3HSFA

Heat shock transcription factor (hsf)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
ARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSMLSNNDSRWEFENERHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined solution structure and dynamics of the DNA-binding domain of the heat shock factor from Kluyveromyces lactis.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription regulation
molecule keywords HEAT SHOCK TRANSCRIPTION FACTOR
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 1995-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hsfA00
3ZMTA 1B4AA 4OOIA 4LLGF 4HDUA 4EM1A 1SD5A 3CUOA 3L09A 1EH8A 2DI3A 3VB2A 4A5MA 4EM0B 5LGUA 3LAPA 2CG4A 1BOAA 1MJ9A 2XROA 1D8JA 1YYVA 5DYMA 4MTEA 3HYIA 1IRGA 3L2CA 1J5YA 2GA2A 3SHFA 3P9CA 3ZMZA 1FOKA 1UCRA 2M87A 1IN5A 3JSOA 3I64A 2HQRA 2MH9A 1WRJA 2QZ8A 5HS7A 4M74A 2XVCA 5HVQC 4U0WA 1O3RA 2QYOA 1X3UA 2VBXA 3LA3A 2F5CA 3G73A 1VTNC 2MD5A 4IF4A 4KICA 1K78A 3CLOA 1FYMA 1QZYA 2HS5A 1SFUA 4AWXB 1ZG1A 2VT2A 3H92A 1USTA 1T39A 2ESNA 1R22A 1IN6A 4RB0A 3TOBA 2GAUA 1XCVA 2A69F 3DF8A 2OU2A 2RV8A 1B1BA 1ZG3A 2G7HA 4UV9A 3WTZA 1YO5C 1B59A 1ZLKA 1YG2A 4I7HA 2WTEA 5CVUA 1QNTA 4Q47A 1YFHA 2CGPA 2XRNA 2X0LA 4P9UA 1U5TA 1QO0D 1CF7B 4N0BA 4S05A 3RYPA 3O2PE 2P6SA 2IPQX 2QWWA 3ZN1A 1ZLJA 3MAJA 3KE2A 1C0WA 2MBFA 3EDPA 3HSFA 3NEUA 2OQRA 3FMQA 3BDDA 3TKYA 1FP2A 4CGZA 2EV5A 3HRUA 4GXOA 1LDKB 1LB2A 3P9KA 1BC8C 4L9VA 3GX4X 1P4AA 3CO7C 3F3XA 3HRTA 2ZO4A 4HAMA 1XSDA 2VC0A 3U2RA 1Z91A 2H09A 3K1NA 2VT3A 2W85A 3FMSA 4KIBA 1YQAA 4B09A 4XRFA 4FT8A 2Y0MA 2ELHA 2XAHA 3GUDA 4BQAA 2QUFA 4Y15A 3RI4A 1H9GA 1S8NA 2Z99A 1T98A 4U7BA 3FZVA 2UXXA 2V1DA 2DK5A 1FZPB 4EQQA 3M1EA 2H6BA 1XSXA 1WKMA 1XMAA 4U88A 3V8JA 5DD8A 4WK8F 3TO7A 3WTUC 2ZFWA 2L01A 3KETA 2Q8KA 2EK5A 2C6YA 4HX7A 5BPIA 5LGTA 1XN7A 4A0XA 1JGSA 1D8KA 1TNSA 4R79A 1H9TA 5HS8A 1TBXA 4G7ZF 3FF5A 4R1HA 1IN7A 2EFPA 4RB2C 2GQQA 4CYDA 5JR3A 4UVCA 1BIAA 2FEZA 4LK0F 1RUNA 1EH6A 2XAQA 3DQVC 4U0VA 4HQEA 1OMIA 3FHZA 3QOPA 2RN7A 2VE9A 3MWMA 1FYLA 1G3TA 4LMYA 3GW2A 3LA2A 2DPDA 4CDGA 4AIJA 3F22A 2RC4A 4WWCA 3WTXC 2FBIA 2CWEA 3F8NA 3GFMA 3B02A 2E1CA 2P5KA 4JBAA 4N9IA 2OZ6A 1GVJA 2YR2A 3K9TA 3T1BA 5DUIA 1FBQA 1LQ1A 4I02A 3D5LA 5JFRA 2V9VA 1S29A 1JHFA 1YW8A 4EMSA 3ML6A 1J7KA 3R6SA 1FT9A 1KGSA 5CYVA 2R3SA 2VBYA 3LWFA 5LGNA 3LQQA 4YFNF 1BIBA 1H0MA 2NS0A 1K7AA 1HKTA 5D8KB 1STZA 4L18B 2YX4A 5AIPA 1ULYA 3SFZA 1AWCA 4UUVA 1ZREA 2ZMEB 3H3ZA 3EYIA 2BEOA 4KN4X 3I58A 2FBHA 5E20A 4ZH4F 1FBUA 2EJRA 2P7CB 4ENNA 1IXSB 3BPXA 4IHTA 4EJUA 3HTSB 2XAJA 2OAZA 3WE3A 5E8GA 1FY7A 3ABUA 1P6RA 2HOEA 3AAFA 3KP6A 2WC2A 4EV0A 4P55A 2DK8A 2PQ8A 5D8LB 3SZTA 3F6VA 4Z2YA 2Z33A 5HDGA 1TQPA 2K86A 2IA2A 1OKRA 4HLXA 5F1RA 4RGRA 1O3TA 2GZWA 1ZHFA 2B0LA 3CO6C 3HOSA 2X4HA 3KFWX 4IRIA 3WE2A 2XAGA 4HZFA 1RZ4A 4GO1A 2M5WA 4XLPF 2MLGA 1UFMA 2E7WA 3L00A 4KA4A 1GHCA 3P7NA 3ZMDA 3KP2A 5FD6A 2H6CA 2L4AA 5L3EA 4AD9A 5CJ9A 1IRFA 3H3UA 4NQWA 2O03A 2ISZA 3E6BA 3LSTA 2P6TA 3WGHA 5JVTA 1ZRDA 4XBFA 2OBPA 1O3QA 4A2UA 2W84A 2OD5A 2HZTA 4B8XA 3RDIA 3HRMA 5H20A 5D6FA 1ZH5A 4HLYA 2Q0OA 5DEQA 3I54A 5FD5A 4EVIA 4RB3C 4G8XA 2O6GE 1DPUA 4U0YA 3R61A 2QM3A 5JI6A 4Q4ZF 3MQ0A 1FNNA 1HQCA 2HEOA 1TW3A 1F9NA 3JW4A 2H27A 2RKHA 4G6QA 3ZPLA 2DAOA 3TGNA 5K5QA 5LHGA 2O61A 2ZJ2A 5DD4A 1NHAA 1J59A 1TLHB 3T8RA 1JHHA 5AONA 2KIFA 3ISPA 1R36A 3T5XA 1R1UA 1LEBA 2XKOA 3U1DA 2VBZA 4OMZA 5J6XA 2EWNA 3F23A 3QU3A 2HKOA 3O6BB 2IRFG 3E97A 4L5IA 1K78B 2KRFA 4AIHA 1QPMA 1RIOH 3M8FA 4BHCA 1SD6A 4Q5SF 1MD0A 2XHKA 1I1SA 1W5SA 2AS5F 4ON0A 1UB9A 2HR3A 5IT9K 5IT9Z 4RGSA 1HKSA 1I5ZA 2WWYA 2NAZA 2DBBA 4WXDA 3QU6A 2R7DA 4CXFA 3K69A 3O3KA 1RI7A 4EGYA 1S7AA 4HBLA 4EJWA 3RJPA 2XGXA 2P8TA 4TV7A 2STWA 1D5VA 2ZCWA 2XAFA 2ZBKA 2LSOA 3Q5FA 4IJAA 1T0FA 3J81K 3J81Z 3MEXA 1HKQA 4ZYDA 2HFHA 1TTYA 2BYVE 4RB1A 2VONA 4I2OA 2A68F 3C7JA 1DP7P 1BN5A 3EQLF 3BWGA 3QP6A 5DCMB 1OYWA 4PZJA 1V3FA 2BGCA 4HOBA 4OMYA 2EFNA 2Y48A 2RQPA 4YIIA 1ZGAA 4IXAA 2VODA 4H0EA 1G4DA 3V7SA 5HLGA 3HUGA 1YLFA 2DFIA 5L3GA 5LHIA 1S7OA 3V7RA 1MDMA 3MFKA 2GWRA 3F21A 4YFKF 3F8MA 4ESBA 5H6RA 3ROUA 4KUMA 2FBKA 4MHGA 2DQRA 4IRHA 3HTUA 2G9WA 3IWZA 1IAWA 5DDGA 2R7FA 5TRDA 3E6MA 2FF4A 3SZPA 1IN4A 2YSRA 3FXRA 2QBYB 4KMFA 3KZZA 3FWEA 4CICA 5K5RA 1A04A 1KQ9A 1OR7A 3GWZA 1FPQA 3W6KB 2ZNYA 1FP1D 1KU9A 1G3WA 1OYIA 5D4SA 2QVOA 2UXNA 2NNYA 1R1TA 3L7WA 4KYWA 2LF8A 4WXCA 4ZZLA 3OOPA 5FB2A 3EETA 1E17A 3L9FA 3I4PA 3KEQA 2HWVA 1ZARA 3QRFF 1DPRA 1R1VA 3MZYA 4GCVA 4KIFA 1YW7A 1XCBA 1Z6RA 4HX8A 1SD4A 4WX9A 5JHUA 3TDUC 3GFLA 2FXAA 2EV0A 4HV6A 1QQIA 4LB6B 2W25A 3GEZA 3FXUA 2ISYA 1FWZA 1LVAA 3KEOA 2ZMEA 3ECHA 1JXSA 2EA4A 2ZXJA 2STTA 3WTYC 1BI0A 3HHHA 4K2EA 3WU0A 5CVIA 3R60A 5FO5A 1O7LA 3E6DA 3E6CC 2FMLA 4HV5A 2P5VA 4LFUA 4MTDA 2Q2EA 4G9YA 4ETSA 4DQ2A 4LK1F 1J0RA 5CVVA 1I27A 1IUYA 3REOA 4PGHA 2PI0A 2QLZA 4KDPA 5D4RA 1HBXG 4XSXF 4A0ZA 2HYFA 1PP7U 3TOAA 3JTGA 4CO8A 4IPAA 3ECOA 3BZ6A 2EFQA 5DCFA 2IA0A 4KNYA 2IW5A 2JTVA 1SFXA 2CO5A 3IKVA 4ZYHA 2XKPA 4I0BA 2WV0A 2L02A 2VE8A 4Q48A 1KU3A 4O6JA 2GXBA 4HQMA 2UWMA 3ZN0A 3JSPA 2O8XA 4EJOA 5ICFA 4BH9A 2V6CA 4Y13A 4GYGA 3LQRA 1IW7F 3RKWA 2IA1A 2F5EA 2KIMA 1DUXC 4LJZF 5H6QA 2JZYA 3MCZA 2RDPA 2D2WA 4E70A 1D3YA 4LG0A 3I71A 4XLNF 1O57A 2RVCA 2BBYA 3RTRA 3E5QA 4KFCA 1YTYA 2MH2A 5HLHA 3NQOA 2DPUA 1K6OA 2JPCA 3LA7A 5LBQA 2PG4A 2PLYA 2F2EA 3I5UA 1J2XA 1EH7A 4DNCA 3RKYA 2L4MA 2FU4A 3RPUA 1XB4A 3E5XA 3PQJA 2HGCA 3COAC 2VOPA 1P2FA 4CHUA 1XGNA 2L3DA 3CUQC 1BI3A 2PJPA 1ZAOA 4BHBA 2IP2A 2FNPA 3I53A 1W7PA 3WTWC 1LNWA 1O3SA 2MLKA 5F64A 3RKXA 3N97A 4BHPA 3WGIA 1ON1A 3GLXA 5D5VB 1FSEA 5FGMA 1YW9A 1Z05A 1GXQA 2K27A 1DDNA 1Y0UA 2ZKZA 3Q9VA 1S6LA 2Z5UA 5HS9A 3I59A 1ZRFA 1F5TA 3ZMUA 4U7DA 1ON2A 1W5TA 4GYIA 2IVMA 2NYXA 2CFXA 1YS6A 1FYKA 2HKXA 5E1WA 3JTHA 4P5OA 4I0AA 2GA1A 1XD7A 1LDDA 5HDKA 4L9TA 4YG2F 4EM2A 3TQNA 3DKWA 5AIQA 5LRRA 4WF2A 1LEAA 4WXHA 4YFXF 4LB5A 4UXNA 3NRVA 1FSHA 5FLXZ 3IL2A 5FLXK 2CW0F 1XMKA 4IVNA 2QBYA 3BROA 2M30A 1R5GA 3TO6A 5FFZA 1TW2A 3E5UA 2J5PA 3GF2A 1WI9A 3IRRA 3SXYA 4M9XA 4RAYA 1W4MA 3ZQ7A 3SQNA 3PFIA 3IRQA 3J80K 3J80Z 1ODDA 4HF1A 1HSJA 2FRHA 3BP8A 2J5OA 3RIRA 5L3DA 4BYYA 1MJAA 4L0ZB 4EGZA 3ZMSA 2A61A 2PBIA 1HW5A 2LF7A 3GVAA 3WTSC 1IXCA 2VBWA 1R00A 2K02A 5DCMA 5HOOA 3R0JA 2PN6A 4ENJA 4I98B 4PDKA 2CYYA 1SMYF 1BM9A 5E17F 1ZG5A 1U2WA 4L9NA 4RGXA 5F6FA 1JE8A 3FMRA 3IHUA 5ICGA 3BOQA 3F8FA 3R4KA 2QENA 4M72A 1U78A 2A07F 3K1PA 2LDUA 2D1HA 1LDJA 1FC3A 2A6HF 4KT5C 2CQKA 3HRSA 5DUKA 1Z6TA 3CJNA 4YIFA 2XASA 3C1DA 2QQBA 1SMTA 4M73A 3V7CA 1YIOA 2NRAC 1SFEA 4O3MA 2K7LA 1BC7C 2HYGD 3BJAA 4MGRA 1EV7A 2OQGA 1K79A 5LRSA 2K4JA 2EV6A 2DLLA 3F8BA 3IC7A 2UZKA 4BNCA 3U9GA 2W24A 2ETHA 3GZ5A 1ZN2A 1P4XA 1G3YA 2KJBA 3K2ZA 5J8FA 2PEXA 4IHSA 1IZ1A 5ED4A 4LLLA 3KP4A 3Q9SA 3C3WA 1YS7A 4ESFA 4UVAA 3GO5A 4WCGA 3DPLC 1XGOA 1F1ZA 2BV6A 2F5FA 3TDZC 3VODA 4F7ZA 5BQTA 4R8HA 4M9SA 1TQIA 4JK1X 1TNTA 4FHTA 1QGPA 4G7OF 2VXZA 3ULQB 1SAXA 2LNBA 5LLQA 1O7FA 2ACJA 1HXDA 3DFGA 1XSVA 4D0PA 2MA3A 2OA4A 3G3ZA 1IN8A 5E8IA 5ICEA 5TJJA 4S04A 1HW1A 5L3FA 1J75A 4G7HF 2QQAA 3EUHA 3KLNA 1R5HA 4LGWA 3WODF 5CVJA 2YPRA 3IKTA 1Z1DA 2M45A 1UHMA 1U3EM 4M6XA 5BS6A 2PMHA 2FA5A 4RS8A 4UV8A 1IXRC 2FE3A 1HW2A 2KIUA 1KQ0A 1XDUA 2XV4S 5EEHA 3M7GA 3TO9A 1E2XA 4KN7X 4LD5A 1I6XA 2KJCA 1J9IA 3ELKA 3GYHX 3WU1B 2Z9OA 1GXPA 3WTVC 4JQFA 1SD7A 1KQ8A 3BJOA 4Y17A 2LKPA 2RGVA 3W6JB 2V1UA 5BPDA 1B9NA 5A2QZ 5A2QK 5K1YA 4M71A 4HX4A 1S3JA 3N4MA 4HDVA 2XUBA 1MDMB 2NNNA 2O3FA 5D6EA 5ICCA 3V8LA 4KIGA 2ZNZA 3K0LA 3T8TA 2A6EF 1MJBA 3LFKA 3FXQA 5EEGA 5D5UB 1R23A 5HLIA 1T38A 4HW0A 2AXLA 2D45A 2Z3YA 4ESJA 2BE5F 4CZZA 1RNLA 2V1XA 5ILVA 1BI2A 3KZYA 5BOXA 2COMA 3BY6A 3KP7A 2L54A 2G7UA 3JAMZ 3JAMK 3V4GA 5E18F 1B9MA 3F72A 3GZ6A 5ERIA 3I0TA 4L9JA 5ILUA 2QQ9A 3J7AO 2P7VB 2HQNA 1OYYA 4A12A 3F6OA 1R58A 1Z9CA 1B6AA 5L3CA 1L3LA 3BPVA 2M1BA 5D5WB 4HF2A 3QAHA 4O5VA 2JPBA 2XIGA 4P96A 5FFXA 2IT0A 5K5OA 2JRTA 4NB5A 2DO7A 1W7PD 3OV8A 2HDCA 4M9ZA 4N9HA 4A5NA 1RUOA 4XSZF 6PAXA 4G94A 4HYEA 3WGGA 4KMUX 2FSWA 1CGPA 3HOTA 4EJVA 2YX7A 2EFWA 5CLSA 4IRGA 5L3BA 1FBSA 4ENMA 3V8KA 4OIRF 2VN2A 1AOYA 4L0YB 1T2KA 3ERED 1U5TB 3M8EA 1CF7A 2HTSA 4ASNA 1XDSA 3RYRA 2FQ3A 2ADUA 5E1XA 3FM5A 2Y75A 2OZUA 5LHHA 3KP3A 3PQKA 3GXOA 4BAYA 2F5DA 2FMYA 2CSOA 3BJ6A 3HSEA 4OIQF 5E1ZB 3IWFA 1P4WA 1ZYRF 3QPHA 2DQLA 3KLOA 3MZHA 1PDNC 1P92A 2MC3A 2O0YA 1WSUA 1BBYA 3T0YA 2A3SA 3CUQA 4ZZDA 3K1MA 5IT3A 1IF1A 1KYWA 1XGMA 5BMZA 4I09A 4AVPA 3KP5A 1ZRCA 2DU9A 4MNUA 2TDXA 1HSTA 3HHGA 3CDHA 4ZYEA 2EA2A 1TQMA 4HF0A 1QZZA 4NHJA 4OIPF 2PFBA 3FM3A 2RNJA 3DP7A 4M6YA 2EB7A 2FOKA 1KU2A 3CTAA 3QPTA 2P5LC 1XGSA 1MZBA 4MQ9F 5CVRA 2FNAA 4RAZA 1FLIA 1V4RA 2DT5A 4PCQA 3HIFA 4OINF 2D1VA 1WQ2A 3QP5A 1PUEE 3VFZA 1QBJA 1FX7A 2V79A 4OIOF 3WG9A 4EJTA 4FX0A 5D5XB 1F4KA 2E7XA 4OU0A 1OPCA 4LLNA 3LAJA 3D0SA 3S2WA 1WWXA 4MQVA 3ABTA 3VOEA 3GFIA 1MGTA 1Q1HA 4LG0B 3GFJA 1BJAA 3F8CA 1KYZA 1Z7UA 3KCCA 1USSA 3R0AA 5LEKA 1L0OC 4QLCU 4I01A 4MEXF 2P4WA 3DV8A 1MKMA 2M8EA 5DV5A 5HDNA 3I59B 4BXUA 2VC1A 4P9FA 2W57A 3CUQB 1U5TC 4QWQA 3DEUA 4UNOA 1PP8F 4RGUA 1UHWA 2IJLA 2HTJA 3B73A 1R7JA 3E3VA 1ONVA 2H94A 3WTTC 2JT1A 4A0YA 1W7PB 3DXJF 4PGGA 1G6NA 1G3SA 4UHTA 2GXGA 2A5YB 2GIVA 2ESHA 2VOOA 3DPTA 4ZYGA 1LJ9A 2EFOA 5LEJA 2PMUA 3M9AA 1U8RA 1KA8A 1BI1A 2K4BA 2E1NA 1KU7A 3HSRA 4ENKA 4FX4A 4A6EA 4HA8A 2DW4A 4G6DA 5J8CA 4GGGA 3VEPA 3ZMVA 2JSCA 5KVRA 3P9IA 4UVBA 4AIKA 2KKOA 3RPQA 3FX3A 1ZGJA 3ZP5A 2DTRA 2YU3A 4A6DA 1REPC 5KK1A 3C18A 5ILSA 1T6SA 1U6GA 3EYYA 4L5JA 4MEYF 1I1GA
chains in the Genus database with same CATH superfamily
2BXZA 1P9QC 2L9SA 3S14J 3ZMTA 1B4AA 2MABA 4OOIA 1BW5A 2XDVA 2L9VA 4LLGF 2JWTA 4HDUA 1LE8A 2DXIA 1V5FA 5M3FJ 4UUTA 1A5JA 4EM1A 1SD5A 2R7WA 3CDLA 4ZTFA 4BE1A 3CUOA 3L09A 1EH8A 2DI3A 3VB2A 4A5MA 4EM0B 5LGUA 3LAPA 1W0UA 2CG4A 4N4NB 1BOAA 1MJ9A 2XROA 1D8JA 1YYVA 5JLWA 1W36D 5DYMA 2ZJQF 3GTGJ 3A0BC 4MTEA 2EZKA 3HYIA 1IRGA 2VPLA 5IOYA 3L2CA 1J5YA 2GA2A 3SHFA 3QYEA 4C2TA 1T56A 3P9CA 3NWTA 3ZMZA 1TL8A 3C2BA 1FOKA 2R4GA 4CCMA 1DU6A 1UCRA 2M87A 1IN5A 3S32A 3JSOA 3I64A 1Y39A 2JQ7A 1WJEA 3BG5A 2KRHA 2HQRA 1IO2A 3MVPA 2K3FA 2MH9A 1WRJA 2QZ8A 3FBIB 2X6WA 3RSNA 2L7ZA 2ZSIB 5HS7A 4M74A 4JYKA 2XVCA 1XPXA 4PK4A 1LFBA 2ZJRF 5HVQC 4U0WA 1JJ6C 1O3RA 5M5WJ 4IQJA 1WCMJ 2QYOA 1X3UA 2VBXA 2DODA 3LA3A 2KHMA 2X9DA 2F5CA 2HPIA 4YRVA 2EINH 4DYCA 2N8GA 3G73A 4CYCA 1VTNC 2MD5A 3CJRB 2HZDA 2CH0A 4IF4A 3OYEA 1S72I 1K4TA 4KICA 1K78A 3CLOA 2B7EA 1FYMA 1QZYA 4F3QA 4HNTA 2HS5A 1SFUA 1TC3C 4AWXB 1ZG1A 1POGA 2VT2A 1VQKI 3H92A 1WJFA 1USTA 3GTOJ 2COBA 1T39A 5FKOA 2ESNA 2E1MB 4II3A 2PJRB 4KITB 2FJ1A 1R22A 1IN6A 1IDYA 4RB0A 3TOBA 2GAUA 2DMTA 1XCVA 2A69F 1A31A 2DJIA 3DF8A 2LMDA 1ZQ3P 2OU2A 2OV7A 3Q0UA 2RV8A 1B1BA 2FD5A 1ZG3A 2G7HA 4UV9A 1X19A 3WTZA 1YO5C 3A1YA 1B59A 3S93A 3DKXA 1EKEA 1SAUA 1ZLKA 4MIMA 1YG2A 5DM7F 1T08B 1D0ZA 4I7HA 2WTEA 1IUFA 5CVUA 5M5YJ 1QNTA 2F4IA 1UHSA 2DYRH 5TGTA 4Q47A 4CSWA 1TWFJ 1YFHA 2CGPA 2XRNA 2X0LA 4P9UA 1U5TA 1QO0D 3ZCOA 1CF7B 4UY8I 4N0BA 4S05A 3S17J 4ANJA 5GTIC 2QSFX 2M8GX 3RYPA 3O2PE 1IGNA 2L2OA 4BL0B 2P6SA 2IPQX 4C2UA 2RAEA 2WY8Q 2QWWA 3ZN1A 3ESWB 1Z3XA 3PNYA 3RPUD 1ZLJA 3MAJA 4IO9F 2DFEA 3KE2A 2K9NA 1C0WA 2MBFA 2OF7A 3EDPA 3FK6A 3HSFA 1VQ7I 3PJRA 2HNHA 5LD2C 3U21A 3NEUA 4G12A 4YIRX 2OQRA 3FMQA 5HNFA 1RKTA 3BDDA 3L2WA 3TKYA 3EUHC 4QTRA 2OJED 3AG1H 1FP2A 3DKYA 2KQRA 1BA5A 1OCCH 3OWTA 4CGZA 2V6EA 2EV5A 4RM3A 4BE0A 3S1MJ 3HRUA 4GXOA 3KYDB 2QF7A 4G6TB 1LDKB 2B63J 1LB2A 2NOGA 1R6RA 3P9KA 5CQEA 2MC4A 4XORA 4HPQA 1BC8C 3GLLA 3Q0VA 5EZHA 4L9VA 3GX4X 1P4AA 5F0CA 3W2VA 3CO7C 3F3XA 3HRTA 2ZO4A 4DYQA 1YI2I 4HAMA 1XSDA 2EPFA 2VC0A 3U2RA 5E3NA 1Z91A 2H09A 3K1NA 3WHBA 4IX7A 2VT3A 3PNVA 2W85A 1OCTC 3FMSA 3LSKA 2LOOA 1YQAA 4KIBA 4B09A 3CCMI 2HXIA 4XRFA 2XSDC 1F36A 4FT8A 2Y0MA 1IG7A 3Q0WA 2ELHA 2XAHA 3GUDA 2EQRA 2UV1A 4BQAA 2R7QA 4C9YA 4BGDA 3DPUA 4RM2A 2QUFA 4Y15A 5EGOA 3RI4A 2DMPA 1H9GA 1I39A 1OJLA 1S8NA 1PVEA 2Z99A 4XOTA 5IP7J 1T98A 4FTHA 2E71A 4U7BA 3FZVA 2UXXA 2V1DA 2DK5A 1FZPB 2AXTC 2DOFA 4EQQA 4F91B 3M1EA 2H6BA 1XSXA 1WKMA 1XMAA 4U88A 2VQLA 2GOMA 3V8JA 2LFBA 5DD8A 2Y9YA 4KISA 4WK8F 2IBDA 3TO7A 4RDUA 2LP0A 3WTUC 2ZFWA 3BR5A 2L01A 3LOCA 3KETA 1MBFA 2Q8KA 2EK5A 2C6YA 4HX7A 4MFDA 1D5YA 2F4OB 5BPIA 1RPWA 2DMNA 5LGTA 1XN7A 3OL3A 3SFIA 2DOEA 4A0XA 1JGSA 1D8KA 1TNSA 4R79A 1H9TA 1W36C 3HOZJ 3PL8A 5HS8A 1TBXA 4G7ZF 1JKQC 3FF5A 4R1HA 2AO9A 2HI3A 2Y9ZA 2LR8A 1IN7A 2EFPA 2GM4A 2ELKA 3H35A 4RB2C 3MKZA 2GQQA 3BCBA 3LSGA 4CYDA 5JR3A 3A2KA 1GVDA 4UVCA 2ME0A 2R92J 1BIAA 2FEZA 4LK0F 1RUNA 2LLKA 3JCUC 1EH6A 3ABKH 2XAQA 3DQVC 3I56I 4U0VA 4HQEA 1OMIA 3FHZA 4ZDOA 1FMWA 3QYFA 1K6YA 2RN7A 3QOPA 2VE9A 3MWMA 1FYLA 4XLHA 5HODA 1G3TA 4LMYA 3GW2A 3LA2A 2DPDA 3HL2A 4CDGA 3LSIA 3F22A 4AIJA 3OY9A 2RC4A 4WWCA 3WTXC 2FBIA 1ACIA 2CWEA 2E1MC 3L1PA 3F8NA 3GFMA 3B02A 2DDBA 1AA7A 2VXDA 5EDNA 2E1CA 2P5KA 4JBAA 5HNHA 1U8BA 4N9IA 2NXNB 2OZ6A 2VB6A 3BT9A 1VQ5I 1GVJA 3BG7A 2YR2A 3K9TA 5J40A 2CQNA 3FIWA 5KAFC 1I50J 3T1BA 5DUIA 1ZELA 1QA6A 1FBQA 1TWAJ 1LQ1A 4I02A 3D5LA 2F5VA 3QPSA 5JFRA 2V9VA 4V2FA 1S29A 1JHFA 3LNQA 5B1BH 1YW8A 4EMSA 1WJBA 3ML6A 1J7KA 3R6SA 4NBQA 4HNVA 1FT9A 1KGSA 5CYVA 2R3SA 2VBYA 3LWFA 5LGNA 3M4OJ 2Y2ZA 3LQQA 1GT0C 3A02A 4YFNF 1BIBA 1H0MA 2E34A 2NS0A 3G71I 1YJWI 2DOAA 5CQGA 1K7AA 2NS8A 3UNGC 3JRIA 4XR6A 1HKTA 5D8KB 1STZA 2JVHA 4L18B 2YX4A 5AIPA 4A3BJ 1ULYA 2F6CA 3M07A 3CF5F 3SFZA 4A3EJ 1AWCA 4UUVA 1ZREA 1UG2A 4PFPA 2ZMEB 3H3ZA 3EYIA 2BEOA 3BTIA 1X1CA 1XMXA 2DA4A 3I58A 4KN4X 2FBHA 3ZQLA 5E20A 1XTAA 4ZH4F 3FK7A 2WAQN 1FBUA 5EG0A 2VI6A 2EJRA 1OCZH 5IY5H 2P7CB 3BZKA 1F43A 4DGWB 4XQFA 2KZGA 4ENNA 3BPXA 1IXSB 3GTMJ 1RETA 3L2RA 3DBLB 4EJUA 3HTSB 4DZJA 2XAJA 2OAZA 4IHTA 3WE3A 3ABLH 5E8GA 1FY7A 2CW8A 1ETOA 3ABUA 1P6RA 2HOEA 2M3AA 3AAFA 3KP6A 2LREA 2WC2A 3TW6A 3CCRI 4EV0A 4P55A 2DK8A 2XGCA 2PQ8A 3O8HA 5D8LB 2R7UA 3SZTA 1AKHB 3ZQQA 3F6VA 4IEJA 4Z2YA 5HDGA 2Z33A 4CCJA 4AM3A 1ETYA 1TQPA 2XAUA 1QHGA 2K86A 3SDBA 2IA2A 1OKRA 4HLXA 5F1RA 4RGRA 1O3TA 3H5NA 3OYJA 2QSGX 2GZWA 3VYTB 1ZHFA 2B0LA 1X1AA 3CO6C 3HOSA 2X4HA 3KFWX 4IRIA 3WE2A 2XAGA 2H8WA 4HZFA 4A3KJ 1RZ4A 4GO1A 1R4MB 3S3NA 3DBHB 4DOZA 3CC4I 2M5WA 1ETVA 2LRDA 4PFOA 1V55H 4XLPF 4XN3A 2MLGA 2JA5J 3BR3A 2KMUA 1UFMA 2E7WA 3K7AJ 3L00A 4KA4A 1GHCA 3P7NA 4JX5A 5EZGA 3ZMDA 4E7IA 3KP2A 1JKPC 3IP4B 2VLAA 1DP3A 5FD6A 1JT6A 2H6CA 2L4AA 2X6XA 1SEUA 4IHXA 2XB0X 5L3EA 3SDGA 4AD9A 5IYCJ 3RZOJ 4MLOA 2LG4A 3FKJA 3H9QA 5CJ9A 3HJEA 1H89C 2X1CA 1IRFA 3H3UA 2DA5A 4NQWA 5FLVA 2GOXB 1QPIA 2IGOA 2O03A 1D1AA 2ISZA 3E6BA 3LSTA 2Y69H 3PSFA 4C3JJ 2P6TA 3WGHA 5JVTA 2ZC2A 1ZRDA 4XBFA 2OBPA 1O3QA 4A2UA 3G2BA 3PIPF 2IS1A 1X1PA 3ASNH 3RCOA 3HOVJ 4XK4A 3CMMA 2W84A 1FOWA 2XC7A 2OD5A 2CRGA 5IYBJ 2HZTA 2K85A 4EATA 5IP9J 2W48A 3LSRA 1K61A 3I9V2 3K10A 4B8XA 1LKXA 2ICWG 3RDIA 3HRMA 2WV1A 2Z1DA 5H20A 4FQGA 5D6FA 4E7SA 1ZH5A 4HLYA 2Q0OA 5DEQA 3I54A 5FD5A 4EVIA 2X6YA 4RB3C 4J19A 2EIMH 4G8XA 5GPCA 2O6GE 3H36A 1LUJB 4UUSB 3IV5A 1DQUA 1DPUA 3BTCA 4U0YA 3R61A 4XRSG 2QM3A 2X51A 1ITYA 3CP8A 1MBHA 3HBLA 5JI6A 4Q4ZF 3MQ0A 1FNNA 1HQCA 2JN6A 4A69C 4DBQA 3K2AA 1TW3A 2HEOA 1F9NA 3JW4A 1ERDA 2H27A 3EUKL 1BR4A 4BDYA 2RKHA 3QOEA 4G6QA 5DS9A 3OYNA 3ZPLA 4RLFA 2DAOA 3AKZA 4OAZA 1R49A 3TGNA 5K5QA 2HQAA 3S15J 5B66C 2DA3A 5LHGA 3D5SC 4FE7A 4Y7NJ 2O61A 2ZJ2A 5DD4A 3PIOF 1NHAA 3LSJA 4H4KC 1R9TJ 1M1EB 1EA3A 2QA4I 1J59A 5LFAA 1TLHB 2XGDA 3T8RA 4JX6A 2E2JJ 1JHHA 1X2MA 4NC8A 5E3LA 1V5GA 2JUCA 2KIFA 2VJ4A 5AONA 3PUBA 3ISPA 1R36A 4DYRA 1QHHD 2R0QC 4LITA 2ZXWH 3T5XA 1R1UA 2NOJB 1LEBA 3K70C 2XKOA 1BW6A 3U1DA 2VBZA 4OMZA 5J6XA 4IKFA 2L7MP 1RKWA 2EWNA 3F23A 3PUFA 3QU3A 2HKOA 1MBGA 1H88C 3AL0B 3O6BB 1JUSA 3CQZJ 1UZCA 4PSWA 2IRFG 5FRNA 3E97A 2IXSA 4L5IA 3DU6A 3FXKA 2FOWA 1K78B 3E0JB 2KRFA 4AIHA 1QPMA 2I5UA 1RIOH 3M8FA 2EIJH 4BHCA 3ZQCA 1SD6A 4Q5SF 2E2IJ 1MD0A 1VQ6I 2CUFA 2NVXJ 2XHKA 1I1SA 4F52A 2DT7B 3N05A 1W5SA 3I4NJ 3K4CA 2AS5F 4ON0A 4PJJA 1UB9A 2HR3A 2X48A 2W7NA 2PJRA 5IT9K 5IT9Z 4RGSA 5F1JA 1HKSA 1I5ZA 3CDIA 2WWYA 4D5FA 2NAZA 2DBBA 3HB9A 4WXDA 1N77A 3QU6A 3C2HA 2CV2A 2JA2A 3TL4X 1BJZA 2EZLA 2H1LA 4XRMA 2R7DA 4CXFA 3K69A 2OCCH 3LMMA 3O3KA 2VQCA 1RI7A 1S9HA 3D5RC 4RBOA 4EGYA 1LFUP 1S7AA 4YEJA 4HBLA 3C2GA 4EJWA 3CMAI 2DA6A 1QZEA 3RJPA 2XGXA 2IEKA 2P8TA 4IL6C 1MNEA 4TV7A 2IGKA 2BVMA 1B8IA 2STWA 2BY1A 1D5VA 1FOXA 1IV6A 3SZGA 2LBFB 2ZCWA 4FE4A 2XAFA 2ZBKA 2WA0A 1Z21A 2LYCA 3UKGA 2LSOA 3GTJJ 3B6CA 4XKCA 3Q5FA 4IJAA 1T0FA 3J81K 3J81Z 1Y1WJ 1Y56A 2TRTA 4F92B 3S16J 3MEXA 1HKQA 4ZYDA 2HFHA 1T95A 1TTYA 3BG6A 2BYVE 1APLC 4RB1A 4BY7J 2VONA 3A01B 3W2AA 2YUSA 3ABMH 4A3FJ 1OQYA 4A3JJ 5H2FC 4I2OA 1N75A 3VWBA 2A68F 2M2EA 3O8GA 2WB1A 3C7JA 1WJAA 5DTDA 1BN5A 3EQLF 4XLAA 1U9NA 1DP7P 3BWGA 3QP6A 5DCMB 2VKHA 1OYWA 4PZJA 1V3FA 3IH2A 2BGCA 1I6HJ 4HOBA 4OMYA 2EFNA 2Y48A 2RQPA 3OYDA 3IUOA 1ZGAA 4YIIA 5J1YA 1HLVA 3FXJA 3BLYA 4ABZA 3A4CA 2LTPA 4AYBA 1A35A 3HOWJ 4IXAA 2VODA 4H0EA 1G4DA 2GIZA 3V7SA 2BY3A 5HLGA 2BHYA 3HUGA 1YLFA 4AU7A 2R7SA 2DFIA 5L3GA 5LHIA 1S7OA 1FJLA 2K5CA 2XSJC 3V7RA 5B3SH 1JJ8C 1MDMA 3MFKA 2GWRA 4PSXA 2V9PA 4YFKF 3F21A 3F8MA 4ESBA 5H6RA 4M3BA 1NH3A 1GV5A 3ROUA 1P7JA 2CW7A 3GCMA 3D1NI 4KUMA 2FBKA 4Z6YA 4MHGA 2DQRA 4RAGA 5KNLA 4J00A 4IRHA 3HTUA 3L2VA 2G9WA 2HU9A 3IWZA 1IAWA 1YRNB 5DDGA 2R7FA 5TRDA 2O7OA 2JA7J 3E6MA 2LVSA 3QODA 2FF4A 3SZPA 1KZHA 1IN4A 2YSRA 1OR7C 3MKYB 1YOVB 4NC7A 1RR8C 1UG0A 1SVMA 3FXRA 3JR9A 1MMDA 3GTQJ 2QBYB 4KMFA 3KZZA 2EZHA 3FWEA 1LE8B 4CICA 5IOZA 5K5RA 3OS1A 5EF6A 1A04A 2V9KA 1KQ9A 2VQGA 4S0HB 3CMYA 3GWZA 1OR7A 3HDDA 4B43A 2XF6A 1FPQA 3W6KB 1TT5B 2ZNYA 1QVUA 1FP1D 1X3WB 2ID6A 3OIQA 3ASOH 5F04A 1KU9A 2ZFUA 1G3WA 1X1BA 1OYIA 5D4SA 2QVOA 2UXNA 4XMYA 2NNYA 1R1TA 3NWSA 3L7WA 4WXCA 2LF8A 4KYWA 4ZZLA 3DLAA 3W2WA 1T33A 3OOPA 5FB2A 1FTZA 1XX5A 3EETA 5JHFA 3FXLA 1E17A 3L9FA 3I4PA 1E0EA 1G2HA 3KEQA 1N25A 3EUAA 2E5NA 5J47A 2ZXIA 2HWVA 1ZARA 5JVGF 1R4NB 2LY2A 4IQ4A 3QRFF 1DPRA 1R1VA 2CS3A 3MZYA 1ZR2A 4NNJA 2XPUA 1O4XA 4GCVA 1V54H 4LIUA 3HOXJ 4KIFA 1YW7A 5E3OA 1XCBA 2ID3A 2GBYA 1Z6RA 4HX8A 1SD4A 4GRIA 2HOTA 1KONA 4WX9A 5JHUA 4XKBA 3TDUC 3BTJA 3GFLA 2FXAA 2AHQA 1YITI 2EV0A 4HV6A 1QQIA 1YX3A 3QPLA 3LFUA 4LB6B 2W25A 4NUBA 1OLTA 2V4JC 1FIPA 3FBNB 3GEZA 1E3PA 5J4YA 4ZTJA 4A3MJ 3FXUA 2ISYA 5EG0B 1FWZA 1GLNA 1LVAA 3KEOA 2ZMEA 3ECHA 1JXSA 3K4LA 1T8IA 2KZVA 1LPQA 2EA4A 2FUG2 2ZXJA 4IOCF 2XF5A 2STTA 3WTYC 1BI0A 3HHHA 3MD2A 1R71A 2JK3A 5IYDJ 4K2EA 3WU0A 5CVIA 2KT0A 3R60A 4A3IJ 5FO5A 4ZYAA 1O7LA 3HGGA 3E6DA 1MW7A 3E6CC 2FMLA 2WAEA 2CV0A 1B8IB 4HV5A 1K4SA 2HDDA 3OYLA 2P5VA 2QCOA 4RMNA 3DTKA 4LFUA 3OR1C 2E60A 2Q2EA 4MTDA 4G9YA 4ETSA 4DQ2A 4LK1F 5IPAA 2WADA 3KYLA 1MMNA 4BXFA 1N78A 4HRIA 3KEYA 4OAYA 1J0RA 2W00A 5CVVA 1I27A 3H9JA 1IUYA 3HKZA 3OSFA 2Y31A 1HOMA 2HVSA 3OYMA 3REOA 2WBMA 1Q1VA 2GLOA 4PGHA 2PI0A 2L9NA 2QLZA 2VKVA 4LIVA 4KDPA 2JVGA 3H5RA 5D4RA 1HBXG 3HZJA 3DEEA 3HXLA 4XSXF 4A0ZA 2HYFA 1PP7U 2PMZN 3TOAA 3JTGA 1R5ID 2DTZA 4CO8A 3FDYA 3M8JA 2W4SA 2R7TA 4IPAA 3MZ8A 3ECOA 3BZ6A 1BOBA 2EFQA 2OUMA 1Z77A 5DCFA 2IA0A 4KNYA 2IW5A 2JTVA 4BDZA 2KL4A 1SFXA 2CO5A 4AIDA 3IKVA 4ZYHA 3OS2A 2E2HJ 1Y0NA 2DFHA 2XKPA 4I0BA 4W97A 4BQQA 3DLLF 2WV0A 1U9OA 4A3DJ 2L02A 2VE8A 4Q48A 1KU3A 4O6JA 5EJCA 2GXBA 3OOUA 1YX5A 2W82A 4HQMA 2UWMA 1D1BA 2NVTJ 1FIAA 2QKLB 3ZN0A 3JSPA 2O8XA 4EJOA 2XGEA 5ICFA 4KJZA 2I8DA 1E3HA 4BH9A 3GMEA 2K9SA 2V6CA 2IAIA 4Y13A 4BKXA 4GYGA 5TISC 1YRNA 2DDAA 3LQRA 1IW7F 3RKWA 4XKWA 5J3LA 4A3GJ 2MGQA 2IA1A 2F5EA 2KIMA 2MFZA 1DUXC 4LJZF 1ZTRA 4XNFA 5H6QA 2ELJA 2JZYA 3MCZA 1Z3YA 3PM1A 2RDPA 2D2WA 3DCFA 4DIQA 4E70A 2DMQA 1D3YA 4LG0A 3I71A 4XLNF 1O57A 1RC9A 2RVCA 4E4HA 2BBYA 2ECCA 4F93B 3RTRA 3E5QA 2Q1ZB 3CC7I 4NQWB 3LL7A 3NARA 4KFCA 1FEXA 2IS2A 1SVOA 1RESA 5GAEJ 1YTYA 5GTHC 2R7OA 2MH2A 5HLHA 3FISA 3NQOA 1MBEA 3ZQFA 2MW8A 1ZR4A 2JPCA 1K6OA 2DPUA 2LH9A 4GFBA 3LA7A 5LBQA 2PG4A 2PLYA 2F2EA 3I5UA 1W1WE 2BY0A 3TBIA 1J2XA 1PUFB 1EH7A 4DNCA 3S2DJ 3RKYA 4D5CA 2L4MA 3BR0A 4B47A 2YS9A 2E1OA 3MN2A 2FU4A 3RPUA 1XB4A 3E5XA 3F9KA 4B3XA 3H9GA 1U0JA 2FQ4A 3PQJA 2HGCA 3COAC 2LC2A 1A6IA 2VOPA 1P2FA 4CHUA 1XGNA 5F27A 2L3DA 2M34A 3CUQC 1BI3A 2PJPA 1ZAOA 1X4PA 4BHBA 3WHCA 2RREA 3G1LA 2IP2A 3TW7A 2FNPA 2VJJA 3TMOA 3I53A 1W7PA 4HSRA 2CUJA 1FMVA 3L2UA 3WTWC 4AYBN 2LD5A 1GUUA 1LNWA 1O3SA 2R5YB 2A6TA 2MLKA 5F64A 2ZSHB 3RKXA 3NAUA 2HYJA 2LBFA 4N4OB 3N97A 2BOLA 4BHPA 1SFOJ 3WGIA 1ON1A 3GLXA 2M4KA 4IZZA 5D5VB 1FSEA 2R7RA 5FGMA 1YW9A 1EF4A 1Z05A 1GXQA 2QGUA 2K27A 1NG7A 2CJJA 1MH3A 1WH7A 1DDNA 1Y0UA 2ZKZA 3HEFA 3JRGA 3RQ4A 4IHVA 3Q9VA 1S6LA 2Z5UA 4BXXJ 5HS9A 1S5LC 4BEHA 1IJWC 2KPMA 3H0GJ 3K4JA 3I59A 3K70D 3PSIA 3SEZA 4QIWN 1ZRFA 1W0TA 1F5TA 5CKTA 3ZMUA 4U7DA 1ON2A 4CCLA 1W5TA 4GYIA 2IVMA 3GTPJ 3LSHA 3BG9A 2NYXA 2CFXA 1YS6A 1FYKA 2DCEA 2HKXA 5E1WA 1ETXA 3J7AY 3JTHA 4P5OA 4XONA 4I0AA 5GADJ 2GA1A 1XD7A 4ZC3A 2P81A 4Y4RA 1LDDA 2JSPA 1GV2A 5HDKA 3JREA 4L9TA 2PX9A 4YG2F 4P1WA 3Q3SA 3LSPA 4BQNA 2CUEA 4FETA 3VSKA 3EPZA 4EM2A 5E79C 3OYGA 1D1CA 3TQNA 3DKWA 5AIQA 5LRRA 3QYBA 4WF2A 1LEAA 3IAM2 3OR2C 1MSEC 3PO2J 4JOMA 2BZTA 2VKDA 2LKSA 3HG9A 4WXHA 4CCKA 2KISA 3DWLE 4YFXF 4LB5A 5C44J 4A3CJ 3GBGA 4UXNA 5FKNA 1CQTA 3NRVA 1JI8A 2FX0A 2O8KA 3MKWB 2NS7A 3OL4A 1FSHA 5FLXZ 3IL2A 5FLXK 1QVTA 2CW0F 1XMKA 4IVNA 4NDLA 5GAGJ 3KPHA 2QBYA 2ZMEC 3BROA 3LSMA 2M30A 4IHYA 2CV1A 1VF9A 1R5GA 3TO6A 1Y8QB 4II2A 1MNMC 3J7YJ 5FFZA 1TW2A 3E5UA 2J5PA 3GF2A 1WI9A 2CQ7A 1UELB 2B9SA 3IRRA 1B72B 1MMSA 3SXYA 4M9XA 1JGGA 4BBSJ 1MH4A 3M3YJ 2HVRA 1DGWY 5FROA 4RAYA 3V42A 3BZCA 1AKHA 2KLOA 1VNDA 3AL0C 3ZGKA 3QQAA 3OYBA 1W4MA 1WJCA 3ZQ7A 1H8AC 3SQNA 3PFIA 3IRQA 3HUGB 1ETKA 3J80K 3J80Z 1ODDA 4HF1A 3RQIA 1HSJA 4YELA 2FRHA 3BP8A 3AG3H 2J5OA 3RIRA 5L3DA 4BYYA 1MJAA 4Y33A 3SEQA 4L0ZB 4E6KG 4EGZA 4A93J 5F08A 2DFFA 3ZMSA 1X1DA 2A61A 4AC0A 2V26A 1SVLA 2PBIA 4FISA 3CCVI 1HW5A 2LK2A 3KZIC 2LF7A 1NG6A 3GVAA 3CJTB 3WTSC 3OIPA 2DA2A 2R7VA 1IXCA 2VBWA 3SJMA 1R00A 2K02A 5DCMA 2KDOA 5HOOA 2BW3A 2M0MA 3OYHA 3IH4A 3R0JA 4QPQA 4RLQA 5F0HA 2WAFA 2PN6A 4ENJA 3HOUJ 1ZK8A 4I98B 1JTYA 4BUPA 5HLTA 3CP2A 1Z0XA 4PDKA 2CYYA 1SMYF 2L9RA 1BM9A 1ENHA 4UB8C 4I6ZA 3OS0A 1ZG5A 5E17F 1U2WA 4L9NA 5DM6F 4BBRJ 1WJ5A 4RGXA 2L7KA 3F0CA 5F6FA 4BJTA 1JE8A 2R7XA 2NVQJ 2XF7A 3FMRA 4ZJZA 4D7MA 3IHUA 5ICGA 4QSHA 5B1AH 1HC8A 2E35A 3BOQA 2ME6A 2BVLA 3F8FA 3DU5A 3R4KA 5J1UA 2BXYA 2QENA 4M72A 4PUSA 1U78A 4V19K 2A07F 2ZB9A 3K1PA 2LDUA 2D1HA 4PJ0C 1LDJA 4MO7A 1J09A 1A6QA 1FC3A 1E3OC 1JT0A 3FHNA 2A6HF 1UJ8A 4KT5C 2CQKA 2CUZA 3HRSA 5DUKA 1Z6TA 3CJNA 1QRYA 5GAHJ 4YIFA 1SFKA 2XASA 1VQ4I 1MBJA 3C1DA 2QQBA 1SMTA 4M73A 4CZCA 3FKIJ 1OCOH 3OYCA 2VASA 3V7CA 1JUPA 5K7FA 1XG1A 1YIOA 2EILH 4A3LJ 2NRAC 1YJNI 1SFEA 4O3MA 2K7LA 2JMWA 2OPTA 1BC7C 2HYGD 3BJAA 3HC7A 4MGRA 2HDWA 1EV7A 2OQGA 1K79A 2HPMA 5LRSA 2YU9J 2WY7Q 2EH3A 2K4JA 2EV6A 3UR3C 2DLLA 3F8BA 3PNTA 3IC7A 2UZKA 1OCPA 5B5EC 5J4VA 4BNCA 2M0CA 3U9GA 2W24A 3BR6A 4I76A 2ETHA 2Q2EB 3GZ5A 1ZN2A 2UUZA 1P4XA 1G3YA 3CCUI 2KJBA 1JUMA 3K2ZA 5J8FA 2PEXA 3BCAA 4IHSA 1IZ1A 5ED4A 2KFDA 4LLLA 4Y52J 3KP4A 3Q9SA 4JX4A 4BQOA 3C3WA 1YS7A 3HKZN 4ESFA 5GPAA 1HDPA 3GO5A 4UVAA 2G0EA 4BY1J 2IGNA 1IRZA 4WCGA 4F55A 3DPLC 2HOSA 1XGOA 1F1ZA 2BV6A 1X58A 2F5FA 3TDZC 2F4MB 2TCTA 3VODA 4F7ZA 5BQTA 4CA0A 2CFOA 4R8HA 4M9SA 2BW3B 1GDTA 1TQIA 4JK1X 1TNTA 4FHTA 3VYSB 1MBKA 1QGPA 4B48A 4G7OF 2Z2SB 2CQQA 3BQZA 2VXZA 2IGMA 3ULQB 1SAXA 3K4MA 2LNBA 5LLQA 2JA6J 3H1CA 3JRAA 5JLXA 1O7FA 2O9LA 2ACJA 4PJMA 3MMYB 1HXDA 5GP9A 3DFGA 4AVZA 1XSVA 4D0PA 2MA3A 2OA4A 1VQMI 3G3ZA 1IN8A 5E8IA 1G59A 4NC6A 4XICA 5ICEA 5TJJA 3W3CA 4S04A 1HW1A 5L3FA 1J75A 2OTJI 4G7HF 2QQAA 3EUHA 3KLNA 3RZDJ 1G8XA 4DBRA 2Y0SA 1R5HA 3P5JA 4U87A 1TZLA 5FRMA 4LGWA 4XLEA 3JRFA 3WODF 3BG3A 5CVJA 3S1NJ 2YPRA 3IKTA 1Z1DA 2M45A 1VQOI 1UHMA 1U3EM 2HQ5A 4B4CA 4M6XA 2KP6A 5BS6A 5EGOB 2PMHA 4XLFA 2VQHA 2FA5A 4RS8A 3I4MJ 4AUXA 1JKRC 4XN0A 3G1OA 3CD6I 2MG4A 2MYSA 2ZXHA 4UV8A 1IXRC 2FE3A 1HW2A 2KIUA 2O5RA 1KQ0A 1XDUA 2XV4S 2R5ZA 5EEHA 3JRDA 3M7GA 1WPKA 1PJRA 2H8RA 4E7HA 3K4KA 3TO9A 1Y8RB 3VSLA 1E2XA 2DT6A 4KN7X 4LD5A 1I6XA 3CLQA 1RR7A 5C3EJ 2KJCA 1J9IA 3ELKA 3GYHX 3WU1B 2Z9OA 2RNGA 3WTVC 4JQFA 3CCYA 3S3MA 1GXPA 1SD7A 1KQ8A 3BJOA 3J7ZI 4Y17A 2LKPA 2RGVA 3W6JB 1ZGWA 3SYTA 5EEAA 3ONQA 3A0HC 3K6GA 4BJ5C 2V1UA 2I10A 4LOCA 5FLMJ 5BPDA 2K9LA 1B9NA 5A2QZ 5A2QK 5K1YA 4M71A 4HX4A 1TWHJ 1S3JA 3ERMA 3N4MA 4HDVA 3KIOA 1Y1VJ 1W5CC 2XUBA 1MDMB 3ZQIA 2NNNA 2O3FA 4UB6C 5D6EA 5ICCA 2M9HA 3V8LA 4J01A 3CJQB 1XS9A 4RA2A 4KIGA 2ZNZA 3K0LA 3T8TA 2A6EF 1MJBA 1IRXA 2A5WA 3LFKA 3FXQA 5EEGA 5D5UB 3BTLA 4B44A 1R23A 2DMUA 2OTLI 3FXOA 5HLIA 3GTKJ 1HCRA 2AQEA 1RRJA 2DJNA 1T38A 1DU0A 2IS4A 4HW0A 2AXLA 1VQLI 3DEWA 2D45A 2Z3YA 4ESJA 2BE5F 1PUFA 3G6EI 3TEDA 4CZZA 1RNLA 2V1XA 5ILVA 1BI2A 1S7EA 3KZYA 2DA7A 4XL9A 1VFCA 1VQPI 3BR1A 5BOXA 2COMA 3BY6A 1X4OA 3KP7A 3HGYA 2L54A 1YE9A 2BHZA 3ZRGA 2G7UA 3CMEI 3OSGA 3JAMZ 3JAMK 3V4GA 5E18F 4FCYA 1WI3A 3BR2A 4E7ZA 3TP3A 4HEA2 1B9MA 4CH7A 5FKMA 2DN0A 1P7IA 1AHDP 3F72A 3GZ6A 1Z67A 2HVQA 5ERIA 3WU2C 1LFPA 2P0WA 3I0TA 4L9JA 5F0FA 5ILUA 2QQ9A 3J7AO 2P7VB 2HQNA 3W6VA 1OYYA 4A12A 3F6OA 1ZKGA 1R58A 3K4BA 4HG2A 1Z9CA 1B6AA 2Z16A 4DZPA 5L3CA 4DJAA 1L3LA 3BPVA 2M1BA 5D5WB 4HF2A 3S1QJ 3QAHA 4O5VA 2JPBA 2XIGA 4P96A 5FFXA 5K5OA 1JKOC 2IT0A 2X1DA 2JRTA 4NB5A 2DO7A 1W7PD 2XRLA 3VYRB 4C2MJ 3WG7H 3OV8A 2LY9A 2HDCA 4BEHB 3G4SI 3S1RJ 2AQFA 2BY2A 1BL0A 1VQ9I 1BR1A 3CF2A 4M9ZA 3ZQHA 3ZR8X 4N9HA 1FTTA 1WJDA 4A5NA 3KX2A 1RUOA 4XSZF 6PAXA 4CCNA 4KT6A 4G94A 4HYEA 3WGGA 3GZNB 1EJ9A 4KMUX 2W1OA 4M3DA 2FSWA 1CGPA 3HOTA 4EJVA 3OYKA 2YX7A 4OWRB 2EFWA 4W1UA 2KRCA 2VUMJ 2X6OA 5CLSA 4IRGA 2M7AA 5L3BA 1I3AA 1FBSA 2OC6A 4X0GA 3JRCA 2K9MA 4ENMA 3V8KA 1VQ8I 4OIRF 2VN2A 1OFCX 1AOYA 4L0YB 2WB1N 4IOAF 5EYRA 3CC2I 1MMGA 1T2KA 2Y30A 1U5TB 3M8EA 5M5XJ 3ERED 1CF7A 2HTSA 2RQQA 4ASNA 2XPWA 2QQ8A 1XDSA 1WHUA 3RYRA 1NK2P 2FQ3A 4M6VA 5C4JJ 5KCMA 5K7HA 2ADUA 2KIQA 5E1XA 3FM5A 2Y75A 4MFEA 2OZUA 5LHHA 1YJ9I 3CCQI 1YIJI 3KP3A 3PQKA 3X2QH 1OISA 3GXOA 2EBIA 4BAYA 2X85A 2F5DA 4B1RA 1LVKA 4PJLA 2FMYA 3DBRB 2CSOA 3BJ6A 3HSEA 3CCJI 4OIQF 3PFYA 5E1ZB 3IWFA 1P4WA 3HM5A 2VJ5A 1ZYRF 3GTLJ 3QPHA 2DQLA 3B6AA 3KLOA 4E7JA 2V7FA 3G1MA 1B72A 3MZHA 1WFXA 1PDNC 3BC8A 3H3VK 5FJ8J 2KDZA 4B3AA 3KYCB 1P92A 2MC3A 4XRSA 4JP0A 2O0YA 1VI0A 1WSUA 3CCEI 1BBYA 1WVRA 2K40A 3T0YA 1FOYA 2A3SA 3CZ6A 5FKKA 3CUQA 4XKVA 4ZZDA 3CCSI 3K1MA 5IT3A 1IF1A 1SANA 3HPHA 1NK3P 1KYWA 2MSYA 4XIDA 3JRHA 3S8PA 5IP6A 1XGMA 3OYIA 4M3EA 3E1SA 2QKMB 4BJ6C 4CUGA 5BMZA 4C30A 5FKLA 1YHQI 3HPGA 4I09A 4AVPA 4BU2A 5J1RA 1AU7A 3KP5A 4C3HJ 1Z7LA 2NVUB 2X1EA 4XOPA 4RAFA 1ZRCA 2VPRA 1UMQA 2DU9A 4MNUA 2H1KA 1D0YA 4GDFA 2TDXA 3RKQA 4D1QA 3K4NA 3U1KA 1IC8A 4BS9A 4ZDLA 1HSTA 3CESA 3HHGA 3CDHA 2LKXA 4ZYEA 2EA2A 1TQMA 3OMYA 1A36A 4HF0A 4Y3OA 1QZZA 2ECBA 4NHJA 2LY1A 4OIPF 2R7ZJ 3IH3A 2PFBA 3FM3A 2RNJA 3OIOA 3DP7A 4M6YA 2EB7A 3S3OA 2FOKA 1X3ZB 2XPVA 1XC5A 1KU2A 4M3FA 3CTAA 3MKLA 2E36A 3QPTA 1IV8A 2P5LC 2CMPA 1TP4A 1QU3A 1XGSA 3CCLI 1MZBA 1TT0A 4MQ9F 5CVRA 2FNAA 2L7FP 4RAZA 1FLIA 4C3IJ 1V4RA 2DT5A 3TP0A 4PCQA 4E7LA 2EZIA 3HIFA 4OINF 2D1VA 1WGXA 2CU7A 1WQ2A 3QP5A 3DTEA 4EEFG 1PUEE 4PJNA 2VJIA 1ETQA 3VFZA 9ANTA 1D0XA 1DGRM 1Y6IA 1QBJA 1FX7A 4QPOA 2V79A 3AFHA 1V5EA 5BNGA 4OIOF 1WZ2A 3WG9A 2DA1A 4EJTA 4FX0A 1MNDA 5D5XB 1F4KA 4V2GA 2E7XA 4OU0A 3PO3J 3JRBA 1OPCA 4LLNA 3A01A 1ETWA 3LAJA 3D0SA 2HOAA 3S2WA 1WWXA 4MQVA 3QWLA 3ABTA 3VOEA 3GFIA 2Y0SN 1MGTA 5KAIC 2R5YA 1Q1HA 4LG0B 5M3MJ 3GFJA 1BJAA 3F8CA 1KYZA 4LG3A 4CYCB 1Z7UA 3KCCA 5CPRB 1WH5A 1USSA 3R0AA 5LEKA 2NVYJ 1UAAA 1L0OC 3DTIA 4QLCU 3E7LA 4I01A 4MEXF 2P4WA 2CQXA 5C4XJ 3DV8A 2DYSH 2F48A 1MKMA 2M8EA 1MIJA 1VZ0A 5DV5A 1OCRH 2ZJPF 5HDNA 5E3MA 1HDDC 3I59B 1PYVA 4BXUA 2VC1A 2E5ZA 4P9FA 2W57A 2V1NA 3CUQB 4X6AJ 4BE2A 1TWCJ 1U5TC 2XB5A 4QWQA 4FASD 3DEUA 3H5AA 4BACA 1ORKA 3H0DA 4UNOA 1PP8F 4RGUA 2OCEA 1UHWA 3VPRA 2IJLA 2HTJA 1X2NA 2M7BA 3B73A 1R7JA 5KHDA 3E3VA 1ONVA 3I3LA 2H94A 1BR2A 2JT1A 3WTTC 4A0YA 1W7PB 3DXJF 4ZDPA 3ZOBA 2E19A 2VIXA 1I3QJ 4PGGA 1G6NA 3BQYA 4I99C 5K7ZA 2R93J 1TWGJ 4HNUA 3I55I 1G3SA 4HSTA 4UHTA 2GXGA 2A5YB 2GIVA 2K3PA 2QSHX 2ESHA 1IDZA 3ZQGA 3DPTA 4ZYGA 2VOOA 3FXMA 4IHWA 4XM3A 1LJ9A 2EFOA 5LEJA 2PMUA 3M9AA 2JJ7A 1U8RA 4D9JA 1KA8A 1BI1A 1MMAA 2EIKH 2K4BA 1NTCA 2E1NA 2VKEA 1KU7A 3AG4H 2A05A 3HSRA 1HF0A 2QEXI 4M3GA 1VQNI 4ENKA 4FX4A 4CCOA 4A6EA 1SC7A 3A03A 4ITVA 4HA8A 3OYFA 2DW4A 4G6DA 2PMZA 1T0FC 5J8CA 2M4GA 3AG2H 3S2HJ 3M1CA 2R5ZB 4GGGA 1MSFC 3VEPA 3VYUB 4DW6A 2VL8A 4L5EA 1K83J 1JTXA 3ZMVA 2JSCA 3IAS2 5KVRA 3P9IA 3OYAA 4D7NA 4UVBA 4AIKA 4X1EA 3L2QA 2KKOA 2L0KA 3RPQA 3FX3A 4E7KA 1ZGJA 3ZP5A 2DTRA 3HOYJ 2IS6A 4XLCA 3ZXSA 2JA8J 2WAQA 2D5VA 2K9QA 2YU3A 2GXAA 3VDXA 2JRMA 4A6DA 1REPC 5KK1A 3C18A 5ILSA 1HA8A 1T6SA 1U6GA 2L5QA 2MD0A 3EYYA 4L5JA 4MEYF 2HXOA 2JUGA 4UUSA 1I1GA
chains in the Genus database with same CATH topology
3ZMTA 1B4AA 4OOIA 4LLGF 4HDUA 4EM1A 1SD5A 3CUOA 3L09A 1EH8A 2DI3A 3VB2A 4A5MA 4EM0B 5LGUA 3LAPA 2CG4A 1BOAA 1MJ9A 2XROA 1D8JA 1YYVA 5DYMA 4MTEA 3HYIA 1IRGA 3L2CA 1J5YA 2GA2A 3SHFA 3P9CA 3ZMZA 1FOKA 1UCRA 2M87A 1IN5A 3JSOA 3I64A 2HQRA 2MH9A 1WRJA 2QZ8A 5HS7A 4M74A 2XVCA 5HVQC 4U0WA 1O3RA 2QYOA 1X3UA 2VBXA 3LA3A 2F5CA 3G73A 1VTNC 2MD5A 4IF4A 4KICA 1K78A 3CLOA 1FYMA 1QZYA 2HS5A 1SFUA 4AWXB 1ZG1A 2VT2A 3H92A 1USTA 1T39A 2ESNA 1R22A 1IN6A 4RB0A 3TOBA 2GAUA 1XCVA 2A69F 3DF8A 2OU2A 2RV8A 1B1BA 1ZG3A 2G7HA 4UV9A 3WTZA 1YO5C 1B59A 1ZLKA 1YG2A 4I7HA 2WTEA 5CVUA 1QNTA 4Q47A 1YFHA 2CGPA 2XRNA 2X0LA 4P9UA 1U5TA 1QO0D 1CF7B 4N0BA 4S05A 3RYPA 3O2PE 2P6SA 2IPQX 2QWWA 3ZN1A 1ZLJA 3MAJA 3KE2A 1C0WA 2MBFA 3EDPA 3HSFA 3NEUA 2OQRA 3FMQA 3BDDA 3TKYA 1FP2A 4CGZA 2EV5A 3HRUA 4GXOA 1LDKB 1LB2A 3P9KA 1BC8C 4L9VA 3GX4X 1P4AA 3CO7C 3F3XA 3HRTA 2ZO4A 4HAMA 1XSDA 2VC0A 3U2RA 1Z91A 2H09A 3K1NA 2VT3A 2W85A 3FMSA 4KIBA 1YQAA 4B09A 4XRFA 4FT8A 2Y0MA 2ELHA 2XAHA 3GUDA 4BQAA 2QUFA 4Y15A 3RI4A 1H9GA 1S8NA 2Z99A 1T98A 4U7BA 3FZVA 2UXXA 2V1DA 2DK5A 1FZPB 4EQQA 3M1EA 2H6BA 1XSXA 1WKMA 1XMAA 4U88A 3V8JA 5DD8A 4WK8F 3TO7A 3WTUC 2ZFWA 2L01A 3KETA 2Q8KA 2EK5A 2C6YA 4HX7A 5BPIA 5LGTA 1XN7A 4A0XA 1JGSA 1D8KA 1TNSA 4R79A 1H9TA 5HS8A 1TBXA 4G7ZF 3FF5A 4R1HA 1IN7A 2EFPA 4RB2C 2GQQA 4CYDA 5JR3A 4UVCA 1BIAA 2FEZA 4LK0F 1RUNA 1EH6A 2XAQA 3DQVC 4U0VA 4HQEA 1OMIA 3FHZA 3QOPA 2RN7A 2VE9A 3MWMA 1FYLA 1G3TA 4LMYA 3GW2A 3LA2A 2DPDA 4CDGA 4AIJA 3F22A 2RC4A 4WWCA 3WTXC 2FBIA 2CWEA 3F8NA 3GFMA 3B02A 2E1CA 2P5KA 4JBAA 4N9IA 2OZ6A 1GVJA 2YR2A 3K9TA 3T1BA 5DUIA 1FBQA 1LQ1A 4I02A 3D5LA 5JFRA 2V9VA 1S29A 1JHFA 1YW8A 4EMSA 3ML6A 1J7KA 3R6SA 1FT9A 1KGSA 5CYVA 2R3SA 2VBYA 3LWFA 5LGNA 3LQQA 4YFNF 1BIBA 1H0MA 2NS0A 1K7AA 1HKTA 5D8KB 1STZA 4L18B 2YX4A 5AIPA 1ULYA 3SFZA 1AWCA 4UUVA 1ZREA 2ZMEB 3H3ZA 3EYIA 2BEOA 4KN4X 3I58A 2FBHA 5E20A 4ZH4F 1FBUA 2EJRA 2P7CB 4ENNA 1IXSB 3BPXA 4IHTA 4EJUA 3HTSB 2XAJA 2OAZA 3WE3A 5E8GA 1FY7A 3ABUA 1P6RA 2HOEA 3AAFA 3KP6A 2WC2A 4EV0A 4P55A 2DK8A 2PQ8A 5D8LB 3SZTA 3F6VA 4Z2YA 2Z33A 5HDGA 1TQPA 2K86A 2IA2A 1OKRA 4HLXA 5F1RA 4RGRA 1O3TA 2GZWA 1ZHFA 2B0LA 3CO6C 3HOSA 2X4HA 3KFWX 4IRIA 3WE2A 2XAGA 4HZFA 1RZ4A 4GO1A 2M5WA 4XLPF 2MLGA 1UFMA 2E7WA 3L00A 4KA4A 1GHCA 3P7NA 3ZMDA 3KP2A 5FD6A 2H6CA 2L4AA 5L3EA 4AD9A 5CJ9A 1IRFA 3H3UA 4NQWA 2O03A 2ISZA 3E6BA 3LSTA 2P6TA 3WGHA 5JVTA 1ZRDA 4XBFA 2OBPA 1O3QA 4A2UA 2W84A 2OD5A 2HZTA 4B8XA 3RDIA 3HRMA 5H20A 5D6FA 1ZH5A 4HLYA 2Q0OA 5DEQA 3I54A 5FD5A 4EVIA 4RB3C 4G8XA 2O6GE 1DPUA 4U0YA 3R61A 2QM3A 5JI6A 4Q4ZF 3MQ0A 1FNNA 1HQCA 2HEOA 1TW3A 1F9NA 3JW4A 2H27A 2RKHA 4G6QA 3ZPLA 2DAOA 3TGNA 5K5QA 5LHGA 2O61A 2ZJ2A 5DD4A 1NHAA 1J59A 1TLHB 3T8RA 1JHHA 5AONA 2KIFA 3ISPA 1R36A 3T5XA 1R1UA 1LEBA 2XKOA 3U1DA 2VBZA 4OMZA 5J6XA 2EWNA 3F23A 3QU3A 2HKOA 3O6BB 2IRFG 3E97A 4L5IA 1K78B 2KRFA 4AIHA 1QPMA 1RIOH 3M8FA 4BHCA 1SD6A 4Q5SF 1MD0A 2XHKA 1I1SA 1W5SA 2AS5F 4ON0A 1UB9A 2HR3A 5IT9K 5IT9Z 4RGSA 1HKSA 1I5ZA 2WWYA 2NAZA 2DBBA 4WXDA 3QU6A 2R7DA 4CXFA 3K69A 3O3KA 1RI7A 4EGYA 1S7AA 4HBLA 4EJWA 3RJPA 2XGXA 2P8TA 4TV7A 2STWA 1D5VA 2ZCWA 2XAFA 2ZBKA 2LSOA 3Q5FA 4IJAA 1T0FA 3J81K 3J81Z 3MEXA 1HKQA 4ZYDA 2HFHA 1TTYA 2BYVE 4RB1A 2VONA 4I2OA 2A68F 3C7JA 1DP7P 1BN5A 3EQLF 3BWGA 3QP6A 5DCMB 1OYWA 4PZJA 1V3FA 2BGCA 4HOBA 4OMYA 2EFNA 2Y48A 2RQPA 4YIIA 1ZGAA 4IXAA 2VODA 4H0EA 1G4DA 3V7SA 5HLGA 3HUGA 1YLFA 2DFIA 5L3GA 5LHIA 1S7OA 3V7RA 1MDMA 3MFKA 2GWRA 3F21A 4YFKF 3F8MA 4ESBA 5H6RA 3ROUA 4KUMA 2FBKA 4MHGA 2DQRA 4IRHA 3HTUA 2G9WA 3IWZA 1IAWA 5DDGA 2R7FA 5TRDA 3E6MA 2FF4A 3SZPA 1IN4A 2YSRA 3FXRA 2QBYB 4KMFA 3KZZA 3FWEA 4CICA 5K5RA 1A04A 1KQ9A 1OR7A 3GWZA 1FPQA 3W6KB 2ZNYA 1FP1D 1KU9A 1G3WA 1OYIA 5D4SA 2QVOA 2UXNA 2NNYA 1R1TA 3L7WA 4KYWA 2LF8A 4WXCA 4ZZLA 3OOPA 5FB2A 3EETA 1E17A 3L9FA 3I4PA 3KEQA 2HWVA 1ZARA 3QRFF 1DPRA 1R1VA 3MZYA 4GCVA 4KIFA 1YW7A 1XCBA 1Z6RA 4HX8A 1SD4A 4WX9A 5JHUA 3TDUC 3GFLA 2FXAA 2EV0A 4HV6A 1QQIA 4LB6B 2W25A 3GEZA 3FXUA 2ISYA 1FWZA 1LVAA 3KEOA 2ZMEA 3ECHA 1JXSA 2EA4A 2ZXJA 2STTA 3WTYC 1BI0A 3HHHA 4K2EA 3WU0A 5CVIA 3R60A 5FO5A 1O7LA 3E6DA 3E6CC 2FMLA 4HV5A 2P5VA 4LFUA 4MTDA 2Q2EA 4G9YA 4ETSA 4DQ2A 4LK1F 1J0RA 5CVVA 1I27A 1IUYA 3REOA 4PGHA 2PI0A 2QLZA 4KDPA 5D4RA 1HBXG 4XSXF 4A0ZA 2HYFA 1PP7U 3TOAA 3JTGA 4CO8A 4IPAA 3ECOA 3BZ6A 2EFQA 5DCFA 2IA0A 4KNYA 2IW5A 2JTVA 1SFXA 2CO5A 3IKVA 4ZYHA 2XKPA 4I0BA 2WV0A 2L02A 2VE8A 4Q48A 1KU3A 4O6JA 2GXBA 4HQMA 2UWMA 3ZN0A 3JSPA 2O8XA 4EJOA 5ICFA 4BH9A 2V6CA 4Y13A 4GYGA 3LQRA 1IW7F 3RKWA 2IA1A 2F5EA 2KIMA 1DUXC 4LJZF 5H6QA 2JZYA 3MCZA 2RDPA 2D2WA 4E70A 1D3YA 4LG0A 3I71A 4XLNF 1O57A 2RVCA 2BBYA 3RTRA 3E5QA 4KFCA 1YTYA 2MH2A 5HLHA 3NQOA 2DPUA 1K6OA 2JPCA 3LA7A 5LBQA 2PG4A 2PLYA 2F2EA 3I5UA 1J2XA 1EH7A 4DNCA 3RKYA 2L4MA 2FU4A 3RPUA 1XB4A 3E5XA 3PQJA 2HGCA 3COAC 2VOPA 1P2FA 4CHUA 1XGNA 2L3DA 3CUQC 1BI3A 2PJPA 1ZAOA 4BHBA 2IP2A 2FNPA 3I53A 1W7PA 3WTWC 1LNWA 1O3SA 2MLKA 5F64A 3RKXA 3N97A 4BHPA 3WGIA 1ON1A 3GLXA 5D5VB 1FSEA 5FGMA 1YW9A 1Z05A 1GXQA 2K27A 1DDNA 1Y0UA 2ZKZA 3Q9VA 1S6LA 2Z5UA 5HS9A 3I59A 1ZRFA 1F5TA 3ZMUA 4U7DA 1ON2A 1W5TA 4GYIA 2IVMA 2NYXA 2CFXA 1YS6A 1FYKA 2HKXA 5E1WA 3JTHA 4P5OA 4I0AA 2GA1A 1XD7A 1LDDA 5HDKA 4L9TA 4YG2F 4EM2A 3TQNA 3DKWA 5AIQA 5LRRA 4WF2A 1LEAA 4WXHA 4YFXF 4LB5A 4UXNA 3NRVA 1FSHA 5FLXZ 3IL2A 5FLXK 2CW0F 1XMKA 4IVNA 2QBYA 3BROA 2M30A 1R5GA 3TO6A 5FFZA 1TW2A 3E5UA 2J5PA 3GF2A 1WI9A 3IRRA 3SXYA 4M9XA 4RAYA 1W4MA 3ZQ7A 3SQNA 3PFIA 3IRQA 3J80K 3J80Z 1ODDA 4HF1A 1HSJA 2FRHA 3BP8A 2J5OA 3RIRA 5L3DA 4BYYA 1MJAA 4L0ZB 4EGZA 3ZMSA 2A61A 2PBIA 1HW5A 2LF7A 3GVAA 3WTSC 1IXCA 2VBWA 1R00A 2K02A 5DCMA 5HOOA 3R0JA 2PN6A 4ENJA 4I98B 4PDKA 2CYYA 1SMYF 1BM9A 5E17F 1ZG5A 1U2WA 4L9NA 4RGXA 5F6FA 1JE8A 3FMRA 3IHUA 5ICGA 3BOQA 3F8FA 3R4KA 2QENA 4M72A 1U78A 2A07F 3K1PA 2LDUA 2D1HA 1LDJA 1FC3A 2A6HF 4KT5C 2CQKA 3HRSA 5DUKA 1Z6TA 3CJNA 4YIFA 2XASA 3C1DA 2QQBA 1SMTA 4M73A 3V7CA 1YIOA 2NRAC 1SFEA 4O3MA 2K7LA 1BC7C 2HYGD 3BJAA 4MGRA 1EV7A 2OQGA 1K79A 5LRSA 2K4JA 2EV6A 2DLLA 3F8BA 3IC7A 2UZKA 4BNCA 3U9GA 2W24A 2ETHA 3GZ5A 1ZN2A 1P4XA 1G3YA 2KJBA 3K2ZA 5J8FA 2PEXA 4IHSA 1IZ1A 5ED4A 4LLLA 3KP4A 3Q9SA 3C3WA 1YS7A 4ESFA 4UVAA 3GO5A 4WCGA 3DPLC 1XGOA 1F1ZA 2BV6A 2F5FA 3TDZC 3VODA 4F7ZA 5BQTA 4R8HA 4M9SA 1TQIA 4JK1X 1TNTA 4FHTA 1QGPA 4G7OF 2VXZA 3ULQB 1SAXA 2LNBA 5LLQA 1O7FA 2ACJA 1HXDA 3DFGA 1XSVA 4D0PA 2MA3A 2OA4A 3G3ZA 1IN8A 5E8IA 5ICEA 5TJJA 4S04A 1HW1A 5L3FA 1J75A 4G7HF 2QQAA 3EUHA 3KLNA 1R5HA 4LGWA 3WODF 5CVJA 2YPRA 3IKTA 1Z1DA 2M45A 1UHMA 1U3EM 4M6XA 5BS6A 2PMHA 2FA5A 4RS8A 4UV8A 1IXRC 2FE3A 1HW2A 2KIUA 1KQ0A 1XDUA 2XV4S 5EEHA 3M7GA 3TO9A 1E2XA 4KN7X 4LD5A 1I6XA 2KJCA 1J9IA 3ELKA 3GYHX 3WU1B 2Z9OA 1GXPA 3WTVC 4JQFA 1SD7A 1KQ8A 3BJOA 4Y17A 2LKPA 2RGVA 3W6JB 2V1UA 5BPDA 1B9NA 5A2QZ 5A2QK 5K1YA 4M71A 4HX4A 1S3JA 3N4MA 4HDVA 2XUBA 1MDMB 2NNNA 2O3FA 5D6EA 5ICCA 3V8LA 4KIGA 2ZNZA 3K0LA 3T8TA 2A6EF 1MJBA 3LFKA 3FXQA 5EEGA 5D5UB 1R23A 5HLIA 1T38A 4HW0A 2AXLA 2D45A 2Z3YA 4ESJA 2BE5F 4CZZA 1RNLA 2V1XA 5ILVA 1BI2A 3KZYA 5BOXA 2COMA 3BY6A 3KP7A 2L54A 2G7UA 3JAMZ 3JAMK 3V4GA 5E18F 1B9MA 3F72A 3GZ6A 5ERIA 3I0TA 4L9JA 5ILUA 2QQ9A 3J7AO 2P7VB 2HQNA 1OYYA 4A12A 3F6OA 1R58A 1Z9CA 1B6AA 5L3CA 1L3LA 3BPVA 2M1BA 5D5WB 4HF2A 3QAHA 4O5VA 2JPBA 2XIGA 4P96A 5FFXA 2IT0A 5K5OA 2JRTA 4NB5A 2DO7A 1W7PD 3OV8A 2HDCA 4M9ZA 4N9HA 4A5NA 1RUOA 4XSZF 6PAXA 4G94A 4HYEA 3WGGA 4KMUX 2FSWA 1CGPA 3HOTA 4EJVA 2YX7A 2EFWA 5CLSA 4IRGA 5L3BA 1FBSA 4ENMA 3V8KA 4OIRF 2VN2A 1AOYA 4L0YB 1T2KA 3ERED 1U5TB 3M8EA 1CF7A 2HTSA 4ASNA 1XDSA 3RYRA 2FQ3A 2ADUA 5E1XA 3FM5A 2Y75A 2OZUA 5LHHA 3KP3A 3PQKA 3GXOA 4BAYA 2F5DA 2FMYA 2CSOA 3BJ6A 3HSEA 4OIQF 5E1ZB 3IWFA 1P4WA 1ZYRF 3QPHA 2DQLA 3KLOA 3MZHA 1PDNC 1P92A 2MC3A 2O0YA 1WSUA 1BBYA 3T0YA 2A3SA 3CUQA 4ZZDA 3K1MA 5IT3A 1IF1A 1KYWA 1XGMA 5BMZA 4I09A 4AVPA 3KP5A 1ZRCA 2DU9A 4MNUA 2TDXA 1HSTA 3HHGA 3CDHA 4ZYEA 2EA2A 1TQMA 4HF0A 1QZZA 4NHJA 4OIPF 2PFBA 3FM3A 2RNJA 3DP7A 4M6YA 2EB7A 2FOKA 1KU2A 3CTAA 3QPTA 2P5LC 1XGSA 1MZBA 4MQ9F 5CVRA 2FNAA 4RAZA 1FLIA 1V4RA 2DT5A 4PCQA 3HIFA 4OINF 2D1VA 1WQ2A 3QP5A 1PUEE 3VFZA 1QBJA 1FX7A 2V79A 4OIOF 3WG9A 4EJTA 4FX0A 5D5XB 1F4KA 2E7XA 4OU0A 1OPCA 4LLNA 3LAJA 3D0SA 3S2WA 1WWXA 4MQVA 3ABTA 3VOEA 3GFIA 1MGTA 1Q1HA 4LG0B 3GFJA 1BJAA 3F8CA 1KYZA 1Z7UA 3KCCA 1USSA 3R0AA 5LEKA 1L0OC 4QLCU 4I01A 4MEXF 2P4WA 3DV8A 1MKMA 2M8EA 5DV5A 5HDNA 3I59B 4BXUA 2VC1A 4P9FA 2W57A 3CUQB 1U5TC 4QWQA 3DEUA 4UNOA 1PP8F 4RGUA 1UHWA 2IJLA 2HTJA 3B73A 1R7JA 3E3VA 1ONVA 2H94A 3WTTC 2JT1A 4A0YA 1W7PB 3DXJF 4PGGA 1G6NA 1G3SA 4UHTA 2GXGA 2A5YB 2GIVA 2ESHA 2VOOA 3DPTA 4ZYGA 1LJ9A 2EFOA 5LEJA 2PMUA 3M9AA 1U8RA 1KA8A 1BI1A 2K4BA 2E1NA 1KU7A 3HSRA 4ENKA 4FX4A 4A6EA 4HA8A 2DW4A 4G6DA 5J8CA 4GGGA 3VEPA 3ZMVA 2JSCA 5KVRA 3P9IA 4UVBA 4AIKA 2KKOA 3RPQA 3FX3A 1ZGJA 3ZP5A 2DTRA 2YU3A 4A6DA 1REPC 5KK1A 3C18A 5ILSA 1T6SA 1U6GA 3EYYA 4L5JA 4MEYF 1I1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZMT A;  1B4A A;  4OOI A;  4LLG F;  4HDU A;  4EM1 A;  1SD5 A;  3CUO A;  3L09 A;  1EH8 A;  2DI3 A;  3VB2 A;  4A5M A;  4EM0 B;  5LGU A;  3LAP A;  2CG4 A;  1BOA A;  1MJ9 A;  2XRO A;  1D8J A;  1YYV A;  5DYM A;  4MTE A;  3HYI A;  1IRG A;  3L2C A;  1J5Y A;  2GA2 A;  3SHF A;  3P9C A;  3ZMZ A;  1FOK A;  1UCR A;  2M87 A;  1IN5 A;  3JSO A;  3I64 A;  2HQR A;  2MH9 A;  1WRJ A;  2QZ8 A;  5HS7 A;  4M74 A;  2XVC A;  5HVQ C;  4U0W A;  1O3R A;  2QYO A;  1X3U A;  2VBX A;  3LA3 A;  2F5C A;  3G73 A;  1VTN C;  2MD5 A;  4IF4 A;  4KIC A;  1K78 A;  3CLO A;  1FYM A;  1QZY A;  2HS5 A;  1SFU A;  4AWX B;  1ZG1 A;  2VT2 A;  3H92 A;  1UST A;  1T39 A;  2ESN A;  1R22 A;  1IN6 A;  4RB0 A;  3TOB A;  2GAU A;  1XCV A;  2A69 F;  3DF8 A;  2OU2 A;  2RV8 A;  1B1B A;  1ZG3 A;  2G7H A;  4UV9 A;  3WTZ A;  1YO5 C;  1B59 A;  1ZLK A;  1YG2 A;  4I7H A;  2WTE A;  5CVU A;  1QNT A;  4Q47 A;  1YFH A;  2CGP A;  2XRN A;  2X0L A;  4P9U A;  1U5T A;  1QO0 D;  1CF7 B;  4N0B A;  4S05 A;  3RYP A;  3O2P E;  2P6S A;  2IPQ X;  2QWW A;  3ZN1 A;  1ZLJ A;  3MAJ A;  3KE2 A;  1C0W A;  2MBF A;  3EDP A;  3HSF A;  3NEU A;  2OQR A;  3FMQ A;  3BDD A;  3TKY A;  1FP2 A;  4CGZ A;  2EV5 A;  3HRU A;  4GXO A;  1LDK B;  1LB2 A;  3P9K A;  1BC8 C;  4L9V A;  3GX4 X;  1P4A A;  3CO7 C;  3F3X A;  3HRT A;  2ZO4 A;  4HAM A;  1XSD A;  2VC0 A;  3U2R A;  1Z91 A;  2H09 A;  3K1N A;  2VT3 A;  2W85 A;  3FMS A;  4KIB A;  1YQA A;  4B09 A;  4XRF A;  4FT8 A;  2Y0M A;  2ELH A;  2XAH A;  3GUD A;  4BQA A;  2QUF A;  4Y15 A;  3RI4 A;  1H9G A;  1S8N A;  2Z99 A;  1T98 A;  4U7B A;  3FZV A;  2UXX A;  2V1D A;  2DK5 A;  1FZP B;  4EQQ A;  3M1E A;  2H6B A;  1XSX A;  1WKM A;  1XMA A;  4U88 A;  3V8J A;  5DD8 A;  4WK8 F;  3TO7 A;  3WTU C;  2ZFW A;  2L01 A;  3KET A;  2Q8K A;  2EK5 A;  2C6Y A;  4HX7 A;  5BPI A;  5LGT A;  1XN7 A;  4A0X A;  1JGS A;  1D8K A;  1TNS A;  4R79 A;  1H9T A;  5HS8 A;  1TBX A;  4G7Z F;  3FF5 A;  4R1H A;  1IN7 A;  2EFP A;  4RB2 C;  2GQQ A;  4CYD A;  5JR3 A;  4UVC A;  1BIA A;  2FEZ A;  4LK0 F;  1RUN A;  1EH6 A;  2XAQ A;  3DQV C;  4U0V A;  4HQE A;  1OMI A;  3FHZ A;  3QOP A;  2RN7 A;  2VE9 A;  3MWM A;  1FYL A;  1G3T A;  4LMY A;  3GW2 A;  3LA2 A;  2DPD A;  4CDG A;  4AIJ A;  3F22 A;  2RC4 A;  4WWC A;  3WTX C;  2FBI A;  2CWE A;  3F8N A;  3GFM A;  3B02 A;  2E1C A;  2P5K A;  4JBA A;  4N9I A;  2OZ6 A;  1GVJ A;  2YR2 A;  3K9T A;  3T1B A;  5DUI A;  1FBQ A;  1LQ1 A;  4I02 A;  3D5L A;  5JFR A;  2V9V A;  1S29 A;  1JHF A;  1YW8 A;  4EMS A;  3ML6 A;  1J7K A;  3R6S A;  1FT9 A;  1KGS A;  5CYV A;  2R3S A;  2VBY A;  3LWF A;  5LGN A;  3LQQ A;  4YFN F;  1BIB A;  1H0M A;  2NS0 A;  1K7A A;  1HKT A;  5D8K B;  1STZ A;  4L18 B;  2YX4 A;  5AIP A;  1ULY A;  3SFZ A;  1AWC A;  4UUV A;  1ZRE A;  2ZME B;  3H3Z A;  3EYI A;  2BEO A;  4KN4 X;  3I58 A;  2FBH A;  5E20 A;  4ZH4 F;  1FBU A;  2EJR A;  2P7C B;  4ENN A;  1IXS B;  3BPX A;  4IHT A;  4EJU A;  3HTS B;  2XAJ A;  2OAZ A;  3WE3 A;  5E8G A;  1FY7 A;  3ABU A;  1P6R A;  2HOE A;  3AAF A;  3KP6 A;  2WC2 A;  4EV0 A;  4P55 A;  2DK8 A;  2PQ8 A;  5D8L B;  3SZT A;  3F6V A;  4Z2Y A;  2Z33 A;  5HDG A;  1TQP A;  2K86 A;  2IA2 A;  1OKR A;  4HLX A;  5F1R A;  4RGR A;  1O3T A;  2GZW A;  1ZHF A;  2B0L A;  3CO6 C;  3HOS A;  2X4H A;  3KFW X;  4IRI A;  3WE2 A;  2XAG A;  4HZF A;  1RZ4 A;  4GO1 A;  2M5W A;  4XLP F;  2MLG A;  1UFM A;  2E7W A;  3L00 A;  4KA4 A;  1GHC A;  3P7N A;  3ZMD A;  3KP2 A;  5FD6 A;  2H6C A;  2L4A A;  5L3E A;  4AD9 A;  5CJ9 A;  1IRF A;  3H3U A;  4NQW A;  2O03 A;  2ISZ A;  3E6B A;  3LST A;  2P6T A;  3WGH A;  5JVT A;  1ZRD A;  4XBF A;  2OBP A;  1O3Q A;  4A2U A;  2W84 A;  2OD5 A;  2HZT A;  4B8X A;  3RDI A;  3HRM A;  5H20 A;  5D6F A;  1ZH5 A;  4HLY A;  2Q0O A;  5DEQ A;  3I54 A;  5FD5 A;  4EVI A;  4RB3 C;  4G8X A;  2O6G E;  1DPU A;  4U0Y A;  3R61 A;  2QM3 A;  5JI6 A;  4Q4Z F;  3MQ0 A;  1FNN A;  1HQC A;  2HEO A;  1TW3 A;  1F9N A;  3JW4 A;  2H27 A;  2RKH A;  4G6Q A;  3ZPL A;  2DAO A;  3TGN A;  5K5Q A;  5LHG A;  2O61 A;  2ZJ2 A;  5DD4 A;  1NHA A;  1J59 A;  1TLH B;  3T8R A;  1JHH A;  5AON A;  2KIF A;  3ISP A;  1R36 A;  3T5X A;  1R1U A;  1LEB A;  2XKO A;  3U1D A;  2VBZ A;  4OMZ A;  5J6X A;  2EWN A;  3F23 A;  3QU3 A;  2HKO A;  3O6B B;  2IRF G;  3E97 A;  4L5I A;  1K78 B;  2KRF A;  4AIH A;  1QPM A;  1RIO H;  3M8F A;  4BHC A;  1SD6 A;  4Q5S F;  1MD0 A;  2XHK A;  1I1S A;  1W5S A;  2AS5 F;  4ON0 A;  1UB9 A;  2HR3 A;  5IT9 K;  5IT9 Z;  4RGS A;  1HKS A;  1I5Z A;  2WWY A;  2NAZ A;  2DBB A;  4WXD A;  3QU6 A;  2R7D A;  4CXF A;  3K69 A;  3O3K A;  1RI7 A;  4EGY A;  1S7A A;  4HBL A;  4EJW A;  3RJP A;  2XGX A;  2P8T A;  4TV7 A;  2STW A;  1D5V A;  2ZCW A;  2XAF A;  2ZBK A;  2LSO A;  3Q5F A;  4IJA A;  1T0F A;  3J81 K;  3J81 Z;  3MEX A;  1HKQ A;  4ZYD A;  2HFH A;  1TTY A;  2BYV E;  4RB1 A;  2VON A;  4I2O A;  2A68 F;  3C7J A;  1DP7 P;  1BN5 A;  3EQL F;  3BWG A;  3QP6 A;  5DCM B;  1OYW A;  4PZJ A;  1V3F A;  2BGC A;  4HOB A;  4OMY A;  2EFN A;  2Y48 A;  2RQP A;  4YII A;  1ZGA A;  4IXA A;  2VOD A;  4H0E A;  1G4D A;  3V7S A;  5HLG A;  3HUG A;  1YLF A;  2DFI A;  5L3G A;  5LHI A;  1S7O A;  3V7R A;  1MDM A;  3MFK A;  2GWR A;  3F21 A;  4YFK F;  3F8M A;  4ESB A;  5H6R A;  3ROU A;  4KUM A;  2FBK A;  4MHG A;  2DQR A;  4IRH A;  3HTU A;  2G9W A;  3IWZ A;  1IAW A;  5DDG A;  2R7F A;  5TRD A;  3E6M A;  2FF4 A;  3SZP A;  1IN4 A;  2YSR A;  3FXR A;  2QBY B;  4KMF A;  3KZZ A;  3FWE A;  4CIC A;  5K5R A;  1A04 A;  1KQ9 A;  1OR7 A;  3GWZ A;  1FPQ A;  3W6K B;  2ZNY A;  1FP1 D;  1KU9 A;  1G3W A;  1OYI A;  5D4S A;  2QVO A;  2UXN A;  2NNY A;  1R1T A;  3L7W A;  4KYW A;  2LF8 A;  4WXC A;  4ZZL A;  3OOP A;  5FB2 A;  3EET A;  1E17 A;  3L9F A;  3I4P A;  3KEQ A;  2HWV A;  1ZAR A;  3QRF F;  1DPR A;  1R1V A;  3MZY A;  4GCV A;  4KIF A;  1YW7 A;  1XCB A;  1Z6R A;  4HX8 A;  1SD4 A;  4WX9 A;  5JHU A;  3TDU C;  3GFL A;  2FXA A;  2EV0 A;  4HV6 A;  1QQI A;  4LB6 B;  2W25 A;  3GEZ A;  3FXU A;  2ISY A;  1FWZ A;  1LVA A;  3KEO A;  2ZME A;  3ECH A;  1JXS A;  2EA4 A;  2ZXJ A;  2STT A;  3WTY C;  1BI0 A;  3HHH A;  4K2E A;  3WU0 A;  5CVI A;  3R60 A;  5FO5 A;  1O7L A;  3E6D A;  3E6C C;  2FML A;  4HV5 A;  2P5V A;  4LFU A;  4MTD A;  2Q2E A;  4G9Y A;  4ETS A;  4DQ2 A;  4LK1 F;  1J0R A;  5CVV A;  1I27 A;  1IUY A;  3REO A;  4PGH A;  2PI0 A;  2QLZ A;  4KDP A;  5D4R A;  1HBX G;  4XSX F;  4A0Z A;  2HYF A;  1PP7 U;  3TOA A;  3JTG A;  4CO8 A;  4IPA A;  3ECO A;  3BZ6 A;  2EFQ A;  5DCF A;  2IA0 A;  4KNY A;  2IW5 A;  2JTV A;  1SFX A;  2CO5 A;  3IKV A;  4ZYH A;  2XKP A;  4I0B A;  2WV0 A;  2L02 A;  2VE8 A;  4Q48 A;  1KU3 A;  4O6J A;  2GXB A;  4HQM A;  2UWM A;  3ZN0 A;  3JSP A;  2O8X A;  4EJO A;  5ICF A;  4BH9 A;  2V6C A;  4Y13 A;  4GYG A;  3LQR A;  1IW7 F;  3RKW A;  2IA1 A;  2F5E A;  2KIM A;  1DUX C;  4LJZ F;  5H6Q A;  2JZY A;  3MCZ A;  2RDP A;  2D2W A;  4E70 A;  1D3Y A;  4LG0 A;  3I71 A;  4XLN F;  1O57 A;  2RVC A;  2BBY A;  3RTR A;  3E5Q A;  4KFC A;  1YTY A;  2MH2 A;  5HLH A;  3NQO A;  2DPU A;  1K6O A;  2JPC A;  3LA7 A;  5LBQ A;  2PG4 A;  2PLY A;  2F2E A;  3I5U A;  1J2X A;  1EH7 A;  4DNC A;  3RKY A;  2L4M A;  2FU4 A;  3RPU A;  1XB4 A;  3E5X A;  3PQJ A;  2HGC A;  3COA C;  2VOP A;  1P2F A;  4CHU A;  1XGN A;  2L3D A;  3CUQ C;  1BI3 A;  2PJP A;  1ZAO A;  4BHB A;  2IP2 A;  2FNP A;  3I53 A;  1W7P A;  3WTW C;  1LNW A;  1O3S A;  2MLK A;  5F64 A;  3RKX A;  3N97 A;  4BHP A;  3WGI A;  1ON1 A;  3GLX A;  5D5V B;  1FSE A;  5FGM A;  1YW9 A;  1Z05 A;  1GXQ A;  2K27 A;  1DDN A;  1Y0U A;  2ZKZ A;  3Q9V A;  1S6L A;  2Z5U A;  5HS9 A;  3I59 A;  1ZRF A;  1F5T A;  3ZMU A;  4U7D A;  1ON2 A;  1W5T A;  4GYI A;  2IVM A;  2NYX A;  2CFX A;  1YS6 A;  1FYK A;  2HKX A;  5E1W A;  3JTH A;  4P5O A;  4I0A A;  2GA1 A;  1XD7 A;  1LDD A;  5HDK A;  4L9T A;  4YG2 F;  4EM2 A;  3TQN A;  3DKW A;  5AIQ A;  5LRR A;  4WF2 A;  1LEA A;  4WXH A;  4YFX F;  4LB5 A;  4UXN A;  3NRV A;  1FSH A;  5FLX Z;  3IL2 A;  5FLX K;  2CW0 F;  1XMK A;  4IVN A;  2QBY A;  3BRO A;  2M30 A;  1R5G A;  3TO6 A;  5FFZ A;  1TW2 A;  3E5U A;  2J5P A;  3GF2 A;  1WI9 A;  3IRR A;  3SXY A;  4M9X A;  4RAY A;  1W4M A;  3ZQ7 A;  3SQN A;  3PFI A;  3IRQ A;  3J80 K;  3J80 Z;  1ODD A;  4HF1 A;  1HSJ A;  2FRH A;  3BP8 A;  2J5O A;  3RIR A;  5L3D A;  4BYY A;  1MJA A;  4L0Z B;  4EGZ A;  3ZMS A;  2A61 A;  2PBI A;  1HW5 A;  2LF7 A;  3GVA A;  3WTS C;  1IXC A;  2VBW A;  1R00 A;  2K02 A;  5DCM A;  5HOO A;  3R0J A;  2PN6 A;  4ENJ A;  4I98 B;  4PDK A;  2CYY A;  1SMY F;  1BM9 A;  5E17 F;  1ZG5 A;  1U2W A;  4L9N A;  4RGX A;  5F6F A;  1JE8 A;  3FMR A;  3IHU A;  5ICG A;  3BOQ A;  3F8F A;  3R4K A;  2QEN A;  4M72 A;  1U78 A;  2A07 F;  3K1P A;  2LDU A;  2D1H A;  1LDJ A;  1FC3 A;  2A6H F;  4KT5 C;  2CQK A;  3HRS A;  5DUK A;  1Z6T A;  3CJN A;  4YIF A;  2XAS A;  3C1D A;  2QQB A;  1SMT A;  4M73 A;  3V7C A;  1YIO A;  2NRA C;  1SFE A;  4O3M A;  2K7L A;  1BC7 C;  2HYG D;  3BJA A;  4MGR A;  1EV7 A;  2OQG A;  1K79 A;  5LRS A;  2K4J A;  2EV6 A;  2DLL A;  3F8B A;  3IC7 A;  2UZK A;  4BNC A;  3U9G A;  2W24 A;  2ETH A;  3GZ5 A;  1ZN2 A;  1P4X A;  1G3Y A;  2KJB A;  3K2Z A;  5J8F A;  2PEX A;  4IHS A;  1IZ1 A;  5ED4 A;  4LLL A;  3KP4 A;  3Q9S A;  3C3W A;  1YS7 A;  4ESF A;  4UVA A;  3GO5 A;  4WCG A;  3DPL C;  1XGO A;  1F1Z A;  2BV6 A;  2F5F A;  3TDZ C;  3VOD A;  4F7Z A;  5BQT A;  4R8H A;  4M9S A;  1TQI A;  4JK1 X;  1TNT A;  4FHT A;  1QGP A;  4G7O F;  2VXZ A;  3ULQ B;  1SAX A;  2LNB A;  5LLQ A;  1O7F A;  2ACJ A;  1HXD A;  3DFG A;  1XSV A;  4D0P A;  2MA3 A;  2OA4 A;  3G3Z A;  1IN8 A;  5E8I A;  5ICE A;  5TJJ A;  4S04 A;  1HW1 A;  5L3F A;  1J75 A;  4G7H F;  2QQA A;  3EUH A;  3KLN A;  1R5H A;  4LGW A;  3WOD F;  5CVJ A;  2YPR A;  3IKT A;  1Z1D A;  2M45 A;  1UHM A;  1U3E M;  4M6X A;  5BS6 A;  2PMH A;  2FA5 A;  4RS8 A;  4UV8 A;  1IXR C;  2FE3 A;  1HW2 A;  2KIU A;  1KQ0 A;  1XDU A;  2XV4 S;  5EEH A;  3M7G A;  3TO9 A;  1E2X A;  4KN7 X;  4LD5 A;  1I6X A;  2KJC A;  1J9I A;  3ELK A;  3GYH X;  3WU1 B;  2Z9O A;  1GXP A;  3WTV C;  4JQF A;  1SD7 A;  1KQ8 A;  3BJO A;  4Y17 A;  2LKP A;  2RGV A;  3W6J B;  2V1U A;  5BPD A;  1B9N A;  5A2Q Z;  5A2Q K;  5K1Y A;  4M71 A;  4HX4 A;  1S3J A;  3N4M A;  4HDV A;  2XUB A;  1MDM B;  2NNN A;  2O3F A;  5D6E A;  5ICC A;  3V8L A;  4KIG A;  2ZNZ A;  3K0L A;  3T8T A;  2A6E F;  1MJB A;  3LFK A;  3FXQ A;  5EEG A;  5D5U B;  1R23 A;  5HLI A;  1T38 A;  4HW0 A;  2AXL A;  2D45 A;  2Z3Y A;  4ESJ A;  2BE5 F;  4CZZ A;  1RNL A;  2V1X A;  5ILV A;  1BI2 A;  3KZY A;  5BOX A;  2COM A;  3BY6 A;  3KP7 A;  2L54 A;  2G7U A;  3JAM Z;  3JAM K;  3V4G A;  5E18 F;  1B9M A;  3F72 A;  3GZ6 A;  5ERI A;  3I0T A;  4L9J A;  5ILU A;  2QQ9 A;  3J7A O;  2P7V B;  2HQN A;  1OYY A;  4A12 A;  3F6O A;  1R58 A;  1Z9C A;  1B6A A;  5L3C A;  1L3L A;  3BPV A;  2M1B A;  5D5W B;  4HF2 A;  3QAH A;  4O5V A;  2JPB A;  2XIG A;  4P96 A;  5FFX A;  2IT0 A;  5K5O A;  2JRT A;  4NB5 A;  2DO7 A;  1W7P D;  3OV8 A;  2HDC A;  4M9Z A;  4N9H A;  4A5N A;  1RUO A;  4XSZ F;  6PAX A;  4G94 A;  4HYE A;  3WGG A;  4KMU X;  2FSW A;  1CGP A;  3HOT A;  4EJV A;  2YX7 A;  2EFW A;  5CLS A;  4IRG A;  5L3B A;  1FBS A;  4ENM A;  3V8K A;  4OIR F;  2VN2 A;  1AOY A;  4L0Y B;  1T2K A;  3ERE D;  1U5T B;  3M8E A;  1CF7 A;  2HTS A;  4ASN A;  1XDS A;  3RYR A;  2FQ3 A;  2ADU A;  5E1X A;  3FM5 A;  2Y75 A;  2OZU A;  5LHH A;  3KP3 A;  3PQK A;  3GXO A;  4BAY A;  2F5D A;  2FMY A;  2CSO A;  3BJ6 A;  3HSE A;  4OIQ F;  5E1Z B;  3IWF A;  1P4W A;  1ZYR F;  3QPH A;  2DQL A;  3KLO A;  3MZH A;  1PDN C;  1P92 A;  2MC3 A;  2O0Y A;  1WSU A;  1BBY A;  3T0Y A;  2A3S A;  3CUQ A;  4ZZD A;  3K1M A;  5IT3 A;  1IF1 A;  1KYW A;  1XGM A;  5BMZ A;  4I09 A;  4AVP A;  3KP5 A;  1ZRC A;  2DU9 A;  4MNU A;  2TDX A;  1HST A;  3HHG A;  3CDH A;  4ZYE A;  2EA2 A;  1TQM A;  4HF0 A;  1QZZ A;  4NHJ A;  4OIP F;  2PFB A;  3FM3 A;  2RNJ A;  3DP7 A;  4M6Y A;  2EB7 A;  2FOK A;  1KU2 A;  3CTA A;  3QPT A;  2P5L C;  1XGS A;  1MZB A;  4MQ9 F;  5CVR A;  2FNA A;  4RAZ A;  1FLI A;  1V4R A;  2DT5 A;  4PCQ A;  3HIF A;  4OIN F;  2D1V A;  1WQ2 A;  3QP5 A;  1PUE E;  3VFZ A;  1QBJ A;  1FX7 A;  2V79 A;  4OIO F;  3WG9 A;  4EJT A;  4FX0 A;  5D5X B;  1F4K A;  2E7X A;  4OU0 A;  1OPC A;  4LLN A;  3LAJ A;  3D0S A;  3S2W A;  1WWX A;  4MQV A;  3ABT A;  3VOE A;  3GFI A;  1MGT A;  1Q1H A;  4LG0 B;  3GFJ A;  1BJA A;  3F8C A;  1KYZ A;  1Z7U A;  3KCC A;  1USS A;  3R0A A;  5LEK A;  1L0O C;  4QLC U;  4I01 A;  4MEX F;  2P4W A;  3DV8 A;  1MKM A;  2M8E A;  5DV5 A;  5HDN A;  3I59 B;  4BXU A;  2VC1 A;  4P9F A;  2W57 A;  3CUQ B;  1U5T C;  4QWQ A;  3DEU A;  4UNO A;  1PP8 F;  4RGU A;  1UHW A;  2IJL A;  2HTJ A;  3B73 A;  1R7J A;  3E3V A;  1ONV A;  2H94 A;  3WTT C;  2JT1 A;  4A0Y A;  1W7P B;  3DXJ F;  4PGG A;  1G6N A;  1G3S A;  4UHT A;  2GXG A;  2A5Y B;  2GIV A;  2ESH A;  2VOO A;  3DPT A;  4ZYG A;  1LJ9 A;  2EFO A;  5LEJ A;  2PMU A;  3M9A A;  1U8R A;  1KA8 A;  1BI1 A;  2K4B A;  2E1N A;  1KU7 A;  3HSR A;  4ENK A;  4FX4 A;  4A6E A;  4HA8 A;  2DW4 A;  4G6D A;  5J8C A;  4GGG A;  3VEP A;  3ZMV A;  2JSC A;  5KVR A;  3P9I A;  4UVB A;  4AIK A;  2KKO A;  3RPQ A;  3FX3 A;  1ZGJ A;  3ZP5 A;  2DTR A;  2YU3 A;  4A6D A;  1REP C;  5KK1 A;  3C18 A;  5ILS A;  1T6S A;  1U6G A;  3EYY A;  4L5J A;  4MEY F;  1I1G A; 
#chains in the Genus database with same CATH topology
 2BXZ A;  1P9Q C;  2L9S A;  3S14 J;  3ZMT A;  1B4A A;  2MAB A;  4OOI A;  1BW5 A;  2XDV A;  2L9V A;  4LLG F;  2JWT A;  4HDU A;  1LE8 A;  2DXI A;  1V5F A;  5M3F J;  4UUT A;  1A5J A;  4EM1 A;  1SD5 A;  2R7W A;  3CDL A;  4ZTF A;  4BE1 A;  3CUO A;  3L09 A;  1EH8 A;  2DI3 A;  3VB2 A;  4A5M A;  4EM0 B;  5LGU A;  3LAP A;  1W0U A;  2CG4 A;  4N4N B;  1BOA A;  1MJ9 A;  2XRO A;  1D8J A;  1YYV A;  5JLW A;  1W36 D;  5DYM A;  2ZJQ F;  3GTG J;  3A0B C;  4MTE A;  2EZK A;  3HYI A;  1IRG A;  2VPL A;  5IOY A;  3L2C A;  1J5Y A;  2GA2 A;  3SHF A;  3QYE A;  4C2T A;  1T56 A;  3P9C A;  3NWT A;  3ZMZ A;  1TL8 A;  3C2B A;  1FOK A;  2R4G A;  4CCM A;  1DU6 A;  1UCR A;  2M87 A;  1IN5 A;  3S32 A;  3JSO A;  3I64 A;  1Y39 A;  2JQ7 A;  1WJE A;  3BG5 A;  2KRH A;  2HQR A;  1IO2 A;  3MVP A;  2K3F A;  2MH9 A;  1WRJ A;  2QZ8 A;  3FBI B;  2X6W A;  3RSN A;  2L7Z A;  2ZSI B;  5HS7 A;  4M74 A;  4JYK A;  2XVC A;  1XPX A;  4PK4 A;  1LFB A;  2ZJR F;  5HVQ C;  4U0W A;  1JJ6 C;  1O3R A;  5M5W J;  4IQJ A;  1WCM J;  2QYO A;  1X3U A;  2VBX A;  2DOD A;  3LA3 A;  2KHM A;  2X9D A;  2F5C A;  2HPI A;  4YRV A;  2EIN H;  4DYC A;  2N8G A;  3G73 A;  4CYC A;  1VTN C;  2MD5 A;  3CJR B;  2HZD A;  2CH0 A;  4IF4 A;  3OYE A;  1S72 I;  1K4T A;  4KIC A;  1K78 A;  3CLO A;  2B7E A;  1FYM A;  1QZY A;  4F3Q A;  4HNT A;  2HS5 A;  1SFU A;  1TC3 C;  4AWX B;  1ZG1 A;  1POG A;  2VT2 A;  1VQK I;  3H92 A;  1WJF A;  1UST A;  3GTO J;  2COB A;  1T39 A;  5FKO A;  2ESN A;  2E1M B;  4II3 A;  2PJR B;  4KIT B;  2FJ1 A;  1R22 A;  1IN6 A;  1IDY A;  4RB0 A;  3TOB A;  2GAU A;  2DMT A;  1XCV A;  2A69 F;  1A31 A;  2DJI A;  3DF8 A;  2LMD A;  1ZQ3 P;  2OU2 A;  2OV7 A;  3Q0U A;  2RV8 A;  1B1B A;  2FD5 A;  1ZG3 A;  2G7H A;  4UV9 A;  1X19 A;  3WTZ A;  1YO5 C;  3A1Y A;  1B59 A;  3S93 A;  3DKX A;  1EKE A;  1SAU A;  1ZLK A;  4MIM A;  1YG2 A;  5DM7 F;  1T08 B;  1D0Z A;  4I7H A;  2WTE A;  1IUF A;  5CVU A;  5M5Y J;  1QNT A;  2F4I A;  1UHS A;  2DYR H;  5TGT A;  4Q47 A;  4CSW A;  1TWF J;  1YFH A;  2CGP A;  2XRN A;  2X0L A;  4P9U A;  1U5T A;  1QO0 D;  3ZCO A;  1CF7 B;  4UY8 I;  4N0B A;  4S05 A;  3S17 J;  4ANJ A;  5GTI C;  2QSF X;  2M8G X;  3RYP A;  3O2P E;  1IGN A;  2L2O A;  4BL0 B;  2P6S A;  2IPQ X;  4C2U A;  2RAE A;  2WY8 Q;  2QWW A;  3ZN1 A;  3ESW B;  1Z3X A;  3PNY A;  3RPU D;  1ZLJ A;  3MAJ A;  4IO9 F;  2DFE A;  3KE2 A;  2K9N A;  1C0W A;  2MBF A;  2OF7 A;  3EDP A;  3FK6 A;  3HSF A;  1VQ7 I;  3PJR A;  2HNH A;  5LD2 C;  3U21 A;  3NEU A;  4G12 A;  4YIR X;  2OQR A;  3FMQ A;  5HNF A;  1RKT A;  3BDD A;  3L2W A;  3TKY A;  3EUH C;  4QTR A;  2OJE D;  3AG1 H;  1FP2 A;  3DKY A;  2KQR A;  1BA5 A;  1OCC H;  3OWT A;  4CGZ A;  2V6E A;  2EV5 A;  4RM3 A;  4BE0 A;  3S1M J;  3HRU A;  4GXO A;  3KYD B;  2QF7 A;  4G6T B;  1LDK B;  2B63 J;  1LB2 A;  2NOG A;  1R6R A;  3P9K A;  5CQE A;  2MC4 A;  4XOR A;  4HPQ A;  1BC8 C;  3GLL A;  3Q0V A;  5EZH A;  4L9V A;  3GX4 X;  1P4A A;  5F0C A;  3W2V A;  3CO7 C;  3F3X A;  3HRT A;  2ZO4 A;  4DYQ A;  1YI2 I;  4HAM A;  1XSD A;  2EPF A;  2VC0 A;  3U2R A;  5E3N A;  1Z91 A;  2H09 A;  3K1N A;  3WHB A;  4IX7 A;  2VT3 A;  3PNV A;  2W85 A;  1OCT C;  3FMS A;  3LSK A;  2LOO A;  1YQA A;  4KIB A;  4B09 A;  3CCM I;  2HXI A;  4XRF A;  2XSD C;  1F36 A;  4FT8 A;  2Y0M A;  1IG7 A;  3Q0W A;  2ELH A;  2XAH A;  3GUD A;  2EQR A;  2UV1 A;  4BQA A;  2R7Q A;  4C9Y A;  4BGD A;  3DPU A;  4RM2 A;  2QUF A;  4Y15 A;  5EGO A;  3RI4 A;  2DMP A;  1H9G A;  1I39 A;  1OJL A;  1S8N A;  1PVE A;  2Z99 A;  4XOT A;  5IP7 J;  1T98 A;  4FTH A;  2E71 A;  4U7B A;  3FZV A;  2UXX A;  2V1D A;  2DK5 A;  1FZP B;  2AXT C;  2DOF A;  4EQQ A;  4F91 B;  3M1E A;  2H6B A;  1XSX A;  1WKM A;  1XMA A;  4U88 A;  2VQL A;  2GOM A;  3V8J A;  2LFB A;  5DD8 A;  2Y9Y A;  4KIS A;  4WK8 F;  2IBD A;  3TO7 A;  4RDU A;  2LP0 A;  3WTU C;  2ZFW A;  3BR5 A;  2L01 A;  3LOC A;  3KET A;  1MBF A;  2Q8K A;  2EK5 A;  2C6Y A;  4HX7 A;  4MFD A;  1D5Y A;  2F4O B;  5BPI A;  1RPW A;  2DMN A;  5LGT A;  1XN7 A;  3OL3 A;  3SFI A;  2DOE A;  4A0X A;  1JGS A;  1D8K A;  1TNS A;  4R79 A;  1H9T A;  1W36 C;  3HOZ J;  3PL8 A;  5HS8 A;  1TBX A;  4G7Z F;  1JKQ C;  3FF5 A;  4R1H A;  2AO9 A;  2HI3 A;  2Y9Z A;  2LR8 A;  1IN7 A;  2EFP A;  2GM4 A;  2ELK A;  3H35 A;  4RB2 C;  3MKZ A;  2GQQ A;  3BCB A;  3LSG A;  4CYD A;  5JR3 A;  3A2K A;  1GVD A;  4UVC A;  2ME0 A;  2R92 J;  1BIA A;  2FEZ A;  4LK0 F;  1RUN A;  2LLK A;  3JCU C;  1EH6 A;  3ABK H;  2XAQ A;  3DQV C;  3I56 I;  4U0V A;  4HQE A;  1OMI A;  3FHZ A;  4ZDO A;  1FMW A;  3QYF A;  1K6Y A;  2RN7 A;  3QOP A;  2VE9 A;  3MWM A;  1FYL A;  4XLH A;  5HOD A;  1G3T A;  4LMY A;  3GW2 A;  3LA2 A;  2DPD A;  3HL2 A;  4CDG A;  3LSI A;  3F22 A;  4AIJ A;  3OY9 A;  2RC4 A;  4WWC A;  3WTX C;  2FBI A;  1ACI A;  2CWE A;  2E1M C;  3L1P A;  3F8N A;  3GFM A;  3B02 A;  2DDB A;  1AA7 A;  2VXD A;  5EDN A;  2E1C A;  2P5K A;  4JBA A;  5HNH A;  1U8B A;  4N9I A;  2NXN B;  2OZ6 A;  2VB6 A;  3BT9 A;  1VQ5 I;  1GVJ A;  3BG7 A;  2YR2 A;  3K9T A;  5J40 A;  2CQN A;  3FIW A;  5KAF C;  1I50 J;  3T1B A;  5DUI A;  1ZEL A;  1QA6 A;  1FBQ A;  1TWA J;  1LQ1 A;  4I02 A;  3D5L A;  2F5V A;  3QPS A;  5JFR A;  2V9V A;  4V2F A;  1S29 A;  1JHF A;  3LNQ A;  5B1B H;  1YW8 A;  4EMS A;  1WJB A;  3ML6 A;  1J7K A;  3R6S A;  4NBQ A;  4HNV A;  1FT9 A;  1KGS A;  5CYV A;  2R3S A;  2VBY A;  3LWF A;  5LGN A;  3M4O J;  2Y2Z A;  3LQQ A;  1GT0 C;  3A02 A;  4YFN F;  1BIB A;  1H0M A;  2E34 A;  2NS0 A;  3G71 I;  1YJW I;  2DOA A;  5CQG A;  1K7A A;  2NS8 A;  3UNG C;  3JRI A;  4XR6 A;  1HKT A;  5D8K B;  1STZ A;  2JVH A;  4L18 B;  2YX4 A;  5AIP A;  4A3B J;  1ULY A;  2F6C A;  3M07 A;  3CF5 F;  3SFZ A;  4A3E J;  1AWC A;  4UUV A;  1ZRE A;  1UG2 A;  4PFP A;  2ZME B;  3H3Z A;  3EYI A;  2BEO A;  3BTI A;  1X1C A;  1XMX A;  2DA4 A;  3I58 A;  4KN4 X;  2FBH A;  3ZQL A;  5E20 A;  1XTA A;  4ZH4 F;  3FK7 A;  2WAQ N;  1FBU A;  5EG0 A;  2VI6 A;  2EJR A;  1OCZ H;  5IY5 H;  2P7C B;  3BZK A;  1F43 A;  4DGW B;  4XQF A;  2KZG A;  4ENN A;  3BPX A;  1IXS B;  3GTM J;  1RET A;  3L2R A;  3DBL B;  4EJU A;  3HTS B;  4DZJ A;  2XAJ A;  2OAZ A;  4IHT A;  3WE3 A;  3ABL H;  5E8G A;  1FY7 A;  2CW8 A;  1ETO A;  3ABU A;  1P6R A;  2HOE A;  2M3A A;  3AAF A;  3KP6 A;  2LRE A;  2WC2 A;  3TW6 A;  3CCR I;  4EV0 A;  4P55 A;  2DK8 A;  2XGC A;  2PQ8 A;  3O8H A;  5D8L B;  2R7U A;  3SZT A;  1AKH B;  3ZQQ A;  3F6V A;  4IEJ A;  4Z2Y A;  5HDG A;  2Z33 A;  4CCJ A;  4AM3 A;  1ETY A;  1TQP A;  2XAU A;  1QHG A;  2K86 A;  3SDB A;  2IA2 A;  1OKR A;  4HLX A;  5F1R A;  4RGR A;  1O3T A;  3H5N A;  3OYJ A;  2QSG X;  2GZW A;  3VYT B;  1ZHF A;  2B0L A;  1X1A A;  3CO6 C;  3HOS A;  2X4H A;  3KFW X;  4IRI A;  3WE2 A;  2XAG A;  2H8W A;  4HZF A;  4A3K J;  1RZ4 A;  4GO1 A;  1R4M B;  3S3N A;  3DBH B;  4DOZ A;  3CC4 I;  2M5W A;  1ETV A;  2LRD A;  4PFO A;  1V55 H;  4XLP F;  4XN3 A;  2MLG A;  2JA5 J;  3BR3 A;  2KMU A;  1UFM A;  2E7W A;  3K7A J;  3L00 A;  4KA4 A;  1GHC A;  3P7N A;  4JX5 A;  5EZG A;  3ZMD A;  4E7I A;  3KP2 A;  1JKP C;  3IP4 B;  2VLA A;  1DP3 A;  5FD6 A;  1JT6 A;  2H6C A;  2L4A A;  2X6X A;  1SEU A;  4IHX A;  2XB0 X;  5L3E A;  3SDG A;  4AD9 A;  5IYC J;  3RZO J;  4MLO A;  2LG4 A;  3FKJ A;  3H9Q A;  5CJ9 A;  3HJE A;  1H89 C;  2X1C A;  1IRF A;  3H3U A;  2DA5 A;  4NQW A;  5FLV A;  2GOX B;  1QPI A;  2IGO A;  2O03 A;  1D1A A;  2ISZ A;  3E6B A;  3LST A;  2Y69 H;  3PSF A;  4C3J J;  2P6T A;  3WGH A;  5JVT A;  2ZC2 A;  1ZRD A;  4XBF A;  2OBP A;  1O3Q A;  4A2U A;  3G2B A;  3PIP F;  2IS1 A;  1X1P A;  3ASN H;  3RCO A;  3HOV J;  4XK4 A;  3CMM A;  2W84 A;  1FOW A;  2XC7 A;  2OD5 A;  2CRG A;  5IYB J;  2HZT A;  2K85 A;  4EAT A;  5IP9 J;  2W48 A;  3LSR A;  1K61 A;  3I9V 2;  3K10 A;  4B8X A;  1LKX A;  2ICW G;  3RDI A;  3HRM A;  2WV1 A;  2Z1D A;  5H20 A;  4FQG A;  5D6F A;  4E7S A;  1ZH5 A;  4HLY A;  2Q0O A;  5DEQ A;  3I54 A;  5FD5 A;  4EVI A;  2X6Y A;  4RB3 C;  4J19 A;  2EIM H;  4G8X A;  5GPC A;  2O6G E;  3H36 A;  1LUJ B;  4UUS B;  3IV5 A;  1DQU A;  1DPU A;  3BTC A;  4U0Y A;  3R61 A;  4XRS G;  2QM3 A;  2X51 A;  1ITY A;  3CP8 A;  1MBH A;  3HBL A;  5JI6 A;  4Q4Z F;  3MQ0 A;  1FNN A;  1HQC A;  2JN6 A;  4A69 C;  4DBQ A;  3K2A A;  1TW3 A;  2HEO A;  1F9N A;  3JW4 A;  1ERD A;  2H27 A;  3EUK L;  1BR4 A;  4BDY A;  2RKH A;  3QOE A;  4G6Q A;  5DS9 A;  3OYN A;  3ZPL A;  4RLF A;  2DAO A;  3AKZ A;  4OAZ A;  1R49 A;  3TGN A;  5K5Q A;  2HQA A;  3S15 J;  5B66 C;  2DA3 A;  5LHG A;  3D5S C;  4FE7 A;  4Y7N J;  2O61 A;  2ZJ2 A;  5DD4 A;  3PIO F;  1NHA A;  3LSJ A;  4H4K C;  1R9T J;  1M1E B;  1EA3 A;  2QA4 I;  1J59 A;  5LFA A;  1TLH B;  2XGD A;  3T8R A;  4JX6 A;  2E2J J;  1JHH A;  1X2M A;  4NC8 A;  5E3L A;  1V5G A;  2JUC A;  2KIF A;  2VJ4 A;  5AON A;  3PUB A;  3ISP A;  1R36 A;  4DYR A;  1QHH D;  2R0Q C;  4LIT A;  2ZXW H;  3T5X A;  1R1U A;  2NOJ B;  1LEB A;  3K70 C;  2XKO A;  1BW6 A;  3U1D A;  2VBZ A;  4OMZ A;  5J6X A;  4IKF A;  2L7M P;  1RKW A;  2EWN A;  3F23 A;  3PUF A;  3QU3 A;  2HKO A;  1MBG A;  1H88 C;  3AL0 B;  3O6B B;  1JUS A;  3CQZ J;  1UZC A;  4PSW A;  2IRF G;  5FRN A;  3E97 A;  2IXS A;  4L5I A;  3DU6 A;  3FXK A;  2FOW A;  1K78 B;  3E0J B;  2KRF A;  4AIH A;  1QPM A;  2I5U A;  1RIO H;  3M8F A;  2EIJ H;  4BHC A;  3ZQC A;  1SD6 A;  4Q5S F;  2E2I J;  1MD0 A;  1VQ6 I;  2CUF A;  2NVX J;  2XHK A;  1I1S A;  4F52 A;  2DT7 B;  3N05 A;  1W5S A;  3I4N J;  3K4C A;  2AS5 F;  4ON0 A;  4PJJ A;  1UB9 A;  2HR3 A;  2X48 A;  2W7N A;  2PJR A;  5IT9 K;  5IT9 Z;  4RGS A;  5F1J A;  1HKS A;  1I5Z A;  3CDI A;  2WWY A;  4D5F A;  2NAZ A;  2DBB A;  3HB9 A;  4WXD A;  1N77 A;  3QU6 A;  3C2H A;  2CV2 A;  2JA2 A;  3TL4 X;  1BJZ A;  2EZL A;  2H1L A;  4XRM A;  2R7D A;  4CXF A;  3K69 A;  2OCC H;  3LMM A;  3O3K A;  2VQC A;  1RI7 A;  1S9H A;  3D5R C;  4RBO A;  4EGY A;  1LFU P;  1S7A A;  4YEJ A;  4HBL A;  3C2G A;  4EJW A;  3CMA I;  2DA6 A;  1QZE A;  3RJP A;  2XGX A;  2IEK A;  2P8T A;  4IL6 C;  1MNE A;  4TV7 A;  2IGK A;  2BVM A;  1B8I A;  2STW A;  2BY1 A;  1D5V A;  1FOX A;  1IV6 A;  3SZG A;  2LBF B;  2ZCW A;  4FE4 A;  2XAF A;  2ZBK A;  2WA0 A;  1Z21 A;  2LYC A;  3UKG A;  2LSO A;  3GTJ J;  3B6C A;  4XKC A;  3Q5F A;  4IJA A;  1T0F A;  3J81 K;  3J81 Z;  1Y1W J;  1Y56 A;  2TRT A;  4F92 B;  3S16 J;  3MEX A;  1HKQ A;  4ZYD A;  2HFH A;  1T95 A;  1TTY A;  3BG6 A;  2BYV E;  1APL C;  4RB1 A;  4BY7 J;  2VON A;  3A01 B;  3W2A A;  2YUS A;  3ABM H;  4A3F J;  1OQY A;  4A3J J;  5H2F C;  4I2O A;  1N75 A;  3VWB A;  2A68 F;  2M2E A;  3O8G A;  2WB1 A;  3C7J A;  1WJA A;  5DTD A;  1BN5 A;  3EQL F;  4XLA A;  1U9N A;  1DP7 P;  3BWG A;  3QP6 A;  5DCM B;  2VKH A;  1OYW A;  4PZJ A;  1V3F A;  3IH2 A;  2BGC A;  1I6H J;  4HOB A;  4OMY A;  2EFN A;  2Y48 A;  2RQP A;  3OYD A;  3IUO A;  1ZGA A;  4YII A;  5J1Y A;  1HLV A;  3FXJ A;  3BLY A;  4ABZ A;  3A4C A;  2LTP A;  4AYB A;  1A35 A;  3HOW J;  4IXA A;  2VOD A;  4H0E A;  1G4D A;  2GIZ A;  3V7S A;  2BY3 A;  5HLG A;  2BHY A;  3HUG A;  1YLF A;  4AU7 A;  2R7S A;  2DFI A;  5L3G A;  5LHI A;  1S7O A;  1FJL A;  2K5C A;  2XSJ C;  3V7R A;  5B3S H;  1JJ8 C;  1MDM A;  3MFK A;  2GWR A;  4PSX A;  2V9P A;  4YFK F;  3F21 A;  3F8M A;  4ESB A;  5H6R A;  4M3B A;  1NH3 A;  1GV5 A;  3ROU A;  1P7J A;  2CW7 A;  3GCM A;  3D1N I;  4KUM A;  2FBK A;  4Z6Y A;  4MHG A;  2DQR A;  4RAG A;  5KNL A;  4J00 A;  4IRH A;  3HTU A;  3L2V A;  2G9W A;  2HU9 A;  3IWZ A;  1IAW A;  1YRN B;  5DDG A;  2R7F A;  5TRD A;  2O7O A;  2JA7 J;  3E6M A;  2LVS A;  3QOD A;  2FF4 A;  3SZP A;  1KZH A;  1IN4 A;  2YSR A;  1OR7 C;  3MKY B;  1YOV B;  4NC7 A;  1RR8 C;  1UG0 A;  1SVM A;  3FXR A;  3JR9 A;  1MMD A;  3GTQ J;  2QBY B;  4KMF A;  3KZZ A;  2EZH A;  3FWE A;  1LE8 B;  4CIC A;  5IOZ A;  5K5R A;  3OS1 A;  5EF6 A;  1A04 A;  2V9K A;  1KQ9 A;  2VQG A;  4S0H B;  3CMY A;  3GWZ A;  1OR7 A;  3HDD A;  4B43 A;  2XF6 A;  1FPQ A;  3W6K B;  1TT5 B;  2ZNY A;  1QVU A;  1FP1 D;  1X3W B;  2ID6 A;  3OIQ A;  3ASO H;  5F04 A;  1KU9 A;  2ZFU A;  1G3W A;  1X1B A;  1OYI A;  5D4S A;  2QVO A;  2UXN A;  4XMY A;  2NNY A;  1R1T A;  3NWS A;  3L7W A;  4WXC A;  2LF8 A;  4KYW A;  4ZZL A;  3DLA A;  3W2W A;  1T33 A;  3OOP A;  5FB2 A;  1FTZ A;  1XX5 A;  3EET A;  5JHF A;  3FXL A;  1E17 A;  3L9F A;  3I4P A;  1E0E A;  1G2H A;  3KEQ A;  1N25 A;  3EUA A;  2E5N A;  5J47 A;  2ZXI A;  2HWV A;  1ZAR A;  5JVG F;  1R4N B;  2LY2 A;  4IQ4 A;  3QRF F;  1DPR A;  1R1V A;  2CS3 A;  3MZY A;  1ZR2 A;  4NNJ A;  2XPU A;  1O4X A;  4GCV A;  1V54 H;  4LIU A;  3HOX J;  4KIF A;  1YW7 A;  5E3O A;  1XCB A;  2ID3 A;  2GBY A;  1Z6R A;  4HX8 A;  1SD4 A;  4GRI A;  2HOT A;  1KON A;  4WX9 A;  5JHU A;  4XKB A;  3TDU C;  3BTJ A;  3GFL A;  2FXA A;  2AHQ A;  1YIT I;  2EV0 A;  4HV6 A;  1QQI A;  1YX3 A;  3QPL A;  3LFU A;  4LB6 B;  2W25 A;  4NUB A;  1OLT A;  2V4J C;  1FIP A;  3FBN B;  3GEZ A;  1E3P A;  5J4Y A;  4ZTJ A;  4A3M J;  3FXU A;  2ISY A;  5EG0 B;  1FWZ A;  1GLN A;  1LVA A;  3KEO A;  2ZME A;  3ECH A;  1JXS A;  3K4L A;  1T8I A;  2KZV A;  1LPQ A;  2EA4 A;  2FUG 2;  2ZXJ A;  4IOC F;  2XF5 A;  2STT A;  3WTY C;  1BI0 A;  3HHH A;  3MD2 A;  1R71 A;  2JK3 A;  5IYD J;  4K2E A;  3WU0 A;  5CVI A;  2KT0 A;  3R60 A;  4A3I J;  5FO5 A;  4ZYA A;  1O7L A;  3HGG A;  3E6D A;  1MW7 A;  3E6C C;  2FML A;  2WAE A;  2CV0 A;  1B8I B;  4HV5 A;  1K4S A;  2HDD A;  3OYL A;  2P5V A;  2QCO A;  4RMN A;  3DTK A;  4LFU A;  3OR1 C;  2E60 A;  2Q2E A;  4MTD A;  4G9Y A;  4ETS A;  4DQ2 A;  4LK1 F;  5IPA A;  2WAD A;  3KYL A;  1MMN A;  4BXF A;  1N78 A;  4HRI A;  3KEY A;  4OAY A;  1J0R A;  2W00 A;  5CVV A;  1I27 A;  3H9J A;  1IUY A;  3HKZ A;  3OSF A;  2Y31 A;  1HOM A;  2HVS A;  3OYM A;  3REO A;  2WBM A;  1Q1V A;  2GLO A;  4PGH A;  2PI0 A;  2L9N A;  2QLZ A;  2VKV A;  4LIV A;  4KDP A;  2JVG A;  3H5R A;  5D4R A;  1HBX G;  3HZJ A;  3DEE A;  3HXL A;  4XSX F;  4A0Z A;  2HYF A;  1PP7 U;  2PMZ N;  3TOA A;  3JTG A;  1R5I D;  2DTZ A;  4CO8 A;  3FDY A;  3M8J A;  2W4S A;  2R7T A;  4IPA A;  3MZ8 A;  3ECO A;  3BZ6 A;  1BOB A;  2EFQ A;  2OUM A;  1Z77 A;  5DCF A;  2IA0 A;  4KNY A;  2IW5 A;  2JTV A;  4BDZ A;  2KL4 A;  1SFX A;  2CO5 A;  4AID A;  3IKV A;  4ZYH A;  3OS2 A;  2E2H J;  1Y0N A;  2DFH A;  2XKP A;  4I0B A;  4W97 A;  4BQQ A;  3DLL F;  2WV0 A;  1U9O A;  4A3D J;  2L02 A;  2VE8 A;  4Q48 A;  1KU3 A;  4O6J A;  5EJC A;  2GXB A;  3OOU A;  1YX5 A;  2W82 A;  4HQM A;  2UWM A;  1D1B A;  2NVT J;  1FIA A;  2QKL B;  3ZN0 A;  3JSP A;  2O8X A;  4EJO A;  2XGE A;  5ICF A;  4KJZ A;  2I8D A;  1E3H A;  4BH9 A;  3GME A;  2K9S A;  2V6C A;  2IAI A;  4Y13 A;  4BKX A;  4GYG A;  5TIS C;  1YRN A;  2DDA A;  3LQR A;  1IW7 F;  3RKW A;  4XKW A;  5J3L A;  4A3G J;  2MGQ A;  2IA1 A;  2F5E A;  2KIM A;  2MFZ A;  1DUX C;  4LJZ F;  1ZTR A;  4XNF A;  5H6Q A;  2ELJ A;  2JZY A;  3MCZ A;  1Z3Y A;  3PM1 A;  2RDP A;  2D2W A;  3DCF A;  4DIQ A;  4E70 A;  2DMQ A;  1D3Y A;  4LG0 A;  3I71 A;  4XLN F;  1O57 A;  1RC9 A;  2RVC A;  4E4H A;  2BBY A;  2ECC A;  4F93 B;  3RTR A;  3E5Q A;  2Q1Z B;  3CC7 I;  4NQW B;  3LL7 A;  3NAR A;  4KFC A;  1FEX A;  2IS2 A;  1SVO A;  1RES A;  5GAE J;  1YTY A;  5GTH C;  2R7O A;  2MH2 A;  5HLH A;  3FIS A;  3NQO A;  1MBE A;  3ZQF A;  2MW8 A;  1ZR4 A;  2JPC A;  1K6O A;  2DPU A;  2LH9 A;  4GFB A;  3LA7 A;  5LBQ A;  2PG4 A;  2PLY A;  2F2E A;  3I5U A;  1W1W E;  2BY0 A;  3TBI A;  1J2X A;  1PUF B;  1EH7 A;  4DNC A;  3S2D J;  3RKY A;  4D5C A;  2L4M A;  3BR0 A;  4B47 A;  2YS9 A;  2E1O A;  3MN2 A;  2FU4 A;  3RPU A;  1XB4 A;  3E5X A;  3F9K A;  4B3X A;  3H9G A;  1U0J A;  2FQ4 A;  3PQJ A;  2HGC A;  3COA C;  2LC2 A;  1A6I A;  2VOP A;  1P2F A;  4CHU A;  1XGN A;  5F27 A;  2L3D A;  2M34 A;  3CUQ C;  1BI3 A;  2PJP A;  1ZAO A;  1X4P A;  4BHB A;  3WHC A;  2RRE A;  3G1L A;  2IP2 A;  3TW7 A;  2FNP A;  2VJJ A;  3TMO A;  3I53 A;  1W7P A;  4HSR A;  2CUJ A;  1FMV A;  3L2U A;  3WTW C;  4AYB N;  2LD5 A;  1GUU A;  1LNW A;  1O3S A;  2R5Y B;  2A6T A;  2MLK A;  5F64 A;  2ZSH B;  3RKX A;  3NAU A;  2HYJ A;  2LBF A;  4N4O B;  3N97 A;  2BOL A;  4BHP A;  1SFO J;  3WGI A;  1ON1 A;  3GLX A;  2M4K A;  4IZZ A;  5D5V B;  1FSE A;  2R7R A;  5FGM A;  1YW9 A;  1EF4 A;  1Z05 A;  1GXQ A;  2QGU A;  2K27 A;  1NG7 A;  2CJJ A;  1MH3 A;  1WH7 A;  1DDN A;  1Y0U A;  2ZKZ A;  3HEF A;  3JRG A;  3RQ4 A;  4IHV A;  3Q9V A;  1S6L A;  2Z5U A;  4BXX J;  5HS9 A;  1S5L C;  4BEH A;  1IJW C;  2KPM A;  3H0G J;  3K4J A;  3I59 A;  3K70 D;  3PSI A;  3SEZ A;  4QIW N;  1ZRF A;  1W0T A;  1F5T A;  5CKT A;  3ZMU A;  4U7D A;  1ON2 A;  4CCL A;  1W5T A;  4GYI A;  2IVM A;  3GTP J;  3LSH A;  3BG9 A;  2NYX A;  2CFX A;  1YS6 A;  1FYK A;  2DCE A;  2HKX A;  5E1W A;  1ETX A;  3J7A Y;  3JTH A;  4P5O A;  4XON A;  4I0A A;  5GAD J;  2GA1 A;  1XD7 A;  4ZC3 A;  2P81 A;  4Y4R A;  1LDD A;  2JSP A;  1GV2 A;  5HDK A;  3JRE A;  4L9T A;  2PX9 A;  4YG2 F;  4P1W A;  3Q3S A;  3LSP A;  4BQN A;  2CUE A;  4FET A;  3VSK A;  3EPZ A;  4EM2 A;  5E79 C;  3OYG A;  1D1C A;  3TQN A;  3DKW A;  5AIQ A;  5LRR A;  3QYB A;  4WF2 A;  1LEA A;  3IAM 2;  3OR2 C;  1MSE C;  3PO2 J;  4JOM A;  2BZT A;  2VKD A;  2LKS A;  3HG9 A;  4WXH A;  4CCK A;  2KIS A;  3DWL E;  4YFX F;  4LB5 A;  5C44 J;  4A3C J;  3GBG A;  4UXN A;  5FKN A;  1CQT A;  3NRV A;  1JI8 A;  2FX0 A;  2O8K A;  3MKW B;  2NS7 A;  3OL4 A;  1FSH A;  5FLX Z;  3IL2 A;  5FLX K;  1QVT A;  2CW0 F;  1XMK A;  4IVN A;  4NDL A;  5GAG J;  3KPH A;  2QBY A;  2ZME C;  3BRO A;  3LSM A;  2M30 A;  4IHY A;  2CV1 A;  1VF9 A;  1R5G A;  3TO6 A;  1Y8Q B;  4II2 A;  1MNM C;  3J7Y J;  5FFZ A;  1TW2 A;  3E5U A;  2J5P A;  3GF2 A;  1WI9 A;  2CQ7 A;  1UEL B;  2B9S A;  3IRR A;  1B72 B;  1MMS A;  3SXY A;  4M9X A;  1JGG A;  4BBS J;  1MH4 A;  3M3Y J;  2HVR A;  1DGW Y;  5FRO A;  4RAY A;  3V42 A;  3BZC A;  1AKH A;  2KLO A;  1VND A;  3AL0 C;  3ZGK A;  3QQA A;  3OYB A;  1W4M A;  1WJC A;  3ZQ7 A;  1H8A C;  3SQN A;  3PFI A;  3IRQ A;  3HUG B;  1ETK A;  3J80 K;  3J80 Z;  1ODD A;  4HF1 A;  3RQI A;  1HSJ A;  4YEL A;  2FRH A;  3BP8 A;  3AG3 H;  2J5O A;  3RIR A;  5L3D A;  4BYY A;  1MJA A;  4Y33 A;  3SEQ A;  4L0Z B;  4E6K G;  4EGZ A;  4A93 J;  5F08 A;  2DFF A;  3ZMS A;  1X1D A;  2A61 A;  4AC0 A;  2V26 A;  1SVL A;  2PBI A;  4FIS A;  3CCV I;  1HW5 A;  2LK2 A;  3KZI C;  2LF7 A;  1NG6 A;  3GVA A;  3CJT B;  3WTS C;  3OIP A;  2DA2 A;  2R7V A;  1IXC A;  2VBW A;  3SJM A;  1R00 A;  2K02 A;  5DCM A;  2KDO A;  5HOO A;  2BW3 A;  2M0M A;  3OYH A;  3IH4 A;  3R0J A;  4QPQ A;  4RLQ A;  5F0H A;  2WAF A;  2PN6 A;  4ENJ A;  3HOU J;  1ZK8 A;  4I98 B;  1JTY A;  4BUP A;  5HLT A;  3CP2 A;  1Z0X A;  4PDK A;  2CYY A;  1SMY F;  2L9R A;  1BM9 A;  1ENH A;  4UB8 C;  4I6Z A;  3OS0 A;  1ZG5 A;  5E17 F;  1U2W A;  4L9N A;  5DM6 F;  4BBR J;  1WJ5 A;  4RGX A;  2L7K A;  3F0C A;  5F6F A;  4BJT A;  1JE8 A;  2R7X A;  2NVQ J;  2XF7 A;  3FMR A;  4ZJZ A;  4D7M A;  3IHU A;  5ICG A;  4QSH A;  5B1A H;  1HC8 A;  2E35 A;  3BOQ A;  2ME6 A;  2BVL A;  3F8F A;  3DU5 A;  3R4K A;  5J1U A;  2BXY A;  2QEN A;  4M72 A;  4PUS A;  1U78 A;  4V19 K;  2A07 F;  2ZB9 A;  3K1P A;  2LDU A;  2D1H A;  4PJ0 C;  1LDJ A;  4MO7 A;  1J09 A;  1A6Q A;  1FC3 A;  1E3O C;  1JT0 A;  3FHN A;  2A6H F;  1UJ8 A;  4KT5 C;  2CQK A;  2CUZ A;  3HRS A;  5DUK A;  1Z6T A;  3CJN A;  1QRY A;  5GAH J;  4YIF A;  1SFK A;  2XAS A;  1VQ4 I;  1MBJ A;  3C1D A;  2QQB A;  1SMT A;  4M73 A;  4CZC A;  3FKI J;  1OCO H;  3OYC A;  2VAS A;  3V7C A;  1JUP A;  5K7F A;  1XG1 A;  1YIO A;  2EIL H;  4A3L J;  2NRA C;  1YJN I;  1SFE A;  4O3M A;  2K7L A;  2JMW A;  2OPT A;  1BC7 C;  2HYG D;  3BJA A;  3HC7 A;  4MGR A;  2HDW A;  1EV7 A;  2OQG A;  1K79 A;  2HPM A;  5LRS A;  2YU9 J;  2WY7 Q;  2EH3 A;  2K4J A;  2EV6 A;  3UR3 C;  2DLL A;  3F8B A;  3PNT A;  3IC7 A;  2UZK A;  1OCP A;  5B5E C;  5J4V A;  4BNC A;  2M0C A;  3U9G A;  2W24 A;  3BR6 A;  4I76 A;  2ETH A;  2Q2E B;  3GZ5 A;  1ZN2 A;  2UUZ A;  1P4X A;  1G3Y A;  3CCU I;  2KJB A;  1JUM A;  3K2Z A;  5J8F A;  2PEX A;  3BCA A;  4IHS A;  1IZ1 A;  5ED4 A;  2KFD A;  4LLL A;  4Y52 J;  3KP4 A;  3Q9S A;  4JX4 A;  4BQO A;  3C3W A;  1YS7 A;  3HKZ N;  4ESF A;  5GPA A;  1HDP A;  3GO5 A;  4UVA A;  2G0E A;  4BY1 J;  2IGN A;  1IRZ A;  4WCG A;  4F55 A;  3DPL C;  2HOS A;  1XGO A;  1F1Z A;  2BV6 A;  1X58 A;  2F5F A;  3TDZ C;  2F4M B;  2TCT A;  3VOD A;  4F7Z A;  5BQT A;  4CA0 A;  2CFO A;  4R8H A;  4M9S A;  2BW3 B;  1GDT A;  1TQI A;  4JK1 X;  1TNT A;  4FHT A;  3VYS B;  1MBK A;  1QGP A;  4B48 A;  4G7O F;  2Z2S B;  2CQQ A;  3BQZ A;  2VXZ A;  2IGM A;  3ULQ B;  1SAX A;  3K4M A;  2LNB A;  5LLQ A;  2JA6 J;  3H1C A;  3JRA A;  5JLX A;  1O7F A;  2O9L A;  2ACJ A;  4PJM A;  3MMY B;  1HXD A;  5GP9 A;  3DFG A;  4AVZ A;  1XSV A;  4D0P A;  2MA3 A;  2OA4 A;  1VQM I;  3G3Z A;  1IN8 A;  5E8I A;  1G59 A;  4NC6 A;  4XIC A;  5ICE A;  5TJJ A;  3W3C A;  4S04 A;  1HW1 A;  5L3F A;  1J75 A;  2OTJ I;  4G7H F;  2QQA A;  3EUH A;  3KLN A;  3RZD J;  1G8X A;  4DBR A;  2Y0S A;  1R5H A;  3P5J A;  4U87 A;  1TZL A;  5FRM A;  4LGW A;  4XLE A;  3JRF A;  3WOD F;  3BG3 A;  5CVJ A;  3S1N J;  2YPR A;  3IKT A;  1Z1D A;  2M45 A;  1VQO I;  1UHM A;  1U3E M;  2HQ5 A;  4B4C A;  4M6X A;  2KP6 A;  5BS6 A;  5EGO B;  2PMH A;  4XLF A;  2VQH A;  2FA5 A;  4RS8 A;  3I4M J;  4AUX A;  1JKR C;  4XN0 A;  3G1O A;  3CD6 I;  2MG4 A;  2MYS A;  2ZXH A;  4UV8 A;  1IXR C;  2FE3 A;  1HW2 A;  2KIU A;  2O5R A;  1KQ0 A;  1XDU A;  2XV4 S;  2R5Z A;  5EEH A;  3JRD A;  3M7G A;  1WPK A;  1PJR A;  2H8R A;  4E7H A;  3K4K A;  3TO9 A;  1Y8R B;  3VSL A;  1E2X A;  2DT6 A;  4KN7 X;  4LD5 A;  1I6X A;  3CLQ A;  1RR7 A;  5C3E J;  2KJC A;  1J9I A;  3ELK A;  3GYH X;  3WU1 B;  2Z9O A;  2RNG A;  3WTV C;  4JQF A;  3CCY A;  3S3M A;  1GXP A;  1SD7 A;  1KQ8 A;  3BJO A;  3J7Z I;  4Y17 A;  2LKP A;  2RGV A;  3W6J B;  1ZGW A;  3SYT A;  5EEA A;  3ONQ A;  3A0H C;  3K6G A;  4BJ5 C;  2V1U A;  2I10 A;  4LOC A;  5FLM J;  5BPD A;  2K9L A;  1B9N A;  5A2Q Z;  5A2Q K;  5K1Y A;  4M71 A;  4HX4 A;  1TWH J;  1S3J A;  3ERM A;  3N4M A;  4HDV A;  3KIO A;  1Y1V J;  1W5C C;  2XUB A;  1MDM B;  3ZQI A;  2NNN A;  2O3F A;  4UB6 C;  5D6E A;  5ICC A;  2M9H A;  3V8L A;  4J01 A;  3CJQ B;  1XS9 A;  4RA2 A;  4KIG A;  2ZNZ A;  3K0L A;  3T8T A;  2A6E F;  1MJB A;  1IRX A;  2A5W A;  3LFK A;  3FXQ A;  5EEG A;  5D5U B;  3BTL A;  4B44 A;  1R23 A;  2DMU A;  2OTL I;  3FXO A;  5HLI A;  3GTK J;  1HCR A;  2AQE A;  1RRJ A;  2DJN A;  1T38 A;  1DU0 A;  2IS4 A;  4HW0 A;  2AXL A;  1VQL I;  3DEW A;  2D45 A;  2Z3Y A;  4ESJ A;  2BE5 F;  1PUF A;  3G6E I;  3TED A;  4CZZ A;  1RNL A;  2V1X A;  5ILV A;  1BI2 A;  1S7E A;  3KZY A;  2DA7 A;  4XL9 A;  1VFC A;  1VQP I;  3BR1 A;  5BOX A;  2COM A;  3BY6 A;  1X4O A;  3KP7 A;  3HGY A;  2L54 A;  1YE9 A;  2BHZ A;  3ZRG A;  2G7U A;  3CME I;  3OSG A;  3JAM Z;  3JAM K;  3V4G A;  5E18 F;  4FCY A;  1WI3 A;  3BR2 A;  4E7Z A;  3TP3 A;  4HEA 2;  1B9M A;  4CH7 A;  5FKM A;  2DN0 A;  1P7I A;  1AHD P;  3F72 A;  3GZ6 A;  1Z67 A;  2HVQ A;  5ERI A;  3WU2 C;  1LFP A;  2P0W A;  3I0T A;  4L9J A;  5F0F A;  5ILU A;  2QQ9 A;  3J7A O;  2P7V B;  2HQN A;  3W6V A;  1OYY A;  4A12 A;  3F6O A;  1ZKG A;  1R58 A;  3K4B A;  4HG2 A;  1Z9C A;  1B6A A;  2Z16 A;  4DZP A;  5L3C A;  4DJA A;  1L3L A;  3BPV A;  2M1B A;  5D5W B;  4HF2 A;  3S1Q J;  3QAH A;  4O5V A;  2JPB A;  2XIG A;  4P96 A;  5FFX A;  5K5O A;  1JKO C;  2IT0 A;  2X1D A;  2JRT A;  4NB5 A;  2DO7 A;  1W7P D;  2XRL A;  3VYR B;  4C2M J;  3WG7 H;  3OV8 A;  2LY9 A;  2HDC A;  4BEH B;  3G4S I;  3S1R J;  2AQF A;  2BY2 A;  1BL0 A;  1VQ9 I;  1BR1 A;  3CF2 A;  4M9Z A;  3ZQH A;  3ZR8 X;  4N9H A;  1FTT A;  1WJD A;  4A5N A;  3KX2 A;  1RUO A;  4XSZ F;  6PAX A;  4CCN A;  4KT6 A;  4G94 A;  4HYE A;  3WGG A;  3GZN B;  1EJ9 A;  4KMU X;  2W1O A;  4M3D A;  2FSW A;  1CGP A;  3HOT A;  4EJV A;  3OYK A;  2YX7 A;  4OWR B;  2EFW A;  4W1U A;  2KRC A;  2VUM J;  2X6O A;  5CLS A;  4IRG A;  2M7A A;  5L3B A;  1I3A A;  1FBS A;  2OC6 A;  4X0G A;  3JRC A;  2K9M A;  4ENM A;  3V8K A;  1VQ8 I;  4OIR F;  2VN2 A;  1OFC X;  1AOY A;  4L0Y B;  2WB1 N;  4IOA F;  5EYR A;  3CC2 I;  1MMG A;  1T2K A;  2Y30 A;  1U5T B;  3M8E A;  5M5X J;  3ERE D;  1CF7 A;  2HTS A;  2RQQ A;  4ASN A;  2XPW A;  2QQ8 A;  1XDS A;  1WHU A;  3RYR A;  1NK2 P;  2FQ3 A;  4M6V A;  5C4J J;  5KCM A;  5K7H A;  2ADU A;  2KIQ A;  5E1X A;  3FM5 A;  2Y75 A;  4MFE A;  2OZU A;  5LHH A;  1YJ9 I;  3CCQ I;  1YIJ I;  3KP3 A;  3PQK A;  3X2Q H;  1OIS A;  3GXO A;  2EBI A;  4BAY A;  2X85 A;  2F5D A;  4B1R A;  1LVK A;  4PJL A;  2FMY A;  3DBR B;  2CSO A;  3BJ6 A;  3HSE A;  3CCJ I;  4OIQ F;  3PFY A;  5E1Z B;  3IWF A;  1P4W A;  3HM5 A;  2VJ5 A;  1ZYR F;  3GTL J;  3QPH A;  2DQL A;  3B6A A;  3KLO A;  4E7J A;  2V7F A;  3G1M A;  1B72 A;  3MZH A;  1WFX A;  1PDN C;  3BC8 A;  3H3V K;  5FJ8 J;  2KDZ A;  4B3A A;  3KYC B;  1P92 A;  2MC3 A;  4XRS A;  4JP0 A;  2O0Y A;  1VI0 A;  1WSU A;  3CCE I;  1BBY A;  1WVR A;  2K40 A;  3T0Y A;  1FOY A;  2A3S A;  3CZ6 A;  5FKK A;  3CUQ A;  4XKV A;  4ZZD A;  3CCS I;  3K1M A;  5IT3 A;  1IF1 A;  1SAN A;  3HPH A;  1NK3 P;  1KYW A;  2MSY A;  4XID A;  3JRH A;  3S8P A;  5IP6 A;  1XGM A;  3OYI A;  4M3E A;  3E1S A;  2QKM B;  4BJ6 C;  4CUG A;  5BMZ A;  4C30 A;  5FKL A;  1YHQ I;  3HPG A;  4I09 A;  4AVP A;  4BU2 A;  5J1R A;  1AU7 A;  3KP5 A;  4C3H J;  1Z7L A;  2NVU B;  2X1E A;  4XOP A;  4RAF A;  1ZRC A;  2VPR A;  1UMQ A;  2DU9 A;  4MNU A;  2H1K A;  1D0Y A;  4GDF A;  2TDX A;  3RKQ A;  4D1Q A;  3K4N A;  3U1K A;  1IC8 A;  4BS9 A;  4ZDL A;  1HST A;  3CES A;  3HHG A;  3CDH A;  2LKX A;  4ZYE A;  2EA2 A;  1TQM A;  3OMY A;  1A36 A;  4HF0 A;  4Y3O A;  1QZZ A;  2ECB A;  4NHJ A;  2LY1 A;  4OIP F;  2R7Z J;  3IH3 A;  2PFB A;  3FM3 A;  2RNJ A;  3OIO A;  3DP7 A;  4M6Y A;  2EB7 A;  3S3O A;  2FOK A;  1X3Z B;  2XPV A;  1XC5 A;  1KU2 A;  4M3F A;  3CTA A;  3MKL A;  2E36 A;  3QPT A;  1IV8 A;  2P5L C;  2CMP A;  1TP4 A;  1QU3 A;  1XGS A;  3CCL I;  1MZB A;  1TT0 A;  4MQ9 F;  5CVR A;  2FNA A;  2L7F P;  4RAZ A;  1FLI A;  4C3I J;  1V4R A;  2DT5 A;  3TP0 A;  4PCQ A;  4E7L A;  2EZI A;  3HIF A;  4OIN F;  2D1V A;  1WGX A;  2CU7 A;  1WQ2 A;  3QP5 A;  3DTE A;  4EEF G;  1PUE E;  4PJN A;  2VJI A;  1ETQ A;  3VFZ A;  9ANT A;  1D0X A;  1DGR M;  1Y6I A;  1QBJ A;  1FX7 A;  4QPO A;  2V79 A;  3AFH A;  1V5E A;  5BNG A;  4OIO F;  1WZ2 A;  3WG9 A;  2DA1 A;  4EJT A;  4FX0 A;  1MND A;  5D5X B;  1F4K A;  4V2G A;  2E7X A;  4OU0 A;  3PO3 J;  3JRB A;  1OPC A;  4LLN A;  3A01 A;  1ETW A;  3LAJ A;  3D0S A;  2HOA A;  3S2W A;  1WWX A;  4MQV A;  3QWL A;  3ABT A;  3VOE A;  3GFI A;  2Y0S N;  1MGT A;  5KAI C;  2R5Y A;  1Q1H A;  4LG0 B;  5M3M J;  3GFJ A;  1BJA A;  3F8C A;  1KYZ A;  4LG3 A;  4CYC B;  1Z7U A;  3KCC A;  5CPR B;  1WH5 A;  1USS A;  3R0A A;  5LEK A;  2NVY J;  1UAA A;  1L0O C;  3DTI A;  4QLC U;  3E7L A;  4I01 A;  4MEX F;  2P4W A;  2CQX A;  5C4X J;  3DV8 A;  2DYS H;  2F48 A;  1MKM A;  2M8E A;  1MIJ A;  1VZ0 A;  5DV5 A;  1OCR H;  2ZJP F;  5HDN A;  5E3M A;  1HDD C;  3I59 B;  1PYV A;  4BXU A;  2VC1 A;  2E5Z A;  4P9F A;  2W57 A;  2V1N A;  3CUQ B;  4X6A J;  4BE2 A;  1TWC J;  1U5T C;  2XB5 A;  4QWQ A;  4FAS D;  3DEU A;  3H5A A;  4BAC A;  1ORK A;  3H0D A;  4UNO A;  1PP8 F;  4RGU A;  2OCE A;  1UHW A;  3VPR A;  2IJL A;  2HTJ A;  1X2N A;  2M7B A;  3B73 A;  1R7J A;  5KHD A;  3E3V A;  1ONV A;  3I3L A;  2H94 A;  1BR2 A;  2JT1 A;  3WTT C;  4A0Y A;  1W7P B;  3DXJ F;  4ZDP A;  3ZOB A;  2E19 A;  2VIX A;  1I3Q J;  4PGG A;  1G6N A;  3BQY A;  4I99 C;  5K7Z A;  2R93 J;  1TWG J;  4HNU A;  3I55 I;  1G3S A;  4HST A;  4UHT A;  2GXG A;  2A5Y B;  2GIV A;  2K3P A;  2QSH X;  2ESH A;  1IDZ A;  3ZQG A;  3DPT A;  4ZYG A;  2VOO A;  3FXM A;  4IHW A;  4XM3 A;  1LJ9 A;  2EFO A;  5LEJ A;  2PMU A;  3M9A A;  2JJ7 A;  1U8R A;  4D9J A;  1KA8 A;  1BI1 A;  1MMA A;  2EIK H;  2K4B A;  1NTC A;  2E1N A;  2VKE A;  1KU7 A;  3AG4 H;  2A05 A;  3HSR A;  1HF0 A;  2QEX I;  4M3G A;  1VQN I;  4ENK A;  4FX4 A;  4CCO A;  4A6E A;  1SC7 A;  3A03 A;  4ITV A;  4HA8 A;  3OYF A;  2DW4 A;  4G6D A;  2PMZ A;  1T0F C;  5J8C A;  2M4G A;  3AG2 H;  3S2H J;  3M1C A;  2R5Z B;  4GGG A;  1MSF C;  3VEP A;  3VYU B;  4DW6 A;  2VL8 A;  4L5E A;  1K83 J;  1JTX A;  3ZMV A;  2JSC A;  3IAS 2;  5KVR A;  3P9I A;  3OYA A;  4D7N A;  4UVB A;  4AIK A;  4X1E A;  3L2Q A;  2KKO A;  2L0K A;  3RPQ A;  3FX3 A;  4E7K A;  1ZGJ A;  3ZP5 A;  2DTR A;  3HOY J;  2IS6 A;  4XLC A;  3ZXS A;  2JA8 J;  2WAQ A;  2D5V A;  2K9Q A;  2YU3 A;  2GXA A;  3VDX A;  2JRM A;  4A6D A;  1REP C;  5KK1 A;  3C18 A;  5ILS A;  1HA8 A;  1T6S A;  1U6G A;  2L5Q A;  2MD0 A;  3EYY A;  4L5J A;  4MEY F;  2HXO A;  2JUG A;  4UUS A;  1I1G A; 
#chains in the Genus database with same CATH homology
 3ZMT A;  1B4A A;  4OOI A;  4LLG F;  4HDU A;  4EM1 A;  1SD5 A;  3CUO A;  3L09 A;  1EH8 A;  2DI3 A;  3VB2 A;  4A5M A;  4EM0 B;  5LGU A;  3LAP A;  2CG4 A;  1BOA A;  1MJ9 A;  2XRO A;  1D8J A;  1YYV A;  5DYM A;  4MTE A;  3HYI A;  1IRG A;  3L2C A;  1J5Y A;  2GA2 A;  3SHF A;  3P9C A;  3ZMZ A;  1FOK A;  1UCR A;  2M87 A;  1IN5 A;  3JSO A;  3I64 A;  2HQR A;  2MH9 A;  1WRJ A;  2QZ8 A;  5HS7 A;  4M74 A;  2XVC A;  5HVQ C;  4U0W A;  1O3R A;  2QYO A;  1X3U A;  2VBX A;  3LA3 A;  2F5C A;  3G73 A;  1VTN C;  2MD5 A;  4IF4 A;  4KIC A;  1K78 A;  3CLO A;  1FYM A;  1QZY A;  2HS5 A;  1SFU A;  4AWX B;  1ZG1 A;  2VT2 A;  3H92 A;  1UST A;  1T39 A;  2ESN A;  1R22 A;  1IN6 A;  4RB0 A;  3TOB A;  2GAU A;  1XCV A;  2A69 F;  3DF8 A;  2OU2 A;  2RV8 A;  1B1B A;  1ZG3 A;  2G7H A;  4UV9 A;  3WTZ A;  1YO5 C;  1B59 A;  1ZLK A;  1YG2 A;  4I7H A;  2WTE A;  5CVU A;  1QNT A;  4Q47 A;  1YFH A;  2CGP A;  2XRN A;  2X0L A;  4P9U A;  1U5T A;  1QO0 D;  1CF7 B;  4N0B A;  4S05 A;  3RYP A;  3O2P E;  2P6S A;  2IPQ X;  2QWW A;  3ZN1 A;  1ZLJ A;  3MAJ A;  3KE2 A;  1C0W A;  2MBF A;  3EDP A;  3HSF A;  3NEU A;  2OQR A;  3FMQ A;  3BDD A;  3TKY A;  1FP2 A;  4CGZ A;  2EV5 A;  3HRU A;  4GXO A;  1LDK B;  1LB2 A;  3P9K A;  1BC8 C;  4L9V A;  3GX4 X;  1P4A A;  3CO7 C;  3F3X A;  3HRT A;  2ZO4 A;  4HAM A;  1XSD A;  2VC0 A;  3U2R A;  1Z91 A;  2H09 A;  3K1N A;  2VT3 A;  2W85 A;  3FMS A;  4KIB A;  1YQA A;  4B09 A;  4XRF A;  4FT8 A;  2Y0M A;  2ELH A;  2XAH A;  3GUD A;  4BQA A;  2QUF A;  4Y15 A;  3RI4 A;  1H9G A;  1S8N A;  2Z99 A;  1T98 A;  4U7B A;  3FZV A;  2UXX A;  2V1D A;  2DK5 A;  1FZP B;  4EQQ A;  3M1E A;  2H6B A;  1XSX A;  1WKM A;  1XMA A;  4U88 A;  3V8J A;  5DD8 A;  4WK8 F;  3TO7 A;  3WTU C;  2ZFW A;  2L01 A;  3KET A;  2Q8K A;  2EK5 A;  2C6Y A;  4HX7 A;  5BPI A;  5LGT A;  1XN7 A;  4A0X A;  1JGS A;  1D8K A;  1TNS A;  4R79 A;  1H9T A;  5HS8 A;  1TBX A;  4G7Z F;  3FF5 A;  4R1H A;  1IN7 A;  2EFP A;  4RB2 C;  2GQQ A;  4CYD A;  5JR3 A;  4UVC A;  1BIA A;  2FEZ A;  4LK0 F;  1RUN A;  1EH6 A;  2XAQ A;  3DQV C;  4U0V A;  4HQE A;  1OMI A;  3FHZ A;  3QOP A;  2RN7 A;  2VE9 A;  3MWM A;  1FYL A;  1G3T A;  4LMY A;  3GW2 A;  3LA2 A;  2DPD A;  4CDG A;  4AIJ A;  3F22 A;  2RC4 A;  4WWC A;  3WTX C;  2FBI A;  2CWE A;  3F8N A;  3GFM A;  3B02 A;  2E1C A;  2P5K A;  4JBA A;  4N9I A;  2OZ6 A;  1GVJ A;  2YR2 A;  3K9T A;  3T1B A;  5DUI A;  1FBQ A;  1LQ1 A;  4I02 A;  3D5L A;  5JFR A;  2V9V A;  1S29 A;  1JHF A;  1YW8 A;  4EMS A;  3ML6 A;  1J7K A;  3R6S A;  1FT9 A;  1KGS A;  5CYV A;  2R3S A;  2VBY A;  3LWF A;  5LGN A;  3LQQ A;  4YFN F;  1BIB A;  1H0M A;  2NS0 A;  1K7A A;  1HKT A;  5D8K B;  1STZ A;  4L18 B;  2YX4 A;  5AIP A;  1ULY A;  3SFZ A;  1AWC A;  4UUV A;  1ZRE A;  2ZME B;  3H3Z A;  3EYI A;  2BEO A;  4KN4 X;  3I58 A;  2FBH A;  5E20 A;  4ZH4 F;  1FBU A;  2EJR A;  2P7C B;  4ENN A;  1IXS B;  3BPX A;  4IHT A;  4EJU A;  3HTS B;  2XAJ A;  2OAZ A;  3WE3 A;  5E8G A;  1FY7 A;  3ABU A;  1P6R A;  2HOE A;  3AAF A;  3KP6 A;  2WC2 A;  4EV0 A;  4P55 A;  2DK8 A;  2PQ8 A;  5D8L B;  3SZT A;  3F6V A;  4Z2Y A;  2Z33 A;  5HDG A;  1TQP A;  2K86 A;  2IA2 A;  1OKR A;  4HLX A;  5F1R A;  4RGR A;  1O3T A;  2GZW A;  1ZHF A;  2B0L A;  3CO6 C;  3HOS A;  2X4H A;  3KFW X;  4IRI A;  3WE2 A;  2XAG A;  4HZF A;  1RZ4 A;  4GO1 A;  2M5W A;  4XLP F;  2MLG A;  1UFM A;  2E7W A;  3L00 A;  4KA4 A;  1GHC A;  3P7N A;  3ZMD A;  3KP2 A;  5FD6 A;  2H6C A;  2L4A A;  5L3E A;  4AD9 A;  5CJ9 A;  1IRF A;  3H3U A;  4NQW A;  2O03 A;  2ISZ A;  3E6B A;  3LST A;  2P6T A;  3WGH A;  5JVT A;  1ZRD A;  4XBF A;  2OBP A;  1O3Q A;  4A2U A;  2W84 A;  2OD5 A;  2HZT A;  4B8X A;  3RDI A;  3HRM A;  5H20 A;  5D6F A;  1ZH5 A;  4HLY A;  2Q0O A;  5DEQ A;  3I54 A;  5FD5 A;  4EVI A;  4RB3 C;  4G8X A;  2O6G E;  1DPU A;  4U0Y A;  3R61 A;  2QM3 A;  5JI6 A;  4Q4Z F;  3MQ0 A;  1FNN A;  1HQC A;  2HEO A;  1TW3 A;  1F9N A;  3JW4 A;  2H27 A;  2RKH A;  4G6Q A;  3ZPL A;  2DAO A;  3TGN A;  5K5Q A;  5LHG A;  2O61 A;  2ZJ2 A;  5DD4 A;  1NHA A;  1J59 A;  1TLH B;  3T8R A;  1JHH A;  5AON A;  2KIF A;  3ISP A;  1R36 A;  3T5X A;  1R1U A;  1LEB A;  2XKO A;  3U1D A;  2VBZ A;  4OMZ A;  5J6X A;  2EWN A;  3F23 A;  3QU3 A;  2HKO A;  3O6B B;  2IRF G;  3E97 A;  4L5I A;  1K78 B;  2KRF A;  4AIH A;  1QPM A;  1RIO H;  3M8F A;  4BHC A;  1SD6 A;  4Q5S F;  1MD0 A;  2XHK A;  1I1S A;  1W5S A;  2AS5 F;  4ON0 A;  1UB9 A;  2HR3 A;  5IT9 K;  5IT9 Z;  4RGS A;  1HKS A;  1I5Z A;  2WWY A;  2NAZ A;  2DBB A;  4WXD A;  3QU6 A;  2R7D A;  4CXF A;  3K69 A;  3O3K A;  1RI7 A;  4EGY A;  1S7A A;  4HBL A;  4EJW A;  3RJP A;  2XGX A;  2P8T A;  4TV7 A;  2STW A;  1D5V A;  2ZCW A;  2XAF A;  2ZBK A;  2LSO A;  3Q5F A;  4IJA A;  1T0F A;  3J81 K;  3J81 Z;  3MEX A;  1HKQ A;  4ZYD A;  2HFH A;  1TTY A;  2BYV E;  4RB1 A;  2VON A;  4I2O A;  2A68 F;  3C7J A;  1DP7 P;  1BN5 A;  3EQL F;  3BWG A;  3QP6 A;  5DCM B;  1OYW A;  4PZJ A;  1V3F A;  2BGC A;  4HOB A;  4OMY A;  2EFN A;  2Y48 A;  2RQP A;  4YII A;  1ZGA A;  4IXA A;  2VOD A;  4H0E A;  1G4D A;  3V7S A;  5HLG A;  3HUG A;  1YLF A;  2DFI A;  5L3G A;  5LHI A;  1S7O A;  3V7R A;  1MDM A;  3MFK A;  2GWR A;  3F21 A;  4YFK F;  3F8M A;  4ESB A;  5H6R A;  3ROU A;  4KUM A;  2FBK A;  4MHG A;  2DQR A;  4IRH A;  3HTU A;  2G9W A;  3IWZ A;  1IAW A;  5DDG A;  2R7F A;  5TRD A;  3E6M A;  2FF4 A;  3SZP A;  1IN4 A;  2YSR A;  3FXR A;  2QBY B;  4KMF A;  3KZZ A;  3FWE A;  4CIC A;  5K5R A;  1A04 A;  1KQ9 A;  1OR7 A;  3GWZ A;  1FPQ A;  3W6K B;  2ZNY A;  1FP1 D;  1KU9 A;  1G3W A;  1OYI A;  5D4S A;  2QVO A;  2UXN A;  2NNY A;  1R1T A;  3L7W A;  4KYW A;  2LF8 A;  4WXC A;  4ZZL A;  3OOP A;  5FB2 A;  3EET A;  1E17 A;  3L9F A;  3I4P A;  3KEQ A;  2HWV A;  1ZAR A;  3QRF F;  1DPR A;  1R1V A;  3MZY A;  4GCV A;  4KIF A;  1YW7 A;  1XCB A;  1Z6R A;  4HX8 A;  1SD4 A;  4WX9 A;  5JHU A;  3TDU C;  3GFL A;  2FXA A;  2EV0 A;  4HV6 A;  1QQI A;  4LB6 B;  2W25 A;  3GEZ A;  3FXU A;  2ISY A;  1FWZ A;  1LVA A;  3KEO A;  2ZME A;  3ECH A;  1JXS A;  2EA4 A;  2ZXJ A;  2STT A;  3WTY C;  1BI0 A;  3HHH A;  4K2E A;  3WU0 A;  5CVI A;  3R60 A;  5FO5 A;  1O7L A;  3E6D A;  3E6C C;  2FML A;  4HV5 A;  2P5V A;  4LFU A;  4MTD A;  2Q2E A;  4G9Y A;  4ETS A;  4DQ2 A;  4LK1 F;  1J0R A;  5CVV A;  1I27 A;  1IUY A;  3REO A;  4PGH A;  2PI0 A;  2QLZ A;  4KDP A;  5D4R A;  1HBX G;  4XSX F;  4A0Z A;  2HYF A;  1PP7 U;  3TOA A;  3JTG A;  4CO8 A;  4IPA A;  3ECO A;  3BZ6 A;  2EFQ A;  5DCF A;  2IA0 A;  4KNY A;  2IW5 A;  2JTV A;  1SFX A;  2CO5 A;  3IKV A;  4ZYH A;  2XKP A;  4I0B A;  2WV0 A;  2L02 A;  2VE8 A;  4Q48 A;  1KU3 A;  4O6J A;  2GXB A;  4HQM A;  2UWM A;  3ZN0 A;  3JSP A;  2O8X A;  4EJO A;  5ICF A;  4BH9 A;  2V6C A;  4Y13 A;  4GYG A;  3LQR A;  1IW7 F;  3RKW A;  2IA1 A;  2F5E A;  2KIM A;  1DUX C;  4LJZ F;  5H6Q A;  2JZY A;  3MCZ A;  2RDP A;  2D2W A;  4E70 A;  1D3Y A;  4LG0 A;  3I71 A;  4XLN F;  1O57 A;  2RVC A;  2BBY A;  3RTR A;  3E5Q A;  4KFC A;  1YTY A;  2MH2 A;  5HLH A;  3NQO A;  2DPU A;  1K6O A;  2JPC A;  3LA7 A;  5LBQ A;  2PG4 A;  2PLY A;  2F2E A;  3I5U A;  1J2X A;  1EH7 A;  4DNC A;  3RKY A;  2L4M A;  2FU4 A;  3RPU A;  1XB4 A;  3E5X A;  3PQJ A;  2HGC A;  3COA C;  2VOP A;  1P2F A;  4CHU A;  1XGN A;  2L3D A;  3CUQ C;  1BI3 A;  2PJP A;  1ZAO A;  4BHB A;  2IP2 A;  2FNP A;  3I53 A;  1W7P A;  3WTW C;  1LNW A;  1O3S A;  2MLK A;  5F64 A;  3RKX A;  3N97 A;  4BHP A;  3WGI A;  1ON1 A;  3GLX A;  5D5V B;  1FSE A;  5FGM A;  1YW9 A;  1Z05 A;  1GXQ A;  2K27 A;  1DDN A;  1Y0U A;  2ZKZ A;  3Q9V A;  1S6L A;  2Z5U A;  5HS9 A;  3I59 A;  1ZRF A;  1F5T A;  3ZMU A;  4U7D A;  1ON2 A;  1W5T A;  4GYI A;  2IVM A;  2NYX A;  2CFX A;  1YS6 A;  1FYK A;  2HKX A;  5E1W A;  3JTH A;  4P5O A;  4I0A A;  2GA1 A;  1XD7 A;  1LDD A;  5HDK A;  4L9T A;  4YG2 F;  4EM2 A;  3TQN A;  3DKW A;  5AIQ A;  5LRR A;  4WF2 A;  1LEA A;  4WXH A;  4YFX F;  4LB5 A;  4UXN A;  3NRV A;  1FSH A;  5FLX Z;  3IL2 A;  5FLX K;  2CW0 F;  1XMK A;  4IVN A;  2QBY A;  3BRO A;  2M30 A;  1R5G A;  3TO6 A;  5FFZ A;  1TW2 A;  3E5U A;  2J5P A;  3GF2 A;  1WI9 A;  3IRR A;  3SXY A;  4M9X A;  4RAY A;  1W4M A;  3ZQ7 A;  3SQN A;  3PFI A;  3IRQ A;  3J80 K;  3J80 Z;  1ODD A;  4HF1 A;  1HSJ A;  2FRH A;  3BP8 A;  2J5O A;  3RIR A;  5L3D A;  4BYY A;  1MJA A;  4L0Z B;  4EGZ A;  3ZMS A;  2A61 A;  2PBI A;  1HW5 A;  2LF7 A;  3GVA A;  3WTS C;  1IXC A;  2VBW A;  1R00 A;  2K02 A;  5DCM A;  5HOO A;  3R0J A;  2PN6 A;  4ENJ A;  4I98 B;  4PDK A;  2CYY A;  1SMY F;  1BM9 A;  5E17 F;  1ZG5 A;  1U2W A;  4L9N A;  4RGX A;  5F6F A;  1JE8 A;  3FMR A;  3IHU A;  5ICG A;  3BOQ A;  3F8F A;  3R4K A;  2QEN A;  4M72 A;  1U78 A;  2A07 F;  3K1P A;  2LDU A;  2D1H A;  1LDJ A;  1FC3 A;  2A6H F;  4KT5 C;  2CQK A;  3HRS A;  5DUK A;  1Z6T A;  3CJN A;  4YIF A;  2XAS A;  3C1D A;  2QQB A;  1SMT A;  4M73 A;  3V7C A;  1YIO A;  2NRA C;  1SFE A;  4O3M A;  2K7L A;  1BC7 C;  2HYG D;  3BJA A;  4MGR A;  1EV7 A;  2OQG A;  1K79 A;  5LRS A;  2K4J A;  2EV6 A;  2DLL A;  3F8B A;  3IC7 A;  2UZK A;  4BNC A;  3U9G A;  2W24 A;  2ETH A;  3GZ5 A;  1ZN2 A;  1P4X A;  1G3Y A;  2KJB A;  3K2Z A;  5J8F A;  2PEX A;  4IHS A;  1IZ1 A;  5ED4 A;  4LLL A;  3KP4 A;  3Q9S A;  3C3W A;  1YS7 A;  4ESF A;  4UVA A;  3GO5 A;  4WCG A;  3DPL C;  1XGO A;  1F1Z A;  2BV6 A;  2F5F A;  3TDZ C;  3VOD A;  4F7Z A;  5BQT A;  4R8H A;  4M9S A;  1TQI A;  4JK1 X;  1TNT A;  4FHT A;  1QGP A;  4G7O F;  2VXZ A;  3ULQ B;  1SAX A;  2LNB A;  5LLQ A;  1O7F A;  2ACJ A;  1HXD A;  3DFG A;  1XSV A;  4D0P A;  2MA3 A;  2OA4 A;  3G3Z A;  1IN8 A;  5E8I A;  5ICE A;  5TJJ A;  4S04 A;  1HW1 A;  5L3F A;  1J75 A;  4G7H F;  2QQA A;  3EUH A;  3KLN A;  1R5H A;  4LGW A;  3WOD F;  5CVJ A;  2YPR A;  3IKT A;  1Z1D A;  2M45 A;  1UHM A;  1U3E M;  4M6X A;  5BS6 A;  2PMH A;  2FA5 A;  4RS8 A;  4UV8 A;  1IXR C;  2FE3 A;  1HW2 A;  2KIU A;  1KQ0 A;  1XDU A;  2XV4 S;  5EEH A;  3M7G A;  3TO9 A;  1E2X A;  4KN7 X;  4LD5 A;  1I6X A;  2KJC A;  1J9I A;  3ELK A;  3GYH X;  3WU1 B;  2Z9O A;  1GXP A;  3WTV C;  4JQF A;  1SD7 A;  1KQ8 A;  3BJO A;  4Y17 A;  2LKP A;  2RGV A;  3W6J B;  2V1U A;  5BPD A;  1B9N A;  5A2Q Z;  5A2Q K;  5K1Y A;  4M71 A;  4HX4 A;  1S3J A;  3N4M A;  4HDV A;  2XUB A;  1MDM B;  2NNN A;  2O3F A;  5D6E A;  5ICC A;  3V8L A;  4KIG A;  2ZNZ A;  3K0L A;  3T8T A;  2A6E F;  1MJB A;  3LFK A;  3FXQ A;  5EEG A;  5D5U B;  1R23 A;  5HLI A;  1T38 A;  4HW0 A;  2AXL A;  2D45 A;  2Z3Y A;  4ESJ A;  2BE5 F;  4CZZ A;  1RNL A;  2V1X A;  5ILV A;  1BI2 A;  3KZY A;  5BOX A;  2COM A;  3BY6 A;  3KP7 A;  2L54 A;  2G7U A;  3JAM Z;  3JAM K;  3V4G A;  5E18 F;  1B9M A;  3F72 A;  3GZ6 A;  5ERI A;  3I0T A;  4L9J A;  5ILU A;  2QQ9 A;  3J7A O;  2P7V B;  2HQN A;  1OYY A;  4A12 A;  3F6O A;  1R58 A;  1Z9C A;  1B6A A;  5L3C A;  1L3L A;  3BPV A;  2M1B A;  5D5W B;  4HF2 A;  3QAH A;  4O5V A;  2JPB A;  2XIG A;  4P96 A;  5FFX A;  2IT0 A;  5K5O A;  2JRT A;  4NB5 A;  2DO7 A;  1W7P D;  3OV8 A;  2HDC A;  4M9Z A;  4N9H A;  4A5N A;  1RUO A;  4XSZ F;  6PAX A;  4G94 A;  4HYE A;  3WGG A;  4KMU X;  2FSW A;  1CGP A;  3HOT A;  4EJV A;  2YX7 A;  2EFW A;  5CLS A;  4IRG A;  5L3B A;  1FBS A;  4ENM A;  3V8K A;  4OIR F;  2VN2 A;  1AOY A;  4L0Y B;  1T2K A;  3ERE D;  1U5T B;  3M8E A;  1CF7 A;  2HTS A;  4ASN A;  1XDS A;  3RYR A;  2FQ3 A;  2ADU A;  5E1X A;  3FM5 A;  2Y75 A;  2OZU A;  5LHH A;  3KP3 A;  3PQK A;  3GXO A;  4BAY A;  2F5D A;  2FMY A;  2CSO A;  3BJ6 A;  3HSE A;  4OIQ F;  5E1Z B;  3IWF A;  1P4W A;  1ZYR F;  3QPH A;  2DQL A;  3KLO A;  3MZH A;  1PDN C;  1P92 A;  2MC3 A;  2O0Y A;  1WSU A;  1BBY A;  3T0Y A;  2A3S A;  3CUQ A;  4ZZD A;  3K1M A;  5IT3 A;  1IF1 A;  1KYW A;  1XGM A;  5BMZ A;  4I09 A;  4AVP A;  3KP5 A;  1ZRC A;  2DU9 A;  4MNU A;  2TDX A;  1HST A;  3HHG A;  3CDH A;  4ZYE A;  2EA2 A;  1TQM A;  4HF0 A;  1QZZ A;  4NHJ A;  4OIP F;  2PFB A;  3FM3 A;  2RNJ A;  3DP7 A;  4M6Y A;  2EB7 A;  2FOK A;  1KU2 A;  3CTA A;  3QPT A;  2P5L C;  1XGS A;  1MZB A;  4MQ9 F;  5CVR A;  2FNA A;  4RAZ A;  1FLI A;  1V4R A;  2DT5 A;  4PCQ A;  3HIF A;  4OIN F;  2D1V A;  1WQ2 A;  3QP5 A;  1PUE E;  3VFZ A;  1QBJ A;  1FX7 A;  2V79 A;  4OIO F;  3WG9 A;  4EJT A;  4FX0 A;  5D5X B;  1F4K A;  2E7X A;  4OU0 A;  1OPC A;  4LLN A;  3LAJ A;  3D0S A;  3S2W A;  1WWX A;  4MQV A;  3ABT A;  3VOE A;  3GFI A;  1MGT A;  1Q1H A;  4LG0 B;  3GFJ A;  1BJA A;  3F8C A;  1KYZ A;  1Z7U A;  3KCC A;  1USS A;  3R0A A;  5LEK A;  1L0O C;  4QLC U;  4I01 A;  4MEX F;  2P4W A;  3DV8 A;  1MKM A;  2M8E A;  5DV5 A;  5HDN A;  3I59 B;  4BXU A;  2VC1 A;  4P9F A;  2W57 A;  3CUQ B;  1U5T C;  4QWQ A;  3DEU A;  4UNO A;  1PP8 F;  4RGU A;  1UHW A;  2IJL A;  2HTJ A;  3B73 A;  1R7J A;  3E3V A;  1ONV A;  2H94 A;  3WTT C;  2JT1 A;  4A0Y A;  1W7P B;  3DXJ F;  4PGG A;  1G6N A;  1G3S A;  4UHT A;  2GXG A;  2A5Y B;  2GIV A;  2ESH A;  2VOO A;  3DPT A;  4ZYG A;  1LJ9 A;  2EFO A;  5LEJ A;  2PMU A;  3M9A A;  1U8R A;  1KA8 A;  1BI1 A;  2K4B A;  2E1N A;  1KU7 A;  3HSR A;  4ENK A;  4FX4 A;  4A6E A;  4HA8 A;  2DW4 A;  4G6D A;  5J8C A;  4GGG A;  3VEP A;  3ZMV A;  2JSC A;  5KVR A;  3P9I A;  4UVB A;  4AIK A;  2KKO A;  3RPQ A;  3FX3 A;  1ZGJ A;  3ZP5 A;  2DTR A;  2YU3 A;  4A6D A;  1REP C;  5KK1 A;  3C18 A;  5ILS A;  1T6S A;  1U6G A;  3EYY A;  4L5J A;  4MEY F;  1I1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...