3HSJA

Crystal structure of e. coli hppk(n55a)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLAAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pterin-binding site mutation Y53A, N55A or F123A and activity of E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords HPPK
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3hsjA00
2F65A 1TMMA 2CG8A 3HT0A 1F9HA 3ILIA 5ETTA 1RU2A 3HSGA 5ETQA 4CYUA 1IM6A 4M5JA 1Q0NA 4PZVA 5ETVA 4M5HA 3KUHA 3HD1A 2QX0A 3HD2A 3UDVA 3ILJA 3MCNA 4M5MA 3UDEA 1RB0A 1CBKA 1RAOA 3IP0A 1HKAA 5ETPA 4AD6A 4M5LA 1TMJA 3HCXA 3HSJA 1DY3A 4M5GA 5ETMA 5ETSA 4CWBA 3QBCA 4F7VA 5ETKA 2F63A 3HSDA 1EX8A 5ETOA 1EQMA 4CRJA 3KUEA 3MCMA 4M5NA 5ETLA 3HSZA 4M5IA 1KBRA 1RU1A 1RTZA 5ETRA 4CYUB 1EQ0A 3ILOA 3KUGA 2BMBA 3ILLA 5ETNA 3UD5A 3MCOA 4M5KA 1G4CA 1HQ2A
chains in the Genus database with same CATH superfamily
5DLFA 3LO3A 2WB4A 4NEZA 2OD4A 5FLXY 3T1YJ 1QAIA 3Q86A 4GVBA 1GT8A 2AP6A 2LMIA 4P2FA 1S79A 4ZVPB 4RO0A 1U6BA 4ECXA 1N34J 1SC1B 1N36J 3DI6B 3H2VE 1PC4A 2DH7A 4IH5A 3I5BA 4RU9A 1T3OA 4DL4A 2FVQA 4OZ3A 2BOPA 4BS2A 5KG3A 4NLUA 2R2SA 4MMOA 3ZO7A 2ZDPA 2U1AA 4IOCQ 1RLCL 5FJ4A 2V63A 4LQ9A 1RT6B 3PEHA 1RTIA 2CJKA 1S0MA 1T11A 5KFNA 3FQLA 3HHKA 1YBUA 4P72A 8AT1B 2RQ4A 3R7SB 4ELTA 3MCOA 5C5JA 1I3OB 1VBKA 1C0UB 1EKSA 2A18A 2BANB 3I0SA 2EFNA 3ILIA 3EXCX 3MZIA 3POTA 1TUVA 4H54A 3RBZA 3H5YA 5KFPA 1UVLA 1U09A 4GMKA 1F0XA 3GZ7A 4ZPVR 3TUZC 4FKYA 1YZ7A 1RAIB 1KOOA 3CGIA 1WSRA 4ELUA 2ZD1A 4JI7J 4IO1A 1XBWA 1FK9A 3D0HE 1FWKA 3N79A 1Q1KA 3A8EA 4Q0BB 4KTQA 1WOPA 1FX2A 2KTQA 5GMEA 3OTDA 2UXDJ 3BEGB 4NLOA 3ZTRA 4C7QA 2UUAJ 1R0CB 2KRBA 3ZC4A 4GKJF 1YZ6A 2CJYB 3VWSA 3HZEA 1JB0C 2F9DA 4Y3CA 3FFIA 1DZ5A 3DOMA 4NE9C 4DCOB 3OFGA 1QTMA 2LU2A 4Q0BA 5CYMA 4FP9A 2LECA 2HVHA 1YRXA 4R25A 4F04B 3UCZP 2BDPA 4ZPDA 3G2XA 4C8NA 1F1BB 3FCWA 4ID5B 1UVJA 2QTWA 1Q7YT 2X3GA 1HL6A 3BS9A 1T9TA 3QLHA 2XS5A 4WTOB 2VICA 2PA3A 1PILA 4Y65A 5C7PA 1ZTWA 4QYZJ 2ZOFA 1S4EA 4DSJA 4RW8B 1U2FA 1WKJA 1GMVA 1FRHA 2G2ZA 1NLKL 2RHSB 4CLLA 2GIQA 2IRUA 3S6EA 2ERRA 1YK9A 2QE5A 2W01A 4NCGB 4Q7AA 1HPZA 2FUG9 3MMJA 3OR1A 2GS8A 2UXDF 2BJEA 1K47A 3RJMB 3RZAA 2W7OA 3OT9A 2CIMA 1TK8A 4M5KA 1S1VA 1HNZF 2QRRA 4KAIA 1KN6A 1NDCA 4QJVA 2OTJS 3TEHB 3C8YA 3NBPA 1PYTA 5DS7A 1U48A 1N33J 3PX4A 2KZMA 4J9KA 1VQSA 1X5TA 4QW8A 3C3LA 2B4PA 1Q81T 2DRDA 1TKZB 1U25A 1QUPA 3C6TA 3MMAA 1PG5B 1VLOA 3TZYA 2MXYA 2YNIA 5IT9U 1SKUB 2B4VA 3KK1A 2FJXA 3VVTA 1YDLA 1UAWA 4NRUA 4P9SA 3CCSS 1ELOA 2CQDA 2OPSB 1S1WA 2RU9A 4WTYA 2VQEJ 4DFPA 1RWWB 3W5XA 2NLWA 5ETMA 2R7WA 3SV4A 2P9GA 2K3KA 4CDIA 4EBCA 1KOHA 2M5YA 3DHXA 1CJKB 4CTAA 3OL8A 4F2SA 2YKOA 4G1IA 1FWLA 2AYMA 4WE1A 4ZN1A 5DJBA 5KFYA 2B9EA 3PHTA 3CCRS 4I68A 1OWXA 3U27A 2V5HG 1WUUA 1X4DA 4BHQA 4ETXA 7AT1B 4ZLLA 5LXYA 4IO9Q 2D9OA 2Z30B 5E3CA 5JUMA 5DM7Q 3IN5A 2ROEA 5KFRA 2QL7B 2GVZB 2DNGA 2HRUA 4OLPA 3KK2B 1N34F 2IPOB 4IG0A 2DT9A 4X4UA 4OYOA 1VYAA 4LR8A 4O4GA 5A0YB 1JKHA 2DGXA 2AZ1A 2PSZA 3N9UC 5EGYA 3TI0A 4ATNA 2GW8A 2B3TB 3T1HF 3PNIA 4DV6F 2VG5B 4M5GA 1HBMB 2QA2A 2WBRA 2FZCB 5ETKA 2XGQA 3QJLA 3HMJG 3BGOP 3CCVS 1IKXB 4BC7A 4FYYB 3UQSA 5LSOA 4IR1A 1VOMA 2W9BB 1T0TV 3M6XA 2FY8A 3V6KA 5J2QB 4WBFA 2MMYA 2PDAA 3HULA 2YWFA 2ZH3A 3D7SB 3OUYB 2HK2A 3TQ1A 3RW6A 2PD1A 5LJ5Y 4Y0FA 4TLRA 1F9HA 3TJ9A 2ZC3A 3F41A 2GNKA 2JSXA 4K5RA 1VBXA 4K4XA 5SZTA 2R7SA 4QZVB 4RNFA 3CCLS 1VHFA 1UVKA 4MKBA 1K9MT 2FYXA 5L1IA 3KLVA 1U4BA 3UDCA 1WHYA 2C2MB 3C15B 3PX0A 1BC6A 4AQYJ 5BYRA 4DI6A 5D4OA 2KN4A 3VQSA 4DOZA 4QYZK 2XY7A 4NPOA 2JJ4D 3C16A 2XM3A 2FGCA 1G7CB 2XMTA 4PYAA 5C24A 4DL0C 3MR2A 3PR5B 1X5OA 1F9EB 2WVBA 3X1LB 2IC3A 2LQ8A 3GV7B 5F0WA 3DRSA 2HQFA 3KDNA 1NK7A 4ILLA 1IKWB 2BKPA 1TKXA 3HX9A 2BMBA 5BJRA 2YWEA 3M7VA 2Z2YB 2R8IA 1O6XA 1RHRB 2ATLA 4KHPF 1GX6A 1LFPA 4N47A 1DLOA 3E2EA 2YNFB 3AB2B 3TZZA 4USUA 4J7CA 2IHR1 2X3DA 3VGSA 1S10A 3DLGA 3H98A 4K2XA 4O3SA 2LQBA 2GA7A 1HNXJ 2VPZB 2HS0A 4X4PA 3NG8A 4WZQA 2Z58B 5FDLB 1T9VA 3QT8A 3TWZA 4NCGA 3AODA 3I9V9 4KKOA 4AD6A 5A8RB 3MOJB 4ANDA 3TUJC 3TR5A 4JB8B 4MFBB 3D2WA 3CC7S 1VISA 2ACMA 1FNMA 5KOWA 4DR1F 1NDPA 2HPUA 3DCAA 2K06A 3DLJA 1LOUA 4NZ6A 4CLSA 3A1YG 4B3MF 3C14A 1ITPA 1RT3B 4QR0A 4USMA 3EZ5A 1SH2A 1SV5B 3EVOA 1I94J 3H4BA 2LA6A 1JLQB 4EYHB 4J9OA 3A3OB 4DL3A 2FGOA 1M1GA 4RBVA 2GMLA 2OPRB 2F8HA 5K5MA 5HQMA 2DNQA 5BR8F 2AGPA 4U7CA 2ABYA 2OGUA 3I4PA 3SI8A 1DHMA 1M0SA 5A8WB 1RHUB 2KVIA 3PVXA 4DJBA 1N8RT 2VJUA 4V19J 1LW0B 2IFXA 4LSLA 5ADZA 1SC3B 3MTJA 1GNKA 2F3JA 4TQSA 3H7HB 3MR6A 2ZH1A 4LJMA 4ED5A 1T9UA 3M32B 2HHUA 4S0MA 1ZAWA 1SIZA 1RT7B 2DGSA 2W2OP 3BH6B 3QT5A 3M30B 4WP9A 5L39A 5CD4A 1WI6A 2BM1A 2DGQA 2IRYA 3W63A 2FLPA 2R8GA 3RR8A 3QRQA 3TP2A 4UOFA 3TARA 3DC2A 1LWXA 1SQGA 3T1HJ 3UO0A 3BQ0A 3V4IB 1S77D 2XLKA 3FBFA 5HROB 3M30A 3CMES 1RTDB 5B7WA 2C3PA 4YEAA 2I2YA 1IR2A 1BE4A 4OZNA 1UWBA 4DR3J 1ROFA 4OMFG 1JLFA 2DO0A 4HDGA 1NJIT 2MSSA 4ED7A 2C2KB 4FYXB 3A8JA 3OXFA 1EB0A 2ZBRA 4U7UK 2VPWB 1URNA 1YLXA 2HFSA 5DZ7A 4PR6A 3UDEA 2HNDA 1HARA 2CPFA 3J7YI 4AXIA 2OUGA 1LXJA 4A46A 5DETA 2XY6A 2EK6A 4K50A 4DV6J 2M8HA 4DCPB 2ROPA 1S57A 3I0RB 1OPIA 2AJ4A 4L74A 4MJKA 2DHHA 5IT0A 2AGQA 2F63A 4A8KA 3K8WA 1IM4A 2CPDA 4LIRA 2BJ8A 1MWZA 2R7VA 1APSA 5DG8A 2B4OA 5IM0B 4IRCA 3Q2TC 2L9NA 2N3OA 1VQ7S 2JEIA 3PZPA 1NK6A 1NSKL 3QFWA 1FVQA 2XMAA 2CQBA 3DYAB 4NYZA 1HA1A 3DM2B 4USWA 1VMBA 3Q83A 5FDLA 6AT1B 5HJXA 4EU0A 3V81A 1H73A 2BKOA 3ENVA 5KFGA 2QFIA 3DLEB 4B9TA 2XMUA 5F41A 3QYYA 2CJBA 2B0GA 5KFTA 2Y8WA 4LF4J 1JLEB 2MYFA 1FFGB 4PKDB 4PG4A 3KLEA 1VBYA 1N56A 3EPIA 4QCLA 2GX8A 3FCHA 5SUHA 1CBKA 1U1RA 2EI5A 3KFWX 3MAHA 1D09B 1DJ0A 2EG2A 3W2VB 2DITA 1WELA 2NXJA 3BKUA 3MMCB 4FDFA 1XWLA 4U8YA 3SBMA 3ZNJ1 2FHKA 2GIFA 4CO4A 4OZ1A 3CDBA 2AJFE 4ZOSA 4TYBA 1SH0A 1KSPA 5C42A 4YHHJ 2QMXA 5C2CA 4CH7A 2WCXA 5KFIA 4QIGA 1HQ2A 1TKTA 2LFVA 1EAYC 2IJNA 5B08A 1FFSB 3VGVA 3QAEA 3H20A 4KIAA 4EK2A 1S7IA 4C8YA 3NCPA 1FHTA 1N32F 2LQ5A 3TA2A 5DG9A 3V4IA 1SL0A 1IWGA 3MEDB 5LMNJ 3VAHA 1CPZA 4OI6A 3N5FA 2PMHA 1JNZB 4KY3A 3SMZA 1IKYB 1MMDA 2ZH7A 2FD2A 1JJCB 4DL7A 2JEFA 1TFWA 1TUGB 4A8QA 1BWEA 1TFYA 4B3SJ 3ZZOA 2VQEF 1R43A 4K0KF 3DOLA 3CDAA 3ET6A 2BXJA 4LRDA 2XS7A 1JX4A 3T19A 1RWUA 3LP1B 4DV7F 2XYHB 1BXNA 4B9LA 4A4JA 2ZFHA 4N8NA 5DGAA 4B3MJ 3CCES 2H5JB 2NQPA 3MWBA 1C4AA 1RXOB 5DGBA 2R8HA 3CCZA 1R27B 1Q79A 3R2DJ 4I64A 3PW0A 4JV5J 3M2UA 3PO4A 1SV5A 1NJYA 2J76E 2YVSA 3AJ2A 3ISZA 4TY8B 3BGUA 3WIUA 3FEZA 3UE2A 2MB0B 2RKIA 2Y3YA 1KR4A 3DLBA 3O1LA 2XG8A 4J5OA 3BQ2A 4PWWA 2HWTA 3DMJA 3HHDA 3O5TB 3SEOA 2ZHOA 2G0IA 1VQ6S 3KJNB 2VG6B 5M2RA 2PMZD 4IG3A 2BJ1A 4C11B 1S0OA 2R8KA 2ASLA 2YWKA 4FF1A 1FNOA 3HI9A 4ZDNA 3TVZA 3IGNA 3ILOA 4C0BA 2BYCA 1YGYA 1AFJA 1PC5A 4DFMA 2XI3A 5D4NA 3DRPB 1GEHA 1S97A 1GXUA 5K8MA 3CULA 2OPSA 3FSXA 3N6MA 4DL5A 3AOAA 4LSLB 4PZVA 3RAXA 1RWOB 2E9TA 1B3TA 1UTAA 4K4YA 1RBLA 2V4JB 4DUZF 2PI5A 1XR7A 4KHMA 2YKMB 4LVNP 1O0PA 3QGPA 2HVEA 3JTPA 4OYWA 1EKRA 3Q8RB 4ZITA 4EGLA 4ECQA 3PCOB 2DR7A 1N52B 3NY0A 1X4FA 3OFFA 4ZP9A 2XCAA 2UUCF 4A8FA 3WHIA 4YB5A 2QLJB 3S7RA 4PUOA 5IS2A 3B8HA 4P6QA 5L1JA 1FESA 4NLQA 1I1GA 4K5SA 4K59A 1HWUA 4LF9F 2CKWA 5GAHI 3OHBA 4ED4A 1RT2B 3GMGA 3DHWC 3W9HA 5GAGI 1S6UA 4YHHF 3JB9k 4LF5J 3K58A 1TVRA 2GIRA 1CJTB 2KO1A 3UR0A 3RB6A 3R7NB 4G6VB 1U1KA 4F0HA 3HD1A 4DEZA 5C25B 3K5MA 1IKXA 2GHWA 4YOEA 2IY5B 3TA0A 1VRUB 4I69A 4QW9A 2IBKA 1JK9B 2E9RX 3CXCR 1TVRB 1RAHB 1DY3A 2ZUGA 3KMSA 1SQEA 3B54A 3CO0P 3TW0A 2V2VA 2OELA 3GCWP 3FQKA 3UI3A 5A8KB 2XGPA 2BR0A 3CMAS 3I5AA 3L4BC 5D15A 3M9OB 2ZHAA 3H25A 4F4KA 3UCUP 3BN7A 3GFHA 2Y8YA 2CPIA 4LFBJ 1CVJA 2Y1IA 1D9DA 4OX9F 4DV3J 4DUYF 3BYRA 4C8LA 3CMQA 3GU0A 1RACB 3EICA 4QWCA 3O44A 3TX8A 3ENWA 3HFVA 3BV8A 4WKYA 5AE3A 2J7WA 1MU2A 1YTYA 1RT7A 2YTCA 1VC6A 1Q82T 2I5JB 2ZZMA 1VIOA 2ZOMA 2F4VJ 2I0XA 3LQVA 2C3MA 4HT5A 4CQ1A 2HGMA 2WVEA 2MKKA 2FY1A 2JX2A 4OV1A 1Y5IB 2B8QA 3HHLC 2FJAB 2OSQA 2DNRA 2R4FA 2OKQA 1UJ6A 4RW6A 1JLAB 3DDNA 5KFSA 5L9NA 3W66A 2CQIA 3LGMA 4IFVB 5H9EJ 2NPFA 2IMWP 9RUBA 1G6BA 4HI2A 3UD4P 4YDDB 3ZNUA 1RWMB 1JXVA 4WPAA 1TQLA 4ITSA 3ONQA 3JQKA 3W9JA 3NGSA 3B82A 2RSQA 3AQOA 2C2OB 2CDRB 3KLIA 1U26A 2IVFB 5A2QU 2W9CB 1N4LA 1GH8A 1WHXA 1Z1ZA 1CJVA 4XIUA 1X4EA 3OHAA 3T5KA 2ASDA 4IDKA 4ZPTR 5KFAA 1SB6A 3JYTB 2HBQB 3V6DA 4LF6F 3IS9A 3KLHA 3R1LA 2P2CB 1QM9A 1YRTA 1MW7A 2IM3A 5KG1A 3SCKE 3BB5A 2J8AA 4GVBB 1FDDA 1QAXA 2K8GA 2IMOA 5IV3A 1RHJB 3G6YA 1M1KT 3M2UB 4X2BA 5I42A 3HP6A 4UOHA 3GCXP 5EX3A 1EQMA 2E44A 4JI6F 5KFOA 4CT8A 3G8QA 4ID5A 4Y6IA 3IRWP 4I7FB 1YRUA 3H2LA 5D0GA 4TLQA 4DR1J 3IR6B 2XNQA 3M8ZA 3CJRA 4ANEA 1PJ6A 3QMQA 1K1QA 4H4OA 4DV3F 4OX9J 2E1RA 3CDEA 3MMBA 4FYWB 4DSFA 3W2WA 2GHPA 3N6NA 3PIOQ 2Y0BB 2MQ8A 2NSCA 3ADAC 2WRMA 2RQKA 3AT1B 3RBXA 2VF3A 3L7PA 3VAKA 2FZGB 2KM8B 2R2TA 4R8UB 2JL9A 1NMEB 4PQAA 1U49A 1VQMS 4UZCA 2XHWA 2MQQA 2C3OA 4M8LA 2QA1A 4W4MA 2P9CA 2YKNA 3OR2B 3RGIA 2HURA 1S6QA 2K1RB 3JXOA 3O3LA 5KFEA 3RUBL 1YITS 3KLFA 2HIQA 2AMCB 1N5YB 1E6VB 4FXWA 1NPKA 4A48A 2FC8A 1TKTB 4F4XA 4OX7A 4CCHA 2JFDA 1XNQJ 3BM7A 1C1BA 1KFDA 3I0SB 2BACA 4RJVA 4NLPA 1S4FA 2XZTB 1YJ7A 2V4RA 4JI2J 4DN9A 4MTPA 3KK1B 4DV5J 2CNKB 2CG8A 2HRTA 1NPRA 5A8WA 2VONA 2E7XA 3W2VA 5C2GA 1NXIA 4URSA 4ICLA 2M2BA 3PYDA 2FPHX 3OL6A 2VG5A 1R8PA 1QAYA 2MEWA 2HLTA 4BLGA 1HHQA 4UT4A 2C2ZB 3NEKA 2MSTA 2NCKL 4CO3A 3SQGB 1IBMF 1CJUB 4X64F 1NU4A 4IG0B 1U8WA 4CLKA 4F3OA 1HQEB 2BV3A 4RW7A 4GKJJ 2FHJD 4IYQA 5CYQB 3DI6A 4RLEA 1VCTA 3DOLB 3ET6B 4ED3A 3SYZA 4C0OC 5AT1B 4QWAA 3M6WA 2RUGA 3GR1A 1SCJB 2KXFA 2OFHX 5AE1A 1IKYA 4A8SA 2KJWA 2CFXA 2H9ZA 2YKPA 1YG0A 1FXDA 3PM9A 2ZUAA 1FRIA 1OPZA 3MEDA 1HNVB 4FN5A 4OYAA 5KFDA 4YP3A 3G96A 2VIHA 2N3LA 3Q8VA 2ZD1B 4KGMA 4CM2A 2J8SA 2CYYA 2RT3A 4LR9A 4ZS6A 4DBQA 4ZVTB 2VL1A 1UA1A 1CQMA 5B0CA 3UWTA 4USJC 1U8SA 5IZHA 3VAFA 3EE3A 2VH7A 3DOKA 4WK3A 2OEKA 4ETZA 2JRSA 5KFMA 3JAMY 3D4JA 1C0UA 2BANA 2KYZA 3CIZA 4HI1A 4IFYA 2NYHA 4P2MA 4UQTA 4DDFA 3TYTA 4Q8EA 4UY85 1HW8A 4WXOA 1VRTB 4ELVA 2CZ9A 1X5SA 1KQFB 1HWIA 1R0BG 2GQQA 3T41A 2CQ4A 3E3XA 4A8XA 4CRJA 3MFIA 5B0EA 2WTFA 2ZH2A 1I6JA 7FD1A 4ZK7M 3GIIA 4O3PA 2NXUA 1FVSA 4FS2A 4KBIA 4IQXA 3HO1A 1S6PA 4JI2F 2RH3A 3M05A 4WIQA 4EBEA 1HMVB 1SVDA 1F2HA 1U24A 3G82B 4Y2MA 4CO2A 4IRDA 3SSRA 5HI7A 3W65A 2J6TA 2AYEA 1BQNA 2LKZA 1H6KX 1KQGB 2GAGC 4ZCMA 4QWBA 5IXUA 4DV0F 5K20B 1S1TA 3OUYA 5J2MA 2O67A 1QJHA 3EUNA 2DR5A 1UVNA 2VQFJ 2D3UA 1U45A 3K8VA 1G3OA 4ECRA 1KLNA 4JV2A 3FNNA 5HVFA 2YNGB 3LGHA 2XY5A 3DXSX 1NH8A 1TL7B 3SFGA 4F3MA 2KYXA 1Y4ZB 4OL8A 1X9WA 3LTOA 4HHUA 1VR6A 5K8PA 1I5OB 1UZHA 3P3DA 1FX4A 4IH7A 1WOSA 4F4AA 2NREA 4C98A 4URGA 1VLYA 4OLOA 1QVGR 5KFUA 1K0VA 4X4SA 4YR3A 2QL9B 1R0AB 2FZKB 3A3NB 5L9XA 4KKOB 5J1NA 1H2TZ 2M7SA 1TUWA 2B9XA 2VB6A 3U1LA 1PO6A 2OPQA 4MH8A 2B6AA 1HI1A 3FC9A 4ZPAA 1KNZA 3HD2A 3F0NA 5D8HB 3DGVA 2MKHA 2BBEA 5AE2A 2BOAA 2DNKA 1NCLA 3HLUA 3G71S 3LALA 1RP5A 2LDIA 1KONA 3FMBA 2VBYA 2GO8A 2VFTA 4LF2A 4ES1A 4YN3B 5HP1A 3OBIA 1CQNA 3BH7B 3R27A 2HWIA 3BZQA 3WQPA 1PIEA 1EP4B 4X4RA 3DGPB 4WP3A 2OI2A 3BYPA 2VKZG 4Y2KA 3DRRB 4DG1A 3C66A 3IR7B 3LUYA 5GAEI 1GQEA 3OSNA 2OH2A 4LFCF 4UTGA 5ETRA 5BYQA 5J2PB 3H0PA 2HMIB 2MTLA 3J7Z5 4GO7X 4O3OA 5KFHA 3TRGA 3CB4A 4ZVFA 1NDKA 1HD0A 3GYGA 5EHHA 3T5HA 1I94F 1RT6A 1PGZA 2O3DA 1NKCA 3R5AA 2QEXS 4C4WA 4LVOP 2Q3PA 4B3RJ 1GK8A 3BBBA 5HQ8A 2BE2B 2W4PA 4DV1F 3HFZB 4OJ3A 4ZLNA 4WCEQ 1RYRA 4K7QA 2M8DB 4JI4J 2QT7A 4CH1A 3J81Y 1Y5LB 2VFUA 1BQMB 1UETA 3QO9B 4RW9B 3GV5B 3OR1B 4KFBA 4Q45A 5L8RC 3QZ7A 1S1UB 2V4JA 5E41A 4LFCJ 2AIRB 1MWYA 2DPIA 1Q8KA 4YUDA 1HI0P 3GFYA 2GMJA 3KUGA 1CULA 1RQ0A 4LBHA 4DG1B 4RNOA 1SJ1A 3DLGB 2MGZA 4F4WA 2AD9A 2F65A 2CQ1A 1EJ7L 3TJ8A 5I3UA 1F3FA 2Q1LA 3CPWR 5KOXA 1NRKA 4NZ0A 1F2GA 5F3TA 1N5YA 3VAJA 3W5YA 2R7XA 1JXEA 1VQNS 1JLBB 5IT9Y 1PYSB 1SH3A 4RR5A 1FRXA 4ANCA 5B09A 1PAEX 1ZM2A 2G0JA 3I9ZA 2OPQB 3MM5B 2V2QA 2H5EA 4C2MA 3TZXA 4CNZA 1KVJA 2GQ2A 3P6YC 3GQCA 1RTDA 1T05A 1HBNB 3H5XA 3UDLA 1U2CA 2W8LA 2QZ8A 1TV6B 3KUEA 1V6HA 2LQJA 1AW0A 2XMJA 2VUGA 1RU1A 4CYUB 2VG7B 3UN3A 2J9DA 2ZVSA 3DKDA 1OQ6A 2ZBPA 5D4LA 1UMJA 3V2UC 4WE1B 4R5PA 1N6QB 4FYDA 2H5IB 4L76A 1BWVA 2FJBB 3QSIA 5HBMB 1TL7A 1TMMA 2YKAA 4A8OA 5C25A 4AE5A 4DCJB 4A47A 4F0KA 2MGZB 3LF0A 1KTQA 3TQEA 2G4BA 4U8VA 2MQPA 2E1PA 2B4UA 1CLFA 4ZCKA 2KVQE 4J37A 3THPA 1W7WA 3RAQA 3L3CA 8RUCA 2WB1D 2OEMA 1BY9A 2G2OA 4L3NA 1DTTA 5T7LB 4XPCA 3MR5A 2HWHA 2CPXA 1SPBP 4MYTA 1FCAA 2XNRA 3C6UB 1S49A 1V3RA 4B3OA 3G82A 2KL8A 4LRAA 3B6BA 4O44B 3K57A 2ZM6F 2HG4A 1SC6A 2LQ9A 4Y2IA 2E7WA 2UVVA 2DRAA 5KG7A 1U0HB 1MLAA 4BCAA 3KKFA 1LWFA 3GIKA 3HM9A 4KR0B 2RU3A 1VQYA 4RZRA 2CAJA 1TU0B 2QN6B 2QA4S 2WAQD 3R3TA 2WONB 3NGRA 3GJRB 4FNHA 1YBAA 4P7TA 4DPWA 3A13A 1JLAA 3I55S 4LF8J 2N4DA 2V0NA 4LRCA 3UNGC 5K9FA 5C42B 2UUWA 2HQDA 3PG9A 1ZAXA 4I0WA 2IDLA 3EYZA 2DEJA 3F56A 3ZXWA 5DLGA 1RWPB 2X1GA 4NLWA 1IBLF 1AB8A 4FF3A 1MMLA 4B3OB 2XHCA 2BW2A 2UUBJ 3A4TA 3NKYA 1MU2B 4FVMA 2EKYA 3VR1A 3NS7B 5ITHA 4NLGA 1FRMA 6FDRA 2FQQB 2M88A 3L95X 2ZE2B 2GGPA 2G9OA 4F2RA 4FYVB 4LSNA 1T03A 2QLWA 3NLCA 2OP5A 5LJ3Y 4DX8H 1FDBA 3BO4A 2HVIA 4AXJA 4YR2A 2VHGA 3QRRA 3B4MA 1BGXT 2JC0A 2V2KA 1HI8A 2MKSA 4J9LA 5GAGU 3CD7A 2W2NP 4EMDA 1RHKB 4K4TA 1FXRA 3R5CA 4K2JA 3CJTA 3NS6A 4DHVA 1XMQJ 2UXCJ 2DNHA 2IDEA 3HSGA 3MD3A 3S01A 5K8NA 4DV0J 2GC8A 1O5JA 4RW7B 1S1VB 5BR8J 1WEXA 2AHOB 1HNXF 3MXHP 1W2BR 3SQGA 3TAPA 1YJTA 3OTEA 4X4OA 1FJ7A 4FPIA 2MZQA 4UW2A 5HSPA 2W2PP 2NUUG 2VA3A 1HBOB 3B78A 1RAFB 5D3GA 1SBRA 4C3MA 5DO2A 3CCTA 1KLMB 4X65F 3CCQS 4RWWA 1X7VA 1J27A 3CIMA 1OO0B 3MPWA 1QE1A 1S1TB 1S9EA 2A3JA 2HZAA 2NXEA 2WSEC 3FSYA 4YB7A 5J2MB 1UL3A 2AJ1A 4AL6A 1S1XB 2KRRA 4XO0A 2A2DA 3MUVP 3DGPA 2BRLA 3CF5Q 4EO8A 3ENAA 1WSVA 2YXLA 1UFKA 1TKDA 1FTCA 4ZJOA 3CJQA 3ZZTA 1S6PB 1VIXA 5D0EA 4ED8A 4ZP7A 3K5OA 4HYKA 4FBTA 4KH0B 4OYBA 2YKNB 3FFIB 1UW4A 2JHEA 2HHXA 4V1Ak 3M1VB 3I96A 1XMBA 4RUAA 5LT5A 3FZ2A 2RDJA 3EPGA 1EETB 2DYAA 1VK8A 1D8ZA 2BE9B 1A9NB 3ZZUA 4B17A 2HEKA 1RJJA 3P49B 3H90A 3HHLB 1AUDA 4RPFA 2RQCA 4W92B 1F5BA 3P45B 1BD6A 1RCXB 2UV8G 1NZ8A 3UN5A 4FF2A 4I2PA 4BBYA 3IRXB 3CE8A 2YX4A 4QWDA 5KAKA 3ILLA 2D69A 1REVA 1WC1A 4HL9A 4I2QB 1YJ9S 2QC3A 3RRGA 1CULB 1Z2ZA 3HPOA 2CJ9A 1E6YB 1QDUB 3PJ9A 3DMJB 2FC9A 3LGNA 4WKRA 3LWLA 4K4UA 4CZCA 3NWRA 1FE4A 2H51B 3D67A 3R5DA 4NASA 4NL5A 4OHWA 3V5RA 5CABA 2A6MA 5KTQA 3AAWB 4X4TA 4FS1A 2DHXA 1JJHA 3SCLE 2F1FA 2YWWA 4DQIA 2BEFA 1BQXA 1HMVA 1Q5YA 2GMHA 4TY9A 4JI8J 3GR0A 3N01A 2DR8A 4NXNJ 1N5SA 1V5IB 4QOTA 2VBZA 3D3BJ 2ZEJA 2EFGA 2OLWA 3RR7A 4H4KC 5LMUF 1J5OB 3QSYB 5MLCV 2R7OA 3HJVA 4IFVA 2HHQA 4ILRA 4ZVQB 3VF0B 1Y7PA 2KG1A 4L72B 2CPHA 4GKKF 1UPPA 1FA0A 1F3VA 2KM8C 5H9EK 2HGLA 2V8VA 3MAAA 4LR7A 2XBPA 4CO1A 2NYIA 2QYCA 3C2PA 3O6QA 1NK0A 4HLBA 5J1EA 3RU0A 2OIHA 1G1XA 2KZZA 5D4PA 3K89A 1UEKA 4WYWA 5HANA 1JJ4A 2MQMA 4LRFA 1YJUA 2XZWA 1S59A 2L3MA 3GONA 3GYXB 5E7OB 4JV0A 1LV5A 5L46A 1N6QA 4LQ3A 3OPKA 3CJ0A 3IGVA 3TUIC 3JSMA 4CH0S 3W1YC 2ZKTA 3F73A 3EM1A 3GG1A 4OYIA 1YIJS 4NXNF 2XQCA 1FD2A 2HQIA 3TANA 2B6AB 1KP6A 2HAIA 2MY8A 3M32A 4IRKA 3MM5A 4Q8FA 3UD5A 2WK4A 4F0MA 5I4MA 1FE0A 1H74A 1RT5A 5BYSA 1ZH5A 1RI7A 2E5GA 2D41A 4XDCA 4WFAQ 3QWPA 2R2UA 2KFNA 1K73T 2FHJA 3EZUA 4MT1A 3MMCA 1NSQA 5HMXA 1M5HA 2GCFA 4P2XA 2I1RA 3FBEA 3PFEA 4JI1F 1VDHA 3NNHA 4EZ9A 4I56A 1VQ8S 2Z0GA 2ZWOA 1NKEA 4IUFA 1TMJA 3HCXA 3KJFB 3HVTA 5BXIA 5JXSA 1G2EA 1RT2A 4DF8A 5G0RA 4AYBD 1NJWA 2D3OR 2HNZA 3KDOA 4ED0A 2DB1A 4BWMA 5KG5A 3IWNC 2EKNA 1N88A 2GVZA 3N6LA 5CXTA 4LF5F 1D9AA 1FRKA 1UKUA 1Y10A 4IDKB 4OJGA 2IBOA 4CLPA 4AFFA 3G6XA 5IC6B 2LU1A 2ADBA 1SL2A 1DTQB 5DG7A 4ZLPA 2GJIA 3CNQP 3HVAA 4OX8A 5GADU 3M4XA 4KC5A 5B0FA 3D1HA 3PXGa 4XPEA 2ZE2A 9ATCB 3UD3P 3E51A 4ZHRB 2FVSA 1DLOB 1W26A 3MAQA 4BWJA 4QR1A 1VQ4S 4E2FB 1WC4A 3GSIA 3CC4S 4KGZB 3MM7A 4RW6B 2Z57B 3W64A 4DU7A 1WJ9A 3NRBA 4HR2A 3QIPA 3TAMB 4A8MP 5JVGQ 2DIVA 2MZSA 2ADCA 1IBMJ 2MJNA 4F7VA 1XN9A 2FJEB 1HLWA 2B7CB 2RUSA 2WW4A 4JI0F 4Q44A 2MLZA 3D1QA 1W2IA 2V2ZA 5HL7Q 3C16B 3QJJA 3GP9A 2A10A 2EXUA 1WDDA 1Y5NB 3OW2R 3AA8A 2ILZA 1HNWF 4OI3A 3TO8A 2UVWA 4KPYA 2YX7A 2IRXA 2J9EA 4NI2A 1Q4RA 4N77A 2B8PA 3Q8SB 2W9AA 2KB2A 3HZGA 2DBBA 4CO0A 5HLFA 1NK9A 4PWDB 3J7AN 4ENOA 3GYNA 1WWHA 1WG4A 4ZVRB 1XTZA 4DFJA 3DM2A 4CO5A 5KT5A 2Q66A 1RBOB 2DGUA 5DDQC 3ILJA 1CSJA 4M5MA 2V69A 4G65A 5LSRA 5G4DA 5G0RB 1E6YA 3QFHA 4TU9A 2BRKA 4M5LA 1RHMB 1M5PC 4G1QA 4QPTA 2M3DA 3S8SA 5F8NA 3TJAA 2UUCJ 2LCWA 4ZVOB 2RS8A 3BQ1A 3QT7A 1REVB 3Q8QB 4IR9A 5A6WA 3LOUA 4Y34A 1FF2A 1ZS6A 3G9CA 2CNNB 2HMIA 2CRLA 5JJBA 4NEYA 1U1NA 5HMYA 1T9WA 2VV5A 1M5OC 1X31C 2UVUA 4D3GA 5DDRC 1HNIB 4MFBA 2UUTA 5F8HA 4JYAF 1C1BB 1EIYB 1IUJA 4E98A 3Q24A 4LF8F 3ETMA 4EUVA 5DDPC 2V94A 2DD8S 5HROA 2MHNA 2CQPA 1L5UA 1HHTP 3MTKA 1E6VA 2DGWA 2ZWPA 3I5CA 4FBUA 5E3QA 2P6TA 5F3ZA 4TU8A 4YMEA 1HKAA 3GJTB 4DQSA 2UUBF 3LANA 3OL7A 3FK4A 3NGKA 4FNIA 3H42A 2OTLS 2EFPA 1H7XA 4C48A 2XLIA 3A12A 1S9FA 3BGRB 2YKMA 3G6VA 3K17A 1FKAF 2G13A 3EGZA 3TZWA 2EC2A 3E01A 1KHVA 1LQ9A 3QGGA 5AJ3J 1RWNB 2BABA 2L08A 4KPCA 4ZJLA 5KFBA 4DUYJ 1JIHA 3GPAA 3T1YF 2Z4PA 2BQ3A 4KV8B 1K8AT 4LFBF 2O5DA 3GB0A 4ED6A 1T94A 3D66A 1HWJA 3BGRA 2K2PA 3CW2C 3FZBA 5B0DA 4DPUA 1NM2A 3M8YA 4YB6A 1VHIA 1TL3A 4JBCA 2QYGA 2CPZA 3IFEA 1R8HA 2CQGA 2RIJA 2XMWA 3AB4B 5IV4A 1RTHB 2BKNA 2L9WA 2VG6A 3KHHA 1XMOJ 1AT1B 2QO3A 3J7YU 1RKJA 1HR0J 2UU9J 4KSEB 2D74B 1B64A 4J9PA 1UJ5A 1XC9A 4PRFA 4PXEA 4Y2CA 4PQUA 4EEYA 3MM8B 4FF4A 3NS5A 3EDRB 1IN0A 3IS9B 4MKVA 2VPYB 1H98A 2ZH4A 5D6GA 4LBPA 1KBRA 2MLXA 3CD5A 5IQQA 1GTHA 2HFZA 4BC9A 4F50A 5FD1A 2SXLA 2PO4A 3Q2SC 1CEZA 2CUYA 3M8QB 3C46A 4NLYA 4K8RA 2YH1A 4NWBA 2HVZA 2UVRA 3BDEA 3CTRA 4X4QA 1XQIA 5ETVA 2AJ2A 2CVEA 1KHWA 3FJ2A 3FVYA 4LF6J 2AV5A 5FIIA 2RD5C 3Q8UA 3PRDA 1W25A 5AXNA 1SI9A 3J81U 3AOCA 4TVAB 1T8EA 2VG7A 3WBZA 1FDNA 1DAXA 1V3ZA 2IA0A 4TNOA 1X9MA 4JI6J 1IVZA 1UWBB 4WXWA 1VC0A 1WF2A 5L1LA 1XNRJ 3CCMS 4USVA 3SCIE 4QWEA 2LXFA 3CJKA 3ZFVA 3KG1A 1RTZA 1V9OA 3MR7A 5GMDA 2VPXB 4QIVA 2QIFA 3QIDA 1AA1B 4ZPBA 3O8WA 1VGYA 3HT3A 4KO0B 3KG4A 2Z2LA 2EPIA 3ITHB 3LWMA 1Q86T 2EEYA 1Q53A 2DXDA 2Z2MA 3FCVA 4OZ5A 5D0HA 5KT2A 1J5EF 4C3LA 1D8YA 3KHGA 1YX2A 2DXFA 4RBTA 5A2QY 1S1XA 2O1PA 2KT2A 4I4BA 1KWMA 4ED2A 2C2RA 1JXLA 3DLLQ 3SQOP 1YWXA 2FJWA 3HKZD 2DIUA 2RRBA 4RKUC 1C1CB 2G0CA 4ZA1A 2MQOA 1OSDA 1FKOB 2OPPA 2IYGA 4X64J 4OHVA 1K0TA 4JI4F 3M2VB 4QIFA 1FEHA 2B7BB 1PBAA 2D3ZA 4OQJA 4J9SA 2OPRA 4NOHA 1WTBA 3M2RB 4M5NA 1LKZA 4WFYA 2XC9A 1OYEA 4OHYA 4G1QB 2HFNA 1JNRB 1N54B 3K5LA 2RQMA 2F4FA 4DZDA 2DNZA 3KG0A 4F26A 5HVGA 1Q5VA 3NWGA 5E33A 3DLEA 2AYGA 2KHCA 4PG6A 1P1TA 4KB7A 4F4YA 4K4VA 2QG9B 3S1TA 4NLTA 1KS2A 4USTA 3UN2A 4JI1J 2ACYA 4QU7A 2X7IA 1PJ5A 4PQUB 4JYAJ 1RT1A 3QT6A 4PEOA 4RW8A 1D0EA 4X62F 2MKYA 2H65B 2MHEA 3CO9A 3MECA 4CIOA 1WOOA 3GWCA 1U1OA 1GMWA 1RHQB 4M5DB 1S72S 3M6UA 3NGDA 2W7AA 4M95A 3DRRA 4YB1P 3VAMA 2OMLA 3PFOA 4GRSA 2YNHA 1ZOTA 4ECWA 2CNOB 5EX0A 3R1HA 2W24A 2AWZA 4ECUA 2Y9HA 4YR0A 2V8PA 1X9SA 2KJVA 1N5TA 1WEZA 1RDRA 1RZMA 1LK5A 2E7VA 2NZCA 4LRBA 3CJ3A 1T9XA 2IC3B 2RAQA 3ELHA 4PXBA 3DRSB 3DXBA 2GV1A 1RT1B 1I51B 1NHKL 1AZSA 3FEYB 4WP8A 4KE5A 4O3NA 1NPPA 2XMVA 1XJWB 3MM6B 3GIMA 1NBEB 4CLFA 4E0DA 2WVFA 3MEKA 5CD4H 2QX0A 2DHGA 2V68A 3QO9A 1OY6A 3N28A 4N76A 3W7BA 2A1BA 3LH2S 3QGHA 4NLSA 5U47A 3FBBA 2Q79A 3ISND 2VD3A 2JVOA 5E0OA 4OHZA 2YBVA 4U6PA 5K8OA 3KK3A 2BZ2A 4MKYA 3AHPA 3T9NA 3TAQA 2ZVIA 2WHOA 1PYOB 4UF4A 3OJUA 3OTCA 5CH7B 2ATCB 5F8MA 2R7TA 3MAAB 3SCJE 3ZTPA 3BBFA 3POTB 5ETOA 2VKRA 2DNMA 2WVCA 1FKOA 4N8OA 4QU6A 1ACMB 1HIYA 2WBMA 5EWFA 1FDAA 1NB7A 5E3RA 3MUMP 3U02A 4LSZB 1NHUA 1SL1A 3BSNA 2FLNA 1NH7A 2NZ4A 2KFZA 5HMWA 3CWJA 1OSCA 2EC0A 4Y28C 4OYPA 4L6V3 1HWKA 1S9GA 4AL5A 4FZVA 1XERA 1GMWD 1RLDA 4OI2A 2HNDB 4RU2A 4LIWA 4RUHA 2DJWA 4RL1A 2F40A 4AUKA 2K1RA 3R5JB 4I2PB 1UWAA 3CCJS 1JLGB 1RT5B 2IM1A 4ECTA 2V8GA 3BGFA 1WNEA 1BMQB 2IM0A 2C3YA 3HHEA 2B51A 4NMLA 4F36A 1RGVA 5A76A 3OSPA 3IAS9 1LNQA 1U47A 1IBLJ 1UVMA 1M1HA 4LF1A 3SIPB 3PRVA 1H3DA 3JAMU 5EN1A 4KT0C 3N4WA 5I3PA 2I8EA 3KK3B 1AXQA 2M4MA 2KH9A 2MKIA 3W62A 3J80Y 1A0OB 4C8KA 2GJ2A 4NI2B 3KLGB 4F67A 1FD8A 2DNLA 2XS2A 2HHWA 2WSCC 5KFCA 3PW5A 2DY9A 5ETQA 4N41A 2UXCF 1L3UA 4JOUA 4NLVA 5KT7A 3DU5A 3W5ZA 3KJVB 4B3SF 2DEIA 5KT6A 4R0EA 2HLUA 2J6UA 1S1WB 1RT4B 1B0VA 2Y0SD 4K4SA 1S48A 2FHOB 3R9LA 3CSKA 1FXLA 4QPXA 1TKZA 3C6TB 3MMAB 3V6DB 1J5OA 1FJGF 2VFVA 2MQNA 3M1VA 3U1NA 1BQNB 1VQKS 2ZJPQ 3D6HB 4X62J 3PR4A 3MEGB 4OI1A 2ZDOA 3NBPB 1KRPA 4RNHA 1CJUA 3RW7A 2C28A 3MECB 1U02A 1RTHA 3V4MA 5KFWA 3W9IA 4PPZA 2X1BA 2LXUA 5KT3A 3CD0A 2JEJA 2M0GB 2LVWA 1P9YA 3TX0A 1T9YA 3J7A1 4IOBA 4RW4A 3RBDA 3KNGA 4DX6A 1QE1B 1GTEA 1Q8LA 1OY8A 1X4CA 1ZM9A 3MCSA 2W1BA 5MAOA 4IFYB 3UW1A 1Y00A 4R0JA 4I2QA 3T3FA 1ZM3A 1SKRA 1WC5A 4ZVSB 4P71A 2AU0A 1RADB 1UVIA 2GGPB 2HVDA 2XMKA 3E01B 2ZJQQ 2UXBF 2FIUA 4M63A 5ETPA 3SSQA 2CDQA 4GC6A 4UOGA 1X4GA 2GVDB 1GMUA 1XK8A 3BKFA 3EZOA 3F44A 4ZMMA 3D68A 1IQZA 2W25A 1S6QB 4KH1B 2I6WA 1B70B 5CYMB 1AROP 1SUQA 3HSZA 5DZ6A 2CJQA 3ZTQA 3EX7B 4DV2F 1SJ3P 1OIAA 3W60A 3AY0A 2E5JA 3HHLA 3U1MA 2CQCA 2AGOA 4B9MA 1S76D 4JV5F 3PJWA 4OJHA 1X0PA 3IM9A 3MPDA 1LXNA 2ZBQA 4CT9A 2HRYA 2RB7A 3WDOA 2JVRA 1SUQB 1U0HA 2CJAA 2U2FA 3MMBB 5AXLA 3RTVA 2XYGB 2CWXA 3HHNB 4I1TA 3GFZA 5T41A 4NMXA 5E3AA 3AJ1A 1NKBA 2GVDA 4MIAA 4AQYF 4LREA 2RE1A 5GAHU 4UY8T 3M8SA 1JLCA 1QUVA 5T14A 4HTJA 1T7PA 3DRYA 2D1CA 3HKWA 4EFAC 4DSEA 4NXMJ 2VC0A 2DKOB 2R9LA 3HK2A 2YNIB 3G6ES 4HKQA 4J9VA 2EWHA 2MQLA 2QSFA 3D0GE 1KLMA 1ULRA 3UVJB 2QLBB 2KKHA 1YKWA 4MK8A 4P10A 5GMKa 3VALA 3MR3A 2E29A 1VS3A 2EK1A 2B5JA 5AXKA 3FUYA 3MEEB 1QLNA 2O66A 4ZVGA 2VFSA 2A0FB 2MDAA 3AXMA 2MPUA 4I6AA 4P73A 5B0AA 2J6SA 2DXEA 4ECVA 3MEGA 1WF1A 4WFNQ 5E5NA 4TU7A 4ER8A 3V81B 3QWUA 1HPZB 3MM6A 4RUBA 3PIPQ 1P6TA 2B9WA 5IQ6A 1FNXH 3OFEA 2AT1B 2QV6A 3L09A 5CCLA 2XZDB 1MWQA 2GFFA 2ZC4A 4A8YA 1HD1A 1QY7A 2BUNA 2BJDA 2DGTA 3ICLA 4UUXA 4J9UE 5D77A 1TK0A 4DLEA 4DPOA 2KDOA 2QMWA 4UQGA 4J9QA 3CJSA 1N0VC 5IT4A 4YFUA 3DRPA 4F3QA 1KEKA 1C2PA 2GQCA 1PAUB 5ETNA 3PY8A 3T5JA 2FDNA 4LFAJ 2YNHB 3CD6S 1HFEL 2EBEA 1EHWA 4CLUA 1TAQA 1OMSA 3KLGA 5HP1B 1U7LA 4M94A 3P96A 3PYGA 2HS4A 1PKUA 4L73A 5LXRA 1JMTA 3TA1A 4Q5VA 1R8BA 1MN9A 4NYOA 1DARA 4GKKJ 2VODA 4F8RA 2VQFF 3IG1A 3H8YA 2J7UA 2CPYA 3BSAA 3JYTA 4DV4F 1R0AA 2DHSA 3CEDA 2HBRB 3VHQA 3KMQA 4B9NA 4DUTA 4M1KA 4ZKAA 4TY8A 1JLGA 1P9QC 2PGCA 5KFLA 2OHDA 2E66A 2R3VA 3K2YA 4NXMF 1IBKJ 1LK7A 5HK4A 4PAAA 4LF7F 3M8PA 3ETOA 3MEEA 2AX1A 1WG5A 5THWA 1NK4A 1M5SA 2L41A 1VJQA 2XSJB 1UZDA 2PT0A 2MZRA 4NLDA 5EUHA 4U67Q 1B99A 1R8CA 1NB2A 3UFCX 1C1CA 4ZP6A 3WX4A 1RWXB 2PEHA 4J91A 3BPDA 3ZTOA 5EDWA 2JOQA 1GX5A 4L75A 1DBDA 1Q78A 2MKCA 3GSDA 5CA5A 5KFJA 1RTIB 3KJVA 4FXDA 3HF5A 4PUOB 2HSEB 2ZZTA 4CNYA 2QJ3A 3WC2A 3EMTA 3H4DA 3M8PB 1ZZNA 3BSCA 2LDYA 1FKPB 1FJEB 4DSIA 1IBCB 4ECSA 3CDUA 1FJCA 2N7YA 3K0JA 1SXLA 2C42A 1S7HA 4R8UA 2ZH8A 5KFXA 1L3TA 3DLKB 5KFKA 2P6SA 4OZ0A 3MUTP 1HW9A 2YWGA 4CLTA 1QSLA 1LWEB 2HHVA 1IJFB 1NJZA 2VOOA 3CJ4A 1VQ5S 2W8KA 4TQRA 1IQTA 4B3TF 1FK9B 3NOGA 4ZIWA 4MK7A 4MIWA 4H4MB 1Q16B 5KG6A 2J0SD 4KJIA 3HJFA 3AA9A 2YNFA 2V34A 3PACA 3TNVA 2H48B 1C0TB 3CJ2A 2ZZNA 1CJKA 4PG7A 4HACB 4TYAA 1GXTA 4CTAB 2DTJA 5CYJA 1VRQC 3IBCB 4DPXA 3PKYA 4C11A 2DNYA 1QD1A 5HVHA 1IKWA 3ZZRA 2DCLA 4G3IA 3U7JA 3T6JA 4NCBA 3J80U 3A8KA 3IA0A 4X66J 3G8TA 4DR7F 3RB0A 2JEGA 2WONA 4LBIA 2KG0A 4MK9A 1S1UA 3JSRA 4U96A 8ATCB 4RW9A 3OL9A 2RKIB 4DXLA 2FTRA 4KFBB 4CLYA 1L3VA 1GXLA 2BJ7A 2IAJB 3C15A 4WU2A 4XAKA 5IM0A 2DH9A 3D9BA 2AKWB 5LMNF 4WFZA 4QIWD 2Z8QA 1R8AA 1JJ2R 1MROA 4K4WA 1WC0A 4OYXA 2FVCA 2VBWA 1VQ9S 1PJ7A 5H9FJ 3R5BA 1OY9A 3TEGA 4QIEA 4C0HA 2N7CA 3BKTA 3CCWA 2NPIA 3I6PA 1XIQA 3WX8A 1Y0HA 2WW8A 3GFXA 4EWTA 4P52A 2FVRA 2RNEA 4KV8A 4MAKA 4RNMA 1TL5A 1DURA 1B4SA 4JI5J 1ZA2B 5CZXA 5HO4A 2H4WB 3NL0A 2J7KA 3GJSB 2I5JA 3DRXA 1MSWD 1EQ0A 3RAMA 1EETA 4PABA 3OVAA 1YVFA 3P4UB 1T03B 1KC8T 3CT9A 3OLBA 4H4MA 2E1AA 4U7UD 5A0YA 1F9FA 1T95A 1UW9A 4CYUA 4DQPA 1CC8A 3D0IE 4B02A 3I82A 1TV6A 5IWAJ 4F4ZA 2HYIB 2XWXA 4IH6A 3T9ZA 3IG1B 1NNDA 4NCAA 1EZZB 3D3CJ 3US5A 1AZSB 3IWXA 3JSBA 4ZPCA 4I6YA 5CAAA 4ZLJA 4RUCA 4RNNA 4DR4F 4P75A 2V8HA 3PYEA 3BF4A 5J2NB 3L9ZA 1CC7A 3QQCD 5AXMA 1M5KC 2AQ4A 4DQRA 3EJMA 3MPVA 4H4OB 1F5CA 6FD1A 1Z4UA 3NGTA 2VC1A 3H5UA 5CQGA 2CPJA 3BREA 3WZ0A 4Z37A 5D3GB 2MZTA 4NRTA 2PFFB 2BW7A 2G1HA 2YNGA 2VZ9A 2V9KA 3UR3C 5A6PA 4DL2A 2UUAF 1FWPA 2D7SA 2QLFB 2AEMA 3OFHA 2R7UA 1UPMB 4KQZA 3ZZ0A 2GZOA 7FDRA 4X84A 1YBTA 4OYMA 2PC6A 3AOBA 1WORA 1ICEB 1RU2A 1IKVB 2CZ4A 2CNLB 2IYIA 2F8EX 3M9MB 2W4CA 2VBXA 1RKIA 3AD9C 3LP1A 3M6VA 4NA2A 4NX9A 3UNYA 3DYAA 3M8RA 4LF4F 3JQJA 3IMQJ 2EVZA 3PW7A 1A6LA 4KGXB 5IOLA 4C97A 2NUHA 2YQ1A 3PHEA 1CS4B 4DPYA 1T3NA 1CJVB 3VCDA 2B9YA 4A8WA 2BJ3A 4FVCA 3MF5A 3GILA 3H2UB 3LP2B 1U2RA 2DNOA 5DQIA 5HLFB 3HSJA 2JFKA 2WZ1A 5HN0A 1U1QA 1DRZA 4EZ6A 2IAJA 1S6OA 2XB2D 3CC2S 2MLYA 4J9NA 3KHRA 2DR9A 4ERDA 2E5IA 2P9EA 3OLAA 1LEOA 2JLFA 3NCQA 2XEXA 1QAJA 4IQMA 4XDDA 4O3QA 3HVWA 4OI4A 5KG0A 1TELA 1F5AA 3OVBA 4PXDA 2E1CA 3PKMA 1OYDA 4NYPA 1D9FA 1MMNA 1FT8A 1R89A 2GJFA 1JLCB 2JZ5A 2MZJA 1PSDA 2PE8A 2OO4A 3BO2A 5GADI 2F8MA 2NXCA 2ZBCA 1REGX 1B0PA 2IJFA 3MOZA 4DV7J 2ZITA 3IRXA 4DR3F 2XLJA 2CWKA 1P27B 3IO1A 4Z7YA 5I42B 3MD1A 1HYSA 3BDPA 4OHXA 1SKSA 4DV2J 1YQHA 1DTQA 1NAQA 1NK5A 5AJ3F 2I9SA 4NLXA 4TN2A 2B56A 2F4VF 4TKTA 1UP1A 1N0UA 5B0GA 1QSSA 1XNQF 1Y11A 3DFEA 4DMZA 4X66F 2QA4G 4OI0A 2RS2A 5T7LA 1ZPWX 2J0WA 2X1AA 3RRHA 2RRAA 4BDPA 4FPRA 1EARA 4OV6A 4Q2MA 4ID8A 4KRWA 2KXNB 4K4ZA 3HVTB 2W9BA 2Y1RI 3FBCA 4I7FA 4JI3J 3EGVA 2HNYB 3Q8PB 2Q6CA 3M2RA 5KT4A 4C8OA 1AUSL 1VRUA 1HBMA 3T1AA 4HVZA 5HBMA 3FRZA 2JLGA 2M70A 1O8BA 3RRKA 1WTFA 5DQGA 1RA6A 2GHVC 2XYPB 3Q89A 3PTWA 2DO4A 4HHHA 2HZVA 1DQ9A 2CQ3A 4RX6A 4URQU 5IWAF 2C1EB 4PG8A 4DQQA 1VC5A 3IWLA 3K5NA 4DPTA 2E5LJ 1VK3A 3LP0A 5K14B 2Y1LB 3KK2A 3D54A 2R42A 2EFQA 2ZHBA 1VI7A 5HJYA 5LMUJ 4PWUA 5DRKA 3MPUB 4Y00A 1WD6A 2V67A 2MJUA 4ZCIA 5IFMA 5F8GA 2ZNZA 3JS9A 3P8BB 4KO0A 3KLIB 4YY3F 1P1LA 2W9CA 1SJQA 3R2CJ 3W3SA 3IR5B 3HVRA 1RAGB 3ZZZA 3BR9A 2YKQA 4DV5F 3WC0A 2FLOA 2IVYA 5ETTA 3AH6A 4X4NA 4KHRA 2PMWA 1A7GE 4OZ2A 2RF2B 4RBUA 2IM2A 2CZVC 1WKKA 4M5HA 4OIXA 4F02A 1LW2A 2K7JA 1WKLA 4O0NA 2BJ9A 2WVDA 2C2EA 5M2PA 5A8KA 4IOAQ 3P5BP 1H0HB 2QGFB 1TKXB 2XSFA 1N48A 1RCOB 1TR0A 2HZCA 2KT3A 4LSNB 2DK2A 3MM9A 1X4BA 3W2WB 3BN4A 2DGVA 3DOKB 2J0XA 2HBYB 3QPIA 3Q23A 4DF4A 4DSLA 2D3O1 2FB0A 2EW9A 4DX7A 1S99A 4IKAA 3Q22A 2Y1JA 4YY3J 2D9PA 3R6GB 4ECYA 3BGLA 3OXLA 4LF7J 5KFQA 2APOA 2AX0A 1F6TA 2CG4A 5IC4B 3VAGA 1QSYA 2FJVA 5KFFA 4AT1B 2F7VA 3C19A 4OX6A 1CJTA 2M52A 1ZTTA 1JWWA 2R7QA 1X60A 2CVIA 3THTA 3C14B 3LPEA 2YX1A 5J1PA 2ILYA 2K7KA 1R7IA 1P8GA 3KWMA 4P7VA 1KQKA 4DR6J 4EYIB 3I87A 3KHLA 3NP5A 1AFIA 5GAEU 5CYQA 3LPYA 2YQ3A 2PA8D 1VJWA 5F9LA 4LMZA 3JSYA 1KVIA 1HWLA 3CDWA 3FEXB 3G86A 3TOQA 3MURP 1RAJA 2AEJA 1DFDA 5J2PA 2IVMA 3ZZYA 4TXSA 4ECZA 1KFSA 2FJDB 1S9GB 4DX5A 2HKEA 5LL6d 5I3QA 3AXKA 3EGNA 1XEZA 2B5JB 4KGKA 1C0TA 3AJDA 4ICLB 1LWCB 4CWBA 2NS1B 2VFRA 3RG6A 1KD1T 1H38A 2HNYA 4FXVA 3MCMA 3FRYA 1RISA 3PRBA 2JLEA 1N32J 1HBUB 1OQ3A 2ZOGA 2DISA 2J5AA 3CJ5A 1Z2LA 1RT4A 4V19X 1UFWA 2GO9A 2W7PA 1JLFB 5DM6Q 5KG4A 1MN7A 3IM8A 4FKXA 4CLWA 1WC3A 2PN6A 4C9DA 4DR5J 4ILMA 1GAOA 3FGVA 2XULA 2V50A 1TP7A 5JMNA 1QVFR 1V3SA 1RSCA 4WZMA 2CQ0A 5F9NA 1D1UA 2H3EB 3D28A 4X4VA 1FJGJ 2XTJP 5J1EB 4AL7A 1WF0A 2HAFA 3OXGA 2J9CA 2DHAA 2ZM6J 3PYFA 5E2QA 3J81j 3QZ8A 3H59A 4C8ZA 1LW0A 2ZBIA 1FFWB 3B4DA 3NCRA 1UA0A 2OFGX 1SJFA 3NXZA 3O2IA 2EFVA 4I6WA 1NJXA 3V6JA 3BBCA 2HFOA 2M9KA 3HXMA 4ALZA 3WIVA 2HHHF 4ZJQA 4ZCLA 1HNZJ 3OV7A 3QJPA 1MROB 1HBOA 1QTNB 2QMUB 1MNEA 4OZJA 2V8DA 3UCGA 3OTOJ 3QATA 1HQUB 3KUHA 2G2YA 1CG2A 3VVUA 2AZ3A 3A8IA 4Z7CA 4UZBA 1BHNA 1R6YA 1T02A 4PCQA 3M8QA 2I38A 3VZIA 3THVA 3L7UA 3SZ2A 2AW0A 1C4CA 4NA3A 1HHSA 4DL6A 1RAOA 1Y3JA 2VU5A 1IJEB 4RW4B 4P74A 3BO3A 3FSIA 4DS5A 3Q0AA 4DSKA 1B7FA 2E1MC 3MPYA 4USKA 1YSJA 3M8WA 4NA1A 1EX8A 1KDNA 4JI5F 2HW3A 2N4CA 2HHSA 4KYZA 4WYLA 2UZAA 3MFHA 3BR8A 4B9VA 1VQPS 2BQUA 3R7BB 4XK8C 3PX6A 1GFWB 3HDSA 2XCPA 1UEVA 2KT5A 1X8DA 5H1SV 5EWGA 3I0RA 1ZZFA 2COLA 1H2VZ 2CA9A 1K1SA 3FMWA 1TK5A 2GAHC 2NSBA 3I31A 1KKHA 2RRNA 4HDHA 1RWKB 2OPPB 3UPFA 2YY3A 1RA7A 2R2RA 3VQTA 5M2UA 2LEAA 4DR5F 1SJ4P 2RDIA 2F9JA 2K3IA 3MM9B 3GV8B 4JV1A 2H4YB 4GO5X 1J5EJ 3NMAA 2KHDA 3W8PA 3GTYX 2H1YA 4ZVHA 4Y2AA 3OQ2A 3AQPA 1ZA1B 2G1DA 3DLKA 3IP0A 3JQMA 2BVZA 3N0VA 4CI0B 4PPDA 3IC1A 2FVPA 3QBCA 3VGTA 1S5ZA 2V9WA 4M5DA 3DLHA 2YPZA 4H4KA 1JLEA 4HH1A 3KLEB 2DGOA 2HIYA 3BPSP 3RYLA 3T6BA 4HEA9 3SDEA 5LOQA 5GVQA 3JSMB 2V6AA 1B7YB 5F8JA 1IWAA 3ZTSA 5F8IA 1PCAA 3J7ZT 4O4RA 4N56A 1CS4A 2X51A 2ZH5A 3ENQA 3C6UA 4EBDA 1NO8A 2KFYA 1MG7A 2BQRA 3QRPA 4PXCA 1U6ZA 1WG1A 4DUZJ 2HNZB 2ASYA 3EXYA 1YJRA 3LP0B 2LYVA 1SKWA 1RBAA 2AEFA 3FDSA 3IBWA 3SV3A 4DR2J 1S0NA 4LF9J 1YJWS 2HS3A 3MCNA 2E5LF 3X3UA 3G8SA 2CXEA 2JC1A 4O23A 1N5VA 4EI2A 1YJVA 1RYSA 3QLHB 2W4DA 4ED1A 1FO1A 3AD8C 3DU6A 2CQHA 1SC4B 3LAMA 1JLQA 3ULHA 1AYEA 1RUSA 3P5TL 2RJZA 1FERA 2CPEA 2EG1A 3ZZPA 3EVMA 4O4GB 3IXQA 4PG5A 4M5IA 4L3KA 3SFUA 3JTOA 1S12A 3IAM9 3K59A 4DWIA 1NK8A 4PWDA 3SXLA 2ASJA 3VAIA 4QYRA 1NUEA 2LA4A 2OSRA 2ROGA 1WACA 4WIIA 3CCUS 1SQFA 1TAUA 3DN9A 1FRLA 2UXBJ 4USIA 1OJ4A 2R8JA 1VFJA 3PJXA 5CHCB 4ZIVA 2W2QP 4DV1J 2J0QD 5KFVA 1HYSB 2JDJA 2JNJA 1N36F 5KFZA 4GVLA 1ZBTA 2IIHA 1XR5A 2E5HA 2PI4A 1YJNS 3PEJA 4JI7F 1RE1B 5I3UB 3PV8A 2JH3A 4MKAA 5L1KA 1UEUA 3KTQA 4B08A 3MI7X 3RB4A 3CVKA 3RB3A 2HBZB 1Q8IA 1UCNA 2L9DA 2Q6BA 3N5BA 3NAHA 4XTTA 3KYLA 2BA9A 4ES3A 2VDHA 2CJXB 2C22A 1VBZA 2DPJA 3E8OA 3QIPB 3TAMA 3CUNA 3VV2B 3QAUA 2HGNA 2ALZA 1UJ4A 2VOPA 3GIJA 2ZKUA 2XMMA 1IXKA 3KLHB 2RF2A 5CZVA 2H54B 1RAAB 3D5MA 2VASA 2ZNYA 3EWGA 4ZHRA 3NNCA 4IG3B 1DQAA 1URRA 1R3NA 4UOCA 3OTOF 4U9RA 4P2SA 5F8LA 5FLXU 3AFGA 2IJRA 4O44A 2VJVA 2FLLA 2IA6A 3OTBA 1R31A 2Z2ZA 4C3KA 1FTRA 5F0UA 4C6AA 1XNRF 4OYZA 3NMRA 4W90B 3UVJA 4HH0A 4B9SA 3H5SA 1XMOF 2UU9F 1RWVB 3GLJA 4JUZA 1Y3KA 2KXHA 4DLGA 5KG2A 4CP5A 4WU3A 3R6LB 4DS4A 4WF9Q 2WOMA 4CLZA 1B0TA 1HQUA 2HHTA 1S0VA 2C3UA 2DVIA 1TL3B 4OZLA 4UUWA 2ZJRQ 3T5LA 3KXDA 2J9DE 3M2VA 2HFVA 3EVWA 2UP1A 3D6MB 1IR0A 5LM7E 2C2NA 4Z2XA 4R5PB 3KNAA 4NZ7A 3DNCA 2POKA 5HATA 3PW2A 1ZPVA 1M5VC 2RHQB 1U0SA 1WHVA 5CCMA 3TVKA 3JTNA 3MGJA 1J2VA 1LWEA 2AF6A 2LEPA 3OJSA 2YQ0A 2LEBA 1T05B 1LFWA 3GG0A 4OFZA 1KTVA 2F5GA 3ITHA 4KGVB 4C8MA 4DZ6A 4E8UA 2ZH9A 5HAOA 3V6HA 1HR0F 1HNWJ 1WI8A 2FHMA 2QSWA 3K5PA 1WHWA 2OEJA 4CM0A 5HQLA 4ZVUB 2AYBA 1TL1B 1WC6A 3HHLD 3R97A 2A2CA 2YPYA 4YQWA 4B9UA 1X0FA 1N5QA 2DY1A 3CJKB 1HNIA 3HFKA 4HHJA 2WOMB 5K14A 3VTIA 5H9FK 1DTTB 2EFOA 2RVJA 2L48A 4M5JA 3H40A 2HQCA 2RILA 3R8YA 3EGWB 3KJQB 3W8GA 3KOAA 4I67A 5D78A 3MM7B 3NOCA 5J2QA 3NGUA 1R6VA 2RDDA 1XMQF 2C2DA 3UDVA 3OVSA 1LWCA 1M90T 4K0KJ 3VGUA 1LWFB 2DCUB 1RABB 4ZPWR 5HMZA 1IR1A 1RT3A 5L38A 1D3WA 2YWHA 3G4SS 1JKHB 4J90A 3I56S 3HSDA 1YHQS 4OJ1A 4WK1A 4PYDA 1NSAA 4USHA 4Q43A 1YI2S 2DNPA 1X4AA 4JI3F 4U95A 3D6TB 3PW4A 1O51A 2W2MP 3D6FB 2AJ0A 2HQGA 2QL5B 3MM8A 4X65J 2OD6A 2AJQA 4MIBA 1K44A 1X4HA 4O0IA 4D3HA 4YS2A 3MHYA 3PO5A 2CADA 2CQ2A 1ZETA 3BJYA 4DFKA 1OS5A 3VZHA 3DDKA 3I4HX 4ZP8A 2WSFC 5E3PA 4HACA 1EP4A 1H7WA 4B3RF 1U1MA 3QGIA 1F60B 1PBUA 5B0BA 2YH0A 2LXIA 2XWYA 1RTJA 3R5GA 2QFJA 3EDQB 1XR6A 2QLXA 3M9NB 4DV4J 1ZYQA 1NZAA 1TL1A 4WFBQ 4N5SA 1BLUA 1HNVA 3FKBA 1TTHB 5ETSA 4DR7J 2RMLA 4W98A 3DOMB 2LP4A 2MKJA 4Q2LA 4JI0J 1NDLA 4ES2A 4DR4J 1LW2B 1V5VA 1SJRA 3LAKA 4YDXA 5C24B 5LSLA 2DRBA 4B3TJ 1L3SA 3GE9A 3NAIA 2XI2A 2HK3A 3OD2A 4JP8A 1G4CA 1HQEA 1JQGA 3AD7C 2UV8A 3GJQB 3MDFA 2HHHJ 4LFAF 3TVYA 2Q43A 4KHPJ 1JLBA 3ISNC 1Y9OA 3LP2A 2MY7A 4ZVEA 1IM6A 2BX6A 4G1PA 2MZ1A 4LT6A 1FKPA 4NLRA 2OAUA 1RAEB 3DDIA 2B43A 2OMOA 3TUPA 1NEEA 1FI4A 4LUBA 2NXNA 2P5VA 2PEBA 1KQSR 1IKVA 3CJ8A 3IBFB 3W61A 2JWNA 1Q8BA 1S9EB 2HQ3A 2OJ3A 1WDTA 1HBUA 1ZM4A 3PDNA 1NSPA 1Q7LB 1X5PA 4EO6A 2N82B 2XO7A 4J9RA 1VQOS 2E9ZA 4RWXA 2XSJA 2DH8A 2BE7D 5ETLA 2LLZA 4N7TA 1UFLA 4WFXA 5RUBA 1U1PA 1IBKF 5D0RA 1L3KA 4QBUA 1BUXA 2KU7A 1BQMA 2HHPA 2PIIA 2DNNA 2EBGA 2O01C 4JI8F 2PFDA 4WJBA 3BSOA 3KLFB 2A6OA 2BM0A 3SDEB 5DDOC 1DQ8A 3HT0A 1U1LA 2BE2A 3L7OA 3OR2A 5EWEA 1NHVA 1TZ0A 2KI2A 3G87A 1Q0NA 4QQBA 3Q8YA 2P8IA 1KVKA 5J2NA 1H72C 1RK8A 1HBNA 2XO6A 4DR2F 4O3RA 4HT7A 4GC7A 2DR6A 1SIWB 5A8RA 2X1FA 1Q95G 2Z56B 1FRJA 4J9MA 4ZN3A 1VRTA 3K7RA 1RB0A 2ALYB 3D1OA 1U6FA 4DU8A 3A3PB 1ZAVA 3GIRA 2V4QA 1TL4A 2R7RA 4F25A 3I32A 3SSSA 4QR2A 1WEYA 3QNWB 4DN0A 1RTJB 3RBEA 1VQLS 3LW5C 4MYUA 4DR6F 2ZH6A 2NR0A 1N33F 5DQHA 2HFUA 3LA0A 4HTIA 4WWSA 5JVHQ 3NNAA 1H2UX 2VDIA 2VA2A 1FEEA
chains in the Genus database with same CATH topology
2F65A 1TMMA 2CG8A 3HT0A 1F9HA 3ILIA 5ETTA 1RU2A 3HSGA 5ETQA 4CYUA 1IM6A 4M5JA 1Q0NA 4PZVA 5ETVA 4M5HA 3KUHA 3HD1A 2QX0A 3HD2A 3UDVA 3ILJA 3MCNA 4M5MA 3UDEA 1RB0A 1CBKA 1RAOA 3IP0A 1HKAA 5ETPA 4AD6A 4M5LA 1TMJA 3HCXA 3HSJA 1DY3A 4M5GA 5ETMA 5ETSA 4CWBA 3QBCA 4F7VA 5ETKA 2F63A 3HSDA 1EX8A 5ETOA 1EQMA 4CRJA 3KUEA 3MCMA 4M5NA 5ETLA 3HSZA 4M5IA 1KBRA 1RU1A 1RTZA 5ETRA 4CYUB 1EQ0A 3ILOA 3KUGA 2BMBA 3ILLA 5ETNA 3UD5A 3MCOA 4M5KA 1G4CA 1HQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F65 A;  1TMM A;  2CG8 A;  3HT0 A;  1F9H A;  3ILI A;  5ETT A;  1RU2 A;  3HSG A;  5ETQ A;  4CYU A;  1IM6 A;  4M5J A;  1Q0N A;  4PZV A;  5ETV A;  4M5H A;  3KUH A;  3HD1 A;  2QX0 A;  3HD2 A;  3UDV A;  3ILJ A;  3MCN A;  4M5M A;  3UDE A;  1RB0 A;  1CBK A;  1RAO A;  3IP0 A;  1HKA A;  5ETP A;  4AD6 A;  4M5L A;  1TMJ A;  3HCX A;  3HSJ A;  1DY3 A;  4M5G A;  5ETM A;  5ETS A;  4CWB A;  3QBC A;  4F7V A;  5ETK A;  2F63 A;  3HSD A;  1EX8 A;  5ETO A;  1EQM A;  4CRJ A;  3KUE A;  3MCM A;  4M5N A;  5ETL A;  3HSZ A;  4M5I A;  1KBR A;  1RU1 A;  1RTZ A;  5ETR A;  4CYU B;  1EQ0 A;  3ILO A;  3KUG A;  2BMB A;  3ILL A;  5ETN A;  3UD5 A;  3MCO A;  4M5K A;  1G4C A;  1HQ2 A; 
#chains in the Genus database with same CATH topology
 5DLF A;  3LO3 A;  2WB4 A;  4NEZ A;  2OD4 A;  5FLX Y;  3T1Y J;  1QAI A;  3Q86 A;  4GVB A;  1GT8 A;  2AP6 A;  2LMI A;  4P2F A;  1S79 A;  4ZVP B;  4RO0 A;  1U6B A;  4ECX A;  1N34 J;  1SC1 B;  1N36 J;  3DI6 B;  3H2V E;  1PC4 A;  2DH7 A;  4IH5 A;  3I5B A;  4RU9 A;  1T3O A;  4DL4 A;  2FVQ A;  4OZ3 A;  2BOP A;  4BS2 A;  5KG3 A;  4NLU A;  2R2S A;  4MMO A;  3ZO7 A;  2ZDP A;  2U1A A;  4IOC Q;  1RLC L;  5FJ4 A;  2V63 A;  4LQ9 A;  1RT6 B;  3PEH A;  1RTI A;  2CJK A;  1S0M A;  1T11 A;  5KFN A;  3FQL A;  3HHK A;  1YBU A;  4P72 A;  8AT1 B;  2RQ4 A;  3R7S B;  4ELT A;  3MCO A;  5C5J A;  1I3O B;  1VBK A;  1C0U B;  1EKS A;  2A18 A;  2BAN B;  3I0S A;  2EFN A;  3ILI A;  3EXC X;  3MZI A;  3POT A;  1TUV A;  4H54 A;  3RBZ A;  3H5Y A;  5KFP A;  1UVL A;  1U09 A;  4GMK A;  1F0X A;  3GZ7 A;  4ZPV R;  3TUZ C;  4FKY A;  1YZ7 A;  1RAI B;  1KOO A;  3CGI A;  1WSR A;  4ELU A;  2ZD1 A;  4JI7 J;  4IO1 A;  1XBW A;  1FK9 A;  3D0H E;  1FWK A;  3N79 A;  1Q1K A;  3A8E A;  4Q0B B;  4KTQ A;  1WOP A;  1FX2 A;  2KTQ A;  5GME A;  3OTD A;  2UXD J;  3BEG B;  4NLO A;  3ZTR A;  4C7Q A;  2UUA J;  1R0C B;  2KRB A;  3ZC4 A;  4GKJ F;  1YZ6 A;  2CJY B;  3VWS A;  3HZE A;  1JB0 C;  2F9D A;  4Y3C A;  3FFI A;  1DZ5 A;  3DOM A;  4NE9 C;  4DCO B;  3OFG A;  1QTM A;  2LU2 A;  4Q0B A;  5CYM A;  4FP9 A;  2LEC A;  2HVH A;  1YRX A;  4R25 A;  4F04 B;  3UCZ P;  2BDP A;  4ZPD A;  3G2X A;  4C8N A;  1F1B B;  3FCW A;  4ID5 B;  1UVJ A;  2QTW A;  1Q7Y T;  2X3G A;  1HL6 A;  3BS9 A;  1T9T A;  3QLH A;  2XS5 A;  4WTO B;  2VIC A;  2PA3 A;  1PIL A;  4Y65 A;  5C7P A;  1ZTW A;  4QYZ J;  2ZOF A;  1S4E A;  4DSJ A;  4RW8 B;  1U2F A;  1WKJ A;  1GMV A;  1FRH A;  2G2Z A;  1NLK L;  2RHS B;  4CLL A;  2GIQ A;  2IRU A;  3S6E A;  2ERR A;  1YK9 A;  2QE5 A;  2W01 A;  4NCG B;  4Q7A A;  1HPZ A;  2FUG 9;  3MMJ A;  3OR1 A;  2GS8 A;  2UXD F;  2BJE A;  1K47 A;  3RJM B;  3RZA A;  2W7O A;  3OT9 A;  2CIM A;  1TK8 A;  4M5K A;  1S1V A;  1HNZ F;  2QRR A;  4KAI A;  1KN6 A;  1NDC A;  4QJV A;  2OTJ S;  3TEH B;  3C8Y A;  3NBP A;  1PYT A;  5DS7 A;  1U48 A;  1N33 J;  3PX4 A;  2KZM A;  4J9K A;  1VQS A;  1X5T A;  4QW8 A;  3C3L A;  2B4P A;  1Q81 T;  2DRD A;  1TKZ B;  1U25 A;  1QUP A;  3C6T A;  3MMA A;  1PG5 B;  1VLO A;  3TZY A;  2MXY A;  2YNI A;  5IT9 U;  1SKU B;  2B4V A;  3KK1 A;  2FJX A;  3VVT A;  1YDL A;  1UAW A;  4NRU A;  4P9S A;  3CCS S;  1ELO A;  2CQD A;  2OPS B;  1S1W A;  2RU9 A;  4WTY A;  2VQE J;  4DFP A;  1RWW B;  3W5X A;  2NLW A;  5ETM A;  2R7W A;  3SV4 A;  2P9G A;  2K3K A;  4CDI A;  4EBC A;  1KOH A;  2M5Y A;  3DHX A;  1CJK B;  4CTA A;  3OL8 A;  4F2S A;  2YKO A;  4G1I A;  1FWL A;  2AYM A;  4WE1 A;  4ZN1 A;  5DJB A;  5KFY A;  2B9E A;  3PHT A;  3CCR S;  4I68 A;  1OWX A;  3U27 A;  2V5H G;  1WUU A;  1X4D A;  4BHQ A;  4ETX A;  7AT1 B;  4ZLL A;  5LXY A;  4IO9 Q;  2D9O A;  2Z30 B;  5E3C A;  5JUM A;  5DM7 Q;  3IN5 A;  2ROE A;  5KFR A;  2QL7 B;  2GVZ B;  2DNG A;  2HRU A;  4OLP A;  3KK2 B;  1N34 F;  2IPO B;  4IG0 A;  2DT9 A;  4X4U A;  4OYO A;  1VYA A;  4LR8 A;  4O4G A;  5A0Y B;  1JKH A;  2DGX A;  2AZ1 A;  2PSZ A;  3N9U C;  5EGY A;  3TI0 A;  4ATN A;  2GW8 A;  2B3T B;  3T1H F;  3PNI A;  4DV6 F;  2VG5 B;  4M5G A;  1HBM B;  2QA2 A;  2WBR A;  2FZC B;  5ETK A;  2XGQ A;  3QJL A;  3HMJ G;  3BGO P;  3CCV S;  1IKX B;  4BC7 A;  4FYY B;  3UQS A;  5LSO A;  4IR1 A;  1VOM A;  2W9B B;  1T0T V;  3M6X A;  2FY8 A;  3V6K A;  5J2Q B;  4WBF A;  2MMY A;  2PDA A;  3HUL A;  2YWF A;  2ZH3 A;  3D7S B;  3OUY B;  2HK2 A;  3TQ1 A;  3RW6 A;  2PD1 A;  5LJ5 Y;  4Y0F A;  4TLR A;  1F9H A;  3TJ9 A;  2ZC3 A;  3F41 A;  2GNK A;  2JSX A;  4K5R A;  1VBX A;  4K4X A;  5SZT A;  2R7S A;  4QZV B;  4RNF A;  3CCL S;  1VHF A;  1UVK A;  4MKB A;  1K9M T;  2FYX A;  5L1I A;  3KLV A;  1U4B A;  3UDC A;  1WHY A;  2C2M B;  3C15 B;  3PX0 A;  1BC6 A;  4AQY J;  5BYR A;  4DI6 A;  5D4O A;  2KN4 A;  3VQS A;  4DOZ A;  4QYZ K;  2XY7 A;  4NPO A;  2JJ4 D;  3C16 A;  2XM3 A;  2FGC A;  1G7C B;  2XMT A;  4PYA A;  5C24 A;  4DL0 C;  3MR2 A;  3PR5 B;  1X5O A;  1F9E B;  2WVB A;  3X1L B;  2IC3 A;  2LQ8 A;  3GV7 B;  5F0W A;  3DRS A;  2HQF A;  3KDN A;  1NK7 A;  4ILL A;  1IKW B;  2BKP A;  1TKX A;  3HX9 A;  2BMB A;  5BJR A;  2YWE A;  3M7V A;  2Z2Y B;  2R8I A;  1O6X A;  1RHR B;  2ATL A;  4KHP F;  1GX6 A;  1LFP A;  4N47 A;  1DLO A;  3E2E A;  2YNF B;  3AB2 B;  3TZZ A;  4USU A;  4J7C A;  2IHR 1;  2X3D A;  3VGS A;  1S10 A;  3DLG A;  3H98 A;  4K2X A;  4O3S A;  2LQB A;  2GA7 A;  1HNX J;  2VPZ B;  2HS0 A;  4X4P A;  3NG8 A;  4WZQ A;  2Z58 B;  5FDL B;  1T9V A;  3QT8 A;  3TWZ A;  4NCG A;  3AOD A;  3I9V 9;  4KKO A;  4AD6 A;  5A8R B;  3MOJ B;  4AND A;  3TUJ C;  3TR5 A;  4JB8 B;  4MFB B;  3D2W A;  3CC7 S;  1VIS A;  2ACM A;  1FNM A;  5KOW A;  4DR1 F;  1NDP A;  2HPU A;  3DCA A;  2K06 A;  3DLJ A;  1LOU A;  4NZ6 A;  4CLS A;  3A1Y G;  4B3M F;  3C14 A;  1ITP A;  1RT3 B;  4QR0 A;  4USM A;  3EZ5 A;  1SH2 A;  1SV5 B;  3EVO A;  1I94 J;  3H4B A;  2LA6 A;  1JLQ B;  4EYH B;  4J9O A;  3A3O B;  4DL3 A;  2FGO A;  1M1G A;  4RBV A;  2GML A;  2OPR B;  2F8H A;  5K5M A;  5HQM A;  2DNQ A;  5BR8 F;  2AGP A;  4U7C A;  2ABY A;  2OGU A;  3I4P A;  3SI8 A;  1DHM A;  1M0S A;  5A8W B;  1RHU B;  2KVI A;  3PVX A;  4DJB A;  1N8R T;  2VJU A;  4V19 J;  1LW0 B;  2IFX A;  4LSL A;  5ADZ A;  1SC3 B;  3MTJ A;  1GNK A;  2F3J A;  4TQS A;  3H7H B;  3MR6 A;  2ZH1 A;  4LJM A;  4ED5 A;  1T9U A;  3M32 B;  2HHU A;  4S0M A;  1ZAW A;  1SIZ A;  1RT7 B;  2DGS A;  2W2O P;  3BH6 B;  3QT5 A;  3M30 B;  4WP9 A;  5L39 A;  5CD4 A;  1WI6 A;  2BM1 A;  2DGQ A;  2IRY A;  3W63 A;  2FLP A;  2R8G A;  3RR8 A;  3QRQ A;  3TP2 A;  4UOF A;  3TAR A;  3DC2 A;  1LWX A;  1SQG A;  3T1H J;  3UO0 A;  3BQ0 A;  3V4I B;  1S77 D;  2XLK A;  3FBF A;  5HRO B;  3M30 A;  3CME S;  1RTD B;  5B7W A;  2C3P A;  4YEA A;  2I2Y A;  1IR2 A;  1BE4 A;  4OZN A;  1UWB A;  4DR3 J;  1ROF A;  4OMF G;  1JLF A;  2DO0 A;  4HDG A;  1NJI T;  2MSS A;  4ED7 A;  2C2K B;  4FYX B;  3A8J A;  3OXF A;  1EB0 A;  2ZBR A;  4U7U K;  2VPW B;  1URN A;  1YLX A;  2HFS A;  5DZ7 A;  4PR6 A;  3UDE A;  2HND A;  1HAR A;  2CPF A;  3J7Y I;  4AXI A;  2OUG A;  1LXJ A;  4A46 A;  5DET A;  2XY6 A;  2EK6 A;  4K50 A;  4DV6 J;  2M8H A;  4DCP B;  2ROP A;  1S57 A;  3I0R B;  1OPI A;  2AJ4 A;  4L74 A;  4MJK A;  2DHH A;  5IT0 A;  2AGQ A;  2F63 A;  4A8K A;  3K8W A;  1IM4 A;  2CPD A;  4LIR A;  2BJ8 A;  1MWZ A;  2R7V A;  1APS A;  5DG8 A;  2B4O A;  5IM0 B;  4IRC A;  3Q2T C;  2L9N A;  2N3O A;  1VQ7 S;  2JEI A;  3PZP A;  1NK6 A;  1NSK L;  3QFW A;  1FVQ A;  2XMA A;  2CQB A;  3DYA B;  4NYZ A;  1HA1 A;  3DM2 B;  4USW A;  1VMB A;  3Q83 A;  5FDL A;  6AT1 B;  5HJX A;  4EU0 A;  3V81 A;  1H73 A;  2BKO A;  3ENV A;  5KFG A;  2QFI A;  3DLE B;  4B9T A;  2XMU A;  5F41 A;  3QYY A;  2CJB A;  2B0G A;  5KFT A;  2Y8W A;  4LF4 J;  1JLE B;  2MYF A;  1FFG B;  4PKD B;  4PG4 A;  3KLE A;  1VBY A;  1N56 A;  3EPI A;  4QCL A;  2GX8 A;  3FCH A;  5SUH A;  1CBK A;  1U1R A;  2EI5 A;  3KFW X;  3MAH A;  1D09 B;  1DJ0 A;  2EG2 A;  3W2V B;  2DIT A;  1WEL A;  2NXJ A;  3BKU A;  3MMC B;  4FDF A;  1XWL A;  4U8Y A;  3SBM A;  3ZNJ 1;  2FHK A;  2GIF A;  4CO4 A;  4OZ1 A;  3CDB A;  2AJF E;  4ZOS A;  4TYB A;  1SH0 A;  1KSP A;  5C42 A;  4YHH J;  2QMX A;  5C2C A;  4CH7 A;  2WCX A;  5KFI A;  4QIG A;  1HQ2 A;  1TKT A;  2LFV A;  1EAY C;  2IJN A;  5B08 A;  1FFS B;  3VGV A;  3QAE A;  3H20 A;  4KIA A;  4EK2 A;  1S7I A;  4C8Y A;  3NCP A;  1FHT A;  1N32 F;  2LQ5 A;  3TA2 A;  5DG9 A;  3V4I A;  1SL0 A;  1IWG A;  3MED B;  5LMN J;  3VAH A;  1CPZ A;  4OI6 A;  3N5F A;  2PMH A;  1JNZ B;  4KY3 A;  3SMZ A;  1IKY B;  1MMD A;  2ZH7 A;  2FD2 A;  1JJC B;  4DL7 A;  2JEF A;  1TFW A;  1TUG B;  4A8Q A;  1BWE A;  1TFY A;  4B3S J;  3ZZO A;  2VQE F;  1R43 A;  4K0K F;  3DOL A;  3CDA A;  3ET6 A;  2BXJ A;  4LRD A;  2XS7 A;  1JX4 A;  3T19 A;  1RWU A;  3LP1 B;  4DV7 F;  2XYH B;  1BXN A;  4B9L A;  4A4J A;  2ZFH A;  4N8N A;  5DGA A;  4B3M J;  3CCE S;  2H5J B;  2NQP A;  3MWB A;  1C4A A;  1RXO B;  5DGB A;  2R8H A;  3CCZ A;  1R27 B;  1Q79 A;  3R2D J;  4I64 A;  3PW0 A;  4JV5 J;  3M2U A;  3PO4 A;  1SV5 A;  1NJY A;  2J76 E;  2YVS A;  3AJ2 A;  3ISZ A;  4TY8 B;  3BGU A;  3WIU A;  3FEZ A;  3UE2 A;  2MB0 B;  2RKI A;  2Y3Y A;  1KR4 A;  3DLB A;  3O1L A;  2XG8 A;  4J5O A;  3BQ2 A;  4PWW A;  2HWT A;  3DMJ A;  3HHD A;  3O5T B;  3SEO A;  2ZHO A;  2G0I A;  1VQ6 S;  3KJN B;  2VG6 B;  5M2R A;  2PMZ D;  4IG3 A;  2BJ1 A;  4C11 B;  1S0O A;  2R8K A;  2ASL A;  2YWK A;  4FF1 A;  1FNO A;  3HI9 A;  4ZDN A;  3TVZ A;  3IGN A;  3ILO A;  4C0B A;  2BYC A;  1YGY A;  1AFJ A;  1PC5 A;  4DFM A;  2XI3 A;  5D4N A;  3DRP B;  1GEH A;  1S97 A;  1GXU A;  5K8M A;  3CUL A;  2OPS A;  3FSX A;  3N6M A;  4DL5 A;  3AOA A;  4LSL B;  4PZV A;  3RAX A;  1RWO B;  2E9T A;  1B3T A;  1UTA A;  4K4Y A;  1RBL A;  2V4J B;  4DUZ F;  2PI5 A;  1XR7 A;  4KHM A;  2YKM B;  4LVN P;  1O0P A;  3QGP A;  2HVE A;  3JTP A;  4OYW A;  1EKR A;  3Q8R B;  4ZIT A;  4EGL A;  4ECQ A;  3PCO B;  2DR7 A;  1N52 B;  3NY0 A;  1X4F A;  3OFF A;  4ZP9 A;  2XCA A;  2UUC F;  4A8F A;  3WHI A;  4YB5 A;  2QLJ B;  3S7R A;  4PUO A;  5IS2 A;  3B8H A;  4P6Q A;  5L1J A;  1FES A;  4NLQ A;  1I1G A;  4K5S A;  4K59 A;  1HWU A;  4LF9 F;  2CKW A;  5GAH I;  3OHB A;  4ED4 A;  1RT2 B;  3GMG A;  3DHW C;  3W9H A;  5GAG I;  1S6U A;  4YHH F;  3JB9 k;  4LF5 J;  3K58 A;  1TVR A;  2GIR A;  1CJT B;  2KO1 A;  3UR0 A;  3RB6 A;  3R7N B;  4G6V B;  1U1K A;  4F0H A;  3HD1 A;  4DEZ A;  5C25 B;  3K5M A;  1IKX A;  2GHW A;  4YOE A;  2IY5 B;  3TA0 A;  1VRU B;  4I69 A;  4QW9 A;  2IBK A;  1JK9 B;  2E9R X;  3CXC R;  1TVR B;  1RAH B;  1DY3 A;  2ZUG A;  3KMS A;  1SQE A;  3B54 A;  3CO0 P;  3TW0 A;  2V2V A;  2OEL A;  3GCW P;  3FQK A;  3UI3 A;  5A8K B;  2XGP A;  2BR0 A;  3CMA S;  3I5A A;  3L4B C;  5D15 A;  3M9O B;  2ZHA A;  3H25 A;  4F4K A;  3UCU P;  3BN7 A;  3GFH A;  2Y8Y A;  2CPI A;  4LFB J;  1CVJ A;  2Y1I A;  1D9D A;  4OX9 F;  4DV3 J;  4DUY F;  3BYR A;  4C8L A;  3CMQ A;  3GU0 A;  1RAC B;  3EIC A;  4QWC A;  3O44 A;  3TX8 A;  3ENW A;  3HFV A;  3BV8 A;  4WKY A;  5AE3 A;  2J7W A;  1MU2 A;  1YTY A;  1RT7 A;  2YTC A;  1VC6 A;  1Q82 T;  2I5J B;  2ZZM A;  1VIO A;  2ZOM A;  2F4V J;  2I0X A;  3LQV A;  2C3M A;  4HT5 A;  4CQ1 A;  2HGM A;  2WVE A;  2MKK A;  2FY1 A;  2JX2 A;  4OV1 A;  1Y5I B;  2B8Q A;  3HHL C;  2FJA B;  2OSQ A;  2DNR A;  2R4F A;  2OKQ A;  1UJ6 A;  4RW6 A;  1JLA B;  3DDN A;  5KFS A;  5L9N A;  3W66 A;  2CQI A;  3LGM A;  4IFV B;  5H9E J;  2NPF A;  2IMW P;  9RUB A;  1G6B A;  4HI2 A;  3UD4 P;  4YDD B;  3ZNU A;  1RWM B;  1JXV A;  4WPA A;  1TQL A;  4ITS A;  3ONQ A;  3JQK A;  3W9J A;  3NGS A;  3B82 A;  2RSQ A;  3AQO A;  2C2O B;  2CDR B;  3KLI A;  1U26 A;  2IVF B;  5A2Q U;  2W9C B;  1N4L A;  1GH8 A;  1WHX A;  1Z1Z A;  1CJV A;  4XIU A;  1X4E A;  3OHA A;  3T5K A;  2ASD A;  4IDK A;  4ZPT R;  5KFA A;  1SB6 A;  3JYT B;  2HBQ B;  3V6D A;  4LF6 F;  3IS9 A;  3KLH A;  3R1L A;  2P2C B;  1QM9 A;  1YRT A;  1MW7 A;  2IM3 A;  5KG1 A;  3SCK E;  3BB5 A;  2J8A A;  4GVB B;  1FDD A;  1QAX A;  2K8G A;  2IMO A;  5IV3 A;  1RHJ B;  3G6Y A;  1M1K T;  3M2U B;  4X2B A;  5I42 A;  3HP6 A;  4UOH A;  3GCX P;  5EX3 A;  1EQM A;  2E44 A;  4JI6 F;  5KFO A;  4CT8 A;  3G8Q A;  4ID5 A;  4Y6I A;  3IRW P;  4I7F B;  1YRU A;  3H2L A;  5D0G A;  4TLQ A;  4DR1 J;  3IR6 B;  2XNQ A;  3M8Z A;  3CJR A;  4ANE A;  1PJ6 A;  3QMQ A;  1K1Q A;  4H4O A;  4DV3 F;  4OX9 J;  2E1R A;  3CDE A;  3MMB A;  4FYW B;  4DSF A;  3W2W A;  2GHP A;  3N6N A;  3PIO Q;  2Y0B B;  2MQ8 A;  2NSC A;  3ADA C;  2WRM A;  2RQK A;  3AT1 B;  3RBX A;  2VF3 A;  3L7P A;  3VAK A;  2FZG B;  2KM8 B;  2R2T A;  4R8U B;  2JL9 A;  1NME B;  4PQA A;  1U49 A;  1VQM S;  4UZC A;  2XHW A;  2MQQ A;  2C3O A;  4M8L A;  2QA1 A;  4W4M A;  2P9C A;  2YKN A;  3OR2 B;  3RGI A;  2HUR A;  1S6Q A;  2K1R B;  3JXO A;  3O3L A;  5KFE A;  3RUB L;  1YIT S;  3KLF A;  2HIQ A;  2AMC B;  1N5Y B;  1E6V B;  4FXW A;  1NPK A;  4A48 A;  2FC8 A;  1TKT B;  4F4X A;  4OX7 A;  4CCH A;  2JFD A;  1XNQ J;  3BM7 A;  1C1B A;  1KFD A;  3I0S B;  2BAC A;  4RJV A;  4NLP A;  1S4F A;  2XZT B;  1YJ7 A;  2V4R A;  4JI2 J;  4DN9 A;  4MTP A;  3KK1 B;  4DV5 J;  2CNK B;  2CG8 A;  2HRT A;  1NPR A;  5A8W A;  2VON A;  2E7X A;  3W2V A;  5C2G A;  1NXI A;  4URS A;  4ICL A;  2M2B A;  3PYD A;  2FPH X;  3OL6 A;  2VG5 A;  1R8P A;  1QAY A;  2MEW A;  2HLT A;  4BLG A;  1HHQ A;  4UT4 A;  2C2Z B;  3NEK A;  2MST A;  2NCK L;  4CO3 A;  3SQG B;  1IBM F;  1CJU B;  4X64 F;  1NU4 A;  4IG0 B;  1U8W A;  4CLK A;  4F3O A;  1HQE B;  2BV3 A;  4RW7 A;  4GKJ J;  2FHJ D;  4IYQ A;  5CYQ B;  3DI6 A;  4RLE A;  1VCT A;  3DOL B;  3ET6 B;  4ED3 A;  3SYZ A;  4C0O C;  5AT1 B;  4QWA A;  3M6W A;  2RUG A;  3GR1 A;  1SCJ B;  2KXF A;  2OFH X;  5AE1 A;  1IKY A;  4A8S A;  2KJW A;  2CFX A;  2H9Z A;  2YKP A;  1YG0 A;  1FXD A;  3PM9 A;  2ZUA A;  1FRI A;  1OPZ A;  3MED A;  1HNV B;  4FN5 A;  4OYA A;  5KFD A;  4YP3 A;  3G96 A;  2VIH A;  2N3L A;  3Q8V A;  2ZD1 B;  4KGM A;  4CM2 A;  2J8S A;  2CYY A;  2RT3 A;  4LR9 A;  4ZS6 A;  4DBQ A;  4ZVT B;  2VL1 A;  1UA1 A;  1CQM A;  5B0C A;  3UWT A;  4USJ C;  1U8S A;  5IZH A;  3VAF A;  3EE3 A;  2VH7 A;  3DOK A;  4WK3 A;  2OEK A;  4ETZ A;  2JRS A;  5KFM A;  3JAM Y;  3D4J A;  1C0U A;  2BAN A;  2KYZ A;  3CIZ A;  4HI1 A;  4IFY A;  2NYH A;  4P2M A;  4UQT A;  4DDF A;  3TYT A;  4Q8E A;  4UY8 5;  1HW8 A;  4WXO A;  1VRT B;  4ELV A;  2CZ9 A;  1X5S A;  1KQF B;  1HWI A;  1R0B G;  2GQQ A;  3T41 A;  2CQ4 A;  3E3X A;  4A8X A;  4CRJ A;  3MFI A;  5B0E A;  2WTF A;  2ZH2 A;  1I6J A;  7FD1 A;  4ZK7 M;  3GII A;  4O3P A;  2NXU A;  1FVS A;  4FS2 A;  4KBI A;  4IQX A;  3HO1 A;  1S6P A;  4JI2 F;  2RH3 A;  3M05 A;  4WIQ A;  4EBE A;  1HMV B;  1SVD A;  1F2H A;  1U24 A;  3G82 B;  4Y2M A;  4CO2 A;  4IRD A;  3SSR A;  5HI7 A;  3W65 A;  2J6T A;  2AYE A;  1BQN A;  2LKZ A;  1H6K X;  1KQG B;  2GAG C;  4ZCM A;  4QWB A;  5IXU A;  4DV0 F;  5K20 B;  1S1T A;  3OUY A;  5J2M A;  2O67 A;  1QJH A;  3EUN A;  2DR5 A;  1UVN A;  2VQF J;  2D3U A;  1U45 A;  3K8V A;  1G3O A;  4ECR A;  1KLN A;  4JV2 A;  3FNN A;  5HVF A;  2YNG B;  3LGH A;  2XY5 A;  3DXS X;  1NH8 A;  1TL7 B;  3SFG A;  4F3M A;  2KYX A;  1Y4Z B;  4OL8 A;  1X9W A;  3LTO A;  4HHU A;  1VR6 A;  5K8P A;  1I5O B;  1UZH A;  3P3D A;  1FX4 A;  4IH7 A;  1WOS A;  4F4A A;  2NRE A;  4C98 A;  4URG A;  1VLY A;  4OLO A;  1QVG R;  5KFU A;  1K0V A;  4X4S A;  4YR3 A;  2QL9 B;  1R0A B;  2FZK B;  3A3N B;  5L9X A;  4KKO B;  5J1N A;  1H2T Z;  2M7S A;  1TUW A;  2B9X A;  2VB6 A;  3U1L A;  1PO6 A;  2OPQ A;  4MH8 A;  2B6A A;  1HI1 A;  3FC9 A;  4ZPA A;  1KNZ A;  3HD2 A;  3F0N A;  5D8H B;  3DGV A;  2MKH A;  2BBE A;  5AE2 A;  2BOA A;  2DNK A;  1NCL A;  3HLU A;  3G71 S;  3LAL A;  1RP5 A;  2LDI A;  1KON A;  3FMB A;  2VBY A;  2GO8 A;  2VFT A;  4LF2 A;  4ES1 A;  4YN3 B;  5HP1 A;  3OBI A;  1CQN A;  3BH7 B;  3R27 A;  2HWI A;  3BZQ A;  3WQP A;  1PIE A;  1EP4 B;  4X4R A;  3DGP B;  4WP3 A;  2OI2 A;  3BYP A;  2VKZ G;  4Y2K A;  3DRR B;  4DG1 A;  3C66 A;  3IR7 B;  3LUY A;  5GAE I;  1GQE A;  3OSN A;  2OH2 A;  4LFC F;  4UTG A;  5ETR A;  5BYQ A;  5J2P B;  3H0P A;  2HMI B;  2MTL A;  3J7Z 5;  4GO7 X;  4O3O A;  5KFH A;  3TRG A;  3CB4 A;  4ZVF A;  1NDK A;  1HD0 A;  3GYG A;  5EHH A;  3T5H A;  1I94 F;  1RT6 A;  1PGZ A;  2O3D A;  1NKC A;  3R5A A;  2QEX S;  4C4W A;  4LVO P;  2Q3P A;  4B3R J;  1GK8 A;  3BBB A;  5HQ8 A;  2BE2 B;  2W4P A;  4DV1 F;  3HFZ B;  4OJ3 A;  4ZLN A;  4WCE Q;  1RYR A;  4K7Q A;  2M8D B;  4JI4 J;  2QT7 A;  4CH1 A;  3J81 Y;  1Y5L B;  2VFU A;  1BQM B;  1UET A;  3QO9 B;  4RW9 B;  3GV5 B;  3OR1 B;  4KFB A;  4Q45 A;  5L8R C;  3QZ7 A;  1S1U B;  2V4J A;  5E41 A;  4LFC J;  2AIR B;  1MWY A;  2DPI A;  1Q8K A;  4YUD A;  1HI0 P;  3GFY A;  2GMJ A;  3KUG A;  1CUL A;  1RQ0 A;  4LBH A;  4DG1 B;  4RNO A;  1SJ1 A;  3DLG B;  2MGZ A;  4F4W A;  2AD9 A;  2F65 A;  2CQ1 A;  1EJ7 L;  3TJ8 A;  5I3U A;  1F3F A;  2Q1L A;  3CPW R;  5KOX A;  1NRK A;  4NZ0 A;  1F2G A;  5F3T A;  1N5Y A;  3VAJ A;  3W5Y A;  2R7X A;  1JXE A;  1VQN S;  1JLB B;  5IT9 Y;  1PYS B;  1SH3 A;  4RR5 A;  1FRX A;  4ANC A;  5B09 A;  1PAE X;  1ZM2 A;  2G0J A;  3I9Z A;  2OPQ B;  3MM5 B;  2V2Q A;  2H5E A;  4C2M A;  3TZX A;  4CNZ A;  1KVJ A;  2GQ2 A;  3P6Y C;  3GQC A;  1RTD A;  1T05 A;  1HBN B;  3H5X A;  3UDL A;  1U2C A;  2W8L A;  2QZ8 A;  1TV6 B;  3KUE A;  1V6H A;  2LQJ A;  1AW0 A;  2XMJ A;  2VUG A;  1RU1 A;  4CYU B;  2VG7 B;  3UN3 A;  2J9D A;  2ZVS A;  3DKD A;  1OQ6 A;  2ZBP A;  5D4L A;  1UMJ A;  3V2U C;  4WE1 B;  4R5P A;  1N6Q B;  4FYD A;  2H5I B;  4L76 A;  1BWV A;  2FJB B;  3QSI A;  5HBM B;  1TL7 A;  1TMM A;  2YKA A;  4A8O A;  5C25 A;  4AE5 A;  4DCJ B;  4A47 A;  4F0K A;  2MGZ B;  3LF0 A;  1KTQ A;  3TQE A;  2G4B A;  4U8V A;  2MQP A;  2E1P A;  2B4U A;  1CLF A;  4ZCK A;  2KVQ E;  4J37 A;  3THP A;  1W7W A;  3RAQ A;  3L3C A;  8RUC A;  2WB1 D;  2OEM A;  1BY9 A;  2G2O A;  4L3N A;  1DTT A;  5T7L B;  4XPC A;  3MR5 A;  2HWH A;  2CPX A;  1SPB P;  4MYT A;  1FCA A;  2XNR A;  3C6U B;  1S49 A;  1V3R A;  4B3O A;  3G82 A;  2KL8 A;  4LRA A;  3B6B A;  4O44 B;  3K57 A;  2ZM6 F;  2HG4 A;  1SC6 A;  2LQ9 A;  4Y2I A;  2E7W A;  2UVV A;  2DRA A;  5KG7 A;  1U0H B;  1MLA A;  4BCA A;  3KKF A;  1LWF A;  3GIK A;  3HM9 A;  4KR0 B;  2RU3 A;  1VQY A;  4RZR A;  2CAJ A;  1TU0 B;  2QN6 B;  2QA4 S;  2WAQ D;  3R3T A;  2WON B;  3NGR A;  3GJR B;  4FNH A;  1YBA A;  4P7T A;  4DPW A;  3A13 A;  1JLA A;  3I55 S;  4LF8 J;  2N4D A;  2V0N A;  4LRC A;  3UNG C;  5K9F A;  5C42 B;  2UUW A;  2HQD A;  3PG9 A;  1ZAX A;  4I0W A;  2IDL A;  3EYZ A;  2DEJ A;  3F56 A;  3ZXW A;  5DLG A;  1RWP B;  2X1G A;  4NLW A;  1IBL F;  1AB8 A;  4FF3 A;  1MML A;  4B3O B;  2XHC A;  2BW2 A;  2UUB J;  3A4T A;  3NKY A;  1MU2 B;  4FVM A;  2EKY A;  3VR1 A;  3NS7 B;  5ITH A;  4NLG A;  1FRM A;  6FDR A;  2FQQ B;  2M88 A;  3L95 X;  2ZE2 B;  2GGP A;  2G9O A;  4F2R A;  4FYV B;  4LSN A;  1T03 A;  2QLW A;  3NLC A;  2OP5 A;  5LJ3 Y;  4DX8 H;  1FDB A;  3BO4 A;  2HVI A;  4AXJ A;  4YR2 A;  2VHG A;  3QRR A;  3B4M A;  1BGX T;  2JC0 A;  2V2K A;  1HI8 A;  2MKS A;  4J9L A;  5GAG U;  3CD7 A;  2W2N P;  4EMD A;  1RHK B;  4K4T A;  1FXR A;  3R5C A;  4K2J A;  3CJT A;  3NS6 A;  4DHV A;  1XMQ J;  2UXC J;  2DNH A;  2IDE A;  3HSG A;  3MD3 A;  3S01 A;  5K8N A;  4DV0 J;  2GC8 A;  1O5J A;  4RW7 B;  1S1V B;  5BR8 J;  1WEX A;  2AHO B;  1HNX F;  3MXH P;  1W2B R;  3SQG A;  3TAP A;  1YJT A;  3OTE A;  4X4O A;  1FJ7 A;  4FPI A;  2MZQ A;  4UW2 A;  5HSP A;  2W2P P;  2NUU G;  2VA3 A;  1HBO B;  3B78 A;  1RAF B;  5D3G A;  1SBR A;  4C3M A;  5DO2 A;  3CCT A;  1KLM B;  4X65 F;  3CCQ S;  4RWW A;  1X7V A;  1J27 A;  3CIM A;  1OO0 B;  3MPW A;  1QE1 A;  1S1T B;  1S9E A;  2A3J A;  2HZA A;  2NXE A;  2WSE C;  3FSY A;  4YB7 A;  5J2M B;  1UL3 A;  2AJ1 A;  4AL6 A;  1S1X B;  2KRR A;  4XO0 A;  2A2D A;  3MUV P;  3DGP A;  2BRL A;  3CF5 Q;  4EO8 A;  3ENA A;  1WSV A;  2YXL A;  1UFK A;  1TKD A;  1FTC A;  4ZJO A;  3CJQ A;  3ZZT A;  1S6P B;  1VIX A;  5D0E A;  4ED8 A;  4ZP7 A;  3K5O A;  4HYK A;  4FBT A;  4KH0 B;  4OYB A;  2YKN B;  3FFI B;  1UW4 A;  2JHE A;  2HHX A;  4V1A k;  3M1V B;  3I96 A;  1XMB A;  4RUA A;  5LT5 A;  3FZ2 A;  2RDJ A;  3EPG A;  1EET B;  2DYA A;  1VK8 A;  1D8Z A;  2BE9 B;  1A9N B;  3ZZU A;  4B17 A;  2HEK A;  1RJJ A;  3P49 B;  3H90 A;  3HHL B;  1AUD A;  4RPF A;  2RQC A;  4W92 B;  1F5B A;  3P45 B;  1BD6 A;  1RCX B;  2UV8 G;  1NZ8 A;  3UN5 A;  4FF2 A;  4I2P A;  4BBY A;  3IRX B;  3CE8 A;  2YX4 A;  4QWD A;  5KAK A;  3ILL A;  2D69 A;  1REV A;  1WC1 A;  4HL9 A;  4I2Q B;  1YJ9 S;  2QC3 A;  3RRG A;  1CUL B;  1Z2Z A;  3HPO A;  2CJ9 A;  1E6Y B;  1QDU B;  3PJ9 A;  3DMJ B;  2FC9 A;  3LGN A;  4WKR A;  3LWL A;  4K4U A;  4CZC A;  3NWR A;  1FE4 A;  2H51 B;  3D67 A;  3R5D A;  4NAS A;  4NL5 A;  4OHW A;  3V5R A;  5CAB A;  2A6M A;  5KTQ A;  3AAW B;  4X4T A;  4FS1 A;  2DHX A;  1JJH A;  3SCL E;  2F1F A;  2YWW A;  4DQI A;  2BEF A;  1BQX A;  1HMV A;  1Q5Y A;  2GMH A;  4TY9 A;  4JI8 J;  3GR0 A;  3N01 A;  2DR8 A;  4NXN J;  1N5S A;  1V5I B;  4QOT A;  2VBZ A;  3D3B J;  2ZEJ A;  2EFG A;  2OLW A;  3RR7 A;  4H4K C;  5LMU F;  1J5O B;  3QSY B;  5MLC V;  2R7O A;  3HJV A;  4IFV A;  2HHQ A;  4ILR A;  4ZVQ B;  3VF0 B;  1Y7P A;  2KG1 A;  4L72 B;  2CPH A;  4GKK F;  1UPP A;  1FA0 A;  1F3V A;  2KM8 C;  5H9E K;  2HGL A;  2V8V A;  3MAA A;  4LR7 A;  2XBP A;  4CO1 A;  2NYI A;  2QYC A;  3C2P A;  3O6Q A;  1NK0 A;  4HLB A;  5J1E A;  3RU0 A;  2OIH A;  1G1X A;  2KZZ A;  5D4P A;  3K89 A;  1UEK A;  4WYW A;  5HAN A;  1JJ4 A;  2MQM A;  4LRF A;  1YJU A;  2XZW A;  1S59 A;  2L3M A;  3GON A;  3GYX B;  5E7O B;  4JV0 A;  1LV5 A;  5L46 A;  1N6Q A;  4LQ3 A;  3OPK A;  3CJ0 A;  3IGV A;  3TUI C;  3JSM A;  4CH0 S;  3W1Y C;  2ZKT A;  3F73 A;  3EM1 A;  3GG1 A;  4OYI A;  1YIJ S;  4NXN F;  2XQC A;  1FD2 A;  2HQI A;  3TAN A;  2B6A B;  1KP6 A;  2HAI A;  2MY8 A;  3M32 A;  4IRK A;  3MM5 A;  4Q8F A;  3UD5 A;  2WK4 A;  4F0M A;  5I4M A;  1FE0 A;  1H74 A;  1RT5 A;  5BYS A;  1ZH5 A;  1RI7 A;  2E5G A;  2D41 A;  4XDC A;  4WFA Q;  3QWP A;  2R2U A;  2KFN A;  1K73 T;  2FHJ A;  3EZU A;  4MT1 A;  3MMC A;  1NSQ A;  5HMX A;  1M5H A;  2GCF A;  4P2X A;  2I1R A;  3FBE A;  3PFE A;  4JI1 F;  1VDH A;  3NNH A;  4EZ9 A;  4I56 A;  1VQ8 S;  2Z0G A;  2ZWO A;  1NKE A;  4IUF A;  1TMJ A;  3HCX A;  3KJF B;  3HVT A;  5BXI A;  5JXS A;  1G2E A;  1RT2 A;  4DF8 A;  5G0R A;  4AYB D;  1NJW A;  2D3O R;  2HNZ A;  3KDO A;  4ED0 A;  2DB1 A;  4BWM A;  5KG5 A;  3IWN C;  2EKN A;  1N88 A;  2GVZ A;  3N6L A;  5CXT A;  4LF5 F;  1D9A A;  1FRK A;  1UKU A;  1Y10 A;  4IDK B;  4OJG A;  2IBO A;  4CLP A;  4AFF A;  3G6X A;  5IC6 B;  2LU1 A;  2ADB A;  1SL2 A;  1DTQ B;  5DG7 A;  4ZLP A;  2GJI A;  3CNQ P;  3HVA A;  4OX8 A;  5GAD U;  3M4X A;  4KC5 A;  5B0F A;  3D1H A;  3PXG a;  4XPE A;  2ZE2 A;  9ATC B;  3UD3 P;  3E51 A;  4ZHR B;  2FVS A;  1DLO B;  1W26 A;  3MAQ A;  4BWJ A;  4QR1 A;  1VQ4 S;  4E2F B;  1WC4 A;  3GSI A;  3CC4 S;  4KGZ B;  3MM7 A;  4RW6 B;  2Z57 B;  3W64 A;  4DU7 A;  1WJ9 A;  3NRB A;  4HR2 A;  3QIP A;  3TAM B;  4A8M P;  5JVG Q;  2DIV A;  2MZS A;  2ADC A;  1IBM J;  2MJN A;  4F7V A;  1XN9 A;  2FJE B;  1HLW A;  2B7C B;  2RUS A;  2WW4 A;  4JI0 F;  4Q44 A;  2MLZ A;  3D1Q A;  1W2I A;  2V2Z A;  5HL7 Q;  3C16 B;  3QJJ A;  3GP9 A;  2A10 A;  2EXU A;  1WDD A;  1Y5N B;  3OW2 R;  3AA8 A;  2ILZ A;  1HNW F;  4OI3 A;  3TO8 A;  2UVW A;  4KPY A;  2YX7 A;  2IRX A;  2J9E A;  4NI2 A;  1Q4R A;  4N77 A;  2B8P A;  3Q8S B;  2W9A A;  2KB2 A;  3HZG A;  2DBB A;  4CO0 A;  5HLF A;  1NK9 A;  4PWD B;  3J7A N;  4ENO A;  3GYN A;  1WWH A;  1WG4 A;  4ZVR B;  1XTZ A;  4DFJ A;  3DM2 A;  4CO5 A;  5KT5 A;  2Q66 A;  1RBO B;  2DGU A;  5DDQ C;  3ILJ A;  1CSJ A;  4M5M A;  2V69 A;  4G65 A;  5LSR A;  5G4D A;  5G0R B;  1E6Y A;  3QFH A;  4TU9 A;  2BRK A;  4M5L A;  1RHM B;  1M5P C;  4G1Q A;  4QPT A;  2M3D A;  3S8S A;  5F8N A;  3TJA A;  2UUC J;  2LCW A;  4ZVO B;  2RS8 A;  3BQ1 A;  3QT7 A;  1REV B;  3Q8Q B;  4IR9 A;  5A6W A;  3LOU A;  4Y34 A;  1FF2 A;  1ZS6 A;  3G9C A;  2CNN B;  2HMI A;  2CRL A;  5JJB A;  4NEY A;  1U1N A;  5HMY A;  1T9W A;  2VV5 A;  1M5O C;  1X31 C;  2UVU A;  4D3G A;  5DDR C;  1HNI B;  4MFB A;  2UUT A;  5F8H A;  4JYA F;  1C1B B;  1EIY B;  1IUJ A;  4E98 A;  3Q24 A;  4LF8 F;  3ETM A;  4EUV A;  5DDP C;  2V94 A;  2DD8 S;  5HRO A;  2MHN A;  2CQP A;  1L5U A;  1HHT P;  3MTK A;  1E6V A;  2DGW A;  2ZWP A;  3I5C A;  4FBU A;  5E3Q A;  2P6T A;  5F3Z A;  4TU8 A;  4YME A;  1HKA A;  3GJT B;  4DQS A;  2UUB F;  3LAN A;  3OL7 A;  3FK4 A;  3NGK A;  4FNI A;  3H42 A;  2OTL S;  2EFP A;  1H7X A;  4C48 A;  2XLI A;  3A12 A;  1S9F A;  3BGR B;  2YKM A;  3G6V A;  3K17 A;  1FKA F;  2G13 A;  3EGZ A;  3TZW A;  2EC2 A;  3E01 A;  1KHV A;  1LQ9 A;  3QGG A;  5AJ3 J;  1RWN B;  2BAB A;  2L08 A;  4KPC A;  4ZJL A;  5KFB A;  4DUY J;  1JIH A;  3GPA A;  3T1Y F;  2Z4P A;  2BQ3 A;  4KV8 B;  1K8A T;  4LFB F;  2O5D A;  3GB0 A;  4ED6 A;  1T94 A;  3D66 A;  1HWJ A;  3BGR A;  2K2P A;  3CW2 C;  3FZB A;  5B0D A;  4DPU A;  1NM2 A;  3M8Y A;  4YB6 A;  1VHI A;  1TL3 A;  4JBC A;  2QYG A;  2CPZ A;  3IFE A;  1R8H A;  2CQG A;  2RIJ A;  2XMW A;  3AB4 B;  5IV4 A;  1RTH B;  2BKN A;  2L9W A;  2VG6 A;  3KHH A;  1XMO J;  1AT1 B;  2QO3 A;  3J7Y U;  1RKJ A;  1HR0 J;  2UU9 J;  4KSE B;  2D74 B;  1B64 A;  4J9P A;  1UJ5 A;  1XC9 A;  4PRF A;  4PXE A;  4Y2C A;  4PQU A;  4EEY A;  3MM8 B;  4FF4 A;  3NS5 A;  3EDR B;  1IN0 A;  3IS9 B;  4MKV A;  2VPY B;  1H98 A;  2ZH4 A;  5D6G A;  4LBP A;  1KBR A;  2MLX A;  3CD5 A;  5IQQ A;  1GTH A;  2HFZ A;  4BC9 A;  4F50 A;  5FD1 A;  2SXL A;  2PO4 A;  3Q2S C;  1CEZ A;  2CUY A;  3M8Q B;  3C46 A;  4NLY A;  4K8R A;  2YH1 A;  4NWB A;  2HVZ A;  2UVR A;  3BDE A;  3CTR A;  4X4Q A;  1XQI A;  5ETV A;  2AJ2 A;  2CVE A;  1KHW A;  3FJ2 A;  3FVY A;  4LF6 J;  2AV5 A;  5FII A;  2RD5 C;  3Q8U A;  3PRD A;  1W25 A;  5AXN A;  1SI9 A;  3J81 U;  3AOC A;  4TVA B;  1T8E A;  2VG7 A;  3WBZ A;  1FDN A;  1DAX A;  1V3Z A;  2IA0 A;  4TNO A;  1X9M A;  4JI6 J;  1IVZ A;  1UWB B;  4WXW A;  1VC0 A;  1WF2 A;  5L1L A;  1XNR J;  3CCM S;  4USV A;  3SCI E;  4QWE A;  2LXF A;  3CJK A;  3ZFV A;  3KG1 A;  1RTZ A;  1V9O A;  3MR7 A;  5GMD A;  2VPX B;  4QIV A;  2QIF A;  3QID A;  1AA1 B;  4ZPB A;  3O8W A;  1VGY A;  3HT3 A;  4KO0 B;  3KG4 A;  2Z2L A;  2EPI A;  3ITH B;  3LWM A;  1Q86 T;  2EEY A;  1Q53 A;  2DXD A;  2Z2M A;  3FCV A;  4OZ5 A;  5D0H A;  5KT2 A;  1J5E F;  4C3L A;  1D8Y A;  3KHG A;  1YX2 A;  2DXF A;  4RBT A;  5A2Q Y;  1S1X A;  2O1P A;  2KT2 A;  4I4B A;  1KWM A;  4ED2 A;  2C2R A;  1JXL A;  3DLL Q;  3SQO P;  1YWX A;  2FJW A;  3HKZ D;  2DIU A;  2RRB A;  4RKU C;  1C1C B;  2G0C A;  4ZA1 A;  2MQO A;  1OSD A;  1FKO B;  2OPP A;  2IYG A;  4X64 J;  4OHV A;  1K0T A;  4JI4 F;  3M2V B;  4QIF A;  1FEH A;  2B7B B;  1PBA A;  2D3Z A;  4OQJ A;  4J9S A;  2OPR A;  4NOH A;  1WTB A;  3M2R B;  4M5N A;  1LKZ A;  4WFY A;  2XC9 A;  1OYE A;  4OHY A;  4G1Q B;  2HFN A;  1JNR B;  1N54 B;  3K5L A;  2RQM A;  2F4F A;  4DZD A;  2DNZ A;  3KG0 A;  4F26 A;  5HVG A;  1Q5V A;  3NWG A;  5E33 A;  3DLE A;  2AYG A;  2KHC A;  4PG6 A;  1P1T A;  4KB7 A;  4F4Y A;  4K4V A;  2QG9 B;  3S1T A;  4NLT A;  1KS2 A;  4UST A;  3UN2 A;  4JI1 J;  2ACY A;  4QU7 A;  2X7I A;  1PJ5 A;  4PQU B;  4JYA J;  1RT1 A;  3QT6 A;  4PEO A;  4RW8 A;  1D0E A;  4X62 F;  2MKY A;  2H65 B;  2MHE A;  3CO9 A;  3MEC A;  4CIO A;  1WOO A;  3GWC A;  1U1O A;  1GMW A;  1RHQ B;  4M5D B;  1S72 S;  3M6U A;  3NGD A;  2W7A A;  4M95 A;  3DRR A;  4YB1 P;  3VAM A;  2OML A;  3PFO A;  4GRS A;  2YNH A;  1ZOT A;  4ECW A;  2CNO B;  5EX0 A;  3R1H A;  2W24 A;  2AWZ A;  4ECU A;  2Y9H A;  4YR0 A;  2V8P A;  1X9S A;  2KJV A;  1N5T A;  1WEZ A;  1RDR A;  1RZM A;  1LK5 A;  2E7V A;  2NZC A;  4LRB A;  3CJ3 A;  1T9X A;  2IC3 B;  2RAQ A;  3ELH A;  4PXB A;  3DRS B;  3DXB A;  2GV1 A;  1RT1 B;  1I51 B;  1NHK L;  1AZS A;  3FEY B;  4WP8 A;  4KE5 A;  4O3N A;  1NPP A;  2XMV A;  1XJW B;  3MM6 B;  3GIM A;  1NBE B;  4CLF A;  4E0D A;  2WVF A;  3MEK A;  5CD4 H;  2QX0 A;  2DHG A;  2V68 A;  3QO9 A;  1OY6 A;  3N28 A;  4N76 A;  3W7B A;  2A1B A;  3LH2 S;  3QGH A;  4NLS A;  5U47 A;  3FBB A;  2Q79 A;  3ISN D;  2VD3 A;  2JVO A;  5E0O A;  4OHZ A;  2YBV A;  4U6P A;  5K8O A;  3KK3 A;  2BZ2 A;  4MKY A;  3AHP A;  3T9N A;  3TAQ A;  2ZVI A;  2WHO A;  1PYO B;  4UF4 A;  3OJU A;  3OTC A;  5CH7 B;  2ATC B;  5F8M A;  2R7T A;  3MAA B;  3SCJ E;  3ZTP A;  3BBF A;  3POT B;  5ETO A;  2VKR A;  2DNM A;  2WVC A;  1FKO A;  4N8O A;  4QU6 A;  1ACM B;  1HIY A;  2WBM A;  5EWF A;  1FDA A;  1NB7 A;  5E3R A;  3MUM P;  3U02 A;  4LSZ B;  1NHU A;  1SL1 A;  3BSN A;  2FLN A;  1NH7 A;  2NZ4 A;  2KFZ A;  5HMW A;  3CWJ A;  1OSC A;  2EC0 A;  4Y28 C;  4OYP A;  4L6V 3;  1HWK A;  1S9G A;  4AL5 A;  4FZV A;  1XER A;  1GMW D;  1RLD A;  4OI2 A;  2HND B;  4RU2 A;  4LIW A;  4RUH A;  2DJW A;  4RL1 A;  2F40 A;  4AUK A;  2K1R A;  3R5J B;  4I2P B;  1UWA A;  3CCJ S;  1JLG B;  1RT5 B;  2IM1 A;  4ECT A;  2V8G A;  3BGF A;  1WNE A;  1BMQ B;  2IM0 A;  2C3Y A;  3HHE A;  2B51 A;  4NML A;  4F36 A;  1RGV A;  5A76 A;  3OSP A;  3IAS 9;  1LNQ A;  1U47 A;  1IBL J;  1UVM A;  1M1H A;  4LF1 A;  3SIP B;  3PRV A;  1H3D A;  3JAM U;  5EN1 A;  4KT0 C;  3N4W A;  5I3P A;  2I8E A;  3KK3 B;  1AXQ A;  2M4M A;  2KH9 A;  2MKI A;  3W62 A;  3J80 Y;  1A0O B;  4C8K A;  2GJ2 A;  4NI2 B;  3KLG B;  4F67 A;  1FD8 A;  2DNL A;  2XS2 A;  2HHW A;  2WSC C;  5KFC A;  3PW5 A;  2DY9 A;  5ETQ A;  4N41 A;  2UXC F;  1L3U A;  4JOU A;  4NLV A;  5KT7 A;  3DU5 A;  3W5Z A;  3KJV B;  4B3S F;  2DEI A;  5KT6 A;  4R0E A;  2HLU A;  2J6U A;  1S1W B;  1RT4 B;  1B0V A;  2Y0S D;  4K4S A;  1S48 A;  2FHO B;  3R9L A;  3CSK A;  1FXL A;  4QPX A;  1TKZ A;  3C6T B;  3MMA B;  3V6D B;  1J5O A;  1FJG F;  2VFV A;  2MQN A;  3M1V A;  3U1N A;  1BQN B;  1VQK S;  2ZJP Q;  3D6H B;  4X62 J;  3PR4 A;  3MEG B;  4OI1 A;  2ZDO A;  3NBP B;  1KRP A;  4RNH A;  1CJU A;  3RW7 A;  2C28 A;  3MEC B;  1U02 A;  1RTH A;  3V4M A;  5KFW A;  3W9I A;  4PPZ A;  2X1B A;  2LXU A;  5KT3 A;  3CD0 A;  2JEJ A;  2M0G B;  2LVW A;  1P9Y A;  3TX0 A;  1T9Y A;  3J7A 1;  4IOB A;  4RW4 A;  3RBD A;  3KNG A;  4DX6 A;  1QE1 B;  1GTE A;  1Q8L A;  1OY8 A;  1X4C A;  1ZM9 A;  3MCS A;  2W1B A;  5MAO A;  4IFY B;  3UW1 A;  1Y00 A;  4R0J A;  4I2Q A;  3T3F A;  1ZM3 A;  1SKR A;  1WC5 A;  4ZVS B;  4P71 A;  2AU0 A;  1RAD B;  1UVI A;  2GGP B;  2HVD A;  2XMK A;  3E01 B;  2ZJQ Q;  2UXB F;  2FIU A;  4M63 A;  5ETP A;  3SSQ A;  2CDQ A;  4GC6 A;  4UOG A;  1X4G A;  2GVD B;  1GMU A;  1XK8 A;  3BKF A;  3EZO A;  3F44 A;  4ZMM A;  3D68 A;  1IQZ A;  2W25 A;  1S6Q B;  4KH1 B;  2I6W A;  1B70 B;  5CYM B;  1ARO P;  1SUQ A;  3HSZ A;  5DZ6 A;  2CJQ A;  3ZTQ A;  3EX7 B;  4DV2 F;  1SJ3 P;  1OIA A;  3W60 A;  3AY0 A;  2E5J A;  3HHL A;  3U1M A;  2CQC A;  2AGO A;  4B9M A;  1S76 D;  4JV5 F;  3PJW A;  4OJH A;  1X0P A;  3IM9 A;  3MPD A;  1LXN A;  2ZBQ A;  4CT9 A;  2HRY A;  2RB7 A;  3WDO A;  2JVR A;  1SUQ B;  1U0H A;  2CJA A;  2U2F A;  3MMB B;  5AXL A;  3RTV A;  2XYG B;  2CWX A;  3HHN B;  4I1T A;  3GFZ A;  5T41 A;  4NMX A;  5E3A A;  3AJ1 A;  1NKB A;  2GVD A;  4MIA A;  4AQY F;  4LRE A;  2RE1 A;  5GAH U;  4UY8 T;  3M8S A;  1JLC A;  1QUV A;  5T14 A;  4HTJ A;  1T7P A;  3DRY A;  2D1C A;  3HKW A;  4EFA C;  4DSE A;  4NXM J;  2VC0 A;  2DKO B;  2R9L A;  3HK2 A;  2YNI B;  3G6E S;  4HKQ A;  4J9V A;  2EWH A;  2MQL A;  2QSF A;  3D0G E;  1KLM A;  1ULR A;  3UVJ B;  2QLB B;  2KKH A;  1YKW A;  4MK8 A;  4P10 A;  5GMK a;  3VAL A;  3MR3 A;  2E29 A;  1VS3 A;  2EK1 A;  2B5J A;  5AXK A;  3FUY A;  3MEE B;  1QLN A;  2O66 A;  4ZVG A;  2VFS A;  2A0F B;  2MDA A;  3AXM A;  2MPU A;  4I6A A;  4P73 A;  5B0A A;  2J6S A;  2DXE A;  4ECV A;  3MEG A;  1WF1 A;  4WFN Q;  5E5N A;  4TU7 A;  4ER8 A;  3V81 B;  3QWU A;  1HPZ B;  3MM6 A;  4RUB A;  3PIP Q;  1P6T A;  2B9W A;  5IQ6 A;  1FNX H;  3OFE A;  2AT1 B;  2QV6 A;  3L09 A;  5CCL A;  2XZD B;  1MWQ A;  2GFF A;  2ZC4 A;  4A8Y A;  1HD1 A;  1QY7 A;  2BUN A;  2BJD A;  2DGT A;  3ICL A;  4UUX A;  4J9U E;  5D77 A;  1TK0 A;  4DLE A;  4DPO A;  2KDO A;  2QMW A;  4UQG A;  4J9Q A;  3CJS A;  1N0V C;  5IT4 A;  4YFU A;  3DRP A;  4F3Q A;  1KEK A;  1C2P A;  2GQC A;  1PAU B;  5ETN A;  3PY8 A;  3T5J A;  2FDN A;  4LFA J;  2YNH B;  3CD6 S;  1HFE L;  2EBE A;  1EHW A;  4CLU A;  1TAQ A;  1OMS A;  3KLG A;  5HP1 B;  1U7L A;  4M94 A;  3P96 A;  3PYG A;  2HS4 A;  1PKU A;  4L73 A;  5LXR A;  1JMT A;  3TA1 A;  4Q5V A;  1R8B A;  1MN9 A;  4NYO A;  1DAR A;  4GKK J;  2VOD A;  4F8R A;  2VQF F;  3IG1 A;  3H8Y A;  2J7U A;  2CPY A;  3BSA A;  3JYT A;  4DV4 F;  1R0A A;  2DHS A;  3CED A;  2HBR B;  3VHQ A;  3KMQ A;  4B9N A;  4DUT A;  4M1K A;  4ZKA A;  4TY8 A;  1JLG A;  1P9Q C;  2PGC A;  5KFL A;  2OHD A;  2E66 A;  2R3V A;  3K2Y A;  4NXM F;  1IBK J;  1LK7 A;  5HK4 A;  4PAA A;  4LF7 F;  3M8P A;  3ETO A;  3MEE A;  2AX1 A;  1WG5 A;  5THW A;  1NK4 A;  1M5S A;  2L41 A;  1VJQ A;  2XSJ B;  1UZD A;  2PT0 A;  2MZR A;  4NLD A;  5EUH A;  4U67 Q;  1B99 A;  1R8C A;  1NB2 A;  3UFC X;  1C1C A;  4ZP6 A;  3WX4 A;  1RWX B;  2PEH A;  4J91 A;  3BPD A;  3ZTO A;  5EDW A;  2JOQ A;  1GX5 A;  4L75 A;  1DBD A;  1Q78 A;  2MKC A;  3GSD A;  5CA5 A;  5KFJ A;  1RTI B;  3KJV A;  4FXD A;  3HF5 A;  4PUO B;  2HSE B;  2ZZT A;  4CNY A;  2QJ3 A;  3WC2 A;  3EMT A;  3H4D A;  3M8P B;  1ZZN A;  3BSC A;  2LDY A;  1FKP B;  1FJE B;  4DSI A;  1IBC B;  4ECS A;  3CDU A;  1FJC A;  2N7Y A;  3K0J A;  1SXL A;  2C42 A;  1S7H A;  4R8U A;  2ZH8 A;  5KFX A;  1L3T A;  3DLK B;  5KFK A;  2P6S A;  4OZ0 A;  3MUT P;  1HW9 A;  2YWG A;  4CLT A;  1QSL A;  1LWE B;  2HHV A;  1IJF B;  1NJZ A;  2VOO A;  3CJ4 A;  1VQ5 S;  2W8K A;  4TQR A;  1IQT A;  4B3T F;  1FK9 B;  3NOG A;  4ZIW A;  4MK7 A;  4MIW A;  4H4M B;  1Q16 B;  5KG6 A;  2J0S D;  4KJI A;  3HJF A;  3AA9 A;  2YNF A;  2V34 A;  3PAC A;  3TNV A;  2H48 B;  1C0T B;  3CJ2 A;  2ZZN A;  1CJK A;  4PG7 A;  4HAC B;  4TYA A;  1GXT A;  4CTA B;  2DTJ A;  5CYJ A;  1VRQ C;  3IBC B;  4DPX A;  3PKY A;  4C11 A;  2DNY A;  1QD1 A;  5HVH A;  1IKW A;  3ZZR A;  2DCL A;  4G3I A;  3U7J A;  3T6J A;  4NCB A;  3J80 U;  3A8K A;  3IA0 A;  4X66 J;  3G8T A;  4DR7 F;  3RB0 A;  2JEG A;  2WON A;  4LBI A;  2KG0 A;  4MK9 A;  1S1U A;  3JSR A;  4U96 A;  8ATC B;  4RW9 A;  3OL9 A;  2RKI B;  4DXL A;  2FTR A;  4KFB B;  4CLY A;  1L3V A;  1GXL A;  2BJ7 A;  2IAJ B;  3C15 A;  4WU2 A;  4XAK A;  5IM0 A;  2DH9 A;  3D9B A;  2AKW B;  5LMN F;  4WFZ A;  4QIW D;  2Z8Q A;  1R8A A;  1JJ2 R;  1MRO A;  4K4W A;  1WC0 A;  4OYX A;  2FVC A;  2VBW A;  1VQ9 S;  1PJ7 A;  5H9F J;  3R5B A;  1OY9 A;  3TEG A;  4QIE A;  4C0H A;  2N7C A;  3BKT A;  3CCW A;  2NPI A;  3I6P A;  1XIQ A;  3WX8 A;  1Y0H A;  2WW8 A;  3GFX A;  4EWT A;  4P52 A;  2FVR A;  2RNE A;  4KV8 A;  4MAK A;  4RNM A;  1TL5 A;  1DUR A;  1B4S A;  4JI5 J;  1ZA2 B;  5CZX A;  5HO4 A;  2H4W B;  3NL0 A;  2J7K A;  3GJS B;  2I5J A;  3DRX A;  1MSW D;  1EQ0 A;  3RAM A;  1EET A;  4PAB A;  3OVA A;  1YVF A;  3P4U B;  1T03 B;  1KC8 T;  3CT9 A;  3OLB A;  4H4M A;  2E1A A;  4U7U D;  5A0Y A;  1F9F A;  1T95 A;  1UW9 A;  4CYU A;  4DQP A;  1CC8 A;  3D0I E;  4B02 A;  3I82 A;  1TV6 A;  5IWA J;  4F4Z A;  2HYI B;  2XWX A;  4IH6 A;  3T9Z A;  3IG1 B;  1NND A;  4NCA A;  1EZZ B;  3D3C J;  3US5 A;  1AZS B;  3IWX A;  3JSB A;  4ZPC A;  4I6Y A;  5CAA A;  4ZLJ A;  4RUC A;  4RNN A;  4DR4 F;  4P75 A;  2V8H A;  3PYE A;  3BF4 A;  5J2N B;  3L9Z A;  1CC7 A;  3QQC D;  5AXM A;  1M5K C;  2AQ4 A;  4DQR A;  3EJM A;  3MPV A;  4H4O B;  1F5C A;  6FD1 A;  1Z4U A;  3NGT A;  2VC1 A;  3H5U A;  5CQG A;  2CPJ A;  3BRE A;  3WZ0 A;  4Z37 A;  5D3G B;  2MZT A;  4NRT A;  2PFF B;  2BW7 A;  2G1H A;  2YNG A;  2VZ9 A;  2V9K A;  3UR3 C;  5A6P A;  4DL2 A;  2UUA F;  1FWP A;  2D7S A;  2QLF B;  2AEM A;  3OFH A;  2R7U A;  1UPM B;  4KQZ A;  3ZZ0 A;  2GZO A;  7FDR A;  4X84 A;  1YBT A;  4OYM A;  2PC6 A;  3AOB A;  1WOR A;  1ICE B;  1RU2 A;  1IKV B;  2CZ4 A;  2CNL B;  2IYI A;  2F8E X;  3M9M B;  2W4C A;  2VBX A;  1RKI A;  3AD9 C;  3LP1 A;  3M6V A;  4NA2 A;  4NX9 A;  3UNY A;  3DYA A;  3M8R A;  4LF4 F;  3JQJ A;  3IMQ J;  2EVZ A;  3PW7 A;  1A6L A;  4KGX B;  5IOL A;  4C97 A;  2NUH A;  2YQ1 A;  3PHE A;  1CS4 B;  4DPY A;  1T3N A;  1CJV B;  3VCD A;  2B9Y A;  4A8W A;  2BJ3 A;  4FVC A;  3MF5 A;  3GIL A;  3H2U B;  3LP2 B;  1U2R A;  2DNO A;  5DQI A;  5HLF B;  3HSJ A;  2JFK A;  2WZ1 A;  5HN0 A;  1U1Q A;  1DRZ A;  4EZ6 A;  2IAJ A;  1S6O A;  2XB2 D;  3CC2 S;  2MLY A;  4J9N A;  3KHR A;  2DR9 A;  4ERD A;  2E5I A;  2P9E A;  3OLA A;  1LEO A;  2JLF A;  3NCQ A;  2XEX A;  1QAJ A;  4IQM A;  4XDD A;  4O3Q A;  3HVW A;  4OI4 A;  5KG0 A;  1TEL A;  1F5A A;  3OVB A;  4PXD A;  2E1C A;  3PKM A;  1OYD A;  4NYP A;  1D9F A;  1MMN A;  1FT8 A;  1R89 A;  2GJF A;  1JLC B;  2JZ5 A;  2MZJ A;  1PSD A;  2PE8 A;  2OO4 A;  3BO2 A;  5GAD I;  2F8M A;  2NXC A;  2ZBC A;  1REG X;  1B0P A;  2IJF A;  3MOZ A;  4DV7 J;  2ZIT A;  3IRX A;  4DR3 F;  2XLJ A;  2CWK A;  1P27 B;  3IO1 A;  4Z7Y A;  5I42 B;  3MD1 A;  1HYS A;  3BDP A;  4OHX A;  1SKS A;  4DV2 J;  1YQH A;  1DTQ A;  1NAQ A;  1NK5 A;  5AJ3 F;  2I9S A;  4NLX A;  4TN2 A;  2B56 A;  2F4V F;  4TKT A;  1UP1 A;  1N0U A;  5B0G A;  1QSS A;  1XNQ F;  1Y11 A;  3DFE A;  4DMZ A;  4X66 F;  2QA4 G;  4OI0 A;  2RS2 A;  5T7L A;  1ZPW X;  2J0W A;  2X1A A;  3RRH A;  2RRA A;  4BDP A;  4FPR A;  1EAR A;  4OV6 A;  4Q2M A;  4ID8 A;  4KRW A;  2KXN B;  4K4Z A;  3HVT B;  2W9B A;  2Y1R I;  3FBC A;  4I7F A;  4JI3 J;  3EGV A;  2HNY B;  3Q8P B;  2Q6C A;  3M2R A;  5KT4 A;  4C8O A;  1AUS L;  1VRU A;  1HBM A;  3T1A A;  4HVZ A;  5HBM A;  3FRZ A;  2JLG A;  2M70 A;  1O8B A;  3RRK A;  1WTF A;  5DQG A;  1RA6 A;  2GHV C;  2XYP B;  3Q89 A;  3PTW A;  2DO4 A;  4HHH A;  2HZV A;  1DQ9 A;  2CQ3 A;  4RX6 A;  4URQ U;  5IWA F;  2C1E B;  4PG8 A;  4DQQ A;  1VC5 A;  3IWL A;  3K5N A;  4DPT A;  2E5L J;  1VK3 A;  3LP0 A;  5K14 B;  2Y1L B;  3KK2 A;  3D54 A;  2R42 A;  2EFQ A;  2ZHB A;  1VI7 A;  5HJY A;  5LMU J;  4PWU A;  5DRK A;  3MPU B;  4Y00 A;  1WD6 A;  2V67 A;  2MJU A;  4ZCI A;  5IFM A;  5F8G A;  2ZNZ A;  3JS9 A;  3P8B B;  4KO0 A;  3KLI B;  4YY3 F;  1P1L A;  2W9C A;  1SJQ A;  3R2C J;  3W3S A;  3IR5 B;  3HVR A;  1RAG B;  3ZZZ A;  3BR9 A;  2YKQ A;  4DV5 F;  3WC0 A;  2FLO A;  2IVY A;  5ETT A;  3AH6 A;  4X4N A;  4KHR A;  2PMW A;  1A7G E;  4OZ2 A;  2RF2 B;  4RBU A;  2IM2 A;  2CZV C;  1WKK A;  4M5H A;  4OIX A;  4F02 A;  1LW2 A;  2K7J A;  1WKL A;  4O0N A;  2BJ9 A;  2WVD A;  2C2E A;  5M2P A;  5A8K A;  4IOA Q;  3P5B P;  1H0H B;  2QGF B;  1TKX B;  2XSF A;  1N48 A;  1RCO B;  1TR0 A;  2HZC A;  2KT3 A;  4LSN B;  2DK2 A;  3MM9 A;  1X4B A;  3W2W B;  3BN4 A;  2DGV A;  3DOK B;  2J0X A;  2HBY B;  3QPI A;  3Q23 A;  4DF4 A;  4DSL A;  2D3O 1;  2FB0 A;  2EW9 A;  4DX7 A;  1S99 A;  4IKA A;  3Q22 A;  2Y1J A;  4YY3 J;  2D9P A;  3R6G B;  4ECY A;  3BGL A;  3OXL A;  4LF7 J;  5KFQ A;  2APO A;  2AX0 A;  1F6T A;  2CG4 A;  5IC4 B;  3VAG A;  1QSY A;  2FJV A;  5KFF A;  4AT1 B;  2F7V A;  3C19 A;  4OX6 A;  1CJT A;  2M52 A;  1ZTT A;  1JWW A;  2R7Q A;  1X60 A;  2CVI A;  3THT A;  3C14 B;  3LPE A;  2YX1 A;  5J1P A;  2ILY A;  2K7K A;  1R7I A;  1P8G A;  3KWM A;  4P7V A;  1KQK A;  4DR6 J;  4EYI B;  3I87 A;  3KHL A;  3NP5 A;  1AFI A;  5GAE U;  5CYQ A;  3LPY A;  2YQ3 A;  2PA8 D;  1VJW A;  5F9L A;  4LMZ A;  3JSY A;  1KVI A;  1HWL A;  3CDW A;  3FEX B;  3G86 A;  3TOQ A;  3MUR P;  1RAJ A;  2AEJ A;  1DFD A;  5J2P A;  2IVM A;  3ZZY A;  4TXS A;  4ECZ A;  1KFS A;  2FJD B;  1S9G B;  4DX5 A;  2HKE A;  5LL6 d;  5I3Q A;  3AXK A;  3EGN A;  1XEZ A;  2B5J B;  4KGK A;  1C0T A;  3AJD A;  4ICL B;  1LWC B;  4CWB A;  2NS1 B;  2VFR A;  3RG6 A;  1KD1 T;  1H38 A;  2HNY A;  4FXV A;  3MCM A;  3FRY A;  1RIS A;  3PRB A;  2JLE A;  1N32 J;  1HBU B;  1OQ3 A;  2ZOG A;  2DIS A;  2J5A A;  3CJ5 A;  1Z2L A;  1RT4 A;  4V19 X;  1UFW A;  2GO9 A;  2W7P A;  1JLF B;  5DM6 Q;  5KG4 A;  1MN7 A;  3IM8 A;  4FKX A;  4CLW A;  1WC3 A;  2PN6 A;  4C9D A;  4DR5 J;  4ILM A;  1GAO A;  3FGV A;  2XUL A;  2V50 A;  1TP7 A;  5JMN A;  1QVF R;  1V3S A;  1RSC A;  4WZM A;  2CQ0 A;  5F9N A;  1D1U A;  2H3E B;  3D28 A;  4X4V A;  1FJG J;  2XTJ P;  5J1E B;  4AL7 A;  1WF0 A;  2HAF A;  3OXG A;  2J9C A;  2DHA A;  2ZM6 J;  3PYF A;  5E2Q A;  3J81 j;  3QZ8 A;  3H59 A;  4C8Z A;  1LW0 A;  2ZBI A;  1FFW B;  3B4D A;  3NCR A;  1UA0 A;  2OFG X;  1SJF A;  3NXZ A;  3O2I A;  2EFV A;  4I6W A;  1NJX A;  3V6J A;  3BBC A;  2HFO A;  2M9K A;  3HXM A;  4ALZ A;  3WIV A;  2HHH F;  4ZJQ A;  4ZCL A;  1HNZ J;  3OV7 A;  3QJP A;  1MRO B;  1HBO A;  1QTN B;  2QMU B;  1MNE A;  4OZJ A;  2V8D A;  3UCG A;  3OTO J;  3QAT A;  1HQU B;  3KUH A;  2G2Y A;  1CG2 A;  3VVU A;  2AZ3 A;  3A8I A;  4Z7C A;  4UZB A;  1BHN A;  1R6Y A;  1T02 A;  4PCQ A;  3M8Q A;  2I38 A;  3VZI A;  3THV A;  3L7U A;  3SZ2 A;  2AW0 A;  1C4C A;  4NA3 A;  1HHS A;  4DL6 A;  1RAO A;  1Y3J A;  2VU5 A;  1IJE B;  4RW4 B;  4P74 A;  3BO3 A;  3FSI A;  4DS5 A;  3Q0A A;  4DSK A;  1B7F A;  2E1M C;  3MPY A;  4USK A;  1YSJ A;  3M8W A;  4NA1 A;  1EX8 A;  1KDN A;  4JI5 F;  2HW3 A;  2N4C A;  2HHS A;  4KYZ A;  4WYL A;  2UZA A;  3MFH A;  3BR8 A;  4B9V A;  1VQP S;  2BQU A;  3R7B B;  4XK8 C;  3PX6 A;  1GFW B;  3HDS A;  2XCP A;  1UEV A;  2KT5 A;  1X8D A;  5H1S V;  5EWG A;  3I0R A;  1ZZF A;  2COL A;  1H2V Z;  2CA9 A;  1K1S A;  3FMW A;  1TK5 A;  2GAH C;  2NSB A;  3I31 A;  1KKH A;  2RRN A;  4HDH A;  1RWK B;  2OPP B;  3UPF A;  2YY3 A;  1RA7 A;  2R2R A;  3VQT A;  5M2U A;  2LEA A;  4DR5 F;  1SJ4 P;  2RDI A;  2F9J A;  2K3I A;  3MM9 B;  3GV8 B;  4JV1 A;  2H4Y B;  4GO5 X;  1J5E J;  3NMA A;  2KHD A;  3W8P A;  3GTY X;  2H1Y A;  4ZVH A;  4Y2A A;  3OQ2 A;  3AQP A;  1ZA1 B;  2G1D A;  3DLK A;  3IP0 A;  3JQM A;  2BVZ A;  3N0V A;  4CI0 B;  4PPD A;  3IC1 A;  2FVP A;  3QBC A;  3VGT A;  1S5Z A;  2V9W A;  4M5D A;  3DLH A;  2YPZ A;  4H4K A;  1JLE A;  4HH1 A;  3KLE B;  2DGO A;  2HIY A;  3BPS P;  3RYL A;  3T6B A;  4HEA 9;  3SDE A;  5LOQ A;  5GVQ A;  3JSM B;  2V6A A;  1B7Y B;  5F8J A;  1IWA A;  3ZTS A;  5F8I A;  1PCA A;  3J7Z T;  4O4R A;  4N56 A;  1CS4 A;  2X51 A;  2ZH5 A;  3ENQ A;  3C6U A;  4EBD A;  1NO8 A;  2KFY A;  1MG7 A;  2BQR A;  3QRP A;  4PXC A;  1U6Z A;  1WG1 A;  4DUZ J;  2HNZ B;  2ASY A;  3EXY A;  1YJR A;  3LP0 B;  2LYV A;  1SKW A;  1RBA A;  2AEF A;  3FDS A;  3IBW A;  3SV3 A;  4DR2 J;  1S0N A;  4LF9 J;  1YJW S;  2HS3 A;  3MCN A;  2E5L F;  3X3U A;  3G8S A;  2CXE A;  2JC1 A;  4O23 A;  1N5V A;  4EI2 A;  1YJV A;  1RYS A;  3QLH B;  2W4D A;  4ED1 A;  1FO1 A;  3AD8 C;  3DU6 A;  2CQH A;  1SC4 B;  3LAM A;  1JLQ A;  3ULH A;  1AYE A;  1RUS A;  3P5T L;  2RJZ A;  1FER A;  2CPE A;  2EG1 A;  3ZZP A;  3EVM A;  4O4G B;  3IXQ A;  4PG5 A;  4M5I A;  4L3K A;  3SFU A;  3JTO A;  1S12 A;  3IAM 9;  3K59 A;  4DWI A;  1NK8 A;  4PWD A;  3SXL A;  2ASJ A;  3VAI A;  4QYR A;  1NUE A;  2LA4 A;  2OSR A;  2ROG A;  1WAC A;  4WII A;  3CCU S;  1SQF A;  1TAU A;  3DN9 A;  1FRL A;  2UXB J;  4USI A;  1OJ4 A;  2R8J A;  1VFJ A;  3PJX A;  5CHC B;  4ZIV A;  2W2Q P;  4DV1 J;  2J0Q D;  5KFV A;  1HYS B;  2JDJ A;  2JNJ A;  1N36 F;  5KFZ A;  4GVL A;  1ZBT A;  2IIH A;  1XR5 A;  2E5H A;  2PI4 A;  1YJN S;  3PEJ A;  4JI7 F;  1RE1 B;  5I3U B;  3PV8 A;  2JH3 A;  4MKA A;  5L1K A;  1UEU A;  3KTQ A;  4B08 A;  3MI7 X;  3RB4 A;  3CVK A;  3RB3 A;  2HBZ B;  1Q8I A;  1UCN A;  2L9D A;  2Q6B A;  3N5B A;  3NAH A;  4XTT A;  3KYL A;  2BA9 A;  4ES3 A;  2VDH A;  2CJX B;  2C22 A;  1VBZ A;  2DPJ A;  3E8O A;  3QIP B;  3TAM A;  3CUN A;  3VV2 B;  3QAU A;  2HGN A;  2ALZ A;  1UJ4 A;  2VOP A;  3GIJ A;  2ZKU A;  2XMM A;  1IXK A;  3KLH B;  2RF2 A;  5CZV A;  2H54 B;  1RAA B;  3D5M A;  2VAS A;  2ZNY A;  3EWG A;  4ZHR A;  3NNC A;  4IG3 B;  1DQA A;  1URR A;  1R3N A;  4UOC A;  3OTO F;  4U9R A;  4P2S A;  5F8L A;  5FLX U;  3AFG A;  2IJR A;  4O44 A;  2VJV A;  2FLL A;  2IA6 A;  3OTB A;  1R31 A;  2Z2Z A;  4C3K A;  1FTR A;  5F0U A;  4C6A A;  1XNR F;  4OYZ A;  3NMR A;  4W90 B;  3UVJ A;  4HH0 A;  4B9S A;  3H5S A;  1XMO F;  2UU9 F;  1RWV B;  3GLJ A;  4JUZ A;  1Y3K A;  2KXH A;  4DLG A;  5KG2 A;  4CP5 A;  4WU3 A;  3R6L B;  4DS4 A;  4WF9 Q;  2WOM A;  4CLZ A;  1B0T A;  1HQU A;  2HHT A;  1S0V A;  2C3U A;  2DVI A;  1TL3 B;  4OZL A;  4UUW A;  2ZJR Q;  3T5L A;  3KXD A;  2J9D E;  3M2V A;  2HFV A;  3EVW A;  2UP1 A;  3D6M B;  1IR0 A;  5LM7 E;  2C2N A;  4Z2X A;  4R5P B;  3KNA A;  4NZ7 A;  3DNC A;  2POK A;  5HAT A;  3PW2 A;  1ZPV A;  1M5V C;  2RHQ B;  1U0S A;  1WHV A;  5CCM A;  3TVK A;  3JTN A;  3MGJ A;  1J2V A;  1LWE A;  2AF6 A;  2LEP A;  3OJS A;  2YQ0 A;  2LEB A;  1T05 B;  1LFW A;  3GG0 A;  4OFZ A;  1KTV A;  2F5G A;  3ITH A;  4KGV B;  4C8M A;  4DZ6 A;  4E8U A;  2ZH9 A;  5HAO A;  3V6H A;  1HR0 F;  1HNW J;  1WI8 A;  2FHM A;  2QSW A;  3K5P A;  1WHW A;  2OEJ A;  4CM0 A;  5HQL A;  4ZVU B;  2AYB A;  1TL1 B;  1WC6 A;  3HHL D;  3R97 A;  2A2C A;  2YPY A;  4YQW A;  4B9U A;  1X0F A;  1N5Q A;  2DY1 A;  3CJK B;  1HNI A;  3HFK A;  4HHJ A;  2WOM B;  5K14 A;  3VTI A;  5H9F K;  1DTT B;  2EFO A;  2RVJ A;  2L48 A;  4M5J A;  3H40 A;  2HQC A;  2RIL A;  3R8Y A;  3EGW B;  3KJQ B;  3W8G A;  3KOA A;  4I67 A;  5D78 A;  3MM7 B;  3NOC A;  5J2Q A;  3NGU A;  1R6V A;  2RDD A;  1XMQ F;  2C2D A;  3UDV A;  3OVS A;  1LWC A;  1M90 T;  4K0K J;  3VGU A;  1LWF B;  2DCU B;  1RAB B;  4ZPW R;  5HMZ A;  1IR1 A;  1RT3 A;  5L38 A;  1D3W A;  2YWH A;  3G4S S;  1JKH B;  4J90 A;  3I56 S;  3HSD A;  1YHQ S;  4OJ1 A;  4WK1 A;  4PYD A;  1NSA A;  4USH A;  4Q43 A;  1YI2 S;  2DNP A;  1X4A A;  4JI3 F;  4U95 A;  3D6T B;  3PW4 A;  1O51 A;  2W2M P;  3D6F B;  2AJ0 A;  2HQG A;  2QL5 B;  3MM8 A;  4X65 J;  2OD6 A;  2AJQ A;  4MIB A;  1K44 A;  1X4H A;  4O0I A;  4D3H A;  4YS2 A;  3MHY A;  3PO5 A;  2CAD A;  2CQ2 A;  1ZET A;  3BJY A;  4DFK A;  1OS5 A;  3VZH A;  3DDK A;  3I4H X;  4ZP8 A;  2WSF C;  5E3P A;  4HAC A;  1EP4 A;  1H7W A;  4B3R F;  1U1M A;  3QGI A;  1F60 B;  1PBU A;  5B0B A;  2YH0 A;  2LXI A;  2XWY A;  1RTJ A;  3R5G A;  2QFJ A;  3EDQ B;  1XR6 A;  2QLX A;  3M9N B;  4DV4 J;  1ZYQ A;  1NZA A;  1TL1 A;  4WFB Q;  4N5S A;  1BLU A;  1HNV A;  3FKB A;  1TTH B;  5ETS A;  4DR7 J;  2RML A;  4W98 A;  3DOM B;  2LP4 A;  2MKJ A;  4Q2L A;  4JI0 J;  1NDL A;  4ES2 A;  4DR4 J;  1LW2 B;  1V5V A;  1SJR A;  3LAK A;  4YDX A;  5C24 B;  5LSL A;  2DRB A;  4B3T J;  1L3S A;  3GE9 A;  3NAI A;  2XI2 A;  2HK3 A;  3OD2 A;  4JP8 A;  1G4C A;  1HQE A;  1JQG A;  3AD7 C;  2UV8 A;  3GJQ B;  3MDF A;  2HHH J;  4LFA F;  3TVY A;  2Q43 A;  4KHP J;  1JLB A;  3ISN C;  1Y9O A;  3LP2 A;  2MY7 A;  4ZVE A;  1IM6 A;  2BX6 A;  4G1P A;  2MZ1 A;  4LT6 A;  1FKP A;  4NLR A;  2OAU A;  1RAE B;  3DDI A;  2B43 A;  2OMO A;  3TUP A;  1NEE A;  1FI4 A;  4LUB A;  2NXN A;  2P5V A;  2PEB A;  1KQS R;  1IKV A;  3CJ8 A;  3IBF B;  3W61 A;  2JWN A;  1Q8B A;  1S9E B;  2HQ3 A;  2OJ3 A;  1WDT A;  1HBU A;  1ZM4 A;  3PDN A;  1NSP A;  1Q7L B;  1X5P A;  4EO6 A;  2N82 B;  2XO7 A;  4J9R A;  1VQO S;  2E9Z A;  4RWX A;  2XSJ A;  2DH8 A;  2BE7 D;  5ETL A;  2LLZ A;  4N7T A;  1UFL A;  4WFX A;  5RUB A;  1U1P A;  1IBK F;  5D0R A;  1L3K A;  4QBU A;  1BUX A;  2KU7 A;  1BQM A;  2HHP A;  2PII A;  2DNN A;  2EBG A;  2O01 C;  4JI8 F;  2PFD A;  4WJB A;  3BSO A;  3KLF B;  2A6O A;  2BM0 A;  3SDE B;  5DDO C;  1DQ8 A;  3HT0 A;  1U1L A;  2BE2 A;  3L7O A;  3OR2 A;  5EWE A;  1NHV A;  1TZ0 A;  2KI2 A;  3G87 A;  1Q0N A;  4QQB A;  3Q8Y A;  2P8I A;  1KVK A;  5J2N A;  1H72 C;  1RK8 A;  1HBN A;  2XO6 A;  4DR2 F;  4O3R A;  4HT7 A;  4GC7 A;  2DR6 A;  1SIW B;  5A8R A;  2X1F A;  1Q95 G;  2Z56 B;  1FRJ A;  4J9M A;  4ZN3 A;  1VRT A;  3K7R A;  1RB0 A;  2ALY B;  3D1O A;  1U6F A;  4DU8 A;  3A3P B;  1ZAV A;  3GIR A;  2V4Q A;  1TL4 A;  2R7R A;  4F25 A;  3I32 A;  3SSS A;  4QR2 A;  1WEY A;  3QNW B;  4DN0 A;  1RTJ B;  3RBE A;  1VQL S;  3LW5 C;  4MYU A;  4DR6 F;  2ZH6 A;  2NR0 A;  1N33 F;  5DQH A;  2HFU A;  3LA0 A;  4HTI A;  4WWS A;  5JVH Q;  3NNA A;  1H2U X;  2VDI A;  2VA2 A;  1FEE A; 
#chains in the Genus database with same CATH homology
 2F65 A;  1TMM A;  2CG8 A;  3HT0 A;  1F9H A;  3ILI A;  5ETT A;  1RU2 A;  3HSG A;  5ETQ A;  4CYU A;  1IM6 A;  4M5J A;  1Q0N A;  4PZV A;  5ETV A;  4M5H A;  3KUH A;  3HD1 A;  2QX0 A;  3HD2 A;  3UDV A;  3ILJ A;  3MCN A;  4M5M A;  3UDE A;  1RB0 A;  1CBK A;  1RAO A;  3IP0 A;  1HKA A;  5ETP A;  4AD6 A;  4M5L A;  1TMJ A;  3HCX A;  3HSJ A;  1DY3 A;  4M5G A;  5ETM A;  5ETS A;  4CWB A;  3QBC A;  4F7V A;  5ETK A;  2F63 A;  3HSD A;  1EX8 A;  5ETO A;  1EQM A;  4CRJ A;  3KUE A;  3MCM A;  4M5N A;  5ETL A;  3HSZ A;  4M5I A;  1KBR A;  1RU1 A;  1RTZ A;  5ETR A;  4CYU B;  1EQ0 A;  3ILO A;  3KUG A;  2BMB A;  3ILL A;  5ETN A;  3UD5 A;  3MCO A;  4M5K A;  1G4C A;  1HQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...