3HSFA

Heat shock transcription factor (hsf)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK TRANSCRIPTION FACTOR
publication title Refined solution structure and dynamics of the DNA-binding domain of the heat shock factor from Kluyveromyces lactis.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription regulation
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1995-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hsfA00
1F4KA 3RKWA 2DAOA 2TDXA 4HV5A 4IRHA 4OIRF 1CF7B 1YW8A 2VXZA 5HDKA 5BMZA 3PQJA 2RDPA 1T39A 2D2WA 4ZZLA 1JGSA 1RI7A 4IHTA 3M9AA 3IWFA 2OD5A 4ZYEA 2IW5A 3K1MA 1J2XA 4IPAA 4HLXA 5D5WB 3BPVA 1IN4A 1P6RA 1SD5A 2K7LA 5FFZA 4PCQA 4L5JA 1JHHA 4U0VA 3WE3A 1DPUA 2V79A 1OYWA 2HWVA 2DPDA 5LGUA 3TGNA 3RPQA 1SD4A 3RPUA 2RVCA 4UHTA 5FFXA 2FRHA 3HRUA 3QOPA 4EGZA 1G3YA 2V1XA 1E2XA 4KDPA 2G7UA 3GFIA 4NB5A 3P9CA 3ZMVA 1TW3A 4ENMA 3M1EA 5E1XA 4YIIA 4KN4X 4Z2YA 1FWZA 1PUEE 5TJJA 3DP7A 3TDUC 3IHUA 2A68F 3V8JA 2HKOA 3JAMZ 2XAFA 2R7DA 2ESHA 5FD5A 4BNCA 4A0YA 5D4RA 2OAZA 3LSTA 1OPCA 1U6GA 2M1BA 1S7OA 3S2WA 2YU3A 4KMFA 5DUIA 3FWEA 4LG0B 4WXDA 3GVAA 5HS9A 3V7RA 2F5FA 1XDSA 3BJ6A 2M30A 4KYWA 3RYPA 4HAMA 1HSTA 2HEOA 1BIBA 4OIOF 1RIOH 3GFMA 4A6DA 1J9IA 4M71A 2BV6A 2JTVA 3TO9A 5AIQA 4A6EA 3KLNA 5HDNA 1MDMA 1YG2A 1AOYA 2FSWA 1R1VA 1ZGJA 4RS8A 2D1VA 3ROUA 4ZYDA 1G4DA 4P9FA 3K69A 5HS7A 4IRGA 1FBSA 3DEUA 1FLIA 1UB9A 2P5VA 3WGIA 3L7WA 3DF8A 3W6JB 1T98A 4N9HA 2NAZA 3I59A 1A04A 1K78A 2YPRA 1R5GA 1D5VA 3M8EA 5D6FA 3JSOA 2ELHA 1KU7A 3F22A 3WU1B 3F72A 4A5NA 4PGGA 1RNLA 1IAWA 5E8GA 4MHGA 4XSXF 1YYVA 3GWZA 1QNTA 3E6DA 3CUOA 1FNNA 1F9NA 2EFNA 3HSFA 2CW0F 2FA5A 2MC3A 1KU3A 4HF0A 3CO7C 3K2ZA 3E6CC 5L3FA 5BQTA 1HBXG 3F6VA 1BJAA 1XGMA 2Q0OA 1ZRDA 2COMA 3CUQB 4AD9A 5K5OA 1ZRFA 3WGHA 4G7HF 2XIGA 4L9VA 1P92A 1GXQA 4OMZA 4LFUA 1Z6RA 2ETHA 1OR7A 2L4AA 3JTHA 1I1GA 4G9YA 5LEKA 2A6HF 3R0AA 4DNCA 4ZYHA 2GXGA 3QP6A 4P5OA 4ON0A 2VOPA 4YG2F 5JVTA 3R4KA 4RAYA 4O6JA 2L3DA 5ILVA 4HDVA 2H94A 2IT0A 1ZAOA 1B9MA 3KZZA 1ZRCA 1O7LA 2LSOA 4UVBA 1Z6TA 1LDDA 4AWXB 1T2KA 4HQEA 2DO7A 3B73A 1MJ9A 4JK1X 4IVNA 2V1DA 4MTEA 3GEZA 5DCMB 1R22A 1ZARA 3EETA 2FMLA 1XMKA 2F5EA 5ICCA 4L9TA 1TQMA 1WQ2A 4EJVA 1UHWA 2EA4A 2OQRA 4Y15A 1HKQA 2BEOA 5DD8A 5ICEA 2L54A 4HLYA 2XKOA 1LQ1A 1HKSA 2KIUA 1FZPB 5JI6A 4MGRA 4K2EA 1F5TA 1G6NA 3ABUA 2FBKA 2EJRA 4EQQA 1YS7A 4M73A 5FD6A 3O6BB 4U0WA 2YX4A 4AIHA 5DD4A 1FP2A 1OMIA 3IKVA 4HF2A 2HYFA 3F8NA 1FBQA 3HHGA 2IA0A 3WTVC 2PJPA 4GGGA 1YTYA 3J81K 4O5VA 5D5UB 5LHIA 4RB0A 1FYMA 2RQPA 2O03A 4M6YA 4HX7A 3IC7A 1ZGAA 3WTUC 3MAJA 1DUXC 2FE3A 2X4HA 2NNYA 2ZNYA 2Y0MA 4M72A 4E70A 4BYYA 4L9NA 5EEGA 3ULQB 2LNBA 3L00A 3R6SA 1O3TA 4HBLA 5HOOA 5H20A 2CSOA 2VC0A 4HOBA 3RKXA 2GZWA 3F8BA 4LJZF 1V4RA 3MWMA 4RB3C 1IXCA 1Q1HA 2NYXA 2Z99A 3MCZA 3WTSC 1IUYA 4L5IA 4HA8A 1BI0A 4I02A 2EV0A 2UZKA 3L9FA 3OOPA 2MA3A 1ZG3A 3ISPA 2JT1A 5KK1A 1R00A 5ILUA 2HYGD 4OU0A 4YFXF 1K6OA 4OINF 1O57A 4LLNA 2QVOA 2RGVA 2M45A 2MD5A 2VC1A 4CHUA 4CGZA 3G3ZA 5H6QA 3RI4A 4H0EA 5E1WA 1Y0UA 2ZXJA 3ZMZA 3WTYC 1JHFA 1W7PA 3CJNA 3HTSB 1R5HA 2CG4A 1GVJA 2R7FA 4WXCA 4R8HA 1XB4A 1ONVA 4Q4ZF 2RC4A 4I7HA 2OQGA 5D5XB 1LNWA 3VB2A 3I5UA 1SD7A 2EFWA 1YO5C 1P4AA 1H9GA 2CO5A 2GAUA 4EVIA 3GO5A 2XGXA 2KRFA 4G6QA 1HW1A 2KJCA 1DPRA 1FP1D 3DQVC 1B4AA 2DT5A 3KETA 2A69F 5IT9Z 1MDMB 1YIOA 3I0TA 4RGSA 4F7ZA 5JR3A 4O3MA 5CVIA 4R79A 5L3BA 2HGCA 3JAMK 2NRAC 1E17A 1EH7A 2P7CB 4CXFA 1P4XA 5L3EA 2ZO4A 1USSA 3LA7A 2ZMEA 3T1BA 1XGSA 2ESNA 1WSUA 4N9IA 2LF7A 4LD5A 1K78B 2A3SA 3BJOA 2Z5UA 5E8IA 5FLXZ 4BXUA 5BPDA 3I4PA 1Z1DA 2QWWA 4LB5A 1V3FA 3BDDA 2V1UA 2XUBA 4CO8A 3O2PE 5JHUA 2L02A 5F6FA 4OMYA 3F21A 1H9TA 2P6TA 1J5YA 2LKPA 3T0YA 1ZYRF 1BI3A 4EV0A 3CDHA 3CO6C 2O0YA 2VBXA 3BPXA 1FYLA 3M7GA 2DLLA 4U7DA 1Z9CA 4JQFA 3B02A 5L3CA 3SXYA 5L3DA 4ESFA 1VTNC 4HX8A 3QAHA 2PLYA 1BC8C 4ESJA 2RNJA 5HLGA 4M9ZA 5K5QA 1U8RA 4U7BA 4LLLA 4EJOA 2FMYA 4RB1A 4A0ZA 3KE2A 3LAJA 4I09A 4EM0B 1ON2A 1SMTA 3EQLF 4Q47A 1JXSA 4UV8A 2IRFG 3LAPA 2G9WA 2QQ9A 3F3XA 4EJUA 1P2FA 1IRFA 3EYIA 4A12A 3WG9A 2VBZA 3FM5A 4HDUA 2EFQA 2DPUA 4UNOA 1YQAA 3ZMDA 3GLXA 1KQ8A 1G3SA 3WTTC 1S8NA 3HOSA 3WODF 4ENNA 1RZ4A 1LDJA 3L2CA 2VN2A 1FSHA 2ZCWA 2KKOA 5CYVA 1TBXA 3F8FA 1XSXA 1ZREA 2DK8A 3T8RA 3DPLC 3TKYA 3C7JA 5HS8A 2FBHA 1WKMA 2DU9A 3FMQA 1R36A 3COAC 2DI3A 4LB6B 1GHCA 5F64A 2Y48A 3K1PA 1KU9A 4JBAA 2IJLA 4GCVA 4ENJA 5LRSA 3WTWC 1R23A 1Z05A 4M9XA 1BN5A 2ZJ2A 3I53A 2Q8KA 3U1DA 5HDGA 1SD6A 3MQ0A 3IL2A 1U3EM 2UWMA 1HXDA 4BHCA 4KA4A 2O8XA 3GZ5A 4IRIA 5A2QZ 3G73A 1SMYF 1B1BA 4CDGA 5LGTA 1QZYA 2IA2A 3E5UA 4IF4A 3KP3A 1FC3A 2VBYA 3C18A 2Y75A 4Q5SF 1XSDA 3ZP5A 1MGTA 2P5KA 2K27A 3E6MA 3KP5A 2FQ3A 3ZN1A 3BROA 2F2EA 4HZFA 3FMSA 4EJWA 3N4MA 4MQVA 1R58A 1MJBA 2D45A 1U78A 3U9GA 3VOEA 5FO5A 3SFZA 4TV7A 1K79A 1HSJA 4G94A 2WTEA 2AS5F 4B09A 1JE8A 2F5CA 3SZPA 2K4BA 5DEQA 2C6YA 1J59A 1X3UA 3TO6A 3QP5A 4IJAA 2E1CA 3I54A 3BWGA 3NQOA 3L09A 1TQIA 5ICGA 1LJ9A 4NQWA 4P55A 1REPC 3MZYA 3LWFA 4M74A 3W6KB 3HIFA 5K1YA 4AIKA 4HW0A 3MEXA 5DUKA 1EH8A 5CVRA 2CWEA 4ZH4F 2GA2A 4EMSA 1BOAA 3LFKA 1D3YA 2PMHA 2P6SA 3DXJF 4BQAA 2EA2A 1XN7A 2PG4A 2HQNA 1SAXA 2WC2A 3LA2A 2FF4A 2BYVE 1W4MA 2FBIA 1ZHFA 3T5XA 5FB2A 4EJTA 4WWCA 2H6CA 5LHHA 4LG0A 1FYKA 3RYRA 2YX7A 3IRRA 2ISZA 3Q9VA 4P9UA 2W84A 1K7AA 1BI1A 3BP8A 1XMAA 2XV4S 1IN5A 4KICA 4CYDA 5IT3A 3AAFA 5J6XA 2QZ8A 2PBIA 2FEZA 2LF8A 3RKYA 3RJPA 2DTRA 1R7JA 1EH6A 2GQQA 5LLQA 2IPQX 3BY6A 1U5TB 2QQBA 3ZQ7A 2XAGA 2DFIA 5J8CA 1PDNC 5D8KB 2E1NA 1YFHA 4GYGA 4ASNA 4EGYA 3CUQC 4QWQA 3RIRA 3J7AO 4KMUX 5LEJA 3KEOA 3F23A 4WF2A 4FT8A 5LGNA 2X0LA 3VEPA 4LLGF 1D8JA 5D6EA 1WI9A 4RAZA 2E7WA 3FXUA 5CVVA 1AWCA 2XVCA 1WRJA 2O61A 3FX3A 3K1NA 1FPQA 3Q5FA 1OYIA 4HX4A 1IZ1A 3FM3A 3VODA 1YS6A 1EV7A 2L01A 4LGWA 5IT9K 1STZA 2QLZA 3PQKA 1RUNA 3CLOA 3HSEA 2V9VA 4KFCA 4I2OA 3HRMA 1UHMA 2KJBA 2DK5A 3T8TA 4PGHA 2CGPA 1ODDA 2OZ6A 4LK1F 4IHSA 5CVJA 3J80Z 3KLOA 3BOQA 2XHKA 3CUQA 4YFKF 4ZZDA 2RV8A 1LEBA 3N97A 1KYZA 5DDGA 3KP4A 3E5XA 3HYIA 5FLXK 1LDKB 4S05A 2W57A 4ETSA 3DPTA 1Z91A 1C0WA 2CYYA 4EM1A 4RGXA 2WV0A 4KUMA 2XROA 1WWXA 2P4WA 1KYWA 1GXPA 1KQ0A 3IWZA 1TW2A 3RTRA 4U88A 2Z3YA 1L3LA 1S29A 2KIMA 2MLGA 4BAYA 2IA1A 2UXXA 5J8FA 3SQNA 4UUVA 3M8FA 2QM3A 1SFUA 3WTXC 1BI2A 1T38A 3DFGA 3EUHA 3I58A 2MLKA 1SFXA 1IRGA 3GFLA 2K4JA 5KVRA 3SZTA 4ENKA 3E5QA 2M8EA 2RN7A 4MTDA 3WTZA 2E7XA 3WU0A 3DV8A 1KGSA 1HW2A 1YW7A 2PN6A 2VE9A 5BPIA 2DQRA 4I98B 1I5ZA 3P9IA 3WGGA 3CTAA 2OZUA 1QZZA 2CQKA 4BH9A 2EWNA 4OIQF 2YSRA 4DQ2A 1ZG1A 3E3VA 3KEQA 1QBJA 2STTA 1FX7A 2IVMA 1QPMA 2GWRA 2HQRA 2RKHA 2XAQA 4M6XA 1O7FA 3I59B 3HUGA 5D4SA 4I01A 3JSPA 2B0LA 1LEAA 2PFBA 1J75A 2D1HA 5EEHA 5AONA 1FSEA 4KIBA 3HTUA 2OBPA 4FX4A 3EDPA 2K86A 1IF1A 5DV5A 2XAJA 1XGNA 2V6CA 3Q9SA 4G6DA 1IW7F 3TDZC 1TNTA 3KZYA 1MZBA 3WE2A 5DYMA 3ZMTA 4MEXF 1U2WA 3HHHA 2P7VB 1D8KA 3MZHA 5HLHA 1IN6A 3O3KA 3TO7A 2VE8A 4I0AA 1BM9A 2CFXA 3HRSA 4XLNF 3KP7A 4NHJA 3VFZA 1TLHB 2HS5A 3GW2A 4AIJA 2MH9A 2EV5A 4A2UA 2J5OA 2QBYA 2G7HA 2J5PA 5H6RA 3R0JA 5A2QK 2HKXA 1J0RA 4UV9A 4G8XA 2ACJA 2P5LC 2W25A 3E6BA 2JSCA 3ZPLA 1HKTA 4KT5C 1XDUA 2Z9OA 2EV6A 4LK0F 1BBYA 3IKTA 2OU2A 3JW4A 1YLFA 3LA3A 5ED4A 2A07F 2H6BA 3V4GA 3HRTA 3TOAA 4UXNA 3KP6A 5E20A 3ABTA 1XCVA 3GF2A 3GZ6A 2EB7A 3ML6A 1FY7A 5TRDA 4QLCU 3IRQA 5K5RA 4BHPA 1O3SA 1HW5A 1O3RA 3D0SA 1OKRA 2ZFWA 1TTYA 3OV8A 4RGRA 1F1ZA 2FU4A 2XRNA 1B6AA 2W85A 1HQCA 2XAHA 3GYHX 1XGOA 2L4MA 2A5YB 3ECOA 2EFOA 2PMUA 1XSVA 4OIPF 1ZG5A 3TQNA 2A61A 1UFMA 2MH2A 1R1TA 3F8CA 1LB2A 4HF1A 4L18B 2DW4A 3QU3A 4PDKA 2K02A 4ESBA 3R61A 1CF7A 3P9KA 4L9JA 1XD7A 1XCBA 5LRRA 1W5SA 5ILSA 4ZYGA 2PI0A 5E18F 1L0OC 3C3WA 1T0FA 5DCFA 2VONA 2PQ8A 3DKWA 5CJ9A 6PAXA 2HTSA 3EYYA 1FOKA 5CVUA 1G3TA 2QUFA 2BGCA 3I64A 5HLIA 4HYEA 4XRFA 4WXHA 2HR3A 1YW9A 4UVAA 4UVCA 2F5DA 4RGUA 1FBUA 4MNUA 1I6XA 1IXSB 4MQ9F 1SFEA 2M87A 2KIFA 3K0LA 3BJAA 1QO0D 1P4WA 4XBFA 3FXRA 2VBWA 1IN8A 3FF5A 1W7PD 2HTJA 3V7CA 1IN7A 1BC7C 3F8MA 2JPBA 2EFPA 3GFJA 4A5MA 1R1UA 5L3GA 2FXAA 4S04A 1NHAA 2YR2A 2XKPA 2WWYA 3H92A 2DBBA 2Q2EA 1ZN2A 3FZVA 2EK5A 3ZMSA 4L0ZB 2ZBKA 3H3ZA 1W7PB 3J80K 3FHZA 4AVPA 2VOOA 2OA4A 2JPCA 3QPTA 3V7SA 4FX0A 3K9TA 4G7OF 2NNNA 3HOTA 4OOIA 4HQMA 3LQQA 4GO1A 5HVQC 2P8TA 4BHBA 1H0MA 4M9SA 1PP7U 1S6LA 1MJAA 3FXQA 4B8XA 1TNSA 2VODA 4P96A 3C1DA 1DDNA 2HOEA 2QYOA 1Z7UA 1ZLJA 3V8KA 5ERIA 4WK8F 3KCCA 2ADUA 2ISYA 4WCGA 1I1SA 3TOBA 1ZH5A 4L0YB 2ZMEB 3BZ6A 4YFNF 3QPHA 4Y13A 2HFHA 5FGMA 4A0XA 1B59A 2NS0A 4CICA 1MKMA 4PZJA 3GXOA 3SHFA 4MEYF 1RUOA 2LDUA 2BBYA 1CGPA 4KNYA 3PFIA 3ELKA 1T6SA 3GX4X 4D0PA 3I71A 3R60A 5CLSA 5D8LB 4WX9A 5ICFA 3D5LA 4GXOA 4Y17A 2AXLA 1I27A 1QQIA 5AIPA 3KP2A 2W24A 3NEUA 1MD0A 3JTGA 2VT2A 4Q48A 2VT3A 1IXRC 3V8LA 3GUDA 2ZKZA 3P7NA 4XLPF 3ERED 4YIFA 1J7KA 1QGPA 4G7ZF 3U2RA 3E97A 2QBYB 2A6EF 2MBFA 2GXBA 2DQLA 1O3QA 2FOKA 1KA8A 3F6OA 1W5TA 4KIGA 1BIAA 1DP7P 4LMYA 3ECHA 5D5VB 3HSRA 2HDCA 2UXNA 1U5TC 4I0BA 2Z33A 2GA1A 2FNAA 1ZLKA 2STWA 3RDIA 1KU2A 4XSZF 5E1ZB 1KQ9A 3REOA 2QQAA 2O3FA 4N0BA 1TQPA 1FT9A 4FHTA 3NRVA 1UCRA 2FNPA 4IXAA 5BS6A 2H27A 3FMRA 5DCMA 1B9NA 1USTA 2QENA 3KFWX 3MFKA 3QU6A 5JFRA 3LQRA 1ON1A 1PP8F 2O6GE 5E17F 2BE5F 2GIVA 4HV6A 4RB2C 3J81Z 3H3UA 2HZTA 2JRTA 4GYIA 2M5WA 3ZMUA 2ZNZA 4EM2A 4U0YA 1LVAA 1ULYA 4CZZA 1U5TA 2PEXA 4KIFA 2XASA 3ZN0A 1S7AA 5BOXA 5F1RA 2IP2A 2H09A 1G3WA 2R3SA 1OYYA 4R1HA 2JZYA 4KN7X 1S3JA 5LHGA 5LBQA 3QRFF
chains in the Genus database with same CATH superfamily
2VXDA 2ZSHB 1F4KA 3AL0C 3RKWA 2DAOA 2TDXA 5JLWA 3G1LA 4UUSA 4HV5A 4IRHA 4OIRF 1CF7B 1YW8A 2VXZA 5HDKA 3BTJA 2CQNA 5DS9A 5BMZA 2HOTA 2K3FA 2VB6A 3PQJA 2RDPA 1T39A 2D2WA 1ETKA 1R4MB 2QKLB 4ZZLA 4YRVA 1JGSA 1RI7A 3OIPA 3M9AA 4IHTA 3IWFA 2OD5A 3OR1C 4ZYEA 2IW5A 3K1MA 1J2XA 4MO7A 4IPAA 2V26A 2DFHA 4KISA 5EF6A 3KYCB 4HLXA 1X1AA 5D5WB 1EJ9A 2DXIA 2LK2A 3BPVA 2YS9A 3L1PA 3TEDA 1CQTA 1IN4A 2WAFA 2L9VA 1P6RA 1SD5A 1K4TA 4AIDA 1YJ9I 2K7LA 5FFZA 4PCQA 4L5JA 3BCBA 1JHHA 3VYTB 4U0VA 3WE3A 1DPUA 1Q1VA 2V79A 1OYWA 5FLMJ 1Y1WJ 2ZXHA 2HWVA 5FROA 2DPDA 4Y7NJ 3BG6A 5LGUA 3TGNA 4MIMA 3RPQA 3GCMA 1SD4A 3RPUA 2RVCA 4UHTA 3C2BA 5FFXA 4IO9F 3W3CA 1OCOH 2FRHA 1ZK8A 3HRUA 3QOPA 3U1KA 1BOBA 4EGZA 1G3YA 1GUUA 2V1XA 2ID6A 1E2XA 4KDPA 2G7UA 3GFIA 4A3LJ 4NB5A 3P9CA 4V19K 4XRMA 3ZMVA 1TW3A 3K6GA 4ENMA 3M1EA 3I4NJ 4FISA 1TWGJ 5E1XA 2B9SA 2KRHA 4YIIA 3FK6A 2A05A 4XKVA 3H5NA 4KN4X 4Z2YA 1FWZA 1PUEE 2DJIA 4E7JA 4J01A 1JI8A 5TJJA 3DP7A 3TDUC 3IHUA 2A68F 3V8JA 5FKKA 2VUMJ 2VJ5A 3OYMA 2HKOA 3JAMZ 1R49A 2XAFA 2L2OA 2KT0A 2R7DA 3GLLA 1MSEC 2KIQA 1ZELA 1E3PA 4OWRB 1ENHA 3SZGA 2FD5A 5KAIC 2ESHA 1ETYA 5FD5A 3PSIA 2ZJRF 4BNCA 4A0YA 5D4RA 4E7HA 2OAZA 2EPFA 2XSJC 3LSTA 1OPCA 2G0EA 1U6GA 2KZVA 2M1BA 1S7OA 3S2WA 3HC7A 2YU3A 4KMFA 2B63J 5DUIA 2E5ZA 1IJWC 3FWEA 3DEWA 4LG0B 2PJRB 4WXDA 3GVAA 5HS9A 3V7RA 2F5FA 1T0FC 3KYLA 3MD2A 1DQUA 1XDSA 3BJ6A 2M30A 4KYWA 3RYPA 1VQ4I 2JA7J 3JRHA 3OYLA 4HAMA 3FXOA 1HSTA 2DOAA 2HYJA 2KDOA 4XIDA 2HEOA 1BIBA 4LIUA 3PM1A 4OIOF 1RIOH 3GFMA 4A6DA 1J9IA 4M71A 2BV6A 4BQQA 2JTVA 2VKVA 3TO9A 1I3QJ 2ZC2A 3LFUA 4XN3A 5AIQA 2XPVA 4A6EA 3KLNA 4IHXA 5HDNA 4DBQA 2HDWA 3HKZA 3PNTA 3GTPJ 1MDMA 2Z1DA 1YG2A 2OC6A 1VQLI 1AOYA 3OYNA 2FSWA 4E7LA 1R1VA 1ZGJA 4RS8A 1BL0A 1LKXA 1WJAA 1P7IA 2D1VA 2UV1A 1U9NA 4BACA 3ROUA 4ZYDA 1G4DA 4P9FA 2M34A 1MNEA 3K69A 5HS7A 3W2AA 4IRGA 1FBSA 3DEUA 1FLIA 1UB9A 3BQZA 1JTXA 5J40A 3S16J 2P5VA 3WGIA 3GMEA 4RAFA 3L7WA 4A3BJ 3DF8A 2TRTA 3BTLA 2OV7A 4HPQA 3W6JB 2EQRA 1T98A 4N9HA 2NAZA 3I59A 1A04A 1K78A 1IDYA 2YPRA 1R5GA 1D5VA 3M8EA 5D6FA 3JSOA 1MIJA 2ME6A 2Q1ZB 1OR7C 2ELHA 2KHMA 1RKWA 2L7ZA 2X51A 4QPQA 4EEFG 2LY2A 1D1BA 1KU7A 1BW6A 2K40A 1YRNB 4C3HJ 3F22A 3WU1B 3F72A 3DLLF 5GPCA 4A5NA 4PGGA 5KCMA 2QA4I 2RNGA 1RNLA 2F48A 1IAWA 4BE1A 5E8GA 3AG4H 3V42A 3DEEA 4BE0A 4MHGA 4XSXF 5F27A 2XPWA 3IUOA 3SEQA 1YYVA 4D9JA 3GWZA 1V5FA 1QNTA 3E6DA 3H1CA 3CUOA 3PO2J 1FNNA 3EPZA 2DA5A 1F9NA 2EFNA 1OQYA 3HSFA 2CW0F 3GBGA 2FA5A 1ZKGA 2MC3A 1KU3A 2H1LA 4HF0A 5FLVA 3KZIC 2E2HJ 3CO7C 3K2ZA 2ELJA 3S1MJ 1I3AA 3CZ6A 5IP6A 3E6CC 3LSMA 5L3FA 4RLQA 2MG4A 5BQTA 3L2RA 1VQNI 4JX5A 1HBXG 1WZ2A 5DM6F 3F6VA 1BJAA 2VIXA 1XGMA 2Q0OA 1ZRDA 4F92B 2COMA 3CUQB 1K6YA 4AD9A 5K5OA 1ZRFA 4JOMA 3WGHA 4G7HF 1IDZA 3PIOF 1ETQA 2XIGA 5EZHA 3HOWJ 2CW7A 4L9VA 1P92A 2ECCA 3E7LA 1GXQA 2DMTA 4OMZA 2MFZA 4LFUA 2RAEA 1Z6RA 2ETHA 4M3DA 3FBIB 4FCYA 1MW7A 1OR7A 2L4AA 3BT9A 3JTHA 4DOZA 1I1GA 2V9KA 4G9YA 1MBGA 1J09A 3M07A 4ITVA 5LEKA 3F9KA 2A6HF 5M5YJ 3R0AA 4DNCA 3FXKA 1FEXA 4ZYHA 4XICA 4XLHA 2GXGA 3QP6A 4P5OA 3S3NA 4ON0A 2VOPA 4YG2F 3A01A 3H0GJ 3OS1A 3Q0UA 2Y31A 1JJ6C 5JVTA 2K3PA 3R4KA 4RAYA 4O6JA 2L3DA 5ILVA 3CCUI 4HDVA 2Y9ZA 2H94A 2IT0A 3PUFA 1ZAOA 2X48A 3HPGA 3OYEA 1GDTA 1B9MA 3KZZA 3H5RA 1ZRCA 5FJ8J 1O7LA 4ZDLA 2YUSA 4B3AA 2LP0A 2LSOA 4UVBA 1WJDA 1XS9A 1Z6TA 3DTIA 4PJMA 2R7UA 2ELKA 1LDDA 3BQYA 4AWXB 2IAIA 4QPOA 1T2KA 4HQEA 2DO7A 3B73A 5FKLA 5B3SH 4NDLA 1MJ9A 3ZRGA 1WVRA 4JK1X 2L7KA 4IVNA 1W36D 2V1DA 1B8IA 3FKIJ 2QEXI 4DYRA 3UR3C 2IS4A 4MTEA 3GEZA 5DCMB 1R22A 2IS2A 1ZARA 3EETA 2Z2SB 2FMLA 1XMKA 4B47A 2CU7A 1H8AC 4D5CA 2DMQA 1A6IA 3OMYA 4XK4A 2F5EA 3PSFA 5ICCA 3BG9A 4L9TA 1TQMA 1RR8C 1X2NA 2P0WA 3X2QH 3S17J 1WQ2A 3S8PA 2TCTA 4I6ZA 5J1RA 4EJVA 1UHWA 3A0BC 2EA4A 2CUJA 2OQRA 3VYSB 3J7YJ 2R5ZB 4Y15A 3Q3SA 1WH7A 1WJEA 2N8GA 1HKQA 1BR4A 4PJNA 2X1EA 2BEOA 5DD8A 5ICEA 2L54A 2X9DA 3BG3A 4HLYA 2LREA 3DTEA 2XKOA 4YEJA 1LQ1A 1HCRA 1HKSA 5E3NA 4UB6C 4A3CJ 4DIQA 1WJFA 2KIUA 1FZPB 2HDDA 5JI6A 4JX6A 4MGRA 2EZLA 4K2EA 5EGOB 3LSPA 2BY3A 3HUGB 1F5TA 2DTZA 1G6NA 3O8GA 2AHQA 4MLOA 1ETXA 2WY8Q 3ABUA 2FBKA 2EJRA 4EATA 4EQQA 4IHVA 3HZJA 1YS7A 4M73A 5FD6A 3O6BB 4U0WA 2YX4A 4AIHA 5DD4A 3ZGKA 4AVZA 1FP2A 2E1MC 5HODA 1OMIA 3IKVA 2CV0A 4HF2A 3FXJA 2HYFA 3F8NA 3NWTA 1MBFA 1FBQA 3HHGA 3S2DJ 2IA0A 1U0JA 3WTVC 2PJPA 4GGGA 1YTYA 3J81K 4O5VA 5D5UB 5EYRA 3K4KA 5LHIA 4RB0A 3ONQA 1GV5A 1FYMA 4M6VA 1VQMI 2RQPA 2O03A 3FBNB 4M6YA 4HX7A 3IC7A 4A3JJ 4RAGA 3L2VA 2A5WA 4N4OB 3S93A 1ZGAA 3WTUC 3MAJA 2OTJI 1DUXC 2FE3A 1NH3A 2X4HA 1UHSA 3KPHA 3RPUD 2NNYA 2EZIA 2VQGA 2VKDA 2ZNYA 2Y0MA 4M72A 3H9QA 3OIOA 4E70A 5GAHJ 4BYYA 1PYVA 4L9NA 5EEGA 4IKFA 1Y8RB 3IAM2 2XGDA 3ULQB 2LNBA 2VL8A 3S3OA 3L00A 2M4KA 3R6SA 4F93B 1O3TA 1TT0A 3LSKA 4HBLA 3TP3A 3C2GA 3CMAI 1MNMC 5HOOA 2KFDA 5H20A 1OISA 2CSOA 1TZLA 2VC0A 1A6QA 2BY0A 5EDNA 1XX5A 4HOBA 3RKXA 2GZWA 4XN0A 2JWTA 2XF5A 1LFUP 3F8BA 4LJZF 4RA2A 1V4RA 3ASOH 3MWMA 3BCAA 3LSHA 4RB3C 1IXCA 1Q1HA 2NYXA 2Z99A 1T56A 3MCZA 2R4GA 3WTSC 1IUYA 4CYCB 1FOXA 2AQFA 2K9MA 4L5IA 4HA8A 4BJ5C 4ANJA 2EZKA 1BI0A 1UZCA 2EV0A 4I02A 3CCSI 1QZEA 2UZKA 1YIJI 3HM5A 4C9YA 1QVUA 1S7EA 3L9FA 3OOPA 2MA3A 1A36A 1JJ8C 1ZG3A 3OY9A 3ISPA 2Y2ZA 2JT1A 2VJJA 5KK1A 3WG7H 3JRDA 2X6XA 1LUJB 1YJNI 1RR7A 1R00A 3AL0B 4BDZA 4LOCA 5ILUA 2HYGD 4OU0A 4B3XA 4YFXF 1K6OA 5B1BH 4OINF 1O57A 3CF2A 4G6TB 3TP0A 2LY9A 2QVOA 4LLNA 2RGVA 2M45A 3VYRB 1UELB 3K70C 2HU9A 2MD5A 1Z0XA 2VC1A 4CHUA 4CGZA 2CS3A 3VWBA 5FKOA 3G3ZA 1Z67A 5H6QA 4BBRJ 2QSHX 3RI4A 1YHQI 4BU2A 4H0EA 5E1WA 1Y0UA 2ZMEC 4Y3OA 2EILH 4B48A 5IYCJ 1EA3A 4E7ZA 1Z77A 3BR1A 2W48A 2ZXJA 3ZMZA 3IH4A 3WTYC 1JHFA 3K4MA 2R92J 1W7PA 3B6AA 3HXLA 2GIZA 2EIKH 2L7FP 1GLNA 3TBIA 3CJNA 3HTSB 3ZQCA 3E0JB 3I4MJ 1MBJA 3GTGJ 1R5HA 2CG4A 3CP2A 1GVJA 2R7FA 4F91B 4WXCA 2DODA 2NVXJ 4R8HA 4BDYA 1XB4A 1ONVA 1BA5A 2E35A 4Q4ZF 2RC4A 4I7HA 1UAAA 2R7XA 2OQGA 5D5XB 3AKZA 2HPMA 1LNWA 4G12A 2NVTJ 1TWCJ 2HVSA 1LFBA 3VB2A 3I5UA 1SD7A 2EFWA 1YO5C 1P4AA 1WPKA 1H9GA 2CO5A 3OR2C 2GAUA 1APLC 4EVIA 3GO5A 2XGXA 2KRFA 1E3HA 4G6QA 1HW1A 2KJCA 3G4SI 1DPRA 1FP1D 2LH9A 3NARA 3DQVC 1B4AA 2DT5A 3KETA 2A69F 5IT9Z 3VSKA 2W82A 1MDMB 1YX3A 1VQ8I 1YIOA 4JP0A 3I0TA 1G59A 4RGSA 4F7ZA 5JR3A 4O3MA 4XONA 5CVIA 4R79A 4ZC3A 1PVEA 4M3GA 3VPRA 4ZDOA 5L3BA 2HGCA 3JAMK 4U87A 2NRAC 1E17A 1X4PA 1EH7A 1VI0A 2P7CB 4CXFA 4GRIA 4UY8I 1P4XA 2XB5A 2DMPA 2DMUA 4Y52J 2L0KA 5L3EA 2CV1A 4XLCA 2ZO4A 1YI2I 3IAS2 1USSA 3LA7A 2ZMEA 1D1CA 3BG7A 2ZB9A 3IP4B 2DYSH 3T1BA 1U9OA 1XGSA 2ID3A 5J1YA 2ESNA 1WSUA 4N9IA 2LF7A 2E2IJ 4CCNA 2E36A 3MKWB 4LD5A 2M0MA 2HXIA 3FXMA 1K78B 3GTQJ 2KPMA 5IY5H 1D5YA 2OUMA 2HOSA 2A3SA 1TWFJ 3BJOA 2R7TA 1IRXA 2Z5UA 2M3AA 5E8IA 4Z6YA 4M3EA 3DBHB 5FLXZ 4C3IJ 3MKYB 4BXUA 3DBRB 2DDAA 3CCRI 5BPDA 3I4PA 1Z1DA 3K7AJ 4GFBA 2QWWA 2QQ8A 1NK2P 2LKSA 4LB5A 2HOAA 4HRIA 1V3FA 3BDDA 2NOJB 2V1UA 3LL7A 4PFPA 2XUBA 4CO8A 3O2PE 5JHUA 2M2EA 1WGXA 2X1CA 5C4JJ 2L02A 3TW7A 5KAFC 2CH0A 5F6FA 4C30A 2JRMA 4OMYA 3F21A 1H9TA 2LVSA 2P6TA 1J5YA 2XB0X 2LKPA 2XPUA 4YIRX 2K9LA 4A3KJ 3T0YA 1IG7A 1ZYRF 2XSDC 1BI3A 4EV0A 3JREA 3CDHA 3CO6C 2O0YA 2VBXA 3BPXA 4W97A 2IXSA 4A3MJ 1FYLA 2KQRA 2HQ5A 4F55A 3M7GA 3Q0VA 1GT0C 1NG6A 4MFDA 3LMMA 2M8GX 4UB8C 2CW8A 2DLLA 4U7DA 1Z9CA 4JQFA 3ZXSA 1R6RA 3B02A 3J7AY 5L3CA 4F3QA 3SXYA 1LPQA 1HLVA 5L3DA 4ESFA 1Y1VJ 1VTNC 4HX8A 3HGGA 3QAHA 1FMVA 3VSLA 2PLYA 5IOZA 1HDPA 2R0QC 1BC8C 4GDFA 4ESJA 4ZTFA 2RNJA 4IHYA 5HLGA 3K4LA 1ZR4A 4M9ZA 1SFKA 3DWLE 1N25A 2JK3A 5K5QA 2NXNB 1U8RA 1BW5A 4U7BA 3FKJA 1UJ8A 2BW3A 3S32A 1EKEA 3AG2H 4LLLA 2FMYA 4EJOA 4ZDPA 5GAEJ 4RB1A 4A3IJ 4A0ZA 3CD6I 3KE2A 3LAJA 4I09A 1NK3P 3S14J 4EM0B 4P1WA 4QSHA 3A01B 2KRCA 1ON2A 3CC2I 1SMTA 3EQLF 5KHDA 4Q47A 1JXSA 4UV8A 2Q2EB 1Y8QB 2IRFG 4V2FA 3LAPA 2G9WA 3BLYA 1ERDA 2QQ9A 2K9QA 3F3XA 2W00A 4NNJA 4EJUA 1P2FA 1ZR2A 1IRFA 4RM2A 3PFYA 3EYIA 4BY1J 4A12A 3S2HJ 3WG9A 2VBZA 1VNDA 3FM5A 1H89C 2HPIA 4HDUA 1QU3A 2H1KA 2EFQA 2DPUA 3KIOA 4UNOA 1YQAA 3NWSA 4NC7A 3ZMDA 3GLXA 3OYIA 1KQ8A 2V7FA 1G3SA 3WTTC 1S8NA 1VQKI 3HOSA 3WODF 1K4SA 2JVHA 4ENNA 1XTAA 1RZ4A 1MMGA 1LDJA 3BTCA 3L2WA 2JN6A 3L2CA 1F36A 2JA2A 2OCCH 3CESA 2VN2A 1FSHA 2R5YB 2ZCWA 2KKOA 5CYVA 2X1DA 1TBXA 1MMNA 5GADJ 3F8FA 1PJRA 1XSXA 3DKXA 1ZREA 2V6EA 2DK8A 3T8RA 1AKHA 1Y39A 5TGTA 3DPLC 3TKYA 2D5VA 3C7JA 4B1RA 5HS8A 2R7WA 3D5RC 2FBHA 1WKMA 2DU9A 3BTIA 1IUFA 1R36A 3FMQA 2DI3A 2W1OA 4XL9A 1LFPA 3COAC 1ACIA 4LB6B 4E7SA 1GHCA 2B7EA 5JLXA 5F64A 1RESA 2Y48A 3K1PA 1KU9A 3MKLA 1V55H 4JBAA 4CA0A 2L9NA 2IJLA 3CCMI 3H5AA 4GCVA 2OF7A 3CJQB 4ENJA 1EF4A 5LRSA 4BQOA 4IOCF 3PJRA 3WTWC 1R23A 1T8IA 1Z05A 4M9XA 1BN5A 3MVPA 2ZJ2A 3QYBA 4CCJA 2WV1A 3I53A 1P9QC 4ABZA 1X19A 1DP3A 2Q8KA 3U1DA 2XF7A 1OLTA 4CCMA 5HDGA 4XORA 1OCCH 1SD6A 3MQ0A 3IL2A 1U3EM 2YU9J 3K4CA 4BUPA 4LIVA 2UWMA 1XG1A 1MMSA 1HXDA 4BHCA 1FTTA 5H2FC 4KA4A 2O8XA 3GZ5A 3ZQIA 5IPAA 1JGGA 4IRIA 3JCUC 5A2QZ 3G73A 1SMYF 1LE8B 1B1BA 4CDGA 5LGTA 1IRZA 1QZYA 2IA2A 3E5UA 2R7OA 4IF4A 3KP3A 3OSFA 3M4OJ 2R7RA 3HGYA 2OJED 5GPAA 5EG0A 1FC3A 2VBYA 1MH3A 3C18A 4XR6A 2EINH 2Y75A 3MKZA 1XSDA 4Q5SF 1RKTA 5CPRB 3BR0A 3ZP5A 4RLFA 2E2JJ 1MGTA 2P5KA 2K27A 2BOLA 3E6MA 3KP5A 3S1QJ 2FQ3A 3ZN1A 3FISA 3BROA 2HI3A 3HDDA 2F2EA 1OCRH 2E60A 3FMSA 3K10A 4HZFA 4EJWA 3QQAA 3N4MA 2ZJQF 4MQVA 1R58A 1MJBA 2D45A 1U78A 3U9GA 3VOEA 2LBFB 2JUGA 5FO5A 3SFZA 4TV7A 1ZQ3P 4LITA 1K79A 1HSJA 4G94A 2WTEA 3SYTA 2AS5F 4B09A 1JE8A 2F5CA 3SZPA 2K4BA 3HOUJ 5DEQA 4FQGA 3L2UA 2C6YA 5K7FA 1J59A 4BBSJ 1X3UA 3TO6A 3QP5A 4IQ4A 1VQ9I 2DA7A 4IJAA 2E1CA 4BL0B 5J4YA 1KZHA 3WU2C 3VDXA 3I54A 3BWGA 1OCTC 3NQOA 3L09A 2VPRA 1TQIA 2E1MB 5ICGA 4N4NB 1LJ9A 1X4OA 4NQWA 3HOYJ 3H9GA 2K9NA 4P55A 1QVTA 1Z3XA 1X3ZB 1ETOA 1REPC 3MZYA 3LWFA 4M74A 3W6KB 3WHBA 4HNVA 3HIFA 4CCOA 5K1YA 4AIKA 4HW0A 3MEXA 5DUKA 1EH8A 3JRIA 5F0CA 5CVRA 2CWEA 5C44J 2LLKA 3DU6A 3G6EI 1X58A 4ZH4F 2GA2A 3DBLB 4EMSA 9ANTA 3OL4A 1BOAA 2Y69H 3D5SC 3OWTA 3LFKA 1D3YA 2PMHA 2P6SA 3ESWB 3DXJF 4BQAA 3I9V2 1MMDA 1X1DA 1YITI 2LTPA 3M3YJ 2E5NA 3GZNB 1TL8A 2EA2A 2MSYA 2NVYJ 1XN7A 2PG4A 2HQNA 1SAXA 2WC2A 3M8JA 3LA2A 3P5JA 2FF4A 2BYVE 1W4MA 3OSGA 2FBIA 1O4XA 3K4BA 5K7ZA 1ZHFA 4BE2A 3T5XA 5FB2A 2WBMA 4WWCA 4EJTA 2H6CA 2LOOA 2MW8A 5LHHA 2VPLA 2XAUA 1PUFA 4LG0A 1FYKA 3RYRA 2KZGA 2PJRA 2YX7A 3IRRA 3LNQA 2ISZA 3Q9VA 1X2MA 1JUSA 1SVLA 4P9UA 3K70D 2L5QA 3S1NJ 2AO9A 2W84A 2O8KA 1K7AA 1BI1A 3BP8A 4PSXA 1XMAA 2XV4S 4IZZA 2DA3A 4HG2A 1IN5A 4KICA 1D0XA 4CYDA 4MFEA 5IT3A 2X85A 3AAFA 5J6XA 1OCPA 3TW6A 2QZ8A 4XM3A 2CMPA 2PBIA 2FEZA 2LF8A 2O7OA 3RKYA 3RJPA 4FE7A 4RM3A 1W0TA 2WY7Q 2DTRA 1R7JA 1EH6A 3RZOJ 2GQQA 5LLQA 3A2KA 2KP6A 3A03A 1K83J 4F52A 2IPQX 1I39A 3BY6A 1U5TB 2QQBA 3ZQ7A 2XAGA 1X1BA 2VQCA 2JJ7A 2DFIA 5J8CA 1R4NB 1PDNC 3HOVJ 5D8KB 2E1NA 1YFHA 1TT5B 4GYGA 4ASNA 3TMOA 4EGYA 3CUQC 4QWQA 3RIRA 3J7AO 5BNGA 3KYDB 4KMUX 3J7ZI 2BVMA 1V5EA 5LEJA 2GLOA 3KEOA 3CDIA 3F23A 3UKGA 3CCEI 1MSFC 4WF2A 5IP7J 2ICWG 3BR6A 4FT8A 5LGNA 4QIWN 2BHZA 2X0LA 3VEPA 4LLGF 1D8JA 5D6EA 1WI9A 3N05A 3LOCA 3W2VA 2V1NA 2HQAA 4OAZA 4RAZA 2E7WA 2QGUA 3FXUA 5CVVA 2XVCA 4UUSB 5DTDA 5J1UA 1AWCA 3DLAA 1WRJA 2O61A 3FX3A 1YRNA 3K1NA 1T95A 4AU7A 1FPQA 3Q5FA 1OYIA 2XRLA 4HX4A 1IZ1A 3FM3A 3VODA 1X1PA 1YS6A 3QPSA 2EZHA 1EV7A 1W1WE 3M1CA 3AFHA 2L01A 2LY1A 4LGWA 5IT9K 1STZA 2QKMB 3H9JA 2QLZA 3CMMA 3PQKA 3QOEA 5J4VA 1RUNA 3CLOA 3HSEA 2V9VA 4KFCA 4I2OA 3HRMA 1UHMA 2KJBA 2DK5A 3AG1H 2HZDA 2ZFUA 3T8TA 2XGEA 2IEKA 3ZQQA 1UG2A 4PGHA 2CGPA 1ODDA 2OZ6A 5B1AH 2Z16A 4LK1F 4IHSA 4B44A 5CVJA 3J80Z 1VF9A 3KLOA 4FTHA 2DT6A 3BOQA 3CJTB 4E6KG 3JRAA 2XHKA 3CUQA 1X3WB 4YFKF 4ZZDA 2RV8A 3O8HA 1ORKA 1LEBA 3N97A 3KX2A 1JKPC 3B6CA 3OYBA 1KYZA 5DDGA 3KP4A 3E5XA 4DYCA 1Z21A 4FE4A 3HYIA 3ZQLA 5FLXK 1LDKB 3G1OA 3K4JA 4S05A 2W57A 4ETSA 3DPTA 3BC8A 5IP9J 1Z91A 3CJRB 5LD2C 2XGCA 1C0WA 2VI6A 2CYYA 2I10A 5FKMA 4EM1A 5C4XJ 4RGXA 1DGRM 2WADA 4BEHA 1ZTRA 2OPTA 2WV0A 4KUMA 2XROA 1WWXA 3ZCOA 1HF0A 2P4WA 1KYWA 2BW3B 3HB9A 3CF5F 1KQ0A 1GXPA 5CKTA 4OAYA 3IWZA 4AC0A 1TW2A 3RTRA 4U88A 2Z3YA 2EIJH 1T08B 5GP9A 4DJAA 2COBA 2FQ4A 1S29A 2ECBA 2NOGA 1L3LA 1HDDC 2KIMA 2MLGA 4D5FA 4BAYA 3VYUB 2IA1A 2UXXA 4DZJA 5J8FA 2MYSA 2V9PA 3ABKH 3SQNA 4UUVA 3M8FA 1VZ0A 2QM3A 4XKBA 1SFUA 3WTXC 1BI2A 3W6VA 1T38A 1YX5A 3CC4I 3DFGA 2GBYA 1UMQA 3EUHA 4DBRA 3I58A 2DA1A 5C3EJ 2HXOA 2KDZA 2FUG2 1Z3YA 2LMDA 2MLKA 1SFXA 1M1EB 3GFLA 1IRGA 2K4JA 5KVRA 2MC4A 3SZTA 4ENKA 4QTRA 3E5QA 1DGWY 3IH2A 2M8EA 4AM3A 5FKNA 1A5JA 2M4GA 2RN7A 2VKHA 5J3LA 4MTDA 3PUBA 3WTZA 1H88C 2E7XA 1JUPA 4NC6A 4DW6A 3HPHA 2NVQJ 3WU0A 2QSFX 2R7SA 1SFOJ 3DV8A 1V54H 1WJ5A 1KGSA 5M5XJ 1HW2A 2JA8J 1YW7A 2PN6A 1VQOI 2E34A 2KL4A 2VE9A 5BPIA 3HOZJ 2DQRA 3Q0WA 4I98B 1I5ZA 1WFXA 3H0DA 3P9IA 3WGGA 2W4SA 2IGMA 1MBHA 1QRYA 3CTAA 4ZJZA 2R5ZA 1IV6A 1I50J 2OZUA 2V4JC 3A4CA 1QZZA 4C2UA 3LSGA 2CQKA 1WHUA 4BH9A 2EWNA 4OIQF 2YSRA 4DQ2A 1ZG1A 1IV8A 3E3VA 3KEQA 1QBJA 1N78A 2STTA 1FX7A 3CP8A 2IVMA 1QPMA 2GWRA 2CV2A 2HQRA 3CDLA 1F43A 3SEZA 3G2BA 2RKHA 2XAQA 4M6XA 2WB1N 1O7FA 3I59B 3HUGA 5D4SA 4I01A 3JSPA 2B0LA 2M9HA 1LEAA 2PFBA 1J75A 1VQPI 2D1HA 1SANA 5EEHA 1AU7A 4H4KC 4IL6C 1B72A 2WAQN 4HNUA 5AONA 3PIPF 5HNFA 2BY1A 2Y0SN 1FSEA 2XF6A 3RSNA 2JQ7A 1RETA 4KIBA 3HTUA 2JA5J 2OBPA 4CUGA 4FX4A 2F4MB 1E3OC 3EDPA 2K86A 4NBQA 2R93J 1IF1A 4AYBN 3CCYA 1T33A 5DV5A 2XAJA 3BR2A 1XGNA 3DU5A 2DMNA 2IGOA 2V6CA 4A3EJ 4XKWA 3Q9SA 4FETA 2O9LA 4G6DA 4AUXA 1WI3A 5EG0B 1IW7F 2BXZA 2OCEA 3TDZC 1VQ6I 1TNTA 3KZYA 1MZBA 3D1NI 4XRSG 1ZGWA 4UUTA 4XQFA 3WE2A 5DYMA 1FJLA 3ZMTA 4MEXF 4IEJA 1U2WA 3HHHA 3WHCA 2P7VB 4XRSA 1D8KA 4CCLA 3MZHA 5HLHA 1IN6A 3O3KA 3TO7A 2FX0A 4I76A 1AHDP 2VE8A 4I0AA 1BM9A 2CFXA 2RREA 3HRSA 4XNFA 4XLNF 3KP7A 4IHWA 4NHJA 3VFZA 4IX7A 1R5ID 1TLHB 2HS5A 3GW2A 4AIJA 2MH9A 2EV5A 3OIQA 4A2UA 4FASD 2J5OA 2QBYA 2G7HA 2J5PA 5H6RA 3R0JA 1E0EA 2GOXB 5A2QK 1MBKA 2HKXA 4CYCA 2I8DA 3QYEA 5CQGA 1J0RA 3GTKJ 4HSTA 2E71A 3RQ4A 4UV9A 3HJEA 4G8XA 3EUAA 2P81A 2ACJA 2KMUA 3QPLA 4DYQA 2P5LC 3RCOA 4NQWB 2W25A 4A3DJ 3E6BA 2JSCA 4J19A 4D1QA 1SC7A 3ZPLA 1HKTA 4KT5C 1XDUA 1R71A 2Z9OA 2DJNA 2EV6A 3MMYB 2CJJA 1K61A 4LK0F 4A69C 2IBDA 2DT7B 3CCVI 1BBYA 4C2TA 2DFFA 2W7NA 3IKTA 3CCLI 2OU2A 2JVGA 2PMZN 3JW4A 3OYKA 1YLFA 3LA3A 1ITYA 5ED4A 2A07F 3PNYA 3GTOJ 2H6BA 2R7ZJ 5JVGF 3V4GA 3HRTA 1DU0A 4BY7J 2CUZA 3TOAA 4UXNA 4HEA2 1JT6A 1GV2A 3KP6A 1SEUA 1YOVB 1D0YA 3SDBA 4PJ0C 5E20A 3ABTA 1XCVA 5IYDJ 3GF2A 3GZ6A 2EB7A 2BY2A 3ML6A 2JMWA 1IGNA 1FY7A 1B8IB 2DA6A 3K2AA 4PK4A 5TRDA 3OYHA 4CCKA 1WCMJ 1RC9A 1KONA 4QLCU 3A0HC 3IRQA 1VQ5I 1PUFB 3CMYA 5K5RA 1XPXA 4DZPA 4BHPA 1O3SA 2NVUB 2JA6J 1HA8A 3OYJA 1HW5A 1JTYA 1O3RA 3D0SA 1OKRA 2ZFWA 1N75A 3MN2A 3DTKA 1TTYA 3ASNH 3OV8A 4RGRA 1F1ZA 2FU4A 2XRNA 4XLEA 1B6AA 1RPWA 2W85A 4XLAA 5IYBJ 3IV5A 2H8RA 1HQCA 2XAHA 3DCFA 2WB1A 1XGOA 4XOTA 3GYHX 2L4MA 2A5YB 2GOMA 3ECOA 2EFOA 2X6WA 2PMUA 1XSVA 2I5UA 3FXLA 5CQEA 4XKCA 4OIPF 2X6YA 3DPUA 3CMEI 1ZG5A 2WAQA 3ERMA 1G2HA 5GTIC 2LFBA 4BXXJ 3TQNA 4M3BA 2DCEA 2QSGX 2Y0SA 4D7NA 1I6HJ 3ZQFA 2A61A 2F4IA 3OYDA 5IOYA 1UFMA 4BGDA 2MH2A 3DKYA 4AYBA 1R1TA 3F8CA 1LVKA 3UNGC 3BR5A 2DOEA 1LB2A 4HF1A 4BJTA 4L18B 4XLFA 2DW4A 2QCOA 3QU3A 2DOFA 4PDKA 2ME0A 2K02A 1SVOA 4ESBA 3RKQA 3S15J 3R61A 3L2QA 1CF7A 1QHHD 3P9KA 1YJWI 4HNTA 1JKRC 4L9JA 3GTLJ 3FHNA 1XD7A 5EJCA 2LRDA 1XCBA 4C3JJ 5LRRA 1W5SA 5ILSA 4PFOA 4ZYGA 2GXAA 2PI0A 5FRMA 4E4HA 5E18F 1L0OC 3LSRA 3EUKL 3C3WA 1T0FA 4NUBA 5DCFA 2VONA 2PQ8A 2EH3A 2LC2A 3DKWA 5CJ9A 6PAXA 2HTSA 3EYYA 4A3GJ 1MMAA 4X6AJ 4KT6A 1FOKA 2R7QA 5CVUA 1G3TA 5KNLA 3ABMH 2QUFA 2PX9A 2BGCA 3SJMA 3I64A 2MABA 5HLIA 3OS0A 4HYEA 4XRFA 4WXHA 2HR3A 1BJZA 1BR2A 1YW9A 3BZCA 2O5RA 3HEFA 4X0GA 4BJ6C 4UVAA 2BZTA 4UVCA 2F5DA 3A02A 4RGUA 1Z7LA 4II2A 1FBUA 4MNUA 1I6XA 1IXSB 1G8XA 4MQ9F 1W0UA 1SFEA 3OS2A 3QWLA 3PO3J 2VLAA 2M87A 2KIFA 3BZKA 4ZYAA 2K5CA 3K0LA 1DU6A 1U8BA 1IO2A 3BJAA 3F0CA 4JYKA 1QO0D 3JRCA 5EZGA 1P4WA 3ZR8X 2LYCA 4XBFA 2PMZA 3FXRA 2VBWA 1IN8A 1D1AA 5E79C 2DDBA 3FF5A 3JRFA 3MZ8A 2AXTC 2LG4A 1W7PD 2HTJA 3V7CA 3FK7A 3CCQI 1S72I 1IN7A 1BC7C 1JUMA 2WA0A 3F8MA 2JPBA 4B43A 3FDYA 3GTMJ 2EFPA 3GFJA 5F0FA 5M5WJ 2FOWA 4BEHB 4A5MA 4DGWB 1R1UA 1IC8A 5L3GA 2FXAA 4S04A 1NHAA 1D0ZA 4E7KA 1WJCA 2YR2A 2XKPA 4PJLA 5EEAA 2WWYA 3I55I 3H92A 2IS1A 1Y56A 2DBBA 1ETWA 5E3LA 2DYRH 3OL3A 2Q2EA 3QODA 1ZN2A 2DA2A 3FZVA 2EK5A 3ZMSA 4L0ZB 2ZBKA 3H3ZA 4ZTJA 1W7PB 3RZDJ 3JR9A 3J80K 1FTZA 5F08A 1JKQC 3FHZA 1WJBA 1FOWA 4AVPA 2VOOA 2OA4A 2JPCA 3QPTA 1FIAA 3V7SA 4FX0A 1MNDA 3K9TA 2NNNA 4G7OF 4LG3A 3PNVA 3HOTA 4OOIA 4HQMA 2EBIA 3LQQA 4GO1A 2L9RA 5HVQC 1OCZH 2P8TA 4BHBA 1H0MA 3H3VK 3HL2A 2DN0A 4M9SA 1PP7U 1VQ7I 1S6LA 3HBLA 2L9SA 1MJAA 4I99C 3FXQA 4B8XA 3CC7I 1TNSA 2R5YA 3ZQHA 2VODA 4P96A 3C1DA 2XC7A 2JUCA 2M0CA 1DDNA 4CZCA 1OJLA 1TWAJ 2HOEA 3HG9A 2QYOA 1Z7UA 1P7JA 1ZLJA 3V8KA 1XMXA 5ERIA 4A93J 4BKXA 3KCCA 4WK8F 4JX4A 4BS9A 2CUFA 2LD5A 3SDGA 4PJJA 1V5GA 5HLTA 1NTCA 3HOXJ 2ADUA 1W5CC 2ISYA 4WCGA 1I1SA 2NS7A 2NS8A 3TOBA 3OYAA 4W1UA 1ZH5A 2MD0A 2BVLA 3GTJJ 2LKXA 4L0YB 2ZMEB 4J00A 2WAEA 4KITB 4M3FA 3BZ6A 3ZQGA 4YFNF 2CFOA 4RBOA 5E3OA 3ABLH 2F5VA 2F6CA 5B66C 4KJZA 1XC5A 1X1CA 2JSPA 3QPHA 4Y13A 2HFHA 3RQIA 5FGMA 1MBEA 3OYFA 2CQXA 4RMNA 4A0XA 3A1YA 3BR3A 3K4NA 1TWHJ 1B59A 2VASA 2NS0A 5M3FJ 5F04A 4CICA 1MKMA 3IH3A 1B72B 4PZJA 3GXOA 1QA6A 2K9SA 3SHFA 4HSRA 4MEYF 1RUOA 2LDUA 1MH4A 2QF7A 1LE8A 2BBYA 1CGPA 4KNYA 3PFIA 2ZJPF 2HVRA 1FOYA 2HNHA 3I3LA 4XOPA 2DA4A 2R7VA 1QHGA 3ELKA 4BQNA 5F1JA 3E1SA 5M3MJ 1T6SA 1UG0A 3GX4X 3JRBA 2Y30A 1HC8A 3EUHC 2VQLA 4D0PA 5TISC 1FMWA 3I71A 3R60A 5CLSA 3OYGA 5GTHC 5D8LB 4WX9A 1OFCX 3D5LA 5ICFA 3G1MA 4GXOA 4Y17A 2AXLA 1I27A 1QQIA 3LSJA 5AIPA 4NC8A 3FIWA 3CCJI 3KP2A 2W24A 1GVDA 3NEUA 1MD0A 2ZXWH 2XDVA 3JTGA 2VT2A 4Q48A 2VT3A 2LBFA 1Y0NA 1IXRC 4PSWA 5E3MA 1RRJA 3V8LA 1S5LC 3GUDA 2ZKZA 3P7NA 4XLPF 4RDUA 3ERED 4YIFA 1J7KA 2EIMH 1QGPA 4G7ZF 5K7HA 1TP4A 2IGKA 3U2RA 2KLOA 3E97A 3OYCA 2QBYB 3S1RJ 2A6EF 3NAUA 1SVMA 3LSIA 2MBFA 2GXBA 1POGA 2DQLA 1O3QA 2FOKA 1KA8A 3F6OA 2H8WA 1W5TA 2HVQA 4KIGA 2VQHA 5GAGJ 1BIAA 1W36C 3H36A 1DP7P 4Y4RA 4LMYA 3ECHA 5D5VB 2L7MP 2VJ4A 3HSRA 1SAUA 3KEYA 2CQQA 1S9HA 3JRGA 2HDCA 4YELA 2UXNA 2VJIA 2M7BA 1U5TC 3OOUA 5HNHA 4I0BA 2Z33A 4A3FJ 2GA1A 2FNAA 1ZLKA 2STWA 3RDIA 1KU2A 1WH5A 3I56I 4XSZF 2IS6A 2BHYA 5E1ZB 3BG5A 2X6OA 1QPIA 1VFCA 3QYFA 1KQ9A 3REOA 3AG3H 4X1EA 2QQAA 2O3FA 3U21A 2AQEA 4N0BA 4Y33A 1TQPA 1HOMA 3H35A 1FT9A 4FHTA 3NRVA 2E1OA 2FJ1A 1UCRA 2FNPA 1TC3C 4IXAA 1NG7A 5BS6A 2H27A 3FMRA 1FIPA 2K85A 2MGQA 1B9NA 5DCMA 3PL8A 1USTA 4C2MJ 2CUEA 3TL4X 4XMYA 4B4CA 1AA7A 2QENA 3KFWX 1JT0A 4E7IA 3MFKA 2ZXIA 3QU6A 4CSWA 3LQRA 5JFRA 4V2GA 1ON1A 1PP8F 5F0HA 2O6GE 5JHFA 1AKHB 5E17F 1BR1A 3CQZJ 4CH7A 2BE5F 2GIVA 4HV6A 2Y9YA 4RB2C 3J81Z 3SFIA 2RQQA 3H3UA 2CRGA 2IGNA 2HZTA 2JRTA 2A6TA 4GYIA 2M5WA 3ZMUA 1ETVA 2CQ7A 2ZNZA 2KISA 2GM4A 5J47A 5FRNA 4EM2A 3W2WA 5B5EC 4U0YA 1LVAA 1YE9A 4L5EA 1R9TJ 1ULYA 1A35A 1Y6IA 4CZZA 1U5TA 3G71I 2DFEA 2E19A 2PEXA 4KIFA 3ZOBA 1A31A 1JKOC 2XASA 4II3A 3ZN0A 5EGOA 1S7AA 4PUSA 2ZSIB 5BOXA 3HKZN 5F1RA 2IP2A 2UUZA 2VKEA 2H09A 1G3WA 2LR8A 2R3SA 1OYYA 3C2HA 5LFAA 2BXYA 4R1HA 4IQJA 2OTLI 2M7AA 1N77A 4IOAF 3S3MA 4D7MA 2JZYA 4S0HB 3CLQA 5DM7F 4KN7X 4BXFA 1S3JA 5LHGA 5LBQA 2F4OB 3QRFF
chains in the Genus database with same CATH topology
1F4KA 3RKWA 2DAOA 2TDXA 4HV5A 4IRHA 4OIRF 1CF7B 1YW8A 2VXZA 5HDKA 5BMZA 3PQJA 2RDPA 1T39A 2D2WA 4ZZLA 1JGSA 1RI7A 4IHTA 3M9AA 3IWFA 2OD5A 4ZYEA 2IW5A 3K1MA 1J2XA 4IPAA 4HLXA 5D5WB 3BPVA 1IN4A 1P6RA 1SD5A 2K7LA 5FFZA 4PCQA 4L5JA 1JHHA 4U0VA 3WE3A 1DPUA 2V79A 1OYWA 2HWVA 2DPDA 5LGUA 3TGNA 3RPQA 1SD4A 3RPUA 2RVCA 4UHTA 5FFXA 2FRHA 3HRUA 3QOPA 4EGZA 1G3YA 2V1XA 1E2XA 4KDPA 2G7UA 3GFIA 4NB5A 3P9CA 3ZMVA 1TW3A 4ENMA 3M1EA 5E1XA 4YIIA 4KN4X 4Z2YA 1FWZA 1PUEE 5TJJA 3DP7A 3TDUC 3IHUA 2A68F 3V8JA 2HKOA 3JAMZ 2XAFA 2R7DA 2ESHA 5FD5A 4BNCA 4A0YA 5D4RA 2OAZA 3LSTA 1OPCA 1U6GA 2M1BA 1S7OA 3S2WA 2YU3A 4KMFA 5DUIA 3FWEA 4LG0B 4WXDA 3GVAA 5HS9A 3V7RA 2F5FA 1XDSA 3BJ6A 2M30A 4KYWA 3RYPA 4HAMA 1HSTA 2HEOA 1BIBA 4OIOF 1RIOH 3GFMA 4A6DA 1J9IA 4M71A 2BV6A 2JTVA 3TO9A 5AIQA 4A6EA 3KLNA 5HDNA 1MDMA 1YG2A 1AOYA 2FSWA 1R1VA 1ZGJA 4RS8A 2D1VA 3ROUA 4ZYDA 1G4DA 4P9FA 3K69A 5HS7A 4IRGA 1FBSA 3DEUA 1FLIA 1UB9A 2P5VA 3WGIA 3L7WA 3DF8A 3W6JB 1T98A 4N9HA 2NAZA 3I59A 1A04A 1K78A 2YPRA 1R5GA 1D5VA 3M8EA 5D6FA 3JSOA 2ELHA 1KU7A 3F22A 3WU1B 3F72A 4A5NA 4PGGA 1RNLA 1IAWA 5E8GA 4MHGA 4XSXF 1YYVA 3GWZA 1QNTA 3E6DA 3CUOA 1FNNA 1F9NA 2EFNA 3HSFA 2CW0F 2FA5A 2MC3A 1KU3A 4HF0A 3CO7C 3K2ZA 3E6CC 5L3FA 5BQTA 1HBXG 3F6VA 1BJAA 1XGMA 2Q0OA 1ZRDA 2COMA 3CUQB 4AD9A 5K5OA 1ZRFA 3WGHA 4G7HF 2XIGA 4L9VA 1P92A 1GXQA 4OMZA 4LFUA 1Z6RA 2ETHA 1OR7A 2L4AA 3JTHA 1I1GA 4G9YA 5LEKA 2A6HF 3R0AA 4DNCA 4ZYHA 2GXGA 3QP6A 4P5OA 4ON0A 2VOPA 4YG2F 5JVTA 3R4KA 4RAYA 4O6JA 2L3DA 5ILVA 4HDVA 2H94A 2IT0A 1ZAOA 1B9MA 3KZZA 1ZRCA 1O7LA 2LSOA 4UVBA 1Z6TA 1LDDA 4AWXB 1T2KA 4HQEA 2DO7A 3B73A 1MJ9A 4JK1X 4IVNA 2V1DA 4MTEA 3GEZA 5DCMB 1R22A 1ZARA 3EETA 2FMLA 1XMKA 2F5EA 5ICCA 4L9TA 1TQMA 1WQ2A 4EJVA 1UHWA 2EA4A 2OQRA 4Y15A 1HKQA 2BEOA 5DD8A 5ICEA 2L54A 4HLYA 2XKOA 1LQ1A 1HKSA 2KIUA 1FZPB 5JI6A 4MGRA 4K2EA 1F5TA 1G6NA 3ABUA 2FBKA 2EJRA 4EQQA 1YS7A 4M73A 5FD6A 3O6BB 4U0WA 2YX4A 4AIHA 5DD4A 1FP2A 1OMIA 3IKVA 4HF2A 2HYFA 3F8NA 1FBQA 3HHGA 2IA0A 3WTVC 2PJPA 4GGGA 1YTYA 3J81K 4O5VA 5D5UB 5LHIA 4RB0A 1FYMA 2RQPA 2O03A 4M6YA 4HX7A 3IC7A 1ZGAA 3WTUC 3MAJA 1DUXC 2FE3A 2X4HA 2NNYA 2ZNYA 2Y0MA 4M72A 4E70A 4BYYA 4L9NA 5EEGA 3ULQB 2LNBA 3L00A 3R6SA 1O3TA 4HBLA 5HOOA 5H20A 2CSOA 2VC0A 4HOBA 3RKXA 2GZWA 3F8BA 4LJZF 1V4RA 3MWMA 4RB3C 1IXCA 1Q1HA 2NYXA 2Z99A 3MCZA 3WTSC 1IUYA 4L5IA 4HA8A 1BI0A 4I02A 2EV0A 2UZKA 3L9FA 3OOPA 2MA3A 1ZG3A 3ISPA 2JT1A 5KK1A 1R00A 5ILUA 2HYGD 4OU0A 4YFXF 1K6OA 4OINF 1O57A 4LLNA 2QVOA 2RGVA 2M45A 2MD5A 2VC1A 4CHUA 4CGZA 3G3ZA 5H6QA 3RI4A 4H0EA 5E1WA 1Y0UA 2ZXJA 3ZMZA 3WTYC 1JHFA 1W7PA 3CJNA 3HTSB 1R5HA 2CG4A 1GVJA 2R7FA 4WXCA 4R8HA 1XB4A 1ONVA 4Q4ZF 2RC4A 4I7HA 2OQGA 5D5XB 1LNWA 3VB2A 3I5UA 1SD7A 2EFWA 1YO5C 1P4AA 1H9GA 2CO5A 2GAUA 4EVIA 3GO5A 2XGXA 2KRFA 4G6QA 1HW1A 2KJCA 1DPRA 1FP1D 3DQVC 1B4AA 2DT5A 3KETA 2A69F 5IT9Z 1MDMB 1YIOA 3I0TA 4RGSA 4F7ZA 5JR3A 4O3MA 5CVIA 4R79A 5L3BA 2HGCA 3JAMK 2NRAC 1E17A 1EH7A 2P7CB 4CXFA 1P4XA 5L3EA 2ZO4A 1USSA 3LA7A 2ZMEA 3T1BA 1XGSA 2ESNA 1WSUA 4N9IA 2LF7A 4LD5A 1K78B 2A3SA 3BJOA 2Z5UA 5E8IA 5FLXZ 4BXUA 5BPDA 3I4PA 1Z1DA 2QWWA 4LB5A 1V3FA 3BDDA 2V1UA 2XUBA 4CO8A 3O2PE 5JHUA 2L02A 5F6FA 4OMYA 3F21A 1H9TA 2P6TA 1J5YA 2LKPA 3T0YA 1ZYRF 1BI3A 4EV0A 3CDHA 3CO6C 2O0YA 2VBXA 3BPXA 1FYLA 3M7GA 2DLLA 4U7DA 1Z9CA 4JQFA 3B02A 5L3CA 3SXYA 5L3DA 4ESFA 1VTNC 4HX8A 3QAHA 2PLYA 1BC8C 4ESJA 2RNJA 5HLGA 4M9ZA 5K5QA 1U8RA 4U7BA 4LLLA 4EJOA 2FMYA 4RB1A 4A0ZA 3KE2A 3LAJA 4I09A 4EM0B 1ON2A 1SMTA 3EQLF 4Q47A 1JXSA 4UV8A 2IRFG 3LAPA 2G9WA 2QQ9A 3F3XA 4EJUA 1P2FA 1IRFA 3EYIA 4A12A 3WG9A 2VBZA 3FM5A 4HDUA 2EFQA 2DPUA 4UNOA 1YQAA 3ZMDA 3GLXA 1KQ8A 1G3SA 3WTTC 1S8NA 3HOSA 3WODF 4ENNA 1RZ4A 1LDJA 3L2CA 2VN2A 1FSHA 2ZCWA 2KKOA 5CYVA 1TBXA 3F8FA 1XSXA 1ZREA 2DK8A 3T8RA 3DPLC 3TKYA 3C7JA 5HS8A 2FBHA 1WKMA 2DU9A 3FMQA 1R36A 3COAC 2DI3A 4LB6B 1GHCA 5F64A 2Y48A 3K1PA 1KU9A 4JBAA 2IJLA 4GCVA 4ENJA 5LRSA 3WTWC 1R23A 1Z05A 4M9XA 1BN5A 2ZJ2A 3I53A 2Q8KA 3U1DA 5HDGA 1SD6A 3MQ0A 3IL2A 1U3EM 2UWMA 1HXDA 4BHCA 4KA4A 2O8XA 3GZ5A 4IRIA 5A2QZ 3G73A 1SMYF 1B1BA 4CDGA 5LGTA 1QZYA 2IA2A 3E5UA 4IF4A 3KP3A 1FC3A 2VBYA 3C18A 2Y75A 4Q5SF 1XSDA 3ZP5A 1MGTA 2P5KA 2K27A 3E6MA 3KP5A 2FQ3A 3ZN1A 3BROA 2F2EA 4HZFA 3FMSA 4EJWA 3N4MA 4MQVA 1R58A 1MJBA 2D45A 1U78A 3U9GA 3VOEA 5FO5A 3SFZA 4TV7A 1K79A 1HSJA 4G94A 2WTEA 2AS5F 4B09A 1JE8A 2F5CA 3SZPA 2K4BA 5DEQA 2C6YA 1J59A 1X3UA 3TO6A 3QP5A 4IJAA 2E1CA 3I54A 3BWGA 3NQOA 3L09A 1TQIA 5ICGA 1LJ9A 4NQWA 4P55A 1REPC 3MZYA 3LWFA 4M74A 3W6KB 3HIFA 5K1YA 4AIKA 4HW0A 3MEXA 5DUKA 1EH8A 5CVRA 2CWEA 4ZH4F 2GA2A 4EMSA 1BOAA 3LFKA 1D3YA 2PMHA 2P6SA 3DXJF 4BQAA 2EA2A 1XN7A 2PG4A 2HQNA 1SAXA 2WC2A 3LA2A 2FF4A 2BYVE 1W4MA 2FBIA 1ZHFA 3T5XA 5FB2A 4EJTA 4WWCA 2H6CA 5LHHA 4LG0A 1FYKA 3RYRA 2YX7A 3IRRA 2ISZA 3Q9VA 4P9UA 2W84A 1K7AA 1BI1A 3BP8A 1XMAA 2XV4S 1IN5A 4KICA 4CYDA 5IT3A 3AAFA 5J6XA 2QZ8A 2PBIA 2FEZA 2LF8A 3RKYA 3RJPA 2DTRA 1R7JA 1EH6A 2GQQA 5LLQA 2IPQX 3BY6A 1U5TB 2QQBA 3ZQ7A 2XAGA 2DFIA 5J8CA 1PDNC 5D8KB 2E1NA 1YFHA 4GYGA 4ASNA 4EGYA 3CUQC 4QWQA 3RIRA 3J7AO 4KMUX 5LEJA 3KEOA 3F23A 4WF2A 4FT8A 5LGNA 2X0LA 3VEPA 4LLGF 1D8JA 5D6EA 1WI9A 4RAZA 2E7WA 3FXUA 5CVVA 1AWCA 2XVCA 1WRJA 2O61A 3FX3A 3K1NA 1FPQA 3Q5FA 1OYIA 4HX4A 1IZ1A 3FM3A 3VODA 1YS6A 1EV7A 2L01A 4LGWA 5IT9K 1STZA 2QLZA 3PQKA 1RUNA 3CLOA 3HSEA 2V9VA 4KFCA 4I2OA 3HRMA 1UHMA 2KJBA 2DK5A 3T8TA 4PGHA 2CGPA 1ODDA 2OZ6A 4LK1F 4IHSA 5CVJA 3J80Z 3KLOA 3BOQA 2XHKA 3CUQA 4YFKF 4ZZDA 2RV8A 1LEBA 3N97A 1KYZA 5DDGA 3KP4A 3E5XA 3HYIA 5FLXK 1LDKB 4S05A 2W57A 4ETSA 3DPTA 1Z91A 1C0WA 2CYYA 4EM1A 4RGXA 2WV0A 4KUMA 2XROA 1WWXA 2P4WA 1KYWA 1GXPA 1KQ0A 3IWZA 1TW2A 3RTRA 4U88A 2Z3YA 1L3LA 1S29A 2KIMA 2MLGA 4BAYA 2IA1A 2UXXA 5J8FA 3SQNA 4UUVA 3M8FA 2QM3A 1SFUA 3WTXC 1BI2A 1T38A 3DFGA 3EUHA 3I58A 2MLKA 1SFXA 1IRGA 3GFLA 2K4JA 5KVRA 3SZTA 4ENKA 3E5QA 2M8EA 2RN7A 4MTDA 3WTZA 2E7XA 3WU0A 3DV8A 1KGSA 1HW2A 1YW7A 2PN6A 2VE9A 5BPIA 2DQRA 4I98B 1I5ZA 3P9IA 3WGGA 3CTAA 2OZUA 1QZZA 2CQKA 4BH9A 2EWNA 4OIQF 2YSRA 4DQ2A 1ZG1A 3E3VA 3KEQA 1QBJA 2STTA 1FX7A 2IVMA 1QPMA 2GWRA 2HQRA 2RKHA 2XAQA 4M6XA 1O7FA 3I59B 3HUGA 5D4SA 4I01A 3JSPA 2B0LA 1LEAA 2PFBA 1J75A 2D1HA 5EEHA 5AONA 1FSEA 4KIBA 3HTUA 2OBPA 4FX4A 3EDPA 2K86A 1IF1A 5DV5A 2XAJA 1XGNA 2V6CA 3Q9SA 4G6DA 1IW7F 3TDZC 1TNTA 3KZYA 1MZBA 3WE2A 5DYMA 3ZMTA 4MEXF 1U2WA 3HHHA 2P7VB 1D8KA 3MZHA 5HLHA 1IN6A 3O3KA 3TO7A 2VE8A 4I0AA 1BM9A 2CFXA 3HRSA 4XLNF 3KP7A 4NHJA 3VFZA 1TLHB 2HS5A 3GW2A 4AIJA 2MH9A 2EV5A 4A2UA 2J5OA 2QBYA 2G7HA 2J5PA 5H6RA 3R0JA 5A2QK 2HKXA 1J0RA 4UV9A 4G8XA 2ACJA 2P5LC 2W25A 3E6BA 2JSCA 3ZPLA 1HKTA 4KT5C 1XDUA 2Z9OA 2EV6A 4LK0F 1BBYA 3IKTA 2OU2A 3JW4A 1YLFA 3LA3A 5ED4A 2A07F 2H6BA 3V4GA 3HRTA 3TOAA 4UXNA 3KP6A 5E20A 3ABTA 1XCVA 3GF2A 3GZ6A 2EB7A 3ML6A 1FY7A 5TRDA 4QLCU 3IRQA 5K5RA 4BHPA 1O3SA 1HW5A 1O3RA 3D0SA 1OKRA 2ZFWA 1TTYA 3OV8A 4RGRA 1F1ZA 2FU4A 2XRNA 1B6AA 2W85A 1HQCA 2XAHA 3GYHX 1XGOA 2L4MA 2A5YB 3ECOA 2EFOA 2PMUA 1XSVA 4OIPF 1ZG5A 3TQNA 2A61A 1UFMA 2MH2A 1R1TA 3F8CA 1LB2A 4HF1A 4L18B 2DW4A 3QU3A 4PDKA 2K02A 4ESBA 3R61A 1CF7A 3P9KA 4L9JA 1XD7A 1XCBA 5LRRA 1W5SA 5ILSA 4ZYGA 2PI0A 5E18F 1L0OC 3C3WA 1T0FA 5DCFA 2VONA 2PQ8A 3DKWA 5CJ9A 6PAXA 2HTSA 3EYYA 1FOKA 5CVUA 1G3TA 2QUFA 2BGCA 3I64A 5HLIA 4HYEA 4XRFA 4WXHA 2HR3A 1YW9A 4UVAA 4UVCA 2F5DA 4RGUA 1FBUA 4MNUA 1I6XA 1IXSB 4MQ9F 1SFEA 2M87A 2KIFA 3K0LA 3BJAA 1QO0D 1P4WA 4XBFA 3FXRA 2VBWA 1IN8A 3FF5A 1W7PD 2HTJA 3V7CA 1IN7A 1BC7C 3F8MA 2JPBA 2EFPA 3GFJA 4A5MA 1R1UA 5L3GA 2FXAA 4S04A 1NHAA 2YR2A 2XKPA 2WWYA 3H92A 2DBBA 2Q2EA 1ZN2A 3FZVA 2EK5A 3ZMSA 4L0ZB 2ZBKA 3H3ZA 1W7PB 3J80K 3FHZA 4AVPA 2VOOA 2OA4A 2JPCA 3QPTA 3V7SA 4FX0A 3K9TA 4G7OF 2NNNA 3HOTA 4OOIA 4HQMA 3LQQA 4GO1A 5HVQC 2P8TA 4BHBA 1H0MA 4M9SA 1PP7U 1S6LA 1MJAA 3FXQA 4B8XA 1TNSA 2VODA 4P96A 3C1DA 1DDNA 2HOEA 2QYOA 1Z7UA 1ZLJA 3V8KA 5ERIA 4WK8F 3KCCA 2ADUA 2ISYA 4WCGA 1I1SA 3TOBA 1ZH5A 4L0YB 2ZMEB 3BZ6A 4YFNF 3QPHA 4Y13A 2HFHA 5FGMA 4A0XA 1B59A 2NS0A 4CICA 1MKMA 4PZJA 3GXOA 3SHFA 4MEYF 1RUOA 2LDUA 2BBYA 1CGPA 4KNYA 3PFIA 3ELKA 1T6SA 3GX4X 4D0PA 3I71A 3R60A 5CLSA 5D8LB 4WX9A 5ICFA 3D5LA 4GXOA 4Y17A 2AXLA 1I27A 1QQIA 5AIPA 3KP2A 2W24A 3NEUA 1MD0A 3JTGA 2VT2A 4Q48A 2VT3A 1IXRC 3V8LA 3GUDA 2ZKZA 3P7NA 4XLPF 3ERED 4YIFA 1J7KA 1QGPA 4G7ZF 3U2RA 3E97A 2QBYB 2A6EF 2MBFA 2GXBA 2DQLA 1O3QA 2FOKA 1KA8A 3F6OA 1W5TA 4KIGA 1BIAA 1DP7P 4LMYA 3ECHA 5D5VB 3HSRA 2HDCA 2UXNA 1U5TC 4I0BA 2Z33A 2GA1A 2FNAA 1ZLKA 2STWA 3RDIA 1KU2A 4XSZF 5E1ZB 1KQ9A 3REOA 2QQAA 2O3FA 4N0BA 1TQPA 1FT9A 4FHTA 3NRVA 1UCRA 2FNPA 4IXAA 5BS6A 2H27A 3FMRA 5DCMA 1B9NA 1USTA 2QENA 3KFWX 3MFKA 3QU6A 5JFRA 3LQRA 1ON1A 1PP8F 2O6GE 5E17F 2BE5F 2GIVA 4HV6A 4RB2C 3J81Z 3H3UA 2HZTA 2JRTA 4GYIA 2M5WA 3ZMUA 2ZNZA 4EM2A 4U0YA 1LVAA 1ULYA 4CZZA 1U5TA 2PEXA 4KIFA 2XASA 3ZN0A 1S7AA 5BOXA 5F1RA 2IP2A 2H09A 1G3WA 2R3SA 1OYYA 4R1HA 2JZYA 4KN7X 1S3JA 5LHGA 5LBQA 3QRFF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F4K A;  3RKW A;  2DAO A;  2TDX A;  4HV5 A;  4IRH A;  4OIR F;  1CF7 B;  1YW8 A;  2VXZ A;  5HDK A;  5BMZ A;  3PQJ A;  2RDP A;  1T39 A;  2D2W A;  4ZZL A;  1JGS A;  1RI7 A;  4IHT A;  3M9A A;  3IWF A;  2OD5 A;  4ZYE A;  2IW5 A;  3K1M A;  1J2X A;  4IPA A;  4HLX A;  5D5W B;  3BPV A;  1IN4 A;  1P6R A;  1SD5 A;  2K7L A;  5FFZ A;  4PCQ A;  4L5J A;  1JHH A;  4U0V A;  3WE3 A;  1DPU A;  2V79 A;  1OYW A;  2HWV A;  2DPD A;  5LGU A;  3TGN A;  3RPQ A;  1SD4 A;  3RPU A;  2RVC A;  4UHT A;  5FFX A;  2FRH A;  3HRU A;  3QOP A;  4EGZ A;  1G3Y A;  2V1X A;  1E2X A;  4KDP A;  2G7U A;  3GFI A;  4NB5 A;  3P9C A;  3ZMV A;  1TW3 A;  4ENM A;  3M1E A;  5E1X A;  4YII A;  4KN4 X;  4Z2Y A;  1FWZ A;  1PUE E;  5TJJ A;  3DP7 A;  3TDU C;  3IHU A;  2A68 F;  3V8J A;  2HKO A;  3JAM Z;  2XAF A;  2R7D A;  2ESH A;  5FD5 A;  4BNC A;  4A0Y A;  5D4R A;  2OAZ A;  3LST A;  1OPC A;  1U6G A;  2M1B A;  1S7O A;  3S2W A;  2YU3 A;  4KMF A;  5DUI A;  3FWE A;  4LG0 B;  4WXD A;  3GVA A;  5HS9 A;  3V7R A;  2F5F A;  1XDS A;  3BJ6 A;  2M30 A;  4KYW A;  3RYP A;  4HAM A;  1HST A;  2HEO A;  1BIB A;  4OIO F;  1RIO H;  3GFM A;  4A6D A;  1J9I A;  4M71 A;  2BV6 A;  2JTV A;  3TO9 A;  5AIQ A;  4A6E A;  3KLN A;  5HDN A;  1MDM A;  1YG2 A;  1AOY A;  2FSW A;  1R1V A;  1ZGJ A;  4RS8 A;  2D1V A;  3ROU A;  4ZYD A;  1G4D A;  4P9F A;  3K69 A;  5HS7 A;  4IRG A;  1FBS A;  3DEU A;  1FLI A;  1UB9 A;  2P5V A;  3WGI A;  3L7W A;  3DF8 A;  3W6J B;  1T98 A;  4N9H A;  2NAZ A;  3I59 A;  1A04 A;  1K78 A;  2YPR A;  1R5G A;  1D5V A;  3M8E A;  5D6F A;  3JSO A;  2ELH A;  1KU7 A;  3F22 A;  3WU1 B;  3F72 A;  4A5N A;  4PGG A;  1RNL A;  1IAW A;  5E8G A;  4MHG A;  4XSX F;  1YYV A;  3GWZ A;  1QNT A;  3E6D A;  3CUO A;  1FNN A;  1F9N A;  2EFN A;  3HSF A;  2CW0 F;  2FA5 A;  2MC3 A;  1KU3 A;  4HF0 A;  3CO7 C;  3K2Z A;  3E6C C;  5L3F A;  5BQT A;  1HBX G;  3F6V A;  1BJA A;  1XGM A;  2Q0O A;  1ZRD A;  2COM A;  3CUQ B;  4AD9 A;  5K5O A;  1ZRF A;  3WGH A;  4G7H F;  2XIG A;  4L9V A;  1P92 A;  1GXQ A;  4OMZ A;  4LFU A;  1Z6R A;  2ETH A;  1OR7 A;  2L4A A;  3JTH A;  1I1G A;  4G9Y A;  5LEK A;  2A6H F;  3R0A A;  4DNC A;  4ZYH A;  2GXG A;  3QP6 A;  4P5O A;  4ON0 A;  2VOP A;  4YG2 F;  5JVT A;  3R4K A;  4RAY A;  4O6J A;  2L3D A;  5ILV A;  4HDV A;  2H94 A;  2IT0 A;  1ZAO A;  1B9M A;  3KZZ A;  1ZRC A;  1O7L A;  2LSO A;  4UVB A;  1Z6T A;  1LDD A;  4AWX B;  1T2K A;  4HQE A;  2DO7 A;  3B73 A;  1MJ9 A;  4JK1 X;  4IVN A;  2V1D A;  4MTE A;  3GEZ A;  5DCM B;  1R22 A;  1ZAR A;  3EET A;  2FML A;  1XMK A;  2F5E A;  5ICC A;  4L9T A;  1TQM A;  1WQ2 A;  4EJV A;  1UHW A;  2EA4 A;  2OQR A;  4Y15 A;  1HKQ A;  2BEO A;  5DD8 A;  5ICE A;  2L54 A;  4HLY A;  2XKO A;  1LQ1 A;  1HKS A;  2KIU A;  1FZP B;  5JI6 A;  4MGR A;  4K2E A;  1F5T A;  1G6N A;  3ABU A;  2FBK A;  2EJR A;  4EQQ A;  1YS7 A;  4M73 A;  5FD6 A;  3O6B B;  4U0W A;  2YX4 A;  4AIH A;  5DD4 A;  1FP2 A;  1OMI A;  3IKV A;  4HF2 A;  2HYF A;  3F8N A;  1FBQ A;  3HHG A;  2IA0 A;  3WTV C;  2PJP A;  4GGG A;  1YTY A;  3J81 K;  4O5V A;  5D5U B;  5LHI A;  4RB0 A;  1FYM A;  2RQP A;  2O03 A;  4M6Y A;  4HX7 A;  3IC7 A;  1ZGA A;  3WTU C;  3MAJ A;  1DUX C;  2FE3 A;  2X4H A;  2NNY A;  2ZNY A;  2Y0M A;  4M72 A;  4E70 A;  4BYY A;  4L9N A;  5EEG A;  3ULQ B;  2LNB A;  3L00 A;  3R6S A;  1O3T A;  4HBL A;  5HOO A;  5H20 A;  2CSO A;  2VC0 A;  4HOB A;  3RKX A;  2GZW A;  3F8B A;  4LJZ F;  1V4R A;  3MWM A;  4RB3 C;  1IXC A;  1Q1H A;  2NYX A;  2Z99 A;  3MCZ A;  3WTS C;  1IUY A;  4L5I A;  4HA8 A;  1BI0 A;  4I02 A;  2EV0 A;  2UZK A;  3L9F A;  3OOP A;  2MA3 A;  1ZG3 A;  3ISP A;  2JT1 A;  5KK1 A;  1R00 A;  5ILU A;  2HYG D;  4OU0 A;  4YFX F;  1K6O A;  4OIN F;  1O57 A;  4LLN A;  2QVO A;  2RGV A;  2M45 A;  2MD5 A;  2VC1 A;  4CHU A;  4CGZ A;  3G3Z A;  5H6Q A;  3RI4 A;  4H0E A;  5E1W A;  1Y0U A;  2ZXJ A;  3ZMZ A;  3WTY C;  1JHF A;  1W7P A;  3CJN A;  3HTS B;  1R5H A;  2CG4 A;  1GVJ A;  2R7F A;  4WXC A;  4R8H A;  1XB4 A;  1ONV A;  4Q4Z F;  2RC4 A;  4I7H A;  2OQG A;  5D5X B;  1LNW A;  3VB2 A;  3I5U A;  1SD7 A;  2EFW A;  1YO5 C;  1P4A A;  1H9G A;  2CO5 A;  2GAU A;  4EVI A;  3GO5 A;  2XGX A;  2KRF A;  4G6Q A;  1HW1 A;  2KJC A;  1DPR A;  1FP1 D;  3DQV C;  1B4A A;  2DT5 A;  3KET A;  2A69 F;  5IT9 Z;  1MDM B;  1YIO A;  3I0T A;  4RGS A;  4F7Z A;  5JR3 A;  4O3M A;  5CVI A;  4R79 A;  5L3B A;  2HGC A;  3JAM K;  2NRA C;  1E17 A;  1EH7 A;  2P7C B;  4CXF A;  1P4X A;  5L3E A;  2ZO4 A;  1USS A;  3LA7 A;  2ZME A;  3T1B A;  1XGS A;  2ESN A;  1WSU A;  4N9I A;  2LF7 A;  4LD5 A;  1K78 B;  2A3S A;  3BJO A;  2Z5U A;  5E8I A;  5FLX Z;  4BXU A;  5BPD A;  3I4P A;  1Z1D A;  2QWW A;  4LB5 A;  1V3F A;  3BDD A;  2V1U A;  2XUB A;  4CO8 A;  3O2P E;  5JHU A;  2L02 A;  5F6F A;  4OMY A;  3F21 A;  1H9T A;  2P6T A;  1J5Y A;  2LKP A;  3T0Y A;  1ZYR F;  1BI3 A;  4EV0 A;  3CDH A;  3CO6 C;  2O0Y A;  2VBX A;  3BPX A;  1FYL A;  3M7G A;  2DLL A;  4U7D A;  1Z9C A;  4JQF A;  3B02 A;  5L3C A;  3SXY A;  5L3D A;  4ESF A;  1VTN C;  4HX8 A;  3QAH A;  2PLY A;  1BC8 C;  4ESJ A;  2RNJ A;  5HLG A;  4M9Z A;  5K5Q A;  1U8R A;  4U7B A;  4LLL A;  4EJO A;  2FMY A;  4RB1 A;  4A0Z A;  3KE2 A;  3LAJ A;  4I09 A;  4EM0 B;  1ON2 A;  1SMT A;  3EQL F;  4Q47 A;  1JXS A;  4UV8 A;  2IRF G;  3LAP A;  2G9W A;  2QQ9 A;  3F3X A;  4EJU A;  1P2F A;  1IRF A;  3EYI A;  4A12 A;  3WG9 A;  2VBZ A;  3FM5 A;  4HDU A;  2EFQ A;  2DPU A;  4UNO A;  1YQA A;  3ZMD A;  3GLX A;  1KQ8 A;  1G3S A;  3WTT C;  1S8N A;  3HOS A;  3WOD F;  4ENN A;  1RZ4 A;  1LDJ A;  3L2C A;  2VN2 A;  1FSH A;  2ZCW A;  2KKO A;  5CYV A;  1TBX A;  3F8F A;  1XSX A;  1ZRE A;  2DK8 A;  3T8R A;  3DPL C;  3TKY A;  3C7J A;  5HS8 A;  2FBH A;  1WKM A;  2DU9 A;  3FMQ A;  1R36 A;  3COA C;  2DI3 A;  4LB6 B;  1GHC A;  5F64 A;  2Y48 A;  3K1P A;  1KU9 A;  4JBA A;  2IJL A;  4GCV A;  4ENJ A;  5LRS A;  3WTW C;  1R23 A;  1Z05 A;  4M9X A;  1BN5 A;  2ZJ2 A;  3I53 A;  2Q8K A;  3U1D A;  5HDG A;  1SD6 A;  3MQ0 A;  3IL2 A;  1U3E M;  2UWM A;  1HXD A;  4BHC A;  4KA4 A;  2O8X A;  3GZ5 A;  4IRI A;  5A2Q Z;  3G73 A;  1SMY F;  1B1B A;  4CDG A;  5LGT A;  1QZY A;  2IA2 A;  3E5U A;  4IF4 A;  3KP3 A;  1FC3 A;  2VBY A;  3C18 A;  2Y75 A;  4Q5S F;  1XSD A;  3ZP5 A;  1MGT A;  2P5K A;  2K27 A;  3E6M A;  3KP5 A;  2FQ3 A;  3ZN1 A;  3BRO A;  2F2E A;  4HZF A;  3FMS A;  4EJW A;  3N4M A;  4MQV A;  1R58 A;  1MJB A;  2D45 A;  1U78 A;  3U9G A;  3VOE A;  5FO5 A;  3SFZ A;  4TV7 A;  1K79 A;  1HSJ A;  4G94 A;  2WTE A;  2AS5 F;  4B09 A;  1JE8 A;  2F5C A;  3SZP A;  2K4B A;  5DEQ A;  2C6Y A;  1J59 A;  1X3U A;  3TO6 A;  3QP5 A;  4IJA A;  2E1C A;  3I54 A;  3BWG A;  3NQO A;  3L09 A;  1TQI A;  5ICG A;  1LJ9 A;  4NQW A;  4P55 A;  1REP C;  3MZY A;  3LWF A;  4M74 A;  3W6K B;  3HIF A;  5K1Y A;  4AIK A;  4HW0 A;  3MEX A;  5DUK A;  1EH8 A;  5CVR A;  2CWE A;  4ZH4 F;  2GA2 A;  4EMS A;  1BOA A;  3LFK A;  1D3Y A;  2PMH A;  2P6S A;  3DXJ F;  4BQA A;  2EA2 A;  1XN7 A;  2PG4 A;  2HQN A;  1SAX A;  2WC2 A;  3LA2 A;  2FF4 A;  2BYV E;  1W4M A;  2FBI A;  1ZHF A;  3T5X A;  5FB2 A;  4EJT A;  4WWC A;  2H6C A;  5LHH A;  4LG0 A;  1FYK A;  3RYR A;  2YX7 A;  3IRR A;  2ISZ A;  3Q9V A;  4P9U A;  2W84 A;  1K7A A;  1BI1 A;  3BP8 A;  1XMA A;  2XV4 S;  1IN5 A;  4KIC A;  4CYD A;  5IT3 A;  3AAF A;  5J6X A;  2QZ8 A;  2PBI A;  2FEZ A;  2LF8 A;  3RKY A;  3RJP A;  2DTR A;  1R7J A;  1EH6 A;  2GQQ A;  5LLQ A;  2IPQ X;  3BY6 A;  1U5T B;  2QQB A;  3ZQ7 A;  2XAG A;  2DFI A;  5J8C A;  1PDN C;  5D8K B;  2E1N A;  1YFH A;  4GYG A;  4ASN A;  4EGY A;  3CUQ C;  4QWQ A;  3RIR A;  3J7A O;  4KMU X;  5LEJ A;  3KEO A;  3F23 A;  4WF2 A;  4FT8 A;  5LGN A;  2X0L A;  3VEP A;  4LLG F;  1D8J A;  5D6E A;  1WI9 A;  4RAZ A;  2E7W A;  3FXU A;  5CVV A;  1AWC A;  2XVC A;  1WRJ A;  2O61 A;  3FX3 A;  3K1N A;  1FPQ A;  3Q5F A;  1OYI A;  4HX4 A;  1IZ1 A;  3FM3 A;  3VOD A;  1YS6 A;  1EV7 A;  2L01 A;  4LGW A;  5IT9 K;  1STZ A;  2QLZ A;  3PQK A;  1RUN A;  3CLO A;  3HSE A;  2V9V A;  4KFC A;  4I2O A;  3HRM A;  1UHM A;  2KJB A;  2DK5 A;  3T8T A;  4PGH A;  2CGP A;  1ODD A;  2OZ6 A;  4LK1 F;  4IHS A;  5CVJ A;  3J80 Z;  3KLO A;  3BOQ A;  2XHK A;  3CUQ A;  4YFK F;  4ZZD A;  2RV8 A;  1LEB A;  3N97 A;  1KYZ A;  5DDG A;  3KP4 A;  3E5X A;  3HYI A;  5FLX K;  1LDK B;  4S05 A;  2W57 A;  4ETS A;  3DPT A;  1Z91 A;  1C0W A;  2CYY A;  4EM1 A;  4RGX A;  2WV0 A;  4KUM A;  2XRO A;  1WWX A;  2P4W A;  1KYW A;  1GXP A;  1KQ0 A;  3IWZ A;  1TW2 A;  3RTR A;  4U88 A;  2Z3Y A;  1L3L A;  1S29 A;  2KIM A;  2MLG A;  4BAY A;  2IA1 A;  2UXX A;  5J8F A;  3SQN A;  4UUV A;  3M8F A;  2QM3 A;  1SFU A;  3WTX C;  1BI2 A;  1T38 A;  3DFG A;  3EUH A;  3I58 A;  2MLK A;  1SFX A;  1IRG A;  3GFL A;  2K4J A;  5KVR A;  3SZT A;  4ENK A;  3E5Q A;  2M8E A;  2RN7 A;  4MTD A;  3WTZ A;  2E7X A;  3WU0 A;  3DV8 A;  1KGS A;  1HW2 A;  1YW7 A;  2PN6 A;  2VE9 A;  5BPI A;  2DQR A;  4I98 B;  1I5Z A;  3P9I A;  3WGG A;  3CTA A;  2OZU A;  1QZZ A;  2CQK A;  4BH9 A;  2EWN A;  4OIQ F;  2YSR A;  4DQ2 A;  1ZG1 A;  3E3V A;  3KEQ A;  1QBJ A;  2STT A;  1FX7 A;  2IVM A;  1QPM A;  2GWR A;  2HQR A;  2RKH A;  2XAQ A;  4M6X A;  1O7F A;  3I59 B;  3HUG A;  5D4S A;  4I01 A;  3JSP A;  2B0L A;  1LEA A;  2PFB A;  1J75 A;  2D1H A;  5EEH A;  5AON A;  1FSE A;  4KIB A;  3HTU A;  2OBP A;  4FX4 A;  3EDP A;  2K86 A;  1IF1 A;  5DV5 A;  2XAJ A;  1XGN A;  2V6C A;  3Q9S A;  4G6D A;  1IW7 F;  3TDZ C;  1TNT A;  3KZY A;  1MZB A;  3WE2 A;  5DYM A;  3ZMT A;  4MEX F;  1U2W A;  3HHH A;  2P7V B;  1D8K A;  3MZH A;  5HLH A;  1IN6 A;  3O3K A;  3TO7 A;  2VE8 A;  4I0A A;  1BM9 A;  2CFX A;  3HRS A;  4XLN F;  3KP7 A;  4NHJ A;  3VFZ A;  1TLH B;  2HS5 A;  3GW2 A;  4AIJ A;  2MH9 A;  2EV5 A;  4A2U A;  2J5O A;  2QBY A;  2G7H A;  2J5P A;  5H6R A;  3R0J A;  5A2Q K;  2HKX A;  1J0R A;  4UV9 A;  4G8X A;  2ACJ A;  2P5L C;  2W25 A;  3E6B A;  2JSC A;  3ZPL A;  1HKT A;  4KT5 C;  1XDU A;  2Z9O A;  2EV6 A;  4LK0 F;  1BBY A;  3IKT A;  2OU2 A;  3JW4 A;  1YLF A;  3LA3 A;  5ED4 A;  2A07 F;  2H6B A;  3V4G A;  3HRT A;  3TOA A;  4UXN A;  3KP6 A;  5E20 A;  3ABT A;  1XCV A;  3GF2 A;  3GZ6 A;  2EB7 A;  3ML6 A;  1FY7 A;  5TRD A;  4QLC U;  3IRQ A;  5K5R A;  4BHP A;  1O3S A;  1HW5 A;  1O3R A;  3D0S A;  1OKR A;  2ZFW A;  1TTY A;  3OV8 A;  4RGR A;  1F1Z A;  2FU4 A;  2XRN A;  1B6A A;  2W85 A;  1HQC A;  2XAH A;  3GYH X;  1XGO A;  2L4M A;  2A5Y B;  3ECO A;  2EFO A;  2PMU A;  1XSV A;  4OIP F;  1ZG5 A;  3TQN A;  2A61 A;  1UFM A;  2MH2 A;  1R1T A;  3F8C A;  1LB2 A;  4HF1 A;  4L18 B;  2DW4 A;  3QU3 A;  4PDK A;  2K02 A;  4ESB A;  3R61 A;  1CF7 A;  3P9K A;  4L9J A;  1XD7 A;  1XCB A;  5LRR A;  1W5S A;  5ILS A;  4ZYG A;  2PI0 A;  5E18 F;  1L0O C;  3C3W A;  1T0F A;  5DCF A;  2VON A;  2PQ8 A;  3DKW A;  5CJ9 A;  6PAX A;  2HTS A;  3EYY A;  1FOK A;  5CVU A;  1G3T A;  2QUF A;  2BGC A;  3I64 A;  5HLI A;  4HYE A;  4XRF A;  4WXH A;  2HR3 A;  1YW9 A;  4UVA A;  4UVC A;  2F5D A;  4RGU A;  1FBU A;  4MNU A;  1I6X A;  1IXS B;  4MQ9 F;  1SFE A;  2M87 A;  2KIF A;  3K0L A;  3BJA A;  1QO0 D;  1P4W A;  4XBF A;  3FXR A;  2VBW A;  1IN8 A;  3FF5 A;  1W7P D;  2HTJ A;  3V7C A;  1IN7 A;  1BC7 C;  3F8M A;  2JPB A;  2EFP A;  3GFJ A;  4A5M A;  1R1U A;  5L3G A;  2FXA A;  4S04 A;  1NHA A;  2YR2 A;  2XKP A;  2WWY A;  3H92 A;  2DBB A;  2Q2E A;  1ZN2 A;  3FZV A;  2EK5 A;  3ZMS A;  4L0Z B;  2ZBK A;  3H3Z A;  1W7P B;  3J80 K;  3FHZ A;  4AVP A;  2VOO A;  2OA4 A;  2JPC A;  3QPT A;  3V7S A;  4FX0 A;  3K9T A;  4G7O F;  2NNN A;  3HOT A;  4OOI A;  4HQM A;  3LQQ A;  4GO1 A;  5HVQ C;  2P8T A;  4BHB A;  1H0M A;  4M9S A;  1PP7 U;  1S6L A;  1MJA A;  3FXQ A;  4B8X A;  1TNS A;  2VOD A;  4P96 A;  3C1D A;  1DDN A;  2HOE A;  2QYO A;  1Z7U A;  1ZLJ A;  3V8K A;  5ERI A;  4WK8 F;  3KCC A;  2ADU A;  2ISY A;  4WCG A;  1I1S A;  3TOB A;  1ZH5 A;  4L0Y B;  2ZME B;  3BZ6 A;  4YFN F;  3QPH A;  4Y13 A;  2HFH A;  5FGM A;  4A0X A;  1B59 A;  2NS0 A;  4CIC A;  1MKM A;  4PZJ A;  3GXO A;  3SHF A;  4MEY F;  1RUO A;  2LDU A;  2BBY A;  1CGP A;  4KNY A;  3PFI A;  3ELK A;  1T6S A;  3GX4 X;  4D0P A;  3I71 A;  3R60 A;  5CLS A;  5D8L B;  4WX9 A;  5ICF A;  3D5L A;  4GXO A;  4Y17 A;  2AXL A;  1I27 A;  1QQI A;  5AIP A;  3KP2 A;  2W24 A;  3NEU A;  1MD0 A;  3JTG A;  2VT2 A;  4Q48 A;  2VT3 A;  1IXR C;  3V8L A;  3GUD A;  2ZKZ A;  3P7N A;  4XLP F;  3ERE D;  4YIF A;  1J7K A;  1QGP A;  4G7Z F;  3U2R A;  3E97 A;  2QBY B;  2A6E F;  2MBF A;  2GXB A;  2DQL A;  1O3Q A;  2FOK A;  1KA8 A;  3F6O A;  1W5T A;  4KIG A;  1BIA A;  1DP7 P;  4LMY A;  3ECH A;  5D5V B;  3HSR A;  2HDC A;  2UXN A;  1U5T C;  4I0B A;  2Z33 A;  2GA1 A;  2FNA A;  1ZLK A;  2STW A;  3RDI A;  1KU2 A;  4XSZ F;  5E1Z B;  1KQ9 A;  3REO A;  2QQA A;  2O3F A;  4N0B A;  1TQP A;  1FT9 A;  4FHT A;  3NRV A;  1UCR A;  2FNP A;  4IXA A;  5BS6 A;  2H27 A;  3FMR A;  5DCM A;  1B9N A;  1UST A;  2QEN A;  3KFW X;  3MFK A;  3QU6 A;  5JFR A;  3LQR A;  1ON1 A;  1PP8 F;  2O6G E;  5E17 F;  2BE5 F;  2GIV A;  4HV6 A;  4RB2 C;  3J81 Z;  3H3U A;  2HZT A;  2JRT A;  4GYI A;  2M5W A;  3ZMU A;  2ZNZ A;  4EM2 A;  4U0Y A;  1LVA A;  1ULY A;  4CZZ A;  1U5T A;  2PEX A;  4KIF A;  2XAS A;  3ZN0 A;  1S7A A;  5BOX A;  5F1R A;  2IP2 A;  2H09 A;  1G3W A;  2R3S A;  1OYY A;  4R1H A;  2JZY A;  4KN7 X;  1S3J A;  5LHG A;  5LBQ A;  3QRF F; 
#chains in the Genus database with same CATH topology
 2VXD A;  2ZSH B;  1F4K A;  3AL0 C;  3RKW A;  2DAO A;  2TDX A;  5JLW A;  3G1L A;  4UUS A;  4HV5 A;  4IRH A;  4OIR F;  1CF7 B;  1YW8 A;  2VXZ A;  5HDK A;  3BTJ A;  2CQN A;  5DS9 A;  5BMZ A;  2HOT A;  2K3F A;  2VB6 A;  3PQJ A;  2RDP A;  1T39 A;  2D2W A;  1ETK A;  1R4M B;  2QKL B;  4ZZL A;  4YRV A;  1JGS A;  1RI7 A;  3OIP A;  3M9A A;  4IHT A;  3IWF A;  2OD5 A;  3OR1 C;  4ZYE A;  2IW5 A;  3K1M A;  1J2X A;  4MO7 A;  4IPA A;  2V26 A;  2DFH A;  4KIS A;  5EF6 A;  3KYC B;  4HLX A;  1X1A A;  5D5W B;  1EJ9 A;  2DXI A;  2LK2 A;  3BPV A;  2YS9 A;  3L1P A;  3TED A;  1CQT A;  1IN4 A;  2WAF A;  2L9V A;  1P6R A;  1SD5 A;  1K4T A;  4AID A;  1YJ9 I;  2K7L A;  5FFZ A;  4PCQ A;  4L5J A;  3BCB A;  1JHH A;  3VYT B;  4U0V A;  3WE3 A;  1DPU A;  1Q1V A;  2V79 A;  1OYW A;  5FLM J;  1Y1W J;  2ZXH A;  2HWV A;  5FRO A;  2DPD A;  4Y7N J;  3BG6 A;  5LGU A;  3TGN A;  4MIM A;  3RPQ A;  3GCM A;  1SD4 A;  3RPU A;  2RVC A;  4UHT A;  3C2B A;  5FFX A;  4IO9 F;  3W3C A;  1OCO H;  2FRH A;  1ZK8 A;  3HRU A;  3QOP A;  3U1K A;  1BOB A;  4EGZ A;  1G3Y A;  1GUU A;  2V1X A;  2ID6 A;  1E2X A;  4KDP A;  2G7U A;  3GFI A;  4A3L J;  4NB5 A;  3P9C A;  4V19 K;  4XRM A;  3ZMV A;  1TW3 A;  3K6G A;  4ENM A;  3M1E A;  3I4N J;  4FIS A;  1TWG J;  5E1X A;  2B9S A;  2KRH A;  4YII A;  3FK6 A;  2A05 A;  4XKV A;  3H5N A;  4KN4 X;  4Z2Y A;  1FWZ A;  1PUE E;  2DJI A;  4E7J A;  4J01 A;  1JI8 A;  5TJJ A;  3DP7 A;  3TDU C;  3IHU A;  2A68 F;  3V8J A;  5FKK A;  2VUM J;  2VJ5 A;  3OYM A;  2HKO A;  3JAM Z;  1R49 A;  2XAF A;  2L2O A;  2KT0 A;  2R7D A;  3GLL A;  1MSE C;  2KIQ A;  1ZEL A;  1E3P A;  4OWR B;  1ENH A;  3SZG A;  2FD5 A;  5KAI C;  2ESH A;  1ETY A;  5FD5 A;  3PSI A;  2ZJR F;  4BNC A;  4A0Y A;  5D4R A;  4E7H A;  2OAZ A;  2EPF A;  2XSJ C;  3LST A;  1OPC A;  2G0E A;  1U6G A;  2KZV A;  2M1B A;  1S7O A;  3S2W A;  3HC7 A;  2YU3 A;  4KMF A;  2B63 J;  5DUI A;  2E5Z A;  1IJW C;  3FWE A;  3DEW A;  4LG0 B;  2PJR B;  4WXD A;  3GVA A;  5HS9 A;  3V7R A;  2F5F A;  1T0F C;  3KYL A;  3MD2 A;  1DQU A;  1XDS A;  3BJ6 A;  2M30 A;  4KYW A;  3RYP A;  1VQ4 I;  2JA7 J;  3JRH A;  3OYL A;  4HAM A;  3FXO A;  1HST A;  2DOA A;  2HYJ A;  2KDO A;  4XID A;  2HEO A;  1BIB A;  4LIU A;  3PM1 A;  4OIO F;  1RIO H;  3GFM A;  4A6D A;  1J9I A;  4M71 A;  2BV6 A;  4BQQ A;  2JTV A;  2VKV A;  3TO9 A;  1I3Q J;  2ZC2 A;  3LFU A;  4XN3 A;  5AIQ A;  2XPV A;  4A6E A;  3KLN A;  4IHX A;  5HDN A;  4DBQ A;  2HDW A;  3HKZ A;  3PNT A;  3GTP J;  1MDM A;  2Z1D A;  1YG2 A;  2OC6 A;  1VQL I;  1AOY A;  3OYN A;  2FSW A;  4E7L A;  1R1V A;  1ZGJ A;  4RS8 A;  1BL0 A;  1LKX A;  1WJA A;  1P7I A;  2D1V A;  2UV1 A;  1U9N A;  4BAC A;  3ROU A;  4ZYD A;  1G4D A;  4P9F A;  2M34 A;  1MNE A;  3K69 A;  5HS7 A;  3W2A A;  4IRG A;  1FBS A;  3DEU A;  1FLI A;  1UB9 A;  3BQZ A;  1JTX A;  5J40 A;  3S16 J;  2P5V A;  3WGI A;  3GME A;  4RAF A;  3L7W A;  4A3B J;  3DF8 A;  2TRT A;  3BTL A;  2OV7 A;  4HPQ A;  3W6J B;  2EQR A;  1T98 A;  4N9H A;  2NAZ A;  3I59 A;  1A04 A;  1K78 A;  1IDY A;  2YPR A;  1R5G A;  1D5V A;  3M8E A;  5D6F A;  3JSO A;  1MIJ A;  2ME6 A;  2Q1Z B;  1OR7 C;  2ELH A;  2KHM A;  1RKW A;  2L7Z A;  2X51 A;  4QPQ A;  4EEF G;  2LY2 A;  1D1B A;  1KU7 A;  1BW6 A;  2K40 A;  1YRN B;  4C3H J;  3F22 A;  3WU1 B;  3F72 A;  3DLL F;  5GPC A;  4A5N A;  4PGG A;  5KCM A;  2QA4 I;  2RNG A;  1RNL A;  2F48 A;  1IAW A;  4BE1 A;  5E8G A;  3AG4 H;  3V42 A;  3DEE A;  4BE0 A;  4MHG A;  4XSX F;  5F27 A;  2XPW A;  3IUO A;  3SEQ A;  1YYV A;  4D9J A;  3GWZ A;  1V5F A;  1QNT A;  3E6D A;  3H1C A;  3CUO A;  3PO2 J;  1FNN A;  3EPZ A;  2DA5 A;  1F9N A;  2EFN A;  1OQY A;  3HSF A;  2CW0 F;  3GBG A;  2FA5 A;  1ZKG A;  2MC3 A;  1KU3 A;  2H1L A;  4HF0 A;  5FLV A;  3KZI C;  2E2H J;  3CO7 C;  3K2Z A;  2ELJ A;  3S1M J;  1I3A A;  3CZ6 A;  5IP6 A;  3E6C C;  3LSM A;  5L3F A;  4RLQ A;  2MG4 A;  5BQT A;  3L2R A;  1VQN I;  4JX5 A;  1HBX G;  1WZ2 A;  5DM6 F;  3F6V A;  1BJA A;  2VIX A;  1XGM A;  2Q0O A;  1ZRD A;  4F92 B;  2COM A;  3CUQ B;  1K6Y A;  4AD9 A;  5K5O A;  1ZRF A;  4JOM A;  3WGH A;  4G7H F;  1IDZ A;  3PIO F;  1ETQ A;  2XIG A;  5EZH A;  3HOW J;  2CW7 A;  4L9V A;  1P92 A;  2ECC A;  3E7L A;  1GXQ A;  2DMT A;  4OMZ A;  2MFZ A;  4LFU A;  2RAE A;  1Z6R A;  2ETH A;  4M3D A;  3FBI B;  4FCY A;  1MW7 A;  1OR7 A;  2L4A A;  3BT9 A;  3JTH A;  4DOZ A;  1I1G A;  2V9K A;  4G9Y A;  1MBG A;  1J09 A;  3M07 A;  4ITV A;  5LEK A;  3F9K A;  2A6H F;  5M5Y J;  3R0A A;  4DNC A;  3FXK A;  1FEX A;  4ZYH A;  4XIC A;  4XLH A;  2GXG A;  3QP6 A;  4P5O A;  3S3N A;  4ON0 A;  2VOP A;  4YG2 F;  3A01 A;  3H0G J;  3OS1 A;  3Q0U A;  2Y31 A;  1JJ6 C;  5JVT A;  2K3P A;  3R4K A;  4RAY A;  4O6J A;  2L3D A;  5ILV A;  3CCU I;  4HDV A;  2Y9Z A;  2H94 A;  2IT0 A;  3PUF A;  1ZAO A;  2X48 A;  3HPG A;  3OYE A;  1GDT A;  1B9M A;  3KZZ A;  3H5R A;  1ZRC A;  5FJ8 J;  1O7L A;  4ZDL A;  2YUS A;  4B3A A;  2LP0 A;  2LSO A;  4UVB A;  1WJD A;  1XS9 A;  1Z6T A;  3DTI A;  4PJM A;  2R7U A;  2ELK A;  1LDD A;  3BQY A;  4AWX B;  2IAI A;  4QPO A;  1T2K A;  4HQE A;  2DO7 A;  3B73 A;  5FKL A;  5B3S H;  4NDL A;  1MJ9 A;  3ZRG A;  1WVR A;  4JK1 X;  2L7K A;  4IVN A;  1W36 D;  2V1D A;  1B8I A;  3FKI J;  2QEX I;  4DYR A;  3UR3 C;  2IS4 A;  4MTE A;  3GEZ A;  5DCM B;  1R22 A;  2IS2 A;  1ZAR A;  3EET A;  2Z2S B;  2FML A;  1XMK A;  4B47 A;  2CU7 A;  1H8A C;  4D5C A;  2DMQ A;  1A6I A;  3OMY A;  4XK4 A;  2F5E A;  3PSF A;  5ICC A;  3BG9 A;  4L9T A;  1TQM A;  1RR8 C;  1X2N A;  2P0W A;  3X2Q H;  3S17 J;  1WQ2 A;  3S8P A;  2TCT A;  4I6Z A;  5J1R A;  4EJV A;  1UHW A;  3A0B C;  2EA4 A;  2CUJ A;  2OQR A;  3VYS B;  3J7Y J;  2R5Z B;  4Y15 A;  3Q3S A;  1WH7 A;  1WJE A;  2N8G A;  1HKQ A;  1BR4 A;  4PJN A;  2X1E A;  2BEO A;  5DD8 A;  5ICE A;  2L54 A;  2X9D A;  3BG3 A;  4HLY A;  2LRE A;  3DTE A;  2XKO A;  4YEJ A;  1LQ1 A;  1HCR A;  1HKS A;  5E3N A;  4UB6 C;  4A3C J;  4DIQ A;  1WJF A;  2KIU A;  1FZP B;  2HDD A;  5JI6 A;  4JX6 A;  4MGR A;  2EZL A;  4K2E A;  5EGO B;  3LSP A;  2BY3 A;  3HUG B;  1F5T A;  2DTZ A;  1G6N A;  3O8G A;  2AHQ A;  4MLO A;  1ETX A;  2WY8 Q;  3ABU A;  2FBK A;  2EJR A;  4EAT A;  4EQQ A;  4IHV A;  3HZJ A;  1YS7 A;  4M73 A;  5FD6 A;  3O6B B;  4U0W A;  2YX4 A;  4AIH A;  5DD4 A;  3ZGK A;  4AVZ A;  1FP2 A;  2E1M C;  5HOD A;  1OMI A;  3IKV A;  2CV0 A;  4HF2 A;  3FXJ A;  2HYF A;  3F8N A;  3NWT A;  1MBF A;  1FBQ A;  3HHG A;  3S2D J;  2IA0 A;  1U0J A;  3WTV C;  2PJP A;  4GGG A;  1YTY A;  3J81 K;  4O5V A;  5D5U B;  5EYR A;  3K4K A;  5LHI A;  4RB0 A;  3ONQ A;  1GV5 A;  1FYM A;  4M6V A;  1VQM I;  2RQP A;  2O03 A;  3FBN B;  4M6Y A;  4HX7 A;  3IC7 A;  4A3J J;  4RAG A;  3L2V A;  2A5W A;  4N4O B;  3S93 A;  1ZGA A;  3WTU C;  3MAJ A;  2OTJ I;  1DUX C;  2FE3 A;  1NH3 A;  2X4H A;  1UHS A;  3KPH A;  3RPU D;  2NNY A;  2EZI A;  2VQG A;  2VKD A;  2ZNY A;  2Y0M A;  4M72 A;  3H9Q A;  3OIO A;  4E70 A;  5GAH J;  4BYY A;  1PYV A;  4L9N A;  5EEG A;  4IKF A;  1Y8R B;  3IAM 2;  2XGD A;  3ULQ B;  2LNB A;  2VL8 A;  3S3O A;  3L00 A;  2M4K A;  3R6S A;  4F93 B;  1O3T A;  1TT0 A;  3LSK A;  4HBL A;  3TP3 A;  3C2G A;  3CMA I;  1MNM C;  5HOO A;  2KFD A;  5H20 A;  1OIS A;  2CSO A;  1TZL A;  2VC0 A;  1A6Q A;  2BY0 A;  5EDN A;  1XX5 A;  4HOB A;  3RKX A;  2GZW A;  4XN0 A;  2JWT A;  2XF5 A;  1LFU P;  3F8B A;  4LJZ F;  4RA2 A;  1V4R A;  3ASO H;  3MWM A;  3BCA A;  3LSH A;  4RB3 C;  1IXC A;  1Q1H A;  2NYX A;  2Z99 A;  1T56 A;  3MCZ A;  2R4G A;  3WTS C;  1IUY A;  4CYC B;  1FOX A;  2AQF A;  2K9M A;  4L5I A;  4HA8 A;  4BJ5 C;  4ANJ A;  2EZK A;  1BI0 A;  1UZC A;  2EV0 A;  4I02 A;  3CCS I;  1QZE A;  2UZK A;  1YIJ I;  3HM5 A;  4C9Y A;  1QVU A;  1S7E A;  3L9F A;  3OOP A;  2MA3 A;  1A36 A;  1JJ8 C;  1ZG3 A;  3OY9 A;  3ISP A;  2Y2Z A;  2JT1 A;  2VJJ A;  5KK1 A;  3WG7 H;  3JRD A;  2X6X A;  1LUJ B;  1YJN I;  1RR7 A;  1R00 A;  3AL0 B;  4BDZ A;  4LOC A;  5ILU A;  2HYG D;  4OU0 A;  4B3X A;  4YFX F;  1K6O A;  5B1B H;  4OIN F;  1O57 A;  3CF2 A;  4G6T B;  3TP0 A;  2LY9 A;  2QVO A;  4LLN A;  2RGV A;  2M45 A;  3VYR B;  1UEL B;  3K70 C;  2HU9 A;  2MD5 A;  1Z0X A;  2VC1 A;  4CHU A;  4CGZ A;  2CS3 A;  3VWB A;  5FKO A;  3G3Z A;  1Z67 A;  5H6Q A;  4BBR J;  2QSH X;  3RI4 A;  1YHQ I;  4BU2 A;  4H0E A;  5E1W A;  1Y0U A;  2ZME C;  4Y3O A;  2EIL H;  4B48 A;  5IYC J;  1EA3 A;  4E7Z A;  1Z77 A;  3BR1 A;  2W48 A;  2ZXJ A;  3ZMZ A;  3IH4 A;  3WTY C;  1JHF A;  3K4M A;  2R92 J;  1W7P A;  3B6A A;  3HXL A;  2GIZ A;  2EIK H;  2L7F P;  1GLN A;  3TBI A;  3CJN A;  3HTS B;  3ZQC A;  3E0J B;  3I4M J;  1MBJ A;  3GTG J;  1R5H A;  2CG4 A;  3CP2 A;  1GVJ A;  2R7F A;  4F91 B;  4WXC A;  2DOD A;  2NVX J;  4R8H A;  4BDY A;  1XB4 A;  1ONV A;  1BA5 A;  2E35 A;  4Q4Z F;  2RC4 A;  4I7H A;  1UAA A;  2R7X A;  2OQG A;  5D5X B;  3AKZ A;  2HPM A;  1LNW A;  4G12 A;  2NVT J;  1TWC J;  2HVS A;  1LFB A;  3VB2 A;  3I5U A;  1SD7 A;  2EFW A;  1YO5 C;  1P4A A;  1WPK A;  1H9G A;  2CO5 A;  3OR2 C;  2GAU A;  1APL C;  4EVI A;  3GO5 A;  2XGX A;  2KRF A;  1E3H A;  4G6Q A;  1HW1 A;  2KJC A;  3G4S I;  1DPR A;  1FP1 D;  2LH9 A;  3NAR A;  3DQV C;  1B4A A;  2DT5 A;  3KET A;  2A69 F;  5IT9 Z;  3VSK A;  2W82 A;  1MDM B;  1YX3 A;  1VQ8 I;  1YIO A;  4JP0 A;  3I0T A;  1G59 A;  4RGS A;  4F7Z A;  5JR3 A;  4O3M A;  4XON A;  5CVI A;  4R79 A;  4ZC3 A;  1PVE A;  4M3G A;  3VPR A;  4ZDO A;  5L3B A;  2HGC A;  3JAM K;  4U87 A;  2NRA C;  1E17 A;  1X4P A;  1EH7 A;  1VI0 A;  2P7C B;  4CXF A;  4GRI A;  4UY8 I;  1P4X A;  2XB5 A;  2DMP A;  2DMU A;  4Y52 J;  2L0K A;  5L3E A;  2CV1 A;  4XLC A;  2ZO4 A;  1YI2 I;  3IAS 2;  1USS A;  3LA7 A;  2ZME A;  1D1C A;  3BG7 A;  2ZB9 A;  3IP4 B;  2DYS H;  3T1B A;  1U9O A;  1XGS A;  2ID3 A;  5J1Y A;  2ESN A;  1WSU A;  4N9I A;  2LF7 A;  2E2I J;  4CCN A;  2E36 A;  3MKW B;  4LD5 A;  2M0M A;  2HXI A;  3FXM A;  1K78 B;  3GTQ J;  2KPM A;  5IY5 H;  1D5Y A;  2OUM A;  2HOS A;  2A3S A;  1TWF J;  3BJO A;  2R7T A;  1IRX A;  2Z5U A;  2M3A A;  5E8I A;  4Z6Y A;  4M3E A;  3DBH B;  5FLX Z;  4C3I J;  3MKY B;  4BXU A;  3DBR B;  2DDA A;  3CCR I;  5BPD A;  3I4P A;  1Z1D A;  3K7A J;  4GFB A;  2QWW A;  2QQ8 A;  1NK2 P;  2LKS A;  4LB5 A;  2HOA A;  4HRI A;  1V3F A;  3BDD A;  2NOJ B;  2V1U A;  3LL7 A;  4PFP A;  2XUB A;  4CO8 A;  3O2P E;  5JHU A;  2M2E A;  1WGX A;  2X1C A;  5C4J J;  2L02 A;  3TW7 A;  5KAF C;  2CH0 A;  5F6F A;  4C30 A;  2JRM A;  4OMY A;  3F21 A;  1H9T A;  2LVS A;  2P6T A;  1J5Y A;  2XB0 X;  2LKP A;  2XPU A;  4YIR X;  2K9L A;  4A3K J;  3T0Y A;  1IG7 A;  1ZYR F;  2XSD C;  1BI3 A;  4EV0 A;  3JRE A;  3CDH A;  3CO6 C;  2O0Y A;  2VBX A;  3BPX A;  4W97 A;  2IXS A;  4A3M J;  1FYL A;  2KQR A;  2HQ5 A;  4F55 A;  3M7G A;  3Q0V A;  1GT0 C;  1NG6 A;  4MFD A;  3LMM A;  2M8G X;  4UB8 C;  2CW8 A;  2DLL A;  4U7D A;  1Z9C A;  4JQF A;  3ZXS A;  1R6R A;  3B02 A;  3J7A Y;  5L3C A;  4F3Q A;  3SXY A;  1LPQ A;  1HLV A;  5L3D A;  4ESF A;  1Y1V J;  1VTN C;  4HX8 A;  3HGG A;  3QAH A;  1FMV A;  3VSL A;  2PLY A;  5IOZ A;  1HDP A;  2R0Q C;  1BC8 C;  4GDF A;  4ESJ A;  4ZTF A;  2RNJ A;  4IHY A;  5HLG A;  3K4L A;  1ZR4 A;  4M9Z A;  1SFK A;  3DWL E;  1N25 A;  2JK3 A;  5K5Q A;  2NXN B;  1U8R A;  1BW5 A;  4U7B A;  3FKJ A;  1UJ8 A;  2BW3 A;  3S32 A;  1EKE A;  3AG2 H;  4LLL A;  2FMY A;  4EJO A;  4ZDP A;  5GAE J;  4RB1 A;  4A3I J;  4A0Z A;  3CD6 I;  3KE2 A;  3LAJ A;  4I09 A;  1NK3 P;  3S14 J;  4EM0 B;  4P1W A;  4QSH A;  3A01 B;  2KRC A;  1ON2 A;  3CC2 I;  1SMT A;  3EQL F;  5KHD A;  4Q47 A;  1JXS A;  4UV8 A;  2Q2E B;  1Y8Q B;  2IRF G;  4V2F A;  3LAP A;  2G9W A;  3BLY A;  1ERD A;  2QQ9 A;  2K9Q A;  3F3X A;  2W00 A;  4NNJ A;  4EJU A;  1P2F A;  1ZR2 A;  1IRF A;  4RM2 A;  3PFY A;  3EYI A;  4BY1 J;  4A12 A;  3S2H J;  3WG9 A;  2VBZ A;  1VND A;  3FM5 A;  1H89 C;  2HPI A;  4HDU A;  1QU3 A;  2H1K A;  2EFQ A;  2DPU A;  3KIO A;  4UNO A;  1YQA A;  3NWS A;  4NC7 A;  3ZMD A;  3GLX A;  3OYI A;  1KQ8 A;  2V7F A;  1G3S A;  3WTT C;  1S8N A;  1VQK I;  3HOS A;  3WOD F;  1K4S A;  2JVH A;  4ENN A;  1XTA A;  1RZ4 A;  1MMG A;  1LDJ A;  3BTC A;  3L2W A;  2JN6 A;  3L2C A;  1F36 A;  2JA2 A;  2OCC H;  3CES A;  2VN2 A;  1FSH A;  2R5Y B;  2ZCW A;  2KKO A;  5CYV A;  2X1D A;  1TBX A;  1MMN A;  5GAD J;  3F8F A;  1PJR A;  1XSX A;  3DKX A;  1ZRE A;  2V6E A;  2DK8 A;  3T8R A;  1AKH A;  1Y39 A;  5TGT A;  3DPL C;  3TKY A;  2D5V A;  3C7J A;  4B1R A;  5HS8 A;  2R7W A;  3D5R C;  2FBH A;  1WKM A;  2DU9 A;  3BTI A;  1IUF A;  1R36 A;  3FMQ A;  2DI3 A;  2W1O A;  4XL9 A;  1LFP A;  3COA C;  1ACI A;  4LB6 B;  4E7S A;  1GHC A;  2B7E A;  5JLX A;  5F64 A;  1RES A;  2Y48 A;  3K1P A;  1KU9 A;  3MKL A;  1V55 H;  4JBA A;  4CA0 A;  2L9N A;  2IJL A;  3CCM I;  3H5A A;  4GCV A;  2OF7 A;  3CJQ B;  4ENJ A;  1EF4 A;  5LRS A;  4BQO A;  4IOC F;  3PJR A;  3WTW C;  1R23 A;  1T8I A;  1Z05 A;  4M9X A;  1BN5 A;  3MVP A;  2ZJ2 A;  3QYB A;  4CCJ A;  2WV1 A;  3I53 A;  1P9Q C;  4ABZ A;  1X19 A;  1DP3 A;  2Q8K A;  3U1D A;  2XF7 A;  1OLT A;  4CCM A;  5HDG A;  4XOR A;  1OCC H;  1SD6 A;  3MQ0 A;  3IL2 A;  1U3E M;  2YU9 J;  3K4C A;  4BUP A;  4LIV A;  2UWM A;  1XG1 A;  1MMS A;  1HXD A;  4BHC A;  1FTT A;  5H2F C;  4KA4 A;  2O8X A;  3GZ5 A;  3ZQI A;  5IPA A;  1JGG A;  4IRI A;  3JCU C;  5A2Q Z;  3G73 A;  1SMY F;  1LE8 B;  1B1B A;  4CDG A;  5LGT A;  1IRZ A;  1QZY A;  2IA2 A;  3E5U A;  2R7O A;  4IF4 A;  3KP3 A;  3OSF A;  3M4O J;  2R7R A;  3HGY A;  2OJE D;  5GPA A;  5EG0 A;  1FC3 A;  2VBY A;  1MH3 A;  3C18 A;  4XR6 A;  2EIN H;  2Y75 A;  3MKZ A;  1XSD A;  4Q5S F;  1RKT A;  5CPR B;  3BR0 A;  3ZP5 A;  4RLF A;  2E2J J;  1MGT A;  2P5K A;  2K27 A;  2BOL A;  3E6M A;  3KP5 A;  3S1Q J;  2FQ3 A;  3ZN1 A;  3FIS A;  3BRO A;  2HI3 A;  3HDD A;  2F2E A;  1OCR H;  2E60 A;  3FMS A;  3K10 A;  4HZF A;  4EJW A;  3QQA A;  3N4M A;  2ZJQ F;  4MQV A;  1R58 A;  1MJB A;  2D45 A;  1U78 A;  3U9G A;  3VOE A;  2LBF B;  2JUG A;  5FO5 A;  3SFZ A;  4TV7 A;  1ZQ3 P;  4LIT A;  1K79 A;  1HSJ A;  4G94 A;  2WTE A;  3SYT A;  2AS5 F;  4B09 A;  1JE8 A;  2F5C A;  3SZP A;  2K4B A;  3HOU J;  5DEQ A;  4FQG A;  3L2U A;  2C6Y A;  5K7F A;  1J59 A;  4BBS J;  1X3U A;  3TO6 A;  3QP5 A;  4IQ4 A;  1VQ9 I;  2DA7 A;  4IJA A;  2E1C A;  4BL0 B;  5J4Y A;  1KZH A;  3WU2 C;  3VDX A;  3I54 A;  3BWG A;  1OCT C;  3NQO A;  3L09 A;  2VPR A;  1TQI A;  2E1M B;  5ICG A;  4N4N B;  1LJ9 A;  1X4O A;  4NQW A;  3HOY J;  3H9G A;  2K9N A;  4P55 A;  1QVT A;  1Z3X A;  1X3Z B;  1ETO A;  1REP C;  3MZY A;  3LWF A;  4M74 A;  3W6K B;  3WHB A;  4HNV A;  3HIF A;  4CCO A;  5K1Y A;  4AIK A;  4HW0 A;  3MEX A;  5DUK A;  1EH8 A;  3JRI A;  5F0C A;  5CVR A;  2CWE A;  5C44 J;  2LLK A;  3DU6 A;  3G6E I;  1X58 A;  4ZH4 F;  2GA2 A;  3DBL B;  4EMS A;  9ANT A;  3OL4 A;  1BOA A;  2Y69 H;  3D5S C;  3OWT A;  3LFK A;  1D3Y A;  2PMH A;  2P6S A;  3ESW B;  3DXJ F;  4BQA A;  3I9V 2;  1MMD A;  1X1D A;  1YIT I;  2LTP A;  3M3Y J;  2E5N A;  3GZN B;  1TL8 A;  2EA2 A;  2MSY A;  2NVY J;  1XN7 A;  2PG4 A;  2HQN A;  1SAX A;  2WC2 A;  3M8J A;  3LA2 A;  3P5J A;  2FF4 A;  2BYV E;  1W4M A;  3OSG A;  2FBI A;  1O4X A;  3K4B A;  5K7Z A;  1ZHF A;  4BE2 A;  3T5X A;  5FB2 A;  2WBM A;  4WWC A;  4EJT A;  2H6C A;  2LOO A;  2MW8 A;  5LHH A;  2VPL A;  2XAU A;  1PUF A;  4LG0 A;  1FYK A;  3RYR A;  2KZG A;  2PJR A;  2YX7 A;  3IRR A;  3LNQ A;  2ISZ A;  3Q9V A;  1X2M A;  1JUS A;  1SVL A;  4P9U A;  3K70 D;  2L5Q A;  3S1N J;  2AO9 A;  2W84 A;  2O8K A;  1K7A A;  1BI1 A;  3BP8 A;  4PSX A;  1XMA A;  2XV4 S;  4IZZ A;  2DA3 A;  4HG2 A;  1IN5 A;  4KIC A;  1D0X A;  4CYD A;  4MFE A;  5IT3 A;  2X85 A;  3AAF A;  5J6X A;  1OCP A;  3TW6 A;  2QZ8 A;  4XM3 A;  2CMP A;  2PBI A;  2FEZ A;  2LF8 A;  2O7O A;  3RKY A;  3RJP A;  4FE7 A;  4RM3 A;  1W0T A;  2WY7 Q;  2DTR A;  1R7J A;  1EH6 A;  3RZO J;  2GQQ A;  5LLQ A;  3A2K A;  2KP6 A;  3A03 A;  1K83 J;  4F52 A;  2IPQ X;  1I39 A;  3BY6 A;  1U5T B;  2QQB A;  3ZQ7 A;  2XAG A;  1X1B A;  2VQC A;  2JJ7 A;  2DFI A;  5J8C A;  1R4N B;  1PDN C;  3HOV J;  5D8K B;  2E1N A;  1YFH A;  1TT5 B;  4GYG A;  4ASN A;  3TMO A;  4EGY A;  3CUQ C;  4QWQ A;  3RIR A;  3J7A O;  5BNG A;  3KYD B;  4KMU X;  3J7Z I;  2BVM A;  1V5E A;  5LEJ A;  2GLO A;  3KEO A;  3CDI A;  3F23 A;  3UKG A;  3CCE I;  1MSF C;  4WF2 A;  5IP7 J;  2ICW G;  3BR6 A;  4FT8 A;  5LGN A;  4QIW N;  2BHZ A;  2X0L A;  3VEP A;  4LLG F;  1D8J A;  5D6E A;  1WI9 A;  3N05 A;  3LOC A;  3W2V A;  2V1N A;  2HQA A;  4OAZ A;  4RAZ A;  2E7W A;  2QGU A;  3FXU A;  5CVV A;  2XVC A;  4UUS B;  5DTD A;  5J1U A;  1AWC A;  3DLA A;  1WRJ A;  2O61 A;  3FX3 A;  1YRN A;  3K1N A;  1T95 A;  4AU7 A;  1FPQ A;  3Q5F A;  1OYI A;  2XRL A;  4HX4 A;  1IZ1 A;  3FM3 A;  3VOD A;  1X1P A;  1YS6 A;  3QPS A;  2EZH A;  1EV7 A;  1W1W E;  3M1C A;  3AFH A;  2L01 A;  2LY1 A;  4LGW A;  5IT9 K;  1STZ A;  2QKM B;  3H9J A;  2QLZ A;  3CMM A;  3PQK A;  3QOE A;  5J4V A;  1RUN A;  3CLO A;  3HSE A;  2V9V A;  4KFC A;  4I2O A;  3HRM A;  1UHM A;  2KJB A;  2DK5 A;  3AG1 H;  2HZD A;  2ZFU A;  3T8T A;  2XGE A;  2IEK A;  3ZQQ A;  1UG2 A;  4PGH A;  2CGP A;  1ODD A;  2OZ6 A;  5B1A H;  2Z16 A;  4LK1 F;  4IHS A;  4B44 A;  5CVJ A;  3J80 Z;  1VF9 A;  3KLO A;  4FTH A;  2DT6 A;  3BOQ A;  3CJT B;  4E6K G;  3JRA A;  2XHK A;  3CUQ A;  1X3W B;  4YFK F;  4ZZD A;  2RV8 A;  3O8H A;  1ORK A;  1LEB A;  3N97 A;  3KX2 A;  1JKP C;  3B6C A;  3OYB A;  1KYZ A;  5DDG A;  3KP4 A;  3E5X A;  4DYC A;  1Z21 A;  4FE4 A;  3HYI A;  3ZQL A;  5FLX K;  1LDK B;  3G1O A;  3K4J A;  4S05 A;  2W57 A;  4ETS A;  3DPT A;  3BC8 A;  5IP9 J;  1Z91 A;  3CJR B;  5LD2 C;  2XGC A;  1C0W A;  2VI6 A;  2CYY A;  2I10 A;  5FKM A;  4EM1 A;  5C4X J;  4RGX A;  1DGR M;  2WAD A;  4BEH A;  1ZTR A;  2OPT A;  2WV0 A;  4KUM A;  2XRO A;  1WWX A;  3ZCO A;  1HF0 A;  2P4W A;  1KYW A;  2BW3 B;  3HB9 A;  3CF5 F;  1KQ0 A;  1GXP A;  5CKT A;  4OAY A;  3IWZ A;  4AC0 A;  1TW2 A;  3RTR A;  4U88 A;  2Z3Y A;  2EIJ H;  1T08 B;  5GP9 A;  4DJA A;  2COB A;  2FQ4 A;  1S29 A;  2ECB A;  2NOG A;  1L3L A;  1HDD C;  2KIM A;  2MLG A;  4D5F A;  4BAY A;  3VYU B;  2IA1 A;  2UXX A;  4DZJ A;  5J8F A;  2MYS A;  2V9P A;  3ABK H;  3SQN A;  4UUV A;  3M8F A;  1VZ0 A;  2QM3 A;  4XKB A;  1SFU A;  3WTX C;  1BI2 A;  3W6V A;  1T38 A;  1YX5 A;  3CC4 I;  3DFG A;  2GBY A;  1UMQ A;  3EUH A;  4DBR A;  3I58 A;  2DA1 A;  5C3E J;  2HXO A;  2KDZ A;  2FUG 2;  1Z3Y A;  2LMD A;  2MLK A;  1SFX A;  1M1E B;  3GFL A;  1IRG A;  2K4J A;  5KVR A;  2MC4 A;  3SZT A;  4ENK A;  4QTR A;  3E5Q A;  1DGW Y;  3IH2 A;  2M8E A;  4AM3 A;  5FKN A;  1A5J A;  2M4G A;  2RN7 A;  2VKH A;  5J3L A;  4MTD A;  3PUB A;  3WTZ A;  1H88 C;  2E7X A;  1JUP A;  4NC6 A;  4DW6 A;  3HPH A;  2NVQ J;  3WU0 A;  2QSF X;  2R7S A;  1SFO J;  3DV8 A;  1V54 H;  1WJ5 A;  1KGS A;  5M5X J;  1HW2 A;  2JA8 J;  1YW7 A;  2PN6 A;  1VQO I;  2E34 A;  2KL4 A;  2VE9 A;  5BPI A;  3HOZ J;  2DQR A;  3Q0W A;  4I98 B;  1I5Z A;  1WFX A;  3H0D A;  3P9I A;  3WGG A;  2W4S A;  2IGM A;  1MBH A;  1QRY A;  3CTA A;  4ZJZ A;  2R5Z A;  1IV6 A;  1I50 J;  2OZU A;  2V4J C;  3A4C A;  1QZZ A;  4C2U A;  3LSG A;  2CQK A;  1WHU A;  4BH9 A;  2EWN A;  4OIQ F;  2YSR A;  4DQ2 A;  1ZG1 A;  1IV8 A;  3E3V A;  3KEQ A;  1QBJ A;  1N78 A;  2STT A;  1FX7 A;  3CP8 A;  2IVM A;  1QPM A;  2GWR A;  2CV2 A;  2HQR A;  3CDL A;  1F43 A;  3SEZ A;  3G2B A;  2RKH A;  2XAQ A;  4M6X A;  2WB1 N;  1O7F A;  3I59 B;  3HUG A;  5D4S A;  4I01 A;  3JSP A;  2B0L A;  2M9H A;  1LEA A;  2PFB A;  1J75 A;  1VQP I;  2D1H A;  1SAN A;  5EEH A;  1AU7 A;  4H4K C;  4IL6 C;  1B72 A;  2WAQ N;  4HNU A;  5AON A;  3PIP F;  5HNF A;  2BY1 A;  2Y0S N;  1FSE A;  2XF6 A;  3RSN A;  2JQ7 A;  1RET A;  4KIB A;  3HTU A;  2JA5 J;  2OBP A;  4CUG A;  4FX4 A;  2F4M B;  1E3O C;  3EDP A;  2K86 A;  4NBQ A;  2R93 J;  1IF1 A;  4AYB N;  3CCY A;  1T33 A;  5DV5 A;  2XAJ A;  3BR2 A;  1XGN A;  3DU5 A;  2DMN A;  2IGO A;  2V6C A;  4A3E J;  4XKW A;  3Q9S A;  4FET A;  2O9L A;  4G6D A;  4AUX A;  1WI3 A;  5EG0 B;  1IW7 F;  2BXZ A;  2OCE A;  3TDZ C;  1VQ6 I;  1TNT A;  3KZY A;  1MZB A;  3D1N I;  4XRS G;  1ZGW A;  4UUT A;  4XQF A;  3WE2 A;  5DYM A;  1FJL A;  3ZMT A;  4MEX F;  4IEJ A;  1U2W A;  3HHH A;  3WHC A;  2P7V B;  4XRS A;  1D8K A;  4CCL A;  3MZH A;  5HLH A;  1IN6 A;  3O3K A;  3TO7 A;  2FX0 A;  4I76 A;  1AHD P;  2VE8 A;  4I0A A;  1BM9 A;  2CFX A;  2RRE A;  3HRS A;  4XNF A;  4XLN F;  3KP7 A;  4IHW A;  4NHJ A;  3VFZ A;  4IX7 A;  1R5I D;  1TLH B;  2HS5 A;  3GW2 A;  4AIJ A;  2MH9 A;  2EV5 A;  3OIQ A;  4A2U A;  4FAS D;  2J5O A;  2QBY A;  2G7H A;  2J5P A;  5H6R A;  3R0J A;  1E0E A;  2GOX B;  5A2Q K;  1MBK A;  2HKX A;  4CYC A;  2I8D A;  3QYE A;  5CQG A;  1J0R A;  3GTK J;  4HST A;  2E71 A;  3RQ4 A;  4UV9 A;  3HJE A;  4G8X A;  3EUA A;  2P81 A;  2ACJ A;  2KMU A;  3QPL A;  4DYQ A;  2P5L C;  3RCO A;  4NQW B;  2W25 A;  4A3D J;  3E6B A;  2JSC A;  4J19 A;  4D1Q A;  1SC7 A;  3ZPL A;  1HKT A;  4KT5 C;  1XDU A;  1R71 A;  2Z9O A;  2DJN A;  2EV6 A;  3MMY B;  2CJJ A;  1K61 A;  4LK0 F;  4A69 C;  2IBD A;  2DT7 B;  3CCV I;  1BBY A;  4C2T A;  2DFF A;  2W7N A;  3IKT A;  3CCL I;  2OU2 A;  2JVG A;  2PMZ N;  3JW4 A;  3OYK A;  1YLF A;  3LA3 A;  1ITY A;  5ED4 A;  2A07 F;  3PNY A;  3GTO J;  2H6B A;  2R7Z J;  5JVG F;  3V4G A;  3HRT A;  1DU0 A;  4BY7 J;  2CUZ A;  3TOA A;  4UXN A;  4HEA 2;  1JT6 A;  1GV2 A;  3KP6 A;  1SEU A;  1YOV B;  1D0Y A;  3SDB A;  4PJ0 C;  5E20 A;  3ABT A;  1XCV A;  5IYD J;  3GF2 A;  3GZ6 A;  2EB7 A;  2BY2 A;  3ML6 A;  2JMW A;  1IGN A;  1FY7 A;  1B8I B;  2DA6 A;  3K2A A;  4PK4 A;  5TRD A;  3OYH A;  4CCK A;  1WCM J;  1RC9 A;  1KON A;  4QLC U;  3A0H C;  3IRQ A;  1VQ5 I;  1PUF B;  3CMY A;  5K5R A;  1XPX A;  4DZP A;  4BHP A;  1O3S A;  2NVU B;  2JA6 J;  1HA8 A;  3OYJ A;  1HW5 A;  1JTY A;  1O3R A;  3D0S A;  1OKR A;  2ZFW A;  1N75 A;  3MN2 A;  3DTK A;  1TTY A;  3ASN H;  3OV8 A;  4RGR A;  1F1Z A;  2FU4 A;  2XRN A;  4XLE A;  1B6A A;  1RPW A;  2W85 A;  4XLA A;  5IYB J;  3IV5 A;  2H8R A;  1HQC A;  2XAH A;  3DCF A;  2WB1 A;  1XGO A;  4XOT A;  3GYH X;  2L4M A;  2A5Y B;  2GOM A;  3ECO A;  2EFO A;  2X6W A;  2PMU A;  1XSV A;  2I5U A;  3FXL A;  5CQE A;  4XKC A;  4OIP F;  2X6Y A;  3DPU A;  3CME I;  1ZG5 A;  2WAQ A;  3ERM A;  1G2H A;  5GTI C;  2LFB A;  4BXX J;  3TQN A;  4M3B A;  2DCE A;  2QSG X;  2Y0S A;  4D7N A;  1I6H J;  3ZQF A;  2A61 A;  2F4I A;  3OYD A;  5IOY A;  1UFM A;  4BGD A;  2MH2 A;  3DKY A;  4AYB A;  1R1T A;  3F8C A;  1LVK A;  3UNG C;  3BR5 A;  2DOE A;  1LB2 A;  4HF1 A;  4BJT A;  4L18 B;  4XLF A;  2DW4 A;  2QCO A;  3QU3 A;  2DOF A;  4PDK A;  2ME0 A;  2K02 A;  1SVO A;  4ESB A;  3RKQ A;  3S15 J;  3R61 A;  3L2Q A;  1CF7 A;  1QHH D;  3P9K A;  1YJW I;  4HNT A;  1JKR C;  4L9J A;  3GTL J;  3FHN A;  1XD7 A;  5EJC A;  2LRD A;  1XCB A;  4C3J J;  5LRR A;  1W5S A;  5ILS A;  4PFO A;  4ZYG A;  2GXA A;  2PI0 A;  5FRM A;  4E4H A;  5E18 F;  1L0O C;  3LSR A;  3EUK L;  3C3W A;  1T0F A;  4NUB A;  5DCF A;  2VON A;  2PQ8 A;  2EH3 A;  2LC2 A;  3DKW A;  5CJ9 A;  6PAX A;  2HTS A;  3EYY A;  4A3G J;  1MMA A;  4X6A J;  4KT6 A;  1FOK A;  2R7Q A;  5CVU A;  1G3T A;  5KNL A;  3ABM H;  2QUF A;  2PX9 A;  2BGC A;  3SJM A;  3I64 A;  2MAB A;  5HLI A;  3OS0 A;  4HYE A;  4XRF A;  4WXH A;  2HR3 A;  1BJZ A;  1BR2 A;  1YW9 A;  3BZC A;  2O5R A;  3HEF A;  4X0G A;  4BJ6 C;  4UVA A;  2BZT A;  4UVC A;  2F5D A;  3A02 A;  4RGU A;  1Z7L A;  4II2 A;  1FBU A;  4MNU A;  1I6X A;  1IXS B;  1G8X A;  4MQ9 F;  1W0U A;  1SFE A;  3OS2 A;  3QWL A;  3PO3 J;  2VLA A;  2M87 A;  2KIF A;  3BZK A;  4ZYA A;  2K5C A;  3K0L A;  1DU6 A;  1U8B A;  1IO2 A;  3BJA A;  3F0C A;  4JYK A;  1QO0 D;  3JRC A;  5EZG A;  1P4W A;  3ZR8 X;  2LYC A;  4XBF A;  2PMZ A;  3FXR A;  2VBW A;  1IN8 A;  1D1A A;  5E79 C;  2DDB A;  3FF5 A;  3JRF A;  3MZ8 A;  2AXT C;  2LG4 A;  1W7P D;  2HTJ A;  3V7C A;  3FK7 A;  3CCQ I;  1S72 I;  1IN7 A;  1BC7 C;  1JUM A;  2WA0 A;  3F8M A;  2JPB A;  4B43 A;  3FDY A;  3GTM J;  2EFP A;  3GFJ A;  5F0F A;  5M5W J;  2FOW A;  4BEH B;  4A5M A;  4DGW B;  1R1U A;  1IC8 A;  5L3G A;  2FXA A;  4S04 A;  1NHA A;  1D0Z A;  4E7K A;  1WJC A;  2YR2 A;  2XKP A;  4PJL A;  5EEA A;  2WWY A;  3I55 I;  3H92 A;  2IS1 A;  1Y56 A;  2DBB A;  1ETW A;  5E3L A;  2DYR H;  3OL3 A;  2Q2E A;  3QOD A;  1ZN2 A;  2DA2 A;  3FZV A;  2EK5 A;  3ZMS A;  4L0Z B;  2ZBK A;  3H3Z A;  4ZTJ A;  1W7P B;  3RZD J;  3JR9 A;  3J80 K;  1FTZ A;  5F08 A;  1JKQ C;  3FHZ A;  1WJB A;  1FOW A;  4AVP A;  2VOO A;  2OA4 A;  2JPC A;  3QPT A;  1FIA A;  3V7S A;  4FX0 A;  1MND A;  3K9T A;  2NNN A;  4G7O F;  4LG3 A;  3PNV A;  3HOT A;  4OOI A;  4HQM A;  2EBI A;  3LQQ A;  4GO1 A;  2L9R A;  5HVQ C;  1OCZ H;  2P8T A;  4BHB A;  1H0M A;  3H3V K;  3HL2 A;  2DN0 A;  4M9S A;  1PP7 U;  1VQ7 I;  1S6L A;  3HBL A;  2L9S A;  1MJA A;  4I99 C;  3FXQ A;  4B8X A;  3CC7 I;  1TNS A;  2R5Y A;  3ZQH A;  2VOD A;  4P96 A;  3C1D A;  2XC7 A;  2JUC A;  2M0C A;  1DDN A;  4CZC A;  1OJL A;  1TWA J;  2HOE A;  3HG9 A;  2QYO A;  1Z7U A;  1P7J A;  1ZLJ A;  3V8K A;  1XMX A;  5ERI A;  4A93 J;  4BKX A;  3KCC A;  4WK8 F;  4JX4 A;  4BS9 A;  2CUF A;  2LD5 A;  3SDG A;  4PJJ A;  1V5G A;  5HLT A;  1NTC A;  3HOX J;  2ADU A;  1W5C C;  2ISY A;  4WCG A;  1I1S A;  2NS7 A;  2NS8 A;  3TOB A;  3OYA A;  4W1U A;  1ZH5 A;  2MD0 A;  2BVL A;  3GTJ J;  2LKX A;  4L0Y B;  2ZME B;  4J00 A;  2WAE A;  4KIT B;  4M3F A;  3BZ6 A;  3ZQG A;  4YFN F;  2CFO A;  4RBO A;  5E3O A;  3ABL H;  2F5V A;  2F6C A;  5B66 C;  4KJZ A;  1XC5 A;  1X1C A;  2JSP A;  3QPH A;  4Y13 A;  2HFH A;  3RQI A;  5FGM A;  1MBE A;  3OYF A;  2CQX A;  4RMN A;  4A0X A;  3A1Y A;  3BR3 A;  3K4N A;  1TWH J;  1B59 A;  2VAS A;  2NS0 A;  5M3F J;  5F04 A;  4CIC A;  1MKM A;  3IH3 A;  1B72 B;  4PZJ A;  3GXO A;  1QA6 A;  2K9S A;  3SHF A;  4HSR A;  4MEY F;  1RUO A;  2LDU A;  1MH4 A;  2QF7 A;  1LE8 A;  2BBY A;  1CGP A;  4KNY A;  3PFI A;  2ZJP F;  2HVR A;  1FOY A;  2HNH A;  3I3L A;  4XOP A;  2DA4 A;  2R7V A;  1QHG A;  3ELK A;  4BQN A;  5F1J A;  3E1S A;  5M3M J;  1T6S A;  1UG0 A;  3GX4 X;  3JRB A;  2Y30 A;  1HC8 A;  3EUH C;  2VQL A;  4D0P A;  5TIS C;  1FMW A;  3I71 A;  3R60 A;  5CLS A;  3OYG A;  5GTH C;  5D8L B;  4WX9 A;  1OFC X;  3D5L A;  5ICF A;  3G1M A;  4GXO A;  4Y17 A;  2AXL A;  1I27 A;  1QQI A;  3LSJ A;  5AIP A;  4NC8 A;  3FIW A;  3CCJ I;  3KP2 A;  2W24 A;  1GVD A;  3NEU A;  1MD0 A;  2ZXW H;  2XDV A;  3JTG A;  2VT2 A;  4Q48 A;  2VT3 A;  2LBF A;  1Y0N A;  1IXR C;  4PSW A;  5E3M A;  1RRJ A;  3V8L A;  1S5L C;  3GUD A;  2ZKZ A;  3P7N A;  4XLP F;  4RDU A;  3ERE D;  4YIF A;  1J7K A;  2EIM H;  1QGP A;  4G7Z F;  5K7H A;  1TP4 A;  2IGK A;  3U2R A;  2KLO A;  3E97 A;  3OYC A;  2QBY B;  3S1R J;  2A6E F;  3NAU A;  1SVM A;  3LSI A;  2MBF A;  2GXB A;  1POG A;  2DQL A;  1O3Q A;  2FOK A;  1KA8 A;  3F6O A;  2H8W A;  1W5T A;  2HVQ A;  4KIG A;  2VQH A;  5GAG J;  1BIA A;  1W36 C;  3H36 A;  1DP7 P;  4Y4R A;  4LMY A;  3ECH A;  5D5V B;  2L7M P;  2VJ4 A;  3HSR A;  1SAU A;  3KEY A;  2CQQ A;  1S9H A;  3JRG A;  2HDC A;  4YEL A;  2UXN A;  2VJI A;  2M7B A;  1U5T C;  3OOU A;  5HNH A;  4I0B A;  2Z33 A;  4A3F J;  2GA1 A;  2FNA A;  1ZLK A;  2STW A;  3RDI A;  1KU2 A;  1WH5 A;  3I56 I;  4XSZ F;  2IS6 A;  2BHY A;  5E1Z B;  3BG5 A;  2X6O A;  1QPI A;  1VFC A;  3QYF A;  1KQ9 A;  3REO A;  3AG3 H;  4X1E A;  2QQA A;  2O3F A;  3U21 A;  2AQE A;  4N0B A;  4Y33 A;  1TQP A;  1HOM A;  3H35 A;  1FT9 A;  4FHT A;  3NRV A;  2E1O A;  2FJ1 A;  1UCR A;  2FNP A;  1TC3 C;  4IXA A;  1NG7 A;  5BS6 A;  2H27 A;  3FMR A;  1FIP A;  2K85 A;  2MGQ A;  1B9N A;  5DCM A;  3PL8 A;  1UST A;  4C2M J;  2CUE A;  3TL4 X;  4XMY A;  4B4C A;  1AA7 A;  2QEN A;  3KFW X;  1JT0 A;  4E7I A;  3MFK A;  2ZXI A;  3QU6 A;  4CSW A;  3LQR A;  5JFR A;  4V2G A;  1ON1 A;  1PP8 F;  5F0H A;  2O6G E;  5JHF A;  1AKH B;  5E17 F;  1BR1 A;  3CQZ J;  4CH7 A;  2BE5 F;  2GIV A;  4HV6 A;  2Y9Y A;  4RB2 C;  3J81 Z;  3SFI A;  2RQQ A;  3H3U A;  2CRG A;  2IGN A;  2HZT A;  2JRT A;  2A6T A;  4GYI A;  2M5W A;  3ZMU A;  1ETV A;  2CQ7 A;  2ZNZ A;  2KIS A;  2GM4 A;  5J47 A;  5FRN A;  4EM2 A;  3W2W A;  5B5E C;  4U0Y A;  1LVA A;  1YE9 A;  4L5E A;  1R9T J;  1ULY A;  1A35 A;  1Y6I A;  4CZZ A;  1U5T A;  3G71 I;  2DFE A;  2E19 A;  2PEX A;  4KIF A;  3ZOB A;  1A31 A;  1JKO C;  2XAS A;  4II3 A;  3ZN0 A;  5EGO A;  1S7A A;  4PUS A;  2ZSI B;  5BOX A;  3HKZ N;  5F1R A;  2IP2 A;  2UUZ A;  2VKE A;  2H09 A;  1G3W A;  2LR8 A;  2R3S A;  1OYY A;  3C2H A;  5LFA A;  2BXY A;  4R1H A;  4IQJ A;  2OTL I;  2M7A A;  1N77 A;  4IOA F;  3S3M A;  4D7M A;  2JZY A;  4S0H B;  3CLQ A;  5DM7 F;  4KN7 X;  4BXF A;  1S3J A;  5LHG A;  5LBQ A;  2F4O B;  3QRF F; 
#chains in the Genus database with same CATH homology
 1F4K A;  3RKW A;  2DAO A;  2TDX A;  4HV5 A;  4IRH A;  4OIR F;  1CF7 B;  1YW8 A;  2VXZ A;  5HDK A;  5BMZ A;  3PQJ A;  2RDP A;  1T39 A;  2D2W A;  4ZZL A;  1JGS A;  1RI7 A;  4IHT A;  3M9A A;  3IWF A;  2OD5 A;  4ZYE A;  2IW5 A;  3K1M A;  1J2X A;  4IPA A;  4HLX A;  5D5W B;  3BPV A;  1IN4 A;  1P6R A;  1SD5 A;  2K7L A;  5FFZ A;  4PCQ A;  4L5J A;  1JHH A;  4U0V A;  3WE3 A;  1DPU A;  2V79 A;  1OYW A;  2HWV A;  2DPD A;  5LGU A;  3TGN A;  3RPQ A;  1SD4 A;  3RPU A;  2RVC A;  4UHT A;  5FFX A;  2FRH A;  3HRU A;  3QOP A;  4EGZ A;  1G3Y A;  2V1X A;  1E2X A;  4KDP A;  2G7U A;  3GFI A;  4NB5 A;  3P9C A;  3ZMV A;  1TW3 A;  4ENM A;  3M1E A;  5E1X A;  4YII A;  4KN4 X;  4Z2Y A;  1FWZ A;  1PUE E;  5TJJ A;  3DP7 A;  3TDU C;  3IHU A;  2A68 F;  3V8J A;  2HKO A;  3JAM Z;  2XAF A;  2R7D A;  2ESH A;  5FD5 A;  4BNC A;  4A0Y A;  5D4R A;  2OAZ A;  3LST A;  1OPC A;  1U6G A;  2M1B A;  1S7O A;  3S2W A;  2YU3 A;  4KMF A;  5DUI A;  3FWE A;  4LG0 B;  4WXD A;  3GVA A;  5HS9 A;  3V7R A;  2F5F A;  1XDS A;  3BJ6 A;  2M30 A;  4KYW A;  3RYP A;  4HAM A;  1HST A;  2HEO A;  1BIB A;  4OIO F;  1RIO H;  3GFM A;  4A6D A;  1J9I A;  4M71 A;  2BV6 A;  2JTV A;  3TO9 A;  5AIQ A;  4A6E A;  3KLN A;  5HDN A;  1MDM A;  1YG2 A;  1AOY A;  2FSW A;  1R1V A;  1ZGJ A;  4RS8 A;  2D1V A;  3ROU A;  4ZYD A;  1G4D A;  4P9F A;  3K69 A;  5HS7 A;  4IRG A;  1FBS A;  3DEU A;  1FLI A;  1UB9 A;  2P5V A;  3WGI A;  3L7W A;  3DF8 A;  3W6J B;  1T98 A;  4N9H A;  2NAZ A;  3I59 A;  1A04 A;  1K78 A;  2YPR A;  1R5G A;  1D5V A;  3M8E A;  5D6F A;  3JSO A;  2ELH A;  1KU7 A;  3F22 A;  3WU1 B;  3F72 A;  4A5N A;  4PGG A;  1RNL A;  1IAW A;  5E8G A;  4MHG A;  4XSX F;  1YYV A;  3GWZ A;  1QNT A;  3E6D A;  3CUO A;  1FNN A;  1F9N A;  2EFN A;  3HSF A;  2CW0 F;  2FA5 A;  2MC3 A;  1KU3 A;  4HF0 A;  3CO7 C;  3K2Z A;  3E6C C;  5L3F A;  5BQT A;  1HBX G;  3F6V A;  1BJA A;  1XGM A;  2Q0O A;  1ZRD A;  2COM A;  3CUQ B;  4AD9 A;  5K5O A;  1ZRF A;  3WGH A;  4G7H F;  2XIG A;  4L9V A;  1P92 A;  1GXQ A;  4OMZ A;  4LFU A;  1Z6R A;  2ETH A;  1OR7 A;  2L4A A;  3JTH A;  1I1G A;  4G9Y A;  5LEK A;  2A6H F;  3R0A A;  4DNC A;  4ZYH A;  2GXG A;  3QP6 A;  4P5O A;  4ON0 A;  2VOP A;  4YG2 F;  5JVT A;  3R4K A;  4RAY A;  4O6J A;  2L3D A;  5ILV A;  4HDV A;  2H94 A;  2IT0 A;  1ZAO A;  1B9M A;  3KZZ A;  1ZRC A;  1O7L A;  2LSO A;  4UVB A;  1Z6T A;  1LDD A;  4AWX B;  1T2K A;  4HQE A;  2DO7 A;  3B73 A;  1MJ9 A;  4JK1 X;  4IVN A;  2V1D A;  4MTE A;  3GEZ A;  5DCM B;  1R22 A;  1ZAR A;  3EET A;  2FML A;  1XMK A;  2F5E A;  5ICC A;  4L9T A;  1TQM A;  1WQ2 A;  4EJV A;  1UHW A;  2EA4 A;  2OQR A;  4Y15 A;  1HKQ A;  2BEO A;  5DD8 A;  5ICE A;  2L54 A;  4HLY A;  2XKO A;  1LQ1 A;  1HKS A;  2KIU A;  1FZP B;  5JI6 A;  4MGR A;  4K2E A;  1F5T A;  1G6N A;  3ABU A;  2FBK A;  2EJR A;  4EQQ A;  1YS7 A;  4M73 A;  5FD6 A;  3O6B B;  4U0W A;  2YX4 A;  4AIH A;  5DD4 A;  1FP2 A;  1OMI A;  3IKV A;  4HF2 A;  2HYF A;  3F8N A;  1FBQ A;  3HHG A;  2IA0 A;  3WTV C;  2PJP A;  4GGG A;  1YTY A;  3J81 K;  4O5V A;  5D5U B;  5LHI A;  4RB0 A;  1FYM A;  2RQP A;  2O03 A;  4M6Y A;  4HX7 A;  3IC7 A;  1ZGA A;  3WTU C;  3MAJ A;  1DUX C;  2FE3 A;  2X4H A;  2NNY A;  2ZNY A;  2Y0M A;  4M72 A;  4E70 A;  4BYY A;  4L9N A;  5EEG A;  3ULQ B;  2LNB A;  3L00 A;  3R6S A;  1O3T A;  4HBL A;  5HOO A;  5H20 A;  2CSO A;  2VC0 A;  4HOB A;  3RKX A;  2GZW A;  3F8B A;  4LJZ F;  1V4R A;  3MWM A;  4RB3 C;  1IXC A;  1Q1H A;  2NYX A;  2Z99 A;  3MCZ A;  3WTS C;  1IUY A;  4L5I A;  4HA8 A;  1BI0 A;  4I02 A;  2EV0 A;  2UZK A;  3L9F A;  3OOP A;  2MA3 A;  1ZG3 A;  3ISP A;  2JT1 A;  5KK1 A;  1R00 A;  5ILU A;  2HYG D;  4OU0 A;  4YFX F;  1K6O A;  4OIN F;  1O57 A;  4LLN A;  2QVO A;  2RGV A;  2M45 A;  2MD5 A;  2VC1 A;  4CHU A;  4CGZ A;  3G3Z A;  5H6Q A;  3RI4 A;  4H0E A;  5E1W A;  1Y0U A;  2ZXJ A;  3ZMZ A;  3WTY C;  1JHF A;  1W7P A;  3CJN A;  3HTS B;  1R5H A;  2CG4 A;  1GVJ A;  2R7F A;  4WXC A;  4R8H A;  1XB4 A;  1ONV A;  4Q4Z F;  2RC4 A;  4I7H A;  2OQG A;  5D5X B;  1LNW A;  3VB2 A;  3I5U A;  1SD7 A;  2EFW A;  1YO5 C;  1P4A A;  1H9G A;  2CO5 A;  2GAU A;  4EVI A;  3GO5 A;  2XGX A;  2KRF A;  4G6Q A;  1HW1 A;  2KJC A;  1DPR A;  1FP1 D;  3DQV C;  1B4A A;  2DT5 A;  3KET A;  2A69 F;  5IT9 Z;  1MDM B;  1YIO A;  3I0T A;  4RGS A;  4F7Z A;  5JR3 A;  4O3M A;  5CVI A;  4R79 A;  5L3B A;  2HGC A;  3JAM K;  2NRA C;  1E17 A;  1EH7 A;  2P7C B;  4CXF A;  1P4X A;  5L3E A;  2ZO4 A;  1USS A;  3LA7 A;  2ZME A;  3T1B A;  1XGS A;  2ESN A;  1WSU A;  4N9I A;  2LF7 A;  4LD5 A;  1K78 B;  2A3S A;  3BJO A;  2Z5U A;  5E8I A;  5FLX Z;  4BXU A;  5BPD A;  3I4P A;  1Z1D A;  2QWW A;  4LB5 A;  1V3F A;  3BDD A;  2V1U A;  2XUB A;  4CO8 A;  3O2P E;  5JHU A;  2L02 A;  5F6F A;  4OMY A;  3F21 A;  1H9T A;  2P6T A;  1J5Y A;  2LKP A;  3T0Y A;  1ZYR F;  1BI3 A;  4EV0 A;  3CDH A;  3CO6 C;  2O0Y A;  2VBX A;  3BPX A;  1FYL A;  3M7G A;  2DLL A;  4U7D A;  1Z9C A;  4JQF A;  3B02 A;  5L3C A;  3SXY A;  5L3D A;  4ESF A;  1VTN C;  4HX8 A;  3QAH A;  2PLY A;  1BC8 C;  4ESJ A;  2RNJ A;  5HLG A;  4M9Z A;  5K5Q A;  1U8R A;  4U7B A;  4LLL A;  4EJO A;  2FMY A;  4RB1 A;  4A0Z A;  3KE2 A;  3LAJ A;  4I09 A;  4EM0 B;  1ON2 A;  1SMT A;  3EQL F;  4Q47 A;  1JXS A;  4UV8 A;  2IRF G;  3LAP A;  2G9W A;  2QQ9 A;  3F3X A;  4EJU A;  1P2F A;  1IRF A;  3EYI A;  4A12 A;  3WG9 A;  2VBZ A;  3FM5 A;  4HDU A;  2EFQ A;  2DPU A;  4UNO A;  1YQA A;  3ZMD A;  3GLX A;  1KQ8 A;  1G3S A;  3WTT C;  1S8N A;  3HOS A;  3WOD F;  4ENN A;  1RZ4 A;  1LDJ A;  3L2C A;  2VN2 A;  1FSH A;  2ZCW A;  2KKO A;  5CYV A;  1TBX A;  3F8F A;  1XSX A;  1ZRE A;  2DK8 A;  3T8R A;  3DPL C;  3TKY A;  3C7J A;  5HS8 A;  2FBH A;  1WKM A;  2DU9 A;  3FMQ A;  1R36 A;  3COA C;  2DI3 A;  4LB6 B;  1GHC A;  5F64 A;  2Y48 A;  3K1P A;  1KU9 A;  4JBA A;  2IJL A;  4GCV A;  4ENJ A;  5LRS A;  3WTW C;  1R23 A;  1Z05 A;  4M9X A;  1BN5 A;  2ZJ2 A;  3I53 A;  2Q8K A;  3U1D A;  5HDG A;  1SD6 A;  3MQ0 A;  3IL2 A;  1U3E M;  2UWM A;  1HXD A;  4BHC A;  4KA4 A;  2O8X A;  3GZ5 A;  4IRI A;  5A2Q Z;  3G73 A;  1SMY F;  1B1B A;  4CDG A;  5LGT A;  1QZY A;  2IA2 A;  3E5U A;  4IF4 A;  3KP3 A;  1FC3 A;  2VBY A;  3C18 A;  2Y75 A;  4Q5S F;  1XSD A;  3ZP5 A;  1MGT A;  2P5K A;  2K27 A;  3E6M A;  3KP5 A;  2FQ3 A;  3ZN1 A;  3BRO A;  2F2E A;  4HZF A;  3FMS A;  4EJW A;  3N4M A;  4MQV A;  1R58 A;  1MJB A;  2D45 A;  1U78 A;  3U9G A;  3VOE A;  5FO5 A;  3SFZ A;  4TV7 A;  1K79 A;  1HSJ A;  4G94 A;  2WTE A;  2AS5 F;  4B09 A;  1JE8 A;  2F5C A;  3SZP A;  2K4B A;  5DEQ A;  2C6Y A;  1J59 A;  1X3U A;  3TO6 A;  3QP5 A;  4IJA A;  2E1C A;  3I54 A;  3BWG A;  3NQO A;  3L09 A;  1TQI A;  5ICG A;  1LJ9 A;  4NQW A;  4P55 A;  1REP C;  3MZY A;  3LWF A;  4M74 A;  3W6K B;  3HIF A;  5K1Y A;  4AIK A;  4HW0 A;  3MEX A;  5DUK A;  1EH8 A;  5CVR A;  2CWE A;  4ZH4 F;  2GA2 A;  4EMS A;  1BOA A;  3LFK A;  1D3Y A;  2PMH A;  2P6S A;  3DXJ F;  4BQA A;  2EA2 A;  1XN7 A;  2PG4 A;  2HQN A;  1SAX A;  2WC2 A;  3LA2 A;  2FF4 A;  2BYV E;  1W4M A;  2FBI A;  1ZHF A;  3T5X A;  5FB2 A;  4EJT A;  4WWC A;  2H6C A;  5LHH A;  4LG0 A;  1FYK A;  3RYR A;  2YX7 A;  3IRR A;  2ISZ A;  3Q9V A;  4P9U A;  2W84 A;  1K7A A;  1BI1 A;  3BP8 A;  1XMA A;  2XV4 S;  1IN5 A;  4KIC A;  4CYD A;  5IT3 A;  3AAF A;  5J6X A;  2QZ8 A;  2PBI A;  2FEZ A;  2LF8 A;  3RKY A;  3RJP A;  2DTR A;  1R7J A;  1EH6 A;  2GQQ A;  5LLQ A;  2IPQ X;  3BY6 A;  1U5T B;  2QQB A;  3ZQ7 A;  2XAG A;  2DFI A;  5J8C A;  1PDN C;  5D8K B;  2E1N A;  1YFH A;  4GYG A;  4ASN A;  4EGY A;  3CUQ C;  4QWQ A;  3RIR A;  3J7A O;  4KMU X;  5LEJ A;  3KEO A;  3F23 A;  4WF2 A;  4FT8 A;  5LGN A;  2X0L A;  3VEP A;  4LLG F;  1D8J A;  5D6E A;  1WI9 A;  4RAZ A;  2E7W A;  3FXU A;  5CVV A;  1AWC A;  2XVC A;  1WRJ A;  2O61 A;  3FX3 A;  3K1N A;  1FPQ A;  3Q5F A;  1OYI A;  4HX4 A;  1IZ1 A;  3FM3 A;  3VOD A;  1YS6 A;  1EV7 A;  2L01 A;  4LGW A;  5IT9 K;  1STZ A;  2QLZ A;  3PQK A;  1RUN A;  3CLO A;  3HSE A;  2V9V A;  4KFC A;  4I2O A;  3HRM A;  1UHM A;  2KJB A;  2DK5 A;  3T8T A;  4PGH A;  2CGP A;  1ODD A;  2OZ6 A;  4LK1 F;  4IHS A;  5CVJ A;  3J80 Z;  3KLO A;  3BOQ A;  2XHK A;  3CUQ A;  4YFK F;  4ZZD A;  2RV8 A;  1LEB A;  3N97 A;  1KYZ A;  5DDG A;  3KP4 A;  3E5X A;  3HYI A;  5FLX K;  1LDK B;  4S05 A;  2W57 A;  4ETS A;  3DPT A;  1Z91 A;  1C0W A;  2CYY A;  4EM1 A;  4RGX A;  2WV0 A;  4KUM A;  2XRO A;  1WWX A;  2P4W A;  1KYW A;  1GXP A;  1KQ0 A;  3IWZ A;  1TW2 A;  3RTR A;  4U88 A;  2Z3Y A;  1L3L A;  1S29 A;  2KIM A;  2MLG A;  4BAY A;  2IA1 A;  2UXX A;  5J8F A;  3SQN A;  4UUV A;  3M8F A;  2QM3 A;  1SFU A;  3WTX C;  1BI2 A;  1T38 A;  3DFG A;  3EUH A;  3I58 A;  2MLK A;  1SFX A;  1IRG A;  3GFL A;  2K4J A;  5KVR A;  3SZT A;  4ENK A;  3E5Q A;  2M8E A;  2RN7 A;  4MTD A;  3WTZ A;  2E7X A;  3WU0 A;  3DV8 A;  1KGS A;  1HW2 A;  1YW7 A;  2PN6 A;  2VE9 A;  5BPI A;  2DQR A;  4I98 B;  1I5Z A;  3P9I A;  3WGG A;  3CTA A;  2OZU A;  1QZZ A;  2CQK A;  4BH9 A;  2EWN A;  4OIQ F;  2YSR A;  4DQ2 A;  1ZG1 A;  3E3V A;  3KEQ A;  1QBJ A;  2STT A;  1FX7 A;  2IVM A;  1QPM A;  2GWR A;  2HQR A;  2RKH A;  2XAQ A;  4M6X A;  1O7F A;  3I59 B;  3HUG A;  5D4S A;  4I01 A;  3JSP A;  2B0L A;  1LEA A;  2PFB A;  1J75 A;  2D1H A;  5EEH A;  5AON A;  1FSE A;  4KIB A;  3HTU A;  2OBP A;  4FX4 A;  3EDP A;  2K86 A;  1IF1 A;  5DV5 A;  2XAJ A;  1XGN A;  2V6C A;  3Q9S A;  4G6D A;  1IW7 F;  3TDZ C;  1TNT A;  3KZY A;  1MZB A;  3WE2 A;  5DYM A;  3ZMT A;  4MEX F;  1U2W A;  3HHH A;  2P7V B;  1D8K A;  3MZH A;  5HLH A;  1IN6 A;  3O3K A;  3TO7 A;  2VE8 A;  4I0A A;  1BM9 A;  2CFX A;  3HRS A;  4XLN F;  3KP7 A;  4NHJ A;  3VFZ A;  1TLH B;  2HS5 A;  3GW2 A;  4AIJ A;  2MH9 A;  2EV5 A;  4A2U A;  2J5O A;  2QBY A;  2G7H A;  2J5P A;  5H6R A;  3R0J A;  5A2Q K;  2HKX A;  1J0R A;  4UV9 A;  4G8X A;  2ACJ A;  2P5L C;  2W25 A;  3E6B A;  2JSC A;  3ZPL A;  1HKT A;  4KT5 C;  1XDU A;  2Z9O A;  2EV6 A;  4LK0 F;  1BBY A;  3IKT A;  2OU2 A;  3JW4 A;  1YLF A;  3LA3 A;  5ED4 A;  2A07 F;  2H6B A;  3V4G A;  3HRT A;  3TOA A;  4UXN A;  3KP6 A;  5E20 A;  3ABT A;  1XCV A;  3GF2 A;  3GZ6 A;  2EB7 A;  3ML6 A;  1FY7 A;  5TRD A;  4QLC U;  3IRQ A;  5K5R A;  4BHP A;  1O3S A;  1HW5 A;  1O3R A;  3D0S A;  1OKR A;  2ZFW A;  1TTY A;  3OV8 A;  4RGR A;  1F1Z A;  2FU4 A;  2XRN A;  1B6A A;  2W85 A;  1HQC A;  2XAH A;  3GYH X;  1XGO A;  2L4M A;  2A5Y B;  3ECO A;  2EFO A;  2PMU A;  1XSV A;  4OIP F;  1ZG5 A;  3TQN A;  2A61 A;  1UFM A;  2MH2 A;  1R1T A;  3F8C A;  1LB2 A;  4HF1 A;  4L18 B;  2DW4 A;  3QU3 A;  4PDK A;  2K02 A;  4ESB A;  3R61 A;  1CF7 A;  3P9K A;  4L9J A;  1XD7 A;  1XCB A;  5LRR A;  1W5S A;  5ILS A;  4ZYG A;  2PI0 A;  5E18 F;  1L0O C;  3C3W A;  1T0F A;  5DCF A;  2VON A;  2PQ8 A;  3DKW A;  5CJ9 A;  6PAX A;  2HTS A;  3EYY A;  1FOK A;  5CVU A;  1G3T A;  2QUF A;  2BGC A;  3I64 A;  5HLI A;  4HYE A;  4XRF A;  4WXH A;  2HR3 A;  1YW9 A;  4UVA A;  4UVC A;  2F5D A;  4RGU A;  1FBU A;  4MNU A;  1I6X A;  1IXS B;  4MQ9 F;  1SFE A;  2M87 A;  2KIF A;  3K0L A;  3BJA A;  1QO0 D;  1P4W A;  4XBF A;  3FXR A;  2VBW A;  1IN8 A;  3FF5 A;  1W7P D;  2HTJ A;  3V7C A;  1IN7 A;  1BC7 C;  3F8M A;  2JPB A;  2EFP A;  3GFJ A;  4A5M A;  1R1U A;  5L3G A;  2FXA A;  4S04 A;  1NHA A;  2YR2 A;  2XKP A;  2WWY A;  3H92 A;  2DBB A;  2Q2E A;  1ZN2 A;  3FZV A;  2EK5 A;  3ZMS A;  4L0Z B;  2ZBK A;  3H3Z A;  1W7P B;  3J80 K;  3FHZ A;  4AVP A;  2VOO A;  2OA4 A;  2JPC A;  3QPT A;  3V7S A;  4FX0 A;  3K9T A;  4G7O F;  2NNN A;  3HOT A;  4OOI A;  4HQM A;  3LQQ A;  4GO1 A;  5HVQ C;  2P8T A;  4BHB A;  1H0M A;  4M9S A;  1PP7 U;  1S6L A;  1MJA A;  3FXQ A;  4B8X A;  1TNS A;  2VOD A;  4P96 A;  3C1D A;  1DDN A;  2HOE A;  2QYO A;  1Z7U A;  1ZLJ A;  3V8K A;  5ERI A;  4WK8 F;  3KCC A;  2ADU A;  2ISY A;  4WCG A;  1I1S A;  3TOB A;  1ZH5 A;  4L0Y B;  2ZME B;  3BZ6 A;  4YFN F;  3QPH A;  4Y13 A;  2HFH A;  5FGM A;  4A0X A;  1B59 A;  2NS0 A;  4CIC A;  1MKM A;  4PZJ A;  3GXO A;  3SHF A;  4MEY F;  1RUO A;  2LDU A;  2BBY A;  1CGP A;  4KNY A;  3PFI A;  3ELK A;  1T6S A;  3GX4 X;  4D0P A;  3I71 A;  3R60 A;  5CLS A;  5D8L B;  4WX9 A;  5ICF A;  3D5L A;  4GXO A;  4Y17 A;  2AXL A;  1I27 A;  1QQI A;  5AIP A;  3KP2 A;  2W24 A;  3NEU A;  1MD0 A;  3JTG A;  2VT2 A;  4Q48 A;  2VT3 A;  1IXR C;  3V8L A;  3GUD A;  2ZKZ A;  3P7N A;  4XLP F;  3ERE D;  4YIF A;  1J7K A;  1QGP A;  4G7Z F;  3U2R A;  3E97 A;  2QBY B;  2A6E F;  2MBF A;  2GXB A;  2DQL A;  1O3Q A;  2FOK A;  1KA8 A;  3F6O A;  1W5T A;  4KIG A;  1BIA A;  1DP7 P;  4LMY A;  3ECH A;  5D5V B;  3HSR A;  2HDC A;  2UXN A;  1U5T C;  4I0B A;  2Z33 A;  2GA1 A;  2FNA A;  1ZLK A;  2STW A;  3RDI A;  1KU2 A;  4XSZ F;  5E1Z B;  1KQ9 A;  3REO A;  2QQA A;  2O3F A;  4N0B A;  1TQP A;  1FT9 A;  4FHT A;  3NRV A;  1UCR A;  2FNP A;  4IXA A;  5BS6 A;  2H27 A;  3FMR A;  5DCM A;  1B9N A;  1UST A;  2QEN A;  3KFW X;  3MFK A;  3QU6 A;  5JFR A;  3LQR A;  1ON1 A;  1PP8 F;  2O6G E;  5E17 F;  2BE5 F;  2GIV A;  4HV6 A;  4RB2 C;  3J81 Z;  3H3U A;  2HZT A;  2JRT A;  4GYI A;  2M5W A;  3ZMU A;  2ZNZ A;  4EM2 A;  4U0Y A;  1LVA A;  1ULY A;  4CZZ A;  1U5T A;  2PEX A;  4KIF A;  2XAS A;  3ZN0 A;  1S7A A;  5BOX A;  5F1R A;  2IP2 A;  2H09 A;  1G3W A;  2R3S A;  1OYY A;  4R1H A;  2JZY A;  4KN7 X;  1S3J A;  5LHG A;  5LBQ A;  3QRF F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...