B A;  5LHG A;  4FX0 A;  5LLQ A;  2PQ8 A;  2VBX A;  2EFP A;  4QWQ A;  1UFM A;  1ZN2 A;  3HRS A;  3H3U A;  1ODD A;  3E6C C;  4L5I A;  2NS0 A;  5LEJ A;  1GXQ A;  5LHI A;  5KK1 A;  4A0Y A;  4MTD A;  2Y75 A;  5FLX K;  2FMY A;  3HTS B;  4HF0 A;  4EV0 A;  1SFU A;  5HS7 A;  2VC1 A;  3EUH A;  3WTW C;  4LLN A;  1FYM A;  1OYI A;  1XMA A;  1PP8 F;  1FSE A;  4ESF A;  4KIC A;  5FB2 A;  4AVP A;  4EJU A;  1F4K A;  2MLK A;  3D5L A;  4G6D A;  2FOK A;  3GX4 X;  2QQA A;  4RS8 A;  4F7Z A;  1QPM A;  3RPQ A;  4HF1 A;  1RUO A;  3E3V A;  4MEY F;  2QZ8 A;  3PQK A;  2FF4 A;  1TTY A;  5ED4 A;  4AIK A;  1IRG A;  3EYI A;  2GAU A;  5DEQ A;  3T8T A;  3TDZ C;  3BPX A;  4KDP A;  1I1S A;  3IC7 A;  2P6T A;  3B02 A;  5K5O A;  5CVR A;  4EJV A;  2QWW A;  3HSF A;  2ZCW A;  3KFW X;  2DQL A;  1I5Z A;  2BEO A;  5HDK A;  2DU9 A;  5DCF A;  3WE3 A;  3JTH A;  3F21 A;  1B59 A;  2DLL A;  1SD6 A;  4WWC A;  2LF8 A;  2GXG A;  1YIO A;  1KQ8 A;  2A07 F;  3SZP A;  1MDM A;  4HZF A;  2UWM A;  4ETS A;  1BN5 A;  3BOQ A;  2DK5 A;  4M6Y A;  2D1H A;  2HQR A;  4EGZ A;  1IZ1 A;  3ABU A;  2Z9O A;  2ZNZ A;  3R0J A;  5D8K B;  2E1N A;  1B6A A;  2EFO A;  4N9I A;  3RYP A;  1H9G A;  4FHT A;  4GGG A;  2R7D A;  1ZLJ A;  1UHM A;  4EGY A;  2MH2 A;  1F9N A;  4KIB A;  4IPA A;  3M9A A;  4G9Y A;  1B9M A;  5EEH A;  1H9T A;  1U6G A;  5BQT A;  2D2W A;  1FLI A;  5ILU A;  3LQR A;  5EEG A;  4A12 A;  3DPT A;  2A3S A;  1SMY F;  4HLY A;  4M9X A;  3F6O A;  3DFG A;  4G7H F;  2XAQ A;  3CUQ C;  1R58 A;  5DUI A;  4U0W A;  3GFM A;  2DAO A;  2K7L A;  4U0V A;  5DCM A;  5ICE A;  1PP7 U;  1IXC A;  1HKT A;  2FE3 A;  3DV8 A;  3F8F A;  2HDC A;  2O6G E;  1UCR A;  2P4W A;  2GIV A;  2W85 A;  3GVA A;  1B9N A;  5ICG A;  4OMY A;  2A6E F;  1MD0 A;  4HYE A;  4XLP F;  2KJB A;  3QP5 A;  2BGC A;  3TKY A;  3ULQ B;  2YSR A;  1RUN A;  4L5J A;  4Q47 A;  5E1Z B;  1LJ9 A;  4KT5 C;  3FZV A;  2STT A;  1LEB A;  5AON A;  1MDM B;  3QAH A;  3Q5F A;  3FMQ A;  1F5T A;  5BMZ A;  1W7P A;  4U0Y A;  3RTR A;  2EFW A;  4G8X A;  1J0R A;  1DDN A;  2ZJ2 A;  5CVJ A;  2RDP A;  3ZN0 A;  2ZKZ A;  4M6X A;  1ZLK A;  4LD5 A;  2VOO A;  3KP4 A;  4HBL A;  2EA4 A;  4EQQ A;  1J7K A;  1IAW A;  1FYL A;  4G94 A;  2LKP A;  4KN4 X;  4L9J A;  5LRR A;  5FLX Z;  1KGS A;  3GW2 A;  3MCZ A;  1HW1 A;  1LNW A;  3FXQ A;  4ON0 A;  2MBF A;  1Z05 A;  1R36 A;  2QBY B;  1MJ9 A;  2K02 A;  4YG2 F;  4HLX A;  1I6X A;  3DP7 A;  3L2C A;  1O57 A;  3RKX A;  3FF5 A;  1XMK A;  6PAX A;  3CO7 C;  4OU0 A;  3N4M A;  1XGS A;  3N97 A;  3IL2 A;  2VBZ A;  1HST A;  4PGH A;  1D8J A;  3VFZ A;  2R3S A;  1QO0 D;  1STZ A;  3LFK A;  1YW7 A;  4HAM A;  1JE8 A;  5D5X B;  2G7U A;  4LMY A;  2QM3 A;  3JSO A;  4PZJ A;  2YX7 A;  3TGN A;  4QLC U;  2DTR A;  4S05 A;  4UVC A;  5E8G A;  2G9W A;  4GO1 A;  2AS5 F;  2J5O A;  5E20 A;  2MH9 A;  4NB5 A;  4RGR A;  4P5O A;  3BP8 A;  5BOX A;  1IN8 A;  4O6J A;  1P4W A;  4MQ9 F;  3MFK A;  4HQM A;  2W57 A;  1H0M A;  2CYY A;  2FEZ A;  1QNT A;  5CVU A;  2X0L A;  4RAY A;  1GXP A;  3P9C A;  2DFI A;  2YR2 A;  3DEU A;  4HOB A;  4LB6 B;  4O3M A;  5E1W A;  3M8F A;  2ELH A;  1KU3 A;  1L3L A;  1S29 A;  4CIC A;  4EM2 A;  5LGN A;  4OIN F;  3RJP A;  3GZ5 A;  2VT3 A;  2KIM A;  4OIQ F;  1V4R A;  1BOA A;  1GHC A;  3CUQ B;  3WTV C;  2H27 A;  4NQW A;  3WU0 A;  3CLO A;  1IXS B;  2COM A;  1FWZ A;  3LA2 A;  4KA4 A;  2O0Y A;  2OAZ A;  1PUE E;  3V4G A;  5BPI A;  1NHA A;  3FMR A;  1ZG3 A;  4HA8 A;  4EM0 B;  4RB3 C;  4YFK F;  1V3F A;  1HBX G;  1R7J A;  3CDH A;  1SD5 A;  3SZT A;  2J5P A;  2HYG D;  1U5T B;  4MNU A;  2NRA C;  4RGS A;  4TV7 A;  2H6C A;  2D1V A;  2FNA A;  4M74 A;  5HS9 A;  1FC3 A;  1XGM A;  2XRO A;  1G3Y A;  3K1P A;  2DI3 A;  3ISP A;  5L3C A;  3VOE A;  2E7W A;  2E1C A;  3P9I A;  3TQN A;  2KRF A;  1AOY A;  1FNN A;  5IT9 Z;  2HQN A;  2VXZ A;  3TO6 A;  3W6J B;  2IW5 A;  3K0L A;  1K7A A;  3LA7 A;  4OIR F;  4YFX F;  4JK1 X;  3GFL A;  2RKH A;  4WXH A;  1BIB A;  1P2F A;  3K9T A;  4U7B A;  3KCC A;  4LLL A;  2F2E A;  3FXR A;  3ROU A;  1S7O A;  2Z99 A;  3KP6 A;  3I71 A;  4UV9 A;  5FFZ A;  2Z3Y A;  3GLX A;  2IVM A;  5TJJ A;  1W5T A;  1EV7 A;  2VC0 A;  2XUB A;  4M9Z A;  1ZRF A;  4XSX F;  1ZYR F;  1A04 A;  5D8L B;  1T6S A;  2VE8 A;  4EMS A;  3V8L A;  2OQR A;  3KEO A;  5JR3 A;  3K1N A;  4CDG A;  4IRI A;  2ZBK A;  5LBQ A;  3LAJ A;  2L4M A;  1BC8 C;  5LHH A;  4HW0 A;  3GEZ A;  5CVI A;  1Y0U A;  1WQ2 A;  3S2W A;  2Z5U A;  2YU3 A;  3K2Z A;  4UVB A;  3V7R A;  3I54 A;  4JQF A;  3J81 Z;  4KMU X;  5JVT A;  4LLG F;  1KYW A;  5D4R A;  2EA2 A;  3KP3 A;  5FD6 A;  3C18 A;  3E6M A;  3IRQ A;  1XN7 A;  2Y0M A;  2XGX A;  5H6Q A;  2IRF G;  1KA8 A;  2G7H A;  3G3Z A;  5LGT A;  3WGI A;  2PN6 A;  5J8C A;  5LRS A;  3DF8 A;  1OR7 A;  4HV5 A;  1T39 A;  3FWE A;  3QOP A;  2CWE A;  2EV0 A;  2XHK A;  3V8K A;  3HYI A;  4A0Z A;  3IWF A;  2FA5 A;  2TDX A;  1BI2 A;  4Y17 A;  3SXY A;  4GYI A;  4G6Q A;  1EH8 A;  2IA0 A;  1J2X A;  4L18 B;  1CF7 A;  4AIH A;  2P6S A;  5D6E A;  3LWF A;  3BPV A;  3H3Z A;  4BH9 A;  3RYR A;  2Q2E A;  2GA2 A;  3J80 K;  4GXO A;  2VT2 A;  4G7Z F;  4DNC A;  5FGM A;  2WTE A;  3KE2 A;  4E70 A;  1J59 A;  2M30 A;  2ZME B;  3AAF A;  3ECO A;  4A2U A;  1ZAO A;  3G73 A;  2XAS A;  5DV5 A;  3BJO A;  3C7J A;  1U2W A;  4ENK A;  2CW0 F;  3WGG A;  1RZ4 A;  1WWX A;  5D5U B;  1W7P B;  1IN6 A;  1SMT A;  2GWR A;  3F23 A;  2CQK A;  3DQV C;  2GZW A;  2ISY A;  3BY6 A;  1R22 A;  1BI3 A;  2IA1 A;  5HDG A;  4ESJ A;  2EB7 A;  3DXJ F;  2A69 F;  4R8H A;  1R1V A;  3OV8 A;  2JT1 A;  4ENN A;  4EJO A;  2EJR A;  2KIU A;  2P7V B;  2ETH A;  4P96 A;  2PLY A;  3GWZ A;  2FQ3 A;  1XCB A;  2XVC A;  1XDS A;  1Z1D A;  1FP1 D;  1WI9 A;  2R7F A;  4HV6 A;  2VBY A;  2QUF A;  3I5U A;  1YTY A;  1R1T A;  4CYD A;  4OOI A;  4IXA A;  4ZYD A;  3KP5 A;  4KFC A;  2K27 A;  2ACJ A;  2M8E A;  3RIR A;  2QQ9 A;  2NNN A;  4IRG A;  3F8C A;  3H92 A;  3TOB A;  4AIJ A;  4LJZ F;  3PQJ A;  1B4A A;  5F6F A;  3ZMD A;  1Z91 A;  5DDG A;  1QQI A;  4ZZL A;  4NHJ A;  4I2O A;  4CHU A;  4P9U A;  1YG2 A;  4OIO F;  4EJT A;  2PG4 A;  2ESN A;  5ILV A;  3R60 A;  3HIF A;  4ZYE A;  1DPU A;  3LQQ A;  1USS A;  4AD9 A;  3PFI A;  2BYV E;  1IN5 A;  2DW4 A;  1G4D A;  3QU6 A;  1R00 A;  1QBJ A;  4GCV A;  2OD5 A;  3GXO A;  2P5L C;  2PBI A;  1O7L A;  1YS6 A;  2FXA A;  4IJA A;  1P4X A;  4U88 A;  3RPU A;  1C0W A;  2BE5 F;  1MJA A;  1HQC A;  1XSV A;  2P5K A;  4IVN A;  4UXN A;  2RV8 A;  5DYM A;  2LF7 A;  2JZY A;  1FBQ A;  4ZZD A;  4RB0 A;  3E6B A;  3ZMU A;  1AWC A;  4GYG A;  4LFU A;  2HZT A;  5F1R A;  1YS7 A;  2A61 A;  3D0S A;  2IA2 A;  2DO7 A;  1CGP A;  4HDV A;  1LEA A;  4A6E A;  5IT9 K;  2HKX A;  5IT3 A;  2V1X A;  1Z6T A;  3ZMT A;  3GZ6 A;  2L4A A;  4A5N A;  3GUD A;  3KET A;  2V1D A;  4Y13 A;  2FU4 A;  4CGZ A;  4I0A A;  3WTU C;  3J80 Z;  4LG0 B;  1KQ0 A;  1ZGJ A;  3GO5 A;  2JPB A;  3KP7 A;  1W4M A;  1ZRC A;  2MD5 A;  1T38 A;  3F72 A;  3ELK A;  4BNC A;  2A5Y B;  3IKV A;  3JTG A;  3HOT A;  4BHP A;  3NEU A;  1P6R A;  5CLS A;  1O3S A;  2CSO A;  1TW2 A;  4P55 A;  1K6O A;  3TDU C;  4CO8 A;  2K4B A;  3LST A;  1XCV A;  2IT0 A;  1FX7 A;  1QZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...