3HSZA

Crystal structure of e. coli hppk(f123a)
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGAMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pterin-binding site mutation Y53A, N55A or F123A and activity of E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords HPPK
total genus 45
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3hszA00
5ETMA 3UDEA 5ETLA 3KUGA 5ETSA 3ILJA 1TMJA 1RU2A 4CRJA 3ILLA 3QBCA 5ETNA 3UD5A 3HD2A 3KUEA 4CYUB 3HSJA 2CG8A 5ETTA 5ETKA 1RAOA 1EX8A 2F63A 4M5JA 4M5NA 4M5IA 3HT0A 3UDVA 4CWBA 1RTZA 1KBRA 3ILIA 3IP0A 4M5HA 4CYUA 1EQMA 1RU1A 1F9HA 1RB0A 3HSDA 4F7VA 1IM6A 1HKAA 1HQ2A 4M5LA 4M5GA 4M5KA 1CBKA 5ETQA 4M5MA 4PZVA 5ETPA 1Q0NA 1EQ0A 2QX0A 1DY3A 3HSZA 3MCOA 3MCNA 5ETOA 3KUHA 3MCMA 3ILOA 2BMBA 5ETRA 3HD1A 4AD6A 1TMMA 3HCXA 3HSGA 2F65A 1G4CA 5ETVA
chains in the Genus database with same CATH superfamily
4F67A 4F8RA 3OTCA 4E8UA 3S6EA 5DDQC 3U02A 4MT1A 1SL2A 1RTJA 2COLA 4DV3J 2WHOA 4C6AA 1DQ8A 2ZE2A 3MM7B 2ZHAA 2L9NA 4C98A 2AV5A 4I7FB 5T14A 1AW0A 4HH1A 1H98A 2V2KA 5JMNA 4UQTA 1HPZA 1YKWA 2CNOB 1L3SA 1VQ9S 2CQ4A 2UUCF 2XI2A 1IM6A 2ACMA 3DLLQ 2HHXA 5EWGA 1N5VA 2CZ4A 2DISA 4ES3A 5LMNF 2YWKA 1TVRA 4OHWA 1E6VA 2BM0A 3MGJA 1PJ5A 5ETOA 2FLOA 2D7SA 3KUHA 3TVYA 5C25A 2QLJB 1X5TA 1Q16B 4EO8A 2CJAA 3TAMA 3OT9A 3FBCA 3ZTSA 3GJSB 4LF7F 2NSCA 5FDLB 4BHQA 4QR1A 3IO1A 2HS0A 1ZM4A 4BC7A 3Q8QB 5IXUA 4PAAA 5HBMA 4LR7A 4B3MF 2J8AA 3CO9A 3HVAA 1LK7A 5D0GA 1TKXA 1TL3A 2IRUA 3RAMA 5GVQA 1X4DA 3UR0A 4AT1B 2W8LA 3TEGA 1U1PA 3JS9A 3W2VA 4CLUA 4BDPA 1OY9A 1KEKA 4JYAF 4EI2A 2V2QA 3FSXA 3OR1A 3QT5A 4CNYA 2XM3A 4NLXA 2HQCA 4AFFA 5M2PA 2Q3PA 2QL7B 4NRTA 3KG1A 1RAHB 2K3IA 4UZCA 1TK0A 1CLFA 2YNIA 4X62F 2HHVA 3W3SA 3JSBA 4KQZA 2H3EB 3TARA 2NCKL 2LEPA 3RBZA 1RYRA 4QWCA 2V4QA 2GGPA 4CIOA 5BYQA 1D8ZA 4N8NA 4AE5A 3H7HB 2GVZA 4CO0A 4LF2A 4LMZA 2C42A 2FYXA 4WKYA 2C2MB 2XC9A 3JYTB 3ET6A 5DO2A 1REVB 4AL7A 4OZ0A 3EUNA 5LM7E 4RU9A 3PR5B 1WDTA 2AZ1A 3E01A 4F02A 2CFXA 3H2LA 4LVNP 1RU2A 3RR8A 4F4KA 4Q8FA 3SXLA 3IR7B 3LF0A 1OMSA 1ELOA 4NLPA 2EG2A 3G82A 5EX0A 4U7UK 2EFVA 3WBZA 2AYMA 3B54A 4ECSA 1X9SA 4DFPA 5KG7A 1KWMA 1RT6A 4DQPA 2FJDB 2ZZTA 1VDHA 1NMEB 4B3TF 4LF9J 1YK9A 3MM8A 1Y4ZB 2DITA 2ZD1A 4NLSA 1QE1B 2EG1A 2KFZA 1QUVA 3CT9A 4ELUA 4M5DB 5IM0A 1N34F 3FUYA 3KG0A 3M2RA 5KT6A 1HHTP 2F9DA 4FN5A 4C8YA 4DR5J 5FD1A 4QWBA 1RHJB 4OJHA 2XB2D 2H5IB 2QSFA 4KFBB 3T6JA 1X60A 4LFAJ 3LP1A 5EWEA 3Q23A 1NKBA 1QTMA 4JI0J 4GC7A 1KS2A 3WHIA 1FNXH 4GVBB 1RTIB 2CJ9A 2DNRA 3PJXA 1JXVA 4HDGA 2N82B 2MKKA 2B5JA 4NZ7A 1LW2B 2ZUAA 3HT0A 2KHDA 3SSSA 1WWHA 2FZCB 4ZDNA 4I2PA 1YLXA 3BKTA 2ZVIA 2WVEA 2DIUA 2CJYB 3I5CA 4KHPF 4UZBA 3KNAA 3ITHB 3M8WA 1IKXB 2ZH4A 1Q0NA 4FZVA 4P9SA 2FHMA 4ZCKA 1HARA 1YDLA 3CF5Q 3RB0A 4X64J 1HW9A 2Q43A 1JLBA 2LEAA 2WCXA 4ETZA 5T7LB 5J2NB 4ZCIA 2DGXA 4RNNA 1T94A 1VQ5S 1ZA2B 4HHUA 3T6BA 4I69A 6FD1A 3ZTRA 2XS5A 5HROA 2OELA 1HNZJ 4GVBA 1NPKA 1R8HA 1TQLA 2XO7A 1UWAA 1HD0A 2HFUA 5KFDA 3OFFA 2DNQA 4OV6A 2HSEB 3SCJE 3CXCR 2FLPA 4OLOA 4P72A 1MMLA 5DQHA 4A8FA 3W61A 2VFRA 2LKZA 2IRYA 3AAWB 2AMCB 1HBOB 1T0TV 3A3OB 4P75A 2FY8A 3IC1A 4ZPDA 2ZOMA 4AQYF 1T7PA 3OTOJ 2GAHC 2FY1A 5D0HA 4F7VA 3OJSA 1RTDA 4DR7J 1C1BB 1AYEA 3DMJB 1M5HA 4P73A 3LQVA 2WVDA 5KT3A 4TVAB 2FD2A 2RQCA 3MM5A 4ECWA 1QLNA 2GHPA 3FMBA 4NL5A 3KJVB 1U47A 1HI0P 2DIVA 4QWDA 1Q4RA 1LWXA 3DXSX 2FZKB 4QIFA 2XY5A 2DH8A 2E5LF 3OJUA 3IRWP 3IG1A 4ED8A 4PG5A 1K8AT 2OH2A 2P5VA 4ED1A 3Q8SB 5HP1A 3ZZUA 4DPYA 3AY0A 1T8EA 2UP1A 2QA4G 1X8DA 1FERA 3IR6B 3MM9A 3AJDA 4Y2CA 5KOXA 3G8QA 4NCAA 1LWFA 4O44B 2WAQD 3ZNJ1 1XMQF 2OI2A 4LF4F 1HWUA 5CAAA 2DCLA 4NCGB 1RHMB 4F4AA 5GADU 2MYFA 4R0JA 2RUSA 5CYMA 2KG0A 4K4VA 4RU2A 3FDSA 3D1HA 1NDCA 3MMCA 1S99A 2V8PA 1S1XA 5DDPC 1JNRB 1EQ0A 4DEZA 5HN0A 3GIIA 2PMWA 4OI1A 5F41A 2JOQA 2OEJA 2W4CA 4BCAA 4CLLA 3MR5A 4HEA9 5A2QU 1AXQA 2BRLA 2GHVC 2X1AA 1I6JA 2OAUA 2IFXA 4K0KF 1JMTA 2LQJA 4PR6A 4DS5A 1VQPS 4OZNA 2CPEA 2MQPA 1VQOS 2G0JA 2VU5A 4DX7A 3X1LB 1IKWB 2V2VA 2CPIA 2W4DA 3BDEA 4HVZA 1FNMA 1NJIT 2IY5B 1T02A 2XHCA 5H9EJ 2HBYB 3NOGA 1U1LA 4OZ1A 3QT7A 4ZMMA 4DCPB 4OI0A 4U8VA 3ISND 1HNWJ 3RAQA 5AJ3F 3BR8A 2G4BA 1RJJA 4DL6A 3H59A 4C4WA 2EK6A 3HF5A 4OIXA 4NE9C 2J0XA 4WZMA 2PGCA 3SDEB 2AX0A 2PA8D 1KN6A 2YWHA 3VF0B 1QD1A 3WIUA 2ZH6A 3C19A 3KXDA 2MKCA 4J37A 5JXSA 2DK2A 3QSYB 1PSDA 1KHVA 4P71A 1N5YA 5T41A 2QGFB 5SZTA 4X2BA 1V5IB 4ED7A 1DFDA 2QT7A 1TR0A 1OY6A 2GV1A 1GFWB 3SQGB 5LMUJ 3V6JA 4DUTA 2R8GA 1RT2A 2DHAA 2DNKA 3K5LA 3RTVA 1X9MA 3QRRA 1FJGF 4HL9A 2WOMB 3BYPA 1S59A 3GFYA 1I94F 2EFQA 5HVFA 2WOMA 3FKBA 4NLGA 3PYGA 1LWEB 3EVMA 2EC0A 3CD6S 1FJ7A 2O66A 1RT2B 1ZOTA 3GTYX 4LSZB 4C8ZA 2HHWA 2NR0A 5I3PA 1RSCA 3QGHA 2XG8A 3BBFA 1MLAA 2GA7A 3D9BA 4KAIA 4OYMA 4YN3B 5EHHA 2GO8A 4MKYA 1H7WA 3GYXB 4O4GB 3E8OA 3T19A 1IKVB 2KVQE 2WVBA 1ULRA 2LVWA 1YI2S 2GHWA 4CO4A 1SJ4P 1UW9A 2NXJA 3IAS9 3U1LA 2JEJA 4MKVA 3KMSA 2XYGB 2D41A 1A0OB 2ZBQA 4PXDA 3CCMS 3AB2B 1YITS 2D3OR 4LSLB 3US5A 4USTA 2ROPA 3ZNUA 3LGNA 5IV4A 4DF4A 3PTWA 3I9V9 3CIZA 1J5OB 5E41A 1M5OC 2CJQA 4RW9B 3BV8A 3TR5A 2R7UA 1M1HA 1EP4A 1NXIA 2I1RA 4RNHA 5AXMA 3R5DA 2QC3A 5KFIA 4I68A 2PDAA 2YTCA 2DXDA 2HS4A 3DOMA 1PBAA 1PG5B 3EZOA 1FRMA 4O3OA 1NK0A 3MHYA 2PSZA 2G1HA 4DV1F 4ECYA 4PG6A 3KFWX 4WE1A 3CB4A 2WONA 3WQPA 4TY9A 2DGSA 4KV8B 1U1OA 1SH2A 3MMCB 3DLKB 5KOWA 1MMNA 4EZ9A 4E98A 2Q79A 3H5SA 5FLXU 2GS8A 1FDDA 3Q83A 4USHA 3W8PA 2V9KA 4U6PA 2PT0A 1T11A 2QYGA 1V9OA 4MYUA 3Q8YA 3GFHA 1F3FA 4O44A 4OV1A 4WP3A 3FC9A 1FKOA 1CQMA 2B6AA 1QSLA 4I64A 4TNOA 4PG8A 2WBRA 1YJUA 4E0DA 1SV5A 2HVEA 2DRDA 4RW6B 4LFAF 3KK3B 4LFCJ 2XS7A 2HQ3A 4GKKF 1TUWA 2Y0BB 1X31C 3NY0A 9RUBA 1EHWA 3TI0A 1M5SA 1XR5A 5D3GB 4CDIA 1K0VA 1K44A 4R5PA 4DSLA 1BWVA 2DY1A 1T9WA 2YQ1A 3B4DA 1CC7A 4ED4A 2WW4A 2LU1A 4WYWA 1UL3A 5CYQA 1RBAA 3MFHA 1NHVA 3DDKA 3GE9A 3JSMA 2VG7B 1PAUB 3KJVA 4QIEA 2A0FB 3MM5B 4KHPJ 3FGVA 2A3JA 3PEJA 1IR2A 3MDFA 2HBRB 5MLCV 1FTCA 3FQKA 1IBKJ 1VFJA 2DR5A 1LKZA 2G2OA 3AXKA 4N47A 2OIHA 1HYSA 1CSJA 5L1IA 4CLYA 3PACA 2VBYA 2EFGA 3MMAA 2D9OA 2MJNA 3TZZA 3UR3C 2L9DA 2YX4A 4ZJLA 1Y9OA 2UXCJ 3DRPB 1PC5A 3MR2A 2DNOA 3L7UA 3MD1A 1JLCA 2HPUA 4IFYA 5HROB 4RUBA 4K4UA 5ITHA 3FFIA 3CJKB 5L8RC 3OBIA 2NS1B 4LF8F 2ILZA 1JLBB 1Q78A 3W62A 4BWMA 1Q79A 4CH7A 4IR9A 1GX5A 1NH7A 5M2UA 5D15A 4X4UA 2VBWA 3VVUA 4ZIWA 5F8IA 4JI7F 1WACA 2V6AA 4KGZB 1Z2ZA 4KH0B 2HZCA 2BJEA 4IG3B 2VG6A 4LUBA 2GAGC 5I42A 1VCTA 4W90B 3K7RA 4DDFA 2LA6A 3UW1A 3MURP 3VGSA 1ZYQA 3P5TL 2AJ4A 1GMWA 1P1LA 1CC8A 1R8PA 1URRA 2EWHA 4DX6A 1HR0J 3NMAA 5CH7B 2CKWA 4P6QA 4CLTA 2ZZNA 1SB6A 3G9CA 2H48B 2CWXA 2W2MP 3DRSA 3TW0A 5DLGA 1HHQA 2MKIA 3CCWA 5IM0B 1XMQJ 3D3BJ 5CZVA 3EDQB 3TA2A 2XMKA 2NQPA 1NDLA 3OVBA 1W25A 2DBBA 3ONQA 3HKZD 9ATCB 4FF2A 1YIJS 3IGVA 1ZM2A 4Q0BB 3R1LA 5L9NA 2FZGB 3IBCB 1D8YA 4QIWD 1GTHA 3QBCA 2LQ8A 4URSA 3ZZZA 2IM3A 2HFZA 3I9ZA 3ULHA 4CNZA 3UN5A 5HVGA 1HW8A 3NAIA 3WZ0A 4AUKA 5B08A 2V9WA 1NB2A 1RZMA 1RLCL 4UOHA 2KZMA 2XTJP 2AJ2A 3MZIA 1UJ4A 4U67Q 5D3GA 2W9CB 1FDNA 1S6PB 3HT3A 1LEOA 3VQTA 1NDPA 2CIMA 1KKHA 4DR4F 4RBVA 6AT1B 1SKRA 1YRUA 4KRWA 1O6XA 1FKOB 1X4HA 3CJQA 4M5MA 3W66A 2VJVA 2JDJA 3BGRB 4EBCA 1JLFB 1NBEB 3S1TA 1WKJA 4XDDA 5HVHA 3HSZA 2UUCJ 2PE8A 3G8TA 3N6MA 5L1KA 2YNIB 2R7OA 3AD8C 2E29A 2DO4A 4RW8A 1U6FA 1DTTB 1NZAA 2CPDA 2W24A 1U6ZA 3KG4A 4L76A 3BF4A 3R7BB 3TYTA 3U27A 5HMZA 2YY3A 3CIMA 2G13A 5AT1B 2BW7A 1TL1B 3HHDA 2DB1A 2W7OA 1NJZA 3HHNB 2Z0GA 2FC9A 2NUHA 4B3MJ 3H2VE 4NCBA 2CVEA 2DTJA 3ILLA 1OPZA 1F60B 1XN9A 1Q8BA 1A7GE 2ASDA 1KVJA 3J7Z5 4O23A 1BY9A 2N4CA 1NK7A 1C0UA 3U7JA 1GMWD 1U7LA 3ZZ0A 5KG2A 1HNIB 2Y9HA 5FDLA 4ZVRB 4DR1J 2XNRA 3KWMA 3CCSS 4FF1A 1YBUA 2DHHA 3FZBA 4M5LA 1QUPA 3HVWA 3L4BC 1RTHA 1TTHB 4FPRA 2EPIA 3M2UB 3QQCD 3RRHA 2XBPA 4LREA 5SUHA 4QIGA 3MEGA 2QLFB 3CC7S 4UY85 1NJYA 3EM1A 1RHRB 3RAXA 2YKPA 1T9TA 2BMBA 5B0GA 4WFNQ 2G2YA 4RW7B 1T9UA 3D67A 4MFBA 2ZOGA 3AD7C 4DN9A 4O4GA 4TXSA 2AGOA 4FF3A 3PRVA 3KLEB 3RB6A 1W7WA 2RS8A 1RT5B 1HMVA 1S1VB 3BYRA 2B56A 4JI3J 3GWCA 4I1TA 3G96A 4USWA 3HZEA 4R0EA 2YNFA 1RCOB 2FIUA 5KT4A 2B7CB 3D0IE 5HO4A 1RP5A 2LFVA 3KLGA 1FXDA 4B3OB 2HMIB 4IRDA 3LAMA 4DPWA 1DAXA 5ETPA 5L1LA 3CJSA 2QX0A 5IQ6A 2AGPA 4CCHA 3EGZA 4NLTA 1CQNA 3HLUA 2HFSA 3MECB 2L08A 1U24A 2W7AA 4FYVB 1J27A 4MJKA 3HFVA 4ZVUB 1JLAA 5EUHA 3KJFB 1F2GA 2FJBB 2VD3A 2QEXS 4ZK7M 2RILA 3DGPA 3FBEA 1RWOB 2NXNA 3MR7A 4DFKA 1QAIA 5KG0A 3C15B 5K14A 5DLFA 1KD1T 1JJ2R 3MTKA 4PCQA 2BUNA 3P96A 3R8YA 4DXLA 2CNLB 2PEBA 1WOSA 3Q2TC 2B7BB 3HI9A 3ZZPA 3AT1B 3I0SA 5KG3A 1VLOA 1RT3B 4TQRA 2UXDF 5I4MA 5KFMA 5KFUA 1C0TA 4ZCLA 1L5UA 4LRAA 4XO0A 4GKKJ 4M5GA 3RR7A 1S1UB 2UUTA 3RB3A 3UN2A 2ROGA 3DM2A 5BR8F 1FK9A 1IKYA 1PBUA 2M52A 1Y5NB 3BKUA 3BPDA 4P74A 7AT1B 7FDRA 2KH9A 3KYLA 2MB0B 2RH3A 1PCAA 3MM6A 3ILOA 2M8DB 1RT7B 1RT4A 1HWIA 3QGPA 2YPZA 1OS5A 4HACA 1I51B 3QIPB 3NCPA 1RT4B 1FDBA 1S1WA 3RGIA 3RYLA 3TVKA 4RPFA 2JLFA 1S6OA 2Q6BA 4A47A 4LQ9A 5CYMB 3WIVA 1HNZF 4ZPAA 3VAKA 3HZGA 2CA9A 5LOQA 5GMEA 2RQ4A 3OPKA 3KHGA 4DV7J 1CJTA 3BH7B 3BSCA 2OJ3A 2PEHA 2XZWA 4EEYA 2FGCA 3THTA 4OYWA 2XLJA 2HMIA 1RT3A 2IAJB 2D74B 2C2ZB 1YBAA 2MPUA 3JAMY 4K4SA 1N36J 3J7AN 2IJRA 2LXFA 4OJGA 1UEUA 2KO1A 4OJ3A 4DR7F 3MCNA 4PKDB 5F9LA 3IG1B 3CDUA 2LA4A 2M88A 4A8YA 1CPZA 2R2SA 5GAHI 2ZDOA 2MZRA 4RX6A 4XTTA 4J9LA 1G4CA 2E5LJ 3OTDA 4LRDA 4O3QA 1RHKB 2K2PA 2ZH7A 1BQNB 5DM6Q 1RTDB 2QV6A 2DNLA 3BSAA 4WFZA 1Q5YA 1QM9A 2C2NA 4PUOA 2E7VA 1QVFR 3V81A 2ZWOA 4NOHA 4PEOA 1SJRA 4O0NA 1HBOA 2IVYA 4OZ3A 1VS3A 2K1RB 1SKUB 5C24A 2Z4PA 3P8BB 3FEZA 3R1HA 2W2NP 1LXNA 2V50A 3FSIA 1X4EA 1NB7A 3OD2A 1S6UA 2I8EA 2OHDA 3V5RA 2LECA 2DNZA 1JXEA 2NSBA 4UW2A 2RE1A 1FXLA 4DL7A 2DY9A 5A8KB 3PZPA 1AROP 1HMVB 2XMTA 1SKWA 1TU0B 4JI1F 4N77A 1SQEA 3NKYA 2BQRA 3ENAA 5J2NA 5T7LA 1Q8LA 3CD7A 3CUNA 3UD3P 2MQ8A 2DR7A 2IDLA 4ETXA 4WTOB 2G9OA 1A9NB 5KFKA 1HBMB 1FCAA 1IR1A 2VBZA 3BN7A 3ITHA 1QAJA 2CQHA 2VDIA 2PD1A 3VR1A 1U2CA 3EXYA 2EK1A 3FNNA 4CT9A 1TUGB 1R27B 2M4MA 2VB6A 3DLEA 4DCOB 4K0KJ 2V34A 3HHEA 3U1MA 1N48A 2VFUA 4DUYF 1BGXT 3NMRA 1WKKA 1RTZA 1CJVB 1VHFA 4RLEA 2JLEA 1C0UB 4WJBA 3HSDA 3UO0A 4ALZA 2VQEJ 3WC2A 3ISNC 3D66A 1HQ2A 2HGNA 2HRTA 3C16B 3QWPA 4UUWA 2R2TA 1PJ6A 3VVTA 2WW8A 1P6TA 5JVGQ 3WC0A 4DBQA 2VH7A 3M2RB 3MPDA 3NGTA 1N32J 1RWVB 3R5JB 4RWXA 4EK2A 2HQDA 4DL4A 5KFSA 1TL1A 1VRQC 2XSJB 1JLQA 1SH3A 4C3KA 4I4BA 5A8RB 5BXIA 4Q44A 3QJLA 3I31A 3MM8B 1P9QC 3QSIA 4NYOA 2V8VA 4ILRA 3HXMA 5G0RA 2DRAA 4S0MA 2JVRA 3RBDA 1FDAA 1HI8A 3TAQA 4A8OA 1JLFA 2OPQA 1IVZA 2MKSA 4M63A 4QYRA 1U4BA 4DPUA 2E9ZA 3PVXA 1VQ8S 1RHQB 3MAQA 4ITSA 1K1QA 3R7NB 4M5HA 2AHOB 1F3VA 2IVFB 4F3MA 2QMXA 3AQOA 1UEVA 2PI5A 1WDDA 2V4RA 1H0HB 4YQWA 1CULA 4L74A 3PNIA 3JYTA 1XMOF 3BBCA 2IYIA 1EKRA 2BRKA 3FK4A 1FO1A 2JSXA 4KB7A 2ADBA 4YY3F 3NAHA 2GVZB 1OSCA 4RUAA 3I5AA 4W98A 2ZM6J 3GZ7A 2GMHA 1VQNS 2GGPB 2V8DA 2X3DA 3W9IA 1FF2A 1GX6A 5D6GA 1SL0A 2EI5A 5E5NA 4CLKA 3OVSA 1D09B 2WSFC 3CMQA 1YG0A 4GO5X 3IR5B 4A8SA 3KDNA 1IWGA 3BN4A 2VONA 5ETSA 1N33F 4C3MA 2BABA 2ZVSA 2BQ3A 3MUMP 1Y11A 4NA1A 1RAOA 1Y0HA 1G2EA 5C42A 2M3DA 2Y3YA 2BOPA 3DRSB 3V6DA 4JI3F 4WP8A 1UVJA 2XLKA 1F2HA 2CQBA 2DKOB 1ITPA 4ZJQA 1RAIB 1UFLA 5A0YB 4YHHJ 1NK5A 3CCZA 3FEYB 3QGIA 5D78A 4GO7X 4YMEA 2HRUA 2W9AA 2R3VA 4DV1J 1S4EA 3QJJA 5C25B 5J2QB 3PKYA 3L7OA 1UVKA 2XNQA 1RISA 2VUGA 3NS5A 3C66A 4ZIVA 3T5JA 4YS2A 5J2PA 1W26A 1FWPA 3A3PB 4NLRA 1FFSB 1SVDA 2WVFA 3NGDA 4F2SA 1K1SA 3Q8UA 4ZITA 2LQBA 4IQMA 2JVOA 4FXWA 4NLVA 4F3QA 1B7FA 3N5BA 5KFYA 4RNOA 4UOFA 3FFIB 3TQEA 4NEZA 1FJEB 4ELTA 2ZEJA 3DOKB 2RRAA 1XQIA 1JLCB 4ZOSA 1VISA 4LBIA 4PABA 4JI5J 3L95X 4JOUA 3TWZA 3RB4A 2VPYB 4ID8A 3O2IA 3IWLA 4F4YA 4MTPA 1T95A 3GCWP 2RU9A 3H25A 4CLZA 4HTIA 4OX9J 2MGZB 2ZZMA 1Q86T 4DL3A 4C97A 5BR8J 4PUOB 3AD9C 1E6YA 3GLJA 2F40A 2X1GA 4QCLA 1U2RA 4FBUA 3E51A 3N5FA 4DX5A 1VGYA 2MXYA 4WFBQ 2HWHA 1KRPA 4F4XA 1WG1A 2OGUA 2QA1A 1N0UA 2C2OB 3W2WB 2QMWA 1BQXA 3AA8A 2CPYA 2KT3A 4X66J 4U95A 1ZTTA 2DJWA 4G1QA 1YWXA 3NNCA 1HBNA 2MHNA 1S1TA 3FSYA 1WJ9A 1BUXA 5F8LA 1Y7PA 4GMKA 1NO8A 2BA9A 2RRNA 4DV0F 3UD4P 2L3MA 1WG5A 2RS2A 4J9NA 2IRXA 3H4BA 4Q43A 4DLEA 2KTQA 4NASA 4HI1A 2QA2A 2PI4A 2LXUA 2VF3A 2MKHA 2UV8A 5BYRA 1H73A 1KLMA 3P45B 2P2CB 4ILMA 4O3NA 4IG0B 1U26A 2D69A 2CRLA 5D4LA 5GAGI 1RHUB 2FC8A 3HJVA 1C4CA 3I0RA 3MD3A 3CCUS 2NYHA 2H4WB 3CDEA 4I6YA 1V5VA 3CMAS 2V4JA 3CC2S 2NREA 4K4ZA 4DU7A 1RLDA 3K2YA 3MAAA 1K47A 2JJ4D 2VKZG 4KV8A 2VFSA 3GFZA 3IWXA 2WONB 4MMOA 5KFOA 3MAAB 1RT7A 2MMYA 3ZTQA 2HFVA 1GXTA 2GQCA 3A8EA 3O44A 2I0XA 4FVCA 2R8KA 3LO3A 2ZH3A 1U2FA 2LP4A 3EICA 5E3AA 3TNVA 4LF5F 2B4OA 1WHWA 3DOMB 3SEOA 4DCJB 4YR2A 4H4MB 5IT4A 1ZZNA 4W92B 2WB4A 1FWLA 5J2MB 4QW9A 2YKNA 2FGOA 3BQ2A 4A8MP 3VCDA 1D1UA 1ZPWX 4N76A 4RW9A 2CQGA 5DGBA 2B9YA 4F0MA 1J5EJ 1EAYC 3BM7A 4IH6A 3QT8A 4KHMA 1AUSL 4ZA1A 2Z30B 4V1Ak 2WTFA 3VAMA 1FEEA 2AYGA 4DZDA 1AFIA 2MTLA 1S7IA 5KFAA 3PW0A 3QAEA 4YDDB 2IC3A 4FYXB 1SCJB 4C8MA 4A8WA 4DUZJ 1S0OA 2EBEA 3H5UA 3RZAA 4KTQA 3V2UC 3O8WA 1RABB 2CZVC 2XHWA 3B8HA 4USVA 4YUDA 2GJIA 5B0DA 5J1EB 4X4VA 3D0HE 4F26A 3VAFA 4J9KA 1TAUA 4DL0C 4Z7CA 3M32B 3UNYA 2DH9A 5LT5A 3C46A 2B4UA 2KXHA 2NZCA 3OSPA 4EMDA 1EJ7L 2V67A 4KPYA 4B02A 4FBTA 2VFTA 4G1IA 2SXLA 1IQTA 3GYGA 5B7WA 2B8QA 1SH0A 1EB0A 2DT9A 3D7SB 1N6QB 1X4CA 3DOKA 4KIAA 3VGUA 4C2MA 3A8IA 3SQGA 4IYQA 2FUG9 5D0EA 1N56A 1F0XA 4IRCA 1XIQA 2C3PA 2RDIA 1Q5VA 4WU2A 5BYSA 2R2RA 2A6OA 1M90T 4MIWA 3HK2A 5KFNA 2ZITA 4UY8T 3T5LA 1T3NA 3B6BA 4I2QB 4RUHA 3MEGB 5J2PB 3IP0A 3EZUA 5KG1A 4KY3A 1KOOA 3CO0P 3LP0B 4TYAA 4Y0FA 3SV3A 4LF7J 1VOMA 5J2QA 3C6TB 2AJFE 3CJ8A 3SSRA 3W7BA 2ROEA 2BE7D 3PIPQ 4DR1F 1K73T 4HKQA 1UVLA 1JLEA 1UVIA 4U96A 3J7ZT 3UVJB 2G1DA 1O8BA 4R25A 1DLOA 4ED2A 2QJ3A 2NLWA 2WVCA 3W63A 2D3UA 2J9DE 3POTA 4WFYA 4YY3J 4BS2A 3W5YA 4F0HA 1HQUB 3DLGA 4JYAJ 3N01A 3HVRA 1FT8A 3H90A 1TK8A 3M05A 2MQLA 2QFIA 5ETNA 2CJKA 2XSFA 4X4SA 2VQFJ 2CPJA 4ECTA 2HIYA 4G1PA 2XLIA 4RW8B 2EFPA 1S0VA 1RBLA 2B4PA 2IMOA 4NCGA 4RR5A 3BGRA 3A12A 2OD6A 5J1PA 1FJCA 2BJDA 3DDNA 4WK1A 1YZ6A 3MEEA 3F44A 1FWKA 1RDRA 3OR2B 3ENWA 2RB7A 4ECZA 4ZPCA 4D3HA 3OSNA 1VBXA 4B9UA 3EGNA 2RQMA 5KFRA 1BWEA 1S79A 4F0KA 2ALYB 1S6PA 4KYZA 5D4PA 3MUTP 2ATLA 3I4PA 4IFVA 4ES1A 2BOAA 2OKQA 1VC5A 2E1MC 2H5EA 3C8YA 2OUGA 2HNDA 5ETVA 5KTQA 4CH0S 3TZWA 1ROFA 2CQIA 2WBMA 4PWWA 2X51A 2QZ8A 1RQ0A 5IQQA 5LSLA 1LFPA 2HVDA 2CUYA 4PQUA 2BEFA 5HATA 2XYHB 1VR6A 1FA0A 3GSIA 3DLBA 2KXNB 1HNVB 1DQAA 1HNXJ 3ZO7A 3H0PA 1I5OB 4CLPA 1HD1A 1WC3A 2AYBA 4D3GA 3AJ2A 1XR6A 2GX8A 2QTWA 2F4VF 1DJ0A 2BJ7A 4IQXA 2LXIA 2QO3A 1JLGA 5E3CA 3M30B 1MROB 1IBMF 4NA3A 2W01A 5U47A 2MQQA 1OYEA 1Q8IA 1X0FA 2BANB 2DGOA 1RYSA 3S8SA 4EBEA 2FLNA 1Z1ZA 3IAM9 1P9YA 3Q2SC 4M8LA 3UVJA 4MIBA 1T05B 2RDJA 5KT5A 2QIFA 4Q2MA 5IV3A 2KRBA 2RHSB 4DR2J 1D9DA 4A48A 2C1EB 4RBUA 4QU6A 1SI9A 1TL5A 1F5CA 1U09A 2BKNA 4Y2IA 4C7QA 1S10A 2RU3A 2MDAA 1M1KT 5JJBA 3GQCA 4YDXA 5F0WA 4FPIA 2UVRA 2X3GA 3FCVA 3I96A 2PO4A 4I0WA 5FIIA 4X64F 3JAMU 1NK6A 2UU9J 3IFEA 2BX6A 1P27B 1UPMB 2I5JA 4W4MA 5G4DA 4CH1A 4F50A 2B5JB 2HIQA 4KKOA 3O3LA 3CJKA 1B70B 1UKUA 1RTIA 2OMLA 2VC1A 5CZXA 1HIYA 1Q53A 3QIDA 1SQFA 2GMLA 4ZVTB 4NLDA 5A8KA 1L3KA 3A3NB 6FDRA 3OL8A 1N6QA 2HRYA 3GYNA 3DRPA 3QFWA 3SFUA 1REGX 2JFDA 3KKFA 5HQLA 4FYWB 2QLWA 4B08A 2F8HA 5A6PA 3MR6A 2AJQA 1AA1B 3K89A 5A8WB 3WX8A 3IM8A 5KAKA 4M5DA 1TV6A 3G6YA 3SCLE 4XK8C 3FRYA 2ZD1B 4K2XA 1KVKA 4EZ6A 4KT0C 1FKPB 4ZVEA 2UXBF 2HHSA 3DYAA 3B82A 3CDWA 1RA6A 3CWJA 3M6WA 3R27A 2DEJA 5HI7A 3JSMB 4ILLA 2IM1A 1FEHA 2QFJA 1B4SA 3QT6A 5KT2A 2R7RA 3TZYA 4DS4A 1FI4A 3C3LA 4NLWA 3EE3A 3CDBA 1FTRA 2C3OA 3QRPA 4HDHA 5A6WA 3OTBA 2YKQA 3OW2R 2UVUA 3JTNA 1NNDA 3QMQA 1GXUA 1I1GA 4N7TA 4EYIB 5H1SV 2R8JA 2IAJA 3IRXA 2D9PA 2DR6A 3I32A 4WK3A 3KHHA 4J9OA 3D6FB 4PXEA 1NPPA 5GAEU 1GAOA 2UV8G 4FP9A 2A6MA 1B7YB 2YNGB 3LALA 5M2RA 5K8MA 4LF4J 1S77D 4JI6J 1CJKA 2AEMA 1YJVA 4HI2A 2HFOA 1RUSA 1H3DA 4USJC 5LL6d 3V4IB 2D3O1 3VQSA 1ZM9A 4UTGA 2J0QD 5AXLA 4UUXA 1WOPA 2FJWA 3QIPA 2E5GA 4URQU 3NS6A 3OR1B 3OVAA 2VOOA 1RT1A 3R7SB 3M8RA 2ALZA 4JI4J 3I5BA 2JC1A 3BBBA 4K2JA 4M5KA 4OMFG 3VWSA 1BHNA 1WELA 3LGMA 4BLGA 3PV8A 3DM2B 4JI2J 4LSNB 2M70A 5K5MA 4C8NA 2KM8B 3TUJC 2DNGA 2RDDA 3RG6A 4N8OA 3K57A 1PIEA 1SL1A 1HLWA 3HHKA 2JEGA 3RJMB 5K9FA 3JQJA 2MSTA 2UUAJ 5LJ5Y 1ZPVA 3UNGC 2BDPA 1RAFB 1O5JA 2KYXA 2OFGX 3TEHB 4EFAC 3L9ZA 2LU2A 3FMWA 1EKSA 1TAQA 2ZBIA 3CJ4A 5HJXA 3N4WA 4LSLA 1S0MA 1K0TA 5KFXA 4DV4F 1U8SA 2CQPA 1VQ4S 1UWBA 5L39A 3F0NA 2OPSA 3DU5A 1VK8A 4DJBA 2XCAA 2IYGA 5RUBA 4IO9Q 1SUQA 1JLAB 2V0NA 4YB5A 2KT5A 4ED3A 1IBLJ 4NRUA 1WHYA 2ZE2B 2XZDB 3MM7A 3PCOB 2J9EA 4DPOA 5AE1A 3IN5A 3X3UA 2QLXA 1S72S 2HZVA 1KSPA 5DDOC 2MZTA 1PAEX 1WOOA 3AQPA 4GKJJ 2H5JB 1XMOJ 2BR0A 4MH8A 2LDYA 2RIJA 3OXGA 3CCRS 1I94J 2VA3A 2PFFB 2CQDA 1GMUA 2MZSA 2CWKA 4BC9A 2IM0A 2HHHF 5DRKA 4WP9A 3OUYA 2ZM6F 3GPAA 4AXIA 3BKFA 3MPWA 3N28A 4JB8B 1NJXA 4O3RA 4Q2LA 1X0PA 3P3DA 3LW5C 3K5NA 2XY6A 5CXTA 4C11B 3Q89A 4DF8A 2WB1D 4P10A 4CT8A 1N5YB 5C5JA 4TU9A 4NLYA 2W25A 3G4SS 3RRGA 1RACB 2XQCA 2OPSB 4U7UD 4OZLA 3ZC4A 4OQJA 4O3SA 3MPUB 1NH8A 4OX6A 1QY7A 3A1YG 4HHJA 4USKA 4WKRA 1U02A 1UWBB 2NYIA 4OHVA 5B0CA 1URNA 1KONA 2C3UA 1KR4A 2JRSA 1NCLA 1RTHB 1VI7A 3MCOA 2OLWA 1KQKA 3MWBA 4IH5A 4KR0B 1VQ7S 5GAEI 4IKAA 2DNHA 3DRRB 5KFTA 2JH3A 2HHPA 2ASYA 2ZC3A 3EGVA 3G2XA 2XMAA 1VQMS 2QA4S 4ENOA 5LXRA 1WSRA 1ZAVA 2J6UA 4NXNJ 2DEIA 1VMBA 2NXEA 1FVQA 5CA5A 3C6UA 5D77A 2Y1JA 4LQ3A 2V94A 5E3QA 1IM4A 2I6WA 5C42B 4ZLJA 5JVHQ 3ZTPA 1S12A 1B3TA 5EN1A 1Q81T 4K5RA 1JIHA 1RWKB 4IDKB 4CWBA 3OXLA 1R0BG 4NA2A 2ATCB 4O4RA 2DGQA 8ATCB 4G6VB 2LQ5A 2POKA 4OFZA 2KJVA 3AOBA 3EPIA 4OZJA 4B9VA 2J0SD 1SIZA 4QU7A 4ATNA 3P5BP 1UFKA 3H98A 2BE9B 4RJVA 1R0CB 4J9MA 1SJFA 2W2OP 1UTAA 3V4IA 3H20A 3KJNB 2XWXA 1JJHA 3VTIA 1YSJA 5HLFA 2GZOA 2VG5A 2YNGA 1SQGA 2ZH1A 1G3OA 1UCNA 3MM9B 2L9WA 1U6BA 1TMMA 3K58A 4JBCA 1DQ9A 4HT7A 1M5VC 3J7YI 3MCSA 3VHQA 1CULB 5DG8A 2OPRA 1S97A 2KJWA 2RSQA 4OX7A 3M8YA 3BO4A 4AXJA 4RL1A 3SYZA 3Q0AA 2DGTA 5LJ3Y 3GILA 1OIAA 2JZ5A 1R6VA 2KU7A 2OSRA 4M5JA 2XCPA 3GIJA 4YOEA 2AX1A 4EU0A 3KLEA 3G6VA 1PYOB 4EBDA 5I3QA 1HBUB 4J9QA 2ZOFA 1FRIA 2YKMA 3FJ2A 1WG4A 2GCFA 1SC4B 5CHCB 4U7CA 3PW2A 4Q0BA 1MSWD 2XGPA 1C1BA 1FKPA 2YPYA 5GMDA 5IC4B 2KFNA 1DY3A 2OPPB 1SBRA 4KO0A 4ZVHA 4DV0J 2OEMA 2R9LA 5ADZA 4DOZA 3PM9A 5L38A 4NXMF 3S01A 2J9DA 5B09A 3C16A 2E9TA 1X5OA 2M8HA 3CNQP 3LH2S 5CABA 1UP1A 3HPOA 2Z2ZA 4U8YA 2AGQA 1KQSR 3D5MA 4CYUB 4A8XA 3KUEA 1XNRJ 3ENVA 3IS9A 3H8YA 1CVJA 4CTAA 5HL7Q 3EYZA 1GXLA 2UVVA 1XNQF 2I5JB 3CGIA 4LRFA 4ZLLA 2W2PP 1JKHA 3UWTA 3HP6A 2HZAA 2C2KB 1OO0B 1PGZA 2I9SA 4K8RA 2PMZD 1NEEA 1YZ7A 4HTJA 4ZCMA 3T1HF 3BR9A 2AEFA 3BQ1A 4ERDA 4LF5J 4F04B 2E7XA 1N54B 3LTOA 3KOAA 1V3RA 3CD0A 4C0HA 4LF9F 4KJIA 4UOGA 2QRRA 1DZ5A 2V8HA 1KP6A 1XEZA 4P52A 4WTYA 2OFHX 1HR0F 1VQ6S 4ED5A 1PJ7A 1VJWA 3QJPA 2Q66A 4ZVOB 1IN0A 1NDKA 2DRBA 2F4FA 2WSCC 3WDOA 4B9SA 1WI8A 3HHLC 5A76A 2FJEB 1NU4A 1S49A 3EJMA 2DNYA 5CCMA 1SIWB 4QZVB 3VAHA 4DL2A 3R3TA 2VPWB 4DR5F 2JEIA 1TUVA 3EX7B 2VL1A 2A1BA 3MUVP 2MY7A 4JI0F 3I6PA 1KNZA 2QSWA 2V5HG 4CM0A 3D0GE 4ZPTR 4RZRA 2YKAA 2NZ4A 4WPAA 1WTFA 1U0SA 1RXOB 1R8CA 3VALA 4A8KA 2D3ZA 1RT6B 4NLOA 4L3NA 8RUCA 1VHIA 1UAWA 2EC2A 1IJFB 1N0VC 3QLHB 3ZFVA 2DNMA 3G82B 3D1OA 3CVKA 3GR1A 3J7YU 3M6UA 3M9MB 3OFGA 4CLSA 1N52B 1FNOA 1Z4UA 2XI3A 4ZLNA 1RWNB 3THPA 4R5PB 2KFYA 1NKEA 3LAKA 1HA1A 3HDSA 2B3TB 3IBFB 3UDEA 1XERA 3THVA 4LF1A 5AJ3J 1NLKL 4Y28C 3W9HA 1YTYA 2FJXA 2R7VA 2LYVA 2VASA 1ZM3A 2Z58B 4DL5A 2K7KA 1CJTB 2IVMA 4Y6IA 2B43A 2VG5B 4QR2A 5JUMA 3BSOA 1KQFB 4ANCA 5E7OB 1TK5A 3ILIA 2ZJRQ 4M95A 3UE2A 2GJFA 4B9LA 3MOZA 4ANEA 2FB0A 1NHUA 4ZVSB 4C48A 4B3RF 4AQYJ 3LPEA 1VQLS 5DZ7A 4Z37A 2B4VA 5BJRA 1ZA1B 1IBLF 4IDKA 1FJGJ 3W65A 5DG9A 4ZJOA 4JV5J 3AOAA 3I87A 5KFGA 2ZWPA 3ISZA 4MK7A 4PXBA 4YB7A 4AD6A 1U49A 3NNHA 1OYDA 2DGUA 1DLOB 2HQIA 2GW8A 3C6UB 1D9FA 1S1UA 2MZJA 5ETMA 3ZXWA 4N56A 4ZN1A 1EP4B 1JLEB 5DJBA 2YH0A 1J2VA 1KFDA 3LPYA 2A10A 7FD1A 2CG8A 1XBWA 3DRRA 4YP3A 3AHPA 3I0SB 3JTOA 1TZ0A 2IHR1 3SIPB 2DNPA 5DG7A 3K5MA 1MG7A 2GJ2A 4XPEA 1W2IA 3BGFA 2IJNA 2R2UA 1GTEA 3MF5A 3C15A 1TL7A 1IJEB 3C14B 5K14B 4Z7YA 1SKSA 1BXNA 2APOA 1FXRA 4HHHA 1Q7LB 1VBYA 4NLUA 3T9NA 1FFWB 1LK5A 3M7VA 2Y8WA 1FE4A 1M0SA 1I3OB 1YJTA 3EVWA 4J9VA 4P2FA 3M1VA 1WC1A 4RW4A 1TL4A 3PFEA 4P2SA 2R7QA 3T1AA 4DPXA 5HAOA 2HURA 2VHGA 1S57A 1RTJB 3CJ3A 5HJYA 4YB1P 2VBXA 2K7JA 4DQRA 5IS2A 2BJ9A 2OSQA 2RD5C 5DM7Q 3R2DJ 4BBYA 4OL8A 3GB0A 4DWIA 3CJ2A 3OUYB 4B3OA 4RO0A 4BWJA 1S9EB 4B9TA 4C8LA 4IO1A 2EEYA 2VICA 1O0PA 1VC6A 3GCXP 2C2RA 4B17A 4HYKA 3R97A 3BSNA 2FHJD 4F36A 1V3ZA 3Q24A 4WYLA 1RAEB 2GIFA 3M8PA 1Y00A 5J1EA 4DV3F 4OYOA 5F8NA 4WIIA 2MEWA 3I82A 4TYBA 5E33A 1U1NA 4QOTA 4MFBB 4WF9Q 1VQYA 1YQHA 1RADB 4H54A 2DVIA 4LF6J 1G1XA 3M2VB 1TL7B 3C14A 2IC3B 1IR0A 2YWFA 3M2UA 4XDCA 5DQIA 2BYCA 3KK2A 4LFCF 2OEKA 4OI3A 2D1CA 2N7CA 3U1NA 5H9FJ 4QQBA 1U1QA 2UXDJ 1UPPA 3KLIB 1GNKA 2RHQB 2BJ8A 2PIIA 3SFGA 5LMUF 1C1CB 4LR8A 1IKWA 2FPHX 3BDPA 3K8VA 1H6KX 1T9VA 2BE2A 3NBPB 4H4MA 5HQ8A 2V63A 1KBRA 4V19J 4Q7AA 5IZHA 2OTLS 1YHQS 1FKAF 4DN0A 5AXNA 2YBVA 5DZ6A 2O3DA 4KGXB 1HQEB 5H9FK 5FLXY 4RKUC 4FNIA 3W8GA 1S1XB 4KH1B 2FJAB 3PIOQ 2PMHA 1YGYA 2IIHA 4JV1A 4MK9A 3NRBA 2BQUA 3A8JA 2UXCF 1CJUB 1WF2A 2R7WA 2GIQA 3JTPA 2I38A 4IG0A 2UU9F 3M9OB 2I2YA 3ILJA 2ZBPA 3JSYA 2BKOA 1WEYA 2PA3A 3UQSA 5DETA 3IRXB 1M1GA 3NCQA 1WF1A 2AWZA 1DBDA 4TU8A 3NP5A 3PR4A 5HP1B 1N8RT 2X1FA 4O0IA 2AW0A 3K59A 2JWNA 2MKYA 5IWAF 2AKWB 3PW7A 4PYDA 3HHLB 1XNQJ 4N5SA 2DGVA 3M8QA 1CBKA 4L72B 5HMXA 4ECVA 3QLHA 1AFJA 2KL8A 4IUFA 4FNHA 1YJRA 2HKEA 4TY8A 4O3PA 2G2ZA 3PHTA 4AYBD 2M9KA 2PN6A 3NXZA 2XMJA 1LWCB 1MU2B 3DYAB 3T1HJ 2KVIA 3OTEA 4C8OA 1S9FA 2ZDPA 2RVJA 3DKDA 4QYZJ 4DR6F 2GQQA 4WXWA 3VZIA 1T3OA 3GONA 2DPIA 1XJWB 1IQZA 2CYYA 1Y3KA 2E1AA 4PG7A 4CLWA 5A8WA 3OV7A 4DSFA 1OSDA 1Q8KA 2C3YA 2BACA 2Q6CA 3W5XA 1GEHA 1QJHA 2HFNA 4DMZA 2AQ4A 1Y5LB 1RU1A 1SPBP 4ZHRB 3KLHA 3KK1A 4A8QA 1KLNA 1PILA 2HVZA 1UVMA 4DFMA 4ZS6A 3OLAA 4ZVFA 2AP6A 3FQLA 5I42B 4C9DA 2ZH5A 2OP5A 2XMMA 1N5SA 3M6XA 3MEKA 4DQSA 4JI4F 1WNEA 4C0OC 2EKYA 1SC6A 1TKZA 2DD8S 1S48A 4FS2A 1R43A 2M5YA 3HCXA 4OYAA 1XTZA 1LNQA 4JI2F 1JKHB 3QAUA 4ID5A 2GQ2A 3CPWR 3TVZA 2B9WA 3SCIE 4DR3F 2CAJA 3S7RA 4K5SA 4J90A 1LFWA 3LOUA 4CTAB 4EUVA 2GO9A 1XR7A 2IA0A 5K8OA 2VQEF 2UUAF 2DCUB 1JQGA 2IDEA 4IFYB 1DTQA 1QAYA 4CI0B 5A2QY 4DLGA 3R6GB 4JV2A 3H42A 1VJQA 4YFUA 1UFWA 3K0JA 3TOQA 4M5IA 3V6DB 3E2EA 5HANA 1B99A 2XY7A 2ZHOA 1MROA 2BJ3A 2ZBRA 1JLGB 2GIRA 3EDRB 1QE1A 2H54B 4K7QA 4ES2A 3OTOF 3CJ0A 2CPXA 4KGKA 1YJWS 4FYDA 1LWCA 1MU2A 3MPYA 1H2TZ 4TLQA 1HBUA 1Y3JA 4OLPA 1GQEA 2V68A 3CC4S 1NSQA 1FRJA 4GKJF 1UJ5A 4PQAA 5CYQB 3DOLB 2C2EA 3HHLA 1P1TA 2F1FA 4F25A 4OYIA 4G65A 3PX6A 2H65B 3CD5A 2VA2A 2RF2B 3ZZTA 3PKMA 4KPCA 1H72C 4H4KA 4LVOP 5KFZA 3T1YJ 5E3RA 2FVQA 3NGKA 5E2QA 3L09A 3KK3A 1RE1B 3ET6B 4OZ2A 2B9EA 2NXUA 2J7WA 3AH6A 1VRTA 5D0RA 5B0EA 2NPIA 3GU0A 1SJ3P 3OR2A 1RKIA 1D0EA 1RB0A 2ZH8A 2PFDA 3EGWB 4YEAA 4MKBA 5J1NA 3CCLS 1XWLA 5HLFB 2OPQB 2K8GA 2J5AA 4UF4A 4L75A 4L6V3 4PWUA 2HAFA 3CSKA 4OYZA 3DNCA 3W1YC 2HNYA 3DRYA 3OHAA 4C8KA 3B78A 1YX2A 4OI4A 2XMVA 1YJ9S 3QYYA 4K59A 5DS7A 1JLQB 1OPIA 2FHKA 2XSJA 5CD4H 1PO6A 3IGNA 1UA0A 4J91A 5HK4A 4TN2A 4EGLA 1NK8A 1IWAA 1HQUA 3DLGB 2FHOB 4DSJA 4XPCA 1AZSA 4NXNF 4QJVA 3DFEA 3GJTB 1RWUA 1TKXB 1TL3B 3NGUA 3IA0A 4FKYA 5L46A 1CS4A 3NBPA 2BE2B 1OQ6A 2AT1B 3DRXA 3G86A 4YHHF 3H4DA 1EETB 4ZVPB 1CJVA 1ZETA 4OYXA 1X4GA 2W8KA 1SC3B 1EARA 2GC8A 3C6TA 2ZH9A 1RWXB 2X7IA 2Z57B 2QE5A 1E6VB 5F8HA 1A6LA 3NG8A 1MWYA 1RAJA 3AOCA 4USIA 4X4QA 1NK4A 4KSEB 1R6YA 3SCKE 4TQSA 4IR1A 1EIYB 3M2VA 1YJ7A 1BE4A 3J80Y 1DURA 3N79A 1F5BA 2M7SA 3MPVA 2L41A 1Y10A 1HBMA 5ETRA 3QO9B 4X62J 2JEFA 4OHZA 3HVTA 3MFIA 5MAOA 5EGYA 2AU0A 2IM2A 5KFEA 3R2CJ 2Y1RI 3M8PB 5KFQA 1B0PA 3MEDA 3QNWB 5ETTA 4JI5F 5D4OA 2HHQA 1EZZB 1LWEA 1QDUB 3W2WA 4DV5F 1TKDA 4HR2A 2EXUA 5C24B 1O51A 2EFNA 2K1RA 4V19X 2CADA 1FX2A 5LSOA 4P7VA 5ETQA 1LXJA 2BBEA 4R8UA 4KC5A 1H74A 5C2GA 3KHRA 2ASJA 3M32A 2HHUA 2Z2YB 3QRQA 1F9EB 2FVCA 2MQMA 4WWSA 3J81j 5HMWA 3OL9A 2IPOB 4ICLB 1XC9A 2YWGA 2FTRA 3M1VB 3F41A 4RW4B 4FS1A 1ZZFA 2GVDA 2UUWA 2YX7A 4PPZA 2WSEC 4X66F 3PO4A 4F4ZA 2MHEA 4CP5A 2HHTA 3PG9A 3EWGA 2YQ3A 3MMBB 1WEZA 3J81U 4IOBA 4TU7A 4NXMJ 1U0HA 3DCAA 1IBCB 1RWMB 4KGVB 2LCWA 1F9FA 1N36F 5FJ4A 2CQ2A 1Q1KA 2QYCA 1U8WA 3T5KA 2P9CA 2J7UA 1RA7A 3GR0A 1RGVA 1EQMA 4I67A 2WK4A 3DHXA 4FXDA 2YKNB 2XULA 2HBZB 3MMJA 1ICEB 4DG1A 5CYJA 4LSNA 2DHSA 4U9RA 2AYEA 3VGVA 1G6BA 4RNFA 5CD4A 1WKLA 2HGMA 3Q8RB 1R0AB 1Q82T 4Q5VA 1FX4A 1SJ1A 3HX9A 1R31A 1WI6A 1H7XA 4P7TA 1FRKA 4QPTA 4B9MA 3O5TB 4HACB 2E7WA 2EW9A 2AJ0A 3MM6B 3PY8A 1VC0A 1OWXA 3JSRA 2DXEA 2MLXA 1JJCB 2HQGA 1R0AA 3LWLA 1FK9B 4DR6J 3SMZA 3D1QA 4CM2A 4J9PA 3TA1A 1CJKB 4DG1B 2E5JA 2CVIA 3NGSA 2H51B 1LWFB 3TQ1A 3MI7X 1MN9A 1N4LA 2Y1LB 4N41A 1N5QA 1C0TB 4GRSA 3GV5B 3KTQA 4JI1J 2ZH2A 4GVLA 5EWFA 2XWYA 3J80U 1TFYA 1F9HA 1YJNS 2YNHA 4ELVA 3CJ5A 3GFXA 1ZAWA 4LFBJ 2BVZA 2FQQB 2Z2MA 1LQ9A 1U0HB 4HLBA 1UMJA 1X4AA 1UA1A 1BQMB 2F7VA 2P9EA 4G1QB 3TA0A 3PW5A 2ZHBA 2GVDB 2HBQB 1EX8A 1PYSB 4MKAA 2NXCA 4WIQA 4DUYJ 1KHWA 3B4MA 5GAHU 4OHYA 1BD6A 1LW0A 1FRHA 4USMA 2W9BB 2H9ZA 2HNZA 1R8BA 3KHLA 1IBKF 1GMVA 4Y2MA 4J9UE 3UDLA 4Y00A 5IFMA 4DR3J 2VC0A 2MGZA 4R8UB 4ZP6A 1MMDA 3JXOA 3KLGB 2JNJA 5L9XA 3UI3A 1FRXA 4I6AA 2DH7A 2DGWA 2OTJS 4OYPA 2DPJA 1WC4A 3BH6B 5F8MA 3H5XA 3TUPA 4DHVA 1LOUA 2HLTA 3MEDB 4DV7F 4ZPWR 2WRMA 3AJ1A 3KJQB 1S4FA 4KKOB 2ERRA 5KFHA 5IC6B 3SBMA 4B3RJ 1AT1B 2KRRA 4QW8A 3G87A 3GV8B 2IBKA 3QO9A 3TX8A 2F65A 2RUGA 3HO1A 4UT4A 2ILYA 3GIRA 5B0AA 3BQ0A 2CNNB 4JV5F 4LRCA 2W1BA 2VV5A 2LEBA 2FVPA 4JI7J 3BJYA 4I2PB 3IWNC 5F8JA 3D4JA 4Q8EA 1NHKL 2CDQA 1R89A 1X7VA 2UUBJ 4DSKA 3JQMA 4ZPBA 3HJFA 5E3PA 1KOHA 3UDVA 3L3CA 2VKRA 1NUEA 1T9YA 3PX0A 4OI2A 3VZHA 1HNIA 5H9EK 4CYUA 4DSIA 3ENQA 1EETA 2MQNA 4QIVA 3T1YF 2KZZA 2P6TA 3CTRA 1RKJA 3LP1B 4WXOA 1KQGB 2BANA 3I55S 1UEKA 3Q86A 4JI8F 1U1KA 1CEZA 2JL9A 3KLVA 3TUIC 4H4KC 3M30A 2VODA 3FCWA 4KO0B 4L3KA 5AE2A 5KFWA 1X5SA 3M6VA 4DU8A 3J81Y 3UFCX 3K8WA 3KLFA 3FVYA 5GMKa 4J7CA 1S0NA 2L48A 2W4PA 1L3TA 3RU0A 2MZ1A 4IOAQ 3HD2A 2BKPA 2O01C 4QWAA 4PQUB 2R4FA 4LR9A 2G0CA 2HNDB 3CCVS 1GH8A 1AUDA 1UVNA 1HFEL 2J76E 1ZBTA 2VPXB 3E01B 4CLFA 3EVOA 1REVA 2FHJA 4FXVA 5B0BA 1X4BA 2J0WA 3R5AA 2BM1A 2RRBA 1RWPB 3OQ2A 4I6WA 3J7A1 1C4AA 4DR4J 1RBOB 3T41A 1QAXA 3M4XA 3NS7B 2HVHA 2B9XA 4NMXA 3FEXB 3TANA 2QG9B 5G0RB 1W2BR 3TJ9A 2EFOA 2CJBA 1D9AA 4RUCA 2C22A 2DNNA 1U48A 1ZS6A 1SC1B 3D6HB 3GG1A 5KG5A 1TKTB 2MJUA 1G7CB 1U1MA 4TLRA 3I56S 3GP9A 4RNMA 1BMQB 3ETOA 1IBMJ 4LF6F 2QMUB 3N9UC 3AXMA 2B8PA 4KHRA 4DV6J 3POTB 1D3WA 2EBGA 2VIHA 4OHXA 2ASLA 4OX9F 5HBMB 4NYZA 3UCZP 3CCQS 3CJTA 4M94A 1XMBA 1S6QA 2KKHA 3QGGA 1NSPA 4KE5A 3TO8A 1VYAA 2BZ2A 4CZCA 1DTQB 3GV7B 2DR9A 4WFXA 3ZTOA 3BB5A 3DI6A 2DYAA 5F0UA 3PEHA 3HHLD 3IXQA 1SXLA 3MXHP 3DLEB 1NPRA 4J9RA 3DDIA 3G6ES 1VRUA 2VG6B 4IG3A 1IUJA 1TKZB 4KBIA 1RAAB 4LBHA 2RAQA 3ICLA 4Y65A 4L73A 4NI2A 5ETLA 4A4JA 3D6TB 3VAIA 1VIXA 1ACMB 3DLJA 4ZP7A 1Q7YT 3RW7A 2O67A 1FHTA 3LUYA 4MAKA 5I3UB 2E5IA 4I7FA 4Y3CA 1WEXA 4P2XA 3TX0A 3QPIA 2YWEA 3JQKA 4ZPVR 4C11A 2C2DA 2AF6A 4ECQA 2CPFA 4ZHRA 3KLHB 2WZ1A 3HFKA 2GFFA 2XYPB 3KK1B 2MLZA 1N33J 2MSSA 3GIMA 4CO3A 1WTBA 3ELHA 4OX8A 4QPXA 4K4WA 2C28A 3IMQJ 3DLHA 5IWAJ 1DHMA 3LP2B 2Y0SD 2MQOA 4X4TA 2B51A 1S76D 3QFHA 4NEYA 4JI6F 3R9LA 4UOCA 2ZNYA 1S9GA 2HWIA 2R42A 5CCLA 3QZ8A 3HD1A 3V81B 4PYAA 4GC6A 3JB9k 2YKOA 1HYSB 1UETA 3CJRA 3D6MB 4NLQA 4C0BA 4K4YA 2H1YA 1LW0B 2W9BA 4EWTA 2ZFHA 4QR0A 3R5GA 2F5GA 4ZVGA 1SUQB 1X5PA 4WU3A 3VV2B 2VG7A 3TJAA 3CMES 1V6HA 3PJWA 2J9CA 1PYTA 2M2BA 2F3JA 3GSDA 2ADCA 2KDOA 3OL7A 4B3TJ 3MTJA 2KM8C 3FBBA 2H4YB 2CQ0A 4EYHB 2AEJA 1J5EF 2Y8YA 4B3SJ 2DO0A 2J6TA 4OYBA 1HKAA 1QTNB 2QLBB 2IBOA 2YNHB 4G3IA 5IT0A 1SV5B 2F8MA 3GG0A 3D68A 2V8GA 1N5TA 1NSKL 1VLYA 2B6AB 3BEGB 5GAGU 4LFBF 2OMOA 3A13A 3GJRB 3N0VA 3NOCA 4ZKAA 2P6SA 2N4DA 4X65J 3M8SA 3W9JA 3V6HA 4X4NA 4KGMA 3HSGA 1PKUA 4CO5A 2OO4A 1WORA 2VDHA 3VAJA 1RT1B 4DQIA 1ZTWA 4TKTA 2Z8QA 4OJ1A 2YWWA 3A8KA 4WE1B 3PO5A 2YH1A 3UCGA 4HH0A 2V4JB 1DRZA 2ZJQQ 4ECXA 2JLGA 2IJFA 1B64A 2HW3A 3P4UB 2CXEA 1KLMB 4MIAA 5KT7A 1CG2A 3FRZA 4ER8A 3W64A 1C1CA 1WSVA 2BW2A 5E0OA 3RW6A 3VGTA 1NKCA 1J5OA 4ZP9A 4WZQA 3KLIA 3ZZYA 4PRFA 1APSA 2E1CA 3AB4B 3LANA 2YQ0A 2FVRA 4J9SA 3KK2B 1K9MT 2HVIA 2Q1LA 1GK8A 5K8NA 1RWWB 4ECRA 3BGLA 1NK9A 4CO2A 3MMBA 1IXKA 2IA6A 4DV2F 2CG4A 4YB6A 3C2PA 2ZKUA 1S5ZA 1Z2LA 2ZBCA 1HWLA 2DHGA 3NWGA 3RBXA 3UD5A 1WUUA 1S7HA 3BPSP 3ZZOA 4YR0A 4UQGA 2KG1A 4ED6A 4AL6A 4IRKA 4ICLA 3QWUA 3PX4A 1L3VA 4PWDA 5AXKA 2E66A 2CNKB 4XAKA 1E6YB 1B0TA 2B0GA 3DN9A 5K20B 1JWWA 5IT9Y 2VOPA 3KNGA 3R6LB 2UUBF 1TV6B 5HMYA 3G6XA 1YRXA 3NGRA 5KFBA 3CE8A 1H38A 2HHHJ 1RI7A 2U1AA 1QSSA 1RK8A 2FLLA 2HEKA 3UPFA 1KTQA 3OFHA 3CDAA 2E1RA 3ETMA 4Y2AA 2HS3A 1TFWA 3PYFA 3M9NB 4QYZK 1FFGB 1JJ4A 3Q22A 4QWEA 5K8PA 3OHBA 1N88A 2VQFF 3HM9A 1RT5A 1S1VA 2U2FA 2LDIA 3GJQB 2W2QP 4JP8A 2MZQA 1JNZB 1GT8A 2XZTB 2JC0A 3PRBA 4ZLPA 3D2WA 3SZ2A 1KFSA 1H2VZ 1TP7A 3FCHA 2BJ1A 4ZN3A 3HVTB 5THWA 3FBFA 3T9ZA 5I3UA 2VPZB 1AB8A 1NJWA 3EPGA 3AODA 3BGUA 4RW7A 3SQOP 3QATA 3SDEA 3R5BA 4NI2B 4K4XA 2HQFA 3OXFA 4NX9A 2QN6B 4Y34A 1VRUB 4LJMA 3MOJB 4H4OA 2CZ9A 4DUZF 4NWBA 1VK3A 2CQ1A 2RMLA 4NMLA 4C3LA 2HYIB 2QL5B 4JUZA 3DI6B 2KB2A 3NCRA 3FZ2A 5A0YA 3TJ8A 1T05A 4ED0A 4IOCQ 5C2CA 1S6QB 4B9NA 4LIRA 1UW4A 2RKIB 3K17A 2KI2A 1Y5IB 1CS4B 2CQCA 2DXFA 2KHCA 1FE0A 3D3CJ 2Z2LA 3DGVA 3KDOA 5D4NA 2GNKA 4DX8H 1AZSB 3DU6A 4FKXA 1XK8A 3NLCA 2AIRB 2QL9B 4E2FB 3G71S 3LA0A 5HSPA 1N32F 1TKTA 1HNWF 3CCTA 2AZ3A 4F3OA 3V6KA 1DTTA 3HMJG 2V69A 2PC6A 2F63A 2HNYB 4FDFA 1HNVA 2FDNA 4M1KA 3UN3A 1YRTA 3Q8PB 3PYDA 2VJUA 3H2UB 5LMNJ 2JX2A 3D54A 3D28A 5F3TA 4DV5J 3HKWA 3IBWA 3TRGA 1T9XA 2N3LA 4DV6F 1T03A 3NL0A 1OQ3A 3EZ5A 1VRTB 4DR2F 5GADI 4IFVB 5AE3A 2KN4A 2UVWA 8AT1B 3RRKA 5LXYA 2KT2A 3PYEA 1KC8T 2CQ3A 1FVSA 3TUZC 4X4RA 5KG4A 2W9CA 1M5PC 2KXFA 3PJ9A 1FD8A 5KG6A 2RF2A 3PRDA 2R8IA 4DPTA 5KFVA 1F6TA 1T03B 1LV5A 1UJ6A 5DDRC 3DHWC 3MEEB 2W7PA 3KMQA 3DOLA 2RJZA 3K5PA 4LRBA 4F2RA 4CO1A 2HG4A 3Q8VA 1F5AA 3ADAC 5F9NA 3HSJA 3ZZRA 3AA9A 1FRLA 4WBFA 3SV4A 2E5HA 3BGOP 3DMJA 2ZJPQ 3KLFB 3R5CA 5A8RA 2R7SA 1TELA 1V3SA 5B0FA 1U45A 3P49B 3WX4A 3BS9A 3E3XA 5EX3A 3NNAA 1MNEA 3PXGa 4LIWA 1U25A 1MWZA 1VBKA 2JFKA 4CQ1A 2YVSA 1UZHA 5C7PA 2BXJA 2EKNA 2YX1A 4ECUA 3CCJS 2R8HA 3CULA 5F3ZA 2JHEA 1WHVA 2RKIA 5KFPA 3GIKA 1RAGB 4X4PA 1OY8A 1XNRF 1WC6A 2HK2A 2HGLA 2P8IA 2RT3A 2ZNZA 4X84A 1QVGR 4K4TA 2HK3A 3EXCX 2ZUGA 3EMTA 1X4FA 3TP2A 3W60A 4K50A 3LP0A 4ID5B 4RWWA 2RQKA 3O6QA 4H4OB 2ACYA 2XO6A 3MR3A 2F9JA 4FF4A 1P8GA 1HL6A 1IKXA 2HLUA 2X1BA 4I2QA 4PXCA 2VZ9A 5ETKA 1MN7A 1ZH5A 1DARA 4WCEQ 3PHEA 2K3KA 3N6LA 2E9RX 3NEKA 5KFJA 3H5YA 4QBUA 1VQKS 1MW7A 2XMWA 1M5KC 1LW2A 4NZ0A 3F73A 3BZQA 3BO2A 3SI8A 1WD6A 3G8SA 1HNXF 1N34J 2J8SA 3IS9B 4B3SF 3OL6A 1KTVA 3HULA 4LT6A 1KVIA 2F4VJ 2ZC4A 2C3MA 3UDCA 4DQQA 1YVFA 1VQSA 2CJXB 4KFBA 1SJQA 4FVMA 1HWKA 4URGA 3BO3A 2EVZA 2G0IA 1FESA 3W5ZA 3MMAB 2J7KA 3F56A 4X65F 1NZ8A 2F8EX 2O1PA 1F1BB 2UZAA 4I56A 1NAQA 1JB0C 2LLZA 2OPPA 4ANDA 3PFOA 1BC6A 2HNZB 2A2CA 4PWDB 1BQNA 3I4HX 3T3FA 4M5NA 4DZ6A 2AD9A 2MKJA 2YKMB 2J6SA 3NWRA 3L7PA 4TY8B 4DI6A 1L3UA 4NPOA 3LWMA 1X9WA 3AFGA 3M8QB 3LGHA 2R7XA 1NRKA 1BQMA 1R8AA 3DXBA 2HWTA 3GMGA 3SSQA 2XS2A 5KFLA 1Q95G 2Y1IA 1WC5A 2LMIA 1JX4A 3CCES 3DC2A 2OPRB 5EDWA 4MYTA 4DV4J 4RW6A 4USUA 1BLUA 3CW2C 3P6YC 2P9GA 5KFFA 1ZAXA 2ABYA 1OJ4A 2MLYA 3RUBL 2DHXA 5J2MA 2HAIA 4OZ5A 1JK9B 2AJ1A 3O1LA 5CQGA 4DFJA 4JV0A 2KYZA 4RBTA 3CEDA 1CJUA 1R3NA 1R7IA 4Q45A 4NZ6A 2IMWP 3TZXA 1VIOA 4WFAQ 4DV2J 1B0VA 3DLKA 1HI1A 4LF8J 4DSEA 1S1WB 1HHSA 4OI6A 4Z2XA 1HQEA 3M8ZA 4Y2KA 4NYPA 3TAPA 1JXLA 4IH7A 3W2VB 1U1RA 4PPDA 4F4WA 3T5HA 1VBZA 2UXBJ 4PZVA 1IKYB 2NUUG 2VFVA 3I0RB 4LBPA 1YBTA 2NPFA 5DGAA 2Z56B 5IT9U 3MCMA 5L1JA 4PG4A 2E44A 5F8GA 2XEXA 1MWQA 1RCXB 4X4OA 3IM9A 4JI8J 2R7TA 2CDRB 2FVSA 2DR8A 3H40A 2E1PA 5KFCA 4XIUA 4YR3A 3TAMB 1WC0A 2M0GB 2A18A 3OLBA 3UCUP 3V4MA 1C2PA 3KUGA 1TMJA 3QZ7A 4CRJA 3OFEA 1TVRB 2GMJA 2N7YA 5DQGA 4P2MA 1S1TB 2N3OA 2K06A 4A46A 1HBNB 1QSYA 2BV3A 2FJVA 1HWJA 1UZDA 1WHXA 2O5DA 1HPZB 2A2DA 3BREA 3DGPB 1IKVA 1WF0A 2YXLA 4FYYB 1NM2A 5IOLA 4ZP8A 1KDNA 1NSAA 3MAHA 2OD4A 4EO6A 2XMUA 2CPHA 5D8HB 3MECA 4MK8A 1H2UX 2LQ9A 3PW4A 4AL5A 5HQMA 3N6NA 3RBEA 2MY8A 1S9GB 2RNEA 3K5OA 3A4TA 4J5OA 2CPZA 4ZVQB 3LP2A 4HT5A 1PC4A 1FD2A 2V2ZA 2YNFB 2ZKTA 1S9EA 2XGQA 3VAGA 5LSRA 3HFZB 3PDNA
chains in the Genus database with same CATH topology
5ETMA 3UDEA 5ETLA 3KUGA 5ETSA 3ILJA 1TMJA 1RU2A 4CRJA 3ILLA 3QBCA 5ETNA 3UD5A 3HD2A 3KUEA 4CYUB 3HSJA 2CG8A 5ETTA 5ETKA 1RAOA 1EX8A 2F63A 4M5JA 4M5NA 4M5IA 3HT0A 3UDVA 4CWBA 1RTZA 1KBRA 3ILIA 3IP0A 4M5HA 4CYUA 1EQMA 1RU1A 1F9HA 1RB0A 3HSDA 4F7VA 1IM6A 1HKAA 1HQ2A 4M5LA 4M5GA 4M5KA 1CBKA 5ETQA 4M5MA 4PZVA 5ETPA 1Q0NA 1EQ0A 2QX0A 1DY3A 3HSZA 3MCOA 3MCNA 5ETOA 3KUHA 3MCMA 3ILOA 2BMBA 5ETRA 3HD1A 4AD6A 1TMMA 3HCXA 3HSGA 2F65A 1G4CA 5ETVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETM A;  3UDE A;  5ETL A;  3KUG A;  5ETS A;  3ILJ A;  1TMJ A;  1RU2 A;  4CRJ A;  3ILL A;  3QBC A;  5ETN A;  3UD5 A;  3HD2 A;  3KUE A;  4CYU B;  3HSJ A;  2CG8 A;  5ETT A;  5ETK A;  1RAO A;  1EX8 A;  2F63 A;  4M5J A;  4M5N A;  4M5I A;  3HT0 A;  3UDV A;  4CWB A;  1RTZ A;  1KBR A;  3ILI A;  3IP0 A;  4M5H A;  4CYU A;  1EQM A;  1RU1 A;  1F9H A;  1RB0 A;  3HSD A;  4F7V A;  1IM6 A;  1HKA A;  1HQ2 A;  4M5L A;  4M5G A;  4M5K A;  1CBK A;  5ETQ A;  4M5M A;  4PZV A;  5ETP A;  1Q0N A;  1EQ0 A;  2QX0 A;  1DY3 A;  3HSZ A;  3MCO A;  3MCN A;  5ETO A;  3KUH A;  3MCM A;  3ILO A;  2BMB A;  5ETR A;  3HD1 A;  4AD6 A;  1TMM A;  3HCX A;  3HSG A;  2F65 A;  1G4C A;  5ETV A; 
#chains in the Genus database with same CATH topology
 4F67 A;  4F8R A;  3OTC A;  4E8U A;  3S6E A;  5DDQ C;  3U02 A;  4MT1 A;  1SL2 A;  1RTJ A;  2COL A;  4DV3 J;  2WHO A;  4C6A A;  1DQ8 A;  2ZE2 A;  3MM7 B;  2ZHA A;  2L9N A;  4C98 A;  2AV5 A;  4I7F B;  5T14 A;  1AW0 A;  4HH1 A;  1H98 A;  2V2K A;  5JMN A;  4UQT A;  1HPZ A;  1YKW A;  2CNO B;  1L3S A;  1VQ9 S;  2CQ4 A;  2UUC F;  2XI2 A;  1IM6 A;  2ACM A;  3DLL Q;  2HHX A;  5EWG A;  1N5V A;  2CZ4 A;  2DIS A;  4ES3 A;  5LMN F;  2YWK A;  1TVR A;  4OHW A;  1E6V A;  2BM0 A;  3MGJ A;  1PJ5 A;  5ETO A;  2FLO A;  2D7S A;  3KUH A;  3TVY A;  5C25 A;  2QLJ B;  1X5T A;  1Q16 B;  4EO8 A;  2CJA A;  3TAM A;  3OT9 A;  3FBC A;  3ZTS A;  3GJS B;  4LF7 F;  2NSC A;  5FDL B;  4BHQ A;  4QR1 A;  3IO1 A;  2HS0 A;  1ZM4 A;  4BC7 A;  3Q8Q B;  5IXU A;  4PAA A;  5HBM A;  4LR7 A;  4B3M F;  2J8A A;  3CO9 A;  3HVA A;  1LK7 A;  5D0G A;  1TKX A;  1TL3 A;  2IRU A;  3RAM A;  5GVQ A;  1X4D A;  3UR0 A;  4AT1 B;  2W8L A;  3TEG A;  1U1P A;  3JS9 A;  3W2V A;  4CLU A;  4BDP A;  1OY9 A;  1KEK A;  4JYA F;  4EI2 A;  2V2Q A;  3FSX A;  3OR1 A;  3QT5 A;  4CNY A;  2XM3 A;  4NLX A;  2HQC A;  4AFF A;  5M2P A;  2Q3P A;  2QL7 B;  4NRT A;  3KG1 A;  1RAH B;  2K3I A;  4UZC A;  1TK0 A;  1CLF A;  2YNI A;  4X62 F;  2HHV A;  3W3S A;  3JSB A;  4KQZ A;  2H3E B;  3TAR A;  2NCK L;  2LEP A;  3RBZ A;  1RYR A;  4QWC A;  2V4Q A;  2GGP A;  4CIO A;  5BYQ A;  1D8Z A;  4N8N A;  4AE5 A;  3H7H B;  2GVZ A;  4CO0 A;  4LF2 A;  4LMZ A;  2C42 A;  2FYX A;  4WKY A;  2C2M B;  2XC9 A;  3JYT B;  3ET6 A;  5DO2 A;  1REV B;  4AL7 A;  4OZ0 A;  3EUN A;  5LM7 E;  4RU9 A;  3PR5 B;  1WDT A;  2AZ1 A;  3E01 A;  4F02 A;  2CFX A;  3H2L A;  4LVN P;  1RU2 A;  3RR8 A;  4F4K A;  4Q8F A;  3SXL A;  3IR7 B;  3LF0 A;  1OMS A;  1ELO A;  4NLP A;  2EG2 A;  3G82 A;  5EX0 A;  4U7U K;  2EFV A;  3WBZ A;  2AYM A;  3B54 A;  4ECS A;  1X9S A;  4DFP A;  5KG7 A;  1KWM A;  1RT6 A;  4DQP A;  2FJD B;  2ZZT A;  1VDH A;  1NME B;  4B3T F;  4LF9 J;  1YK9 A;  3MM8 A;  1Y4Z B;  2DIT A;  2ZD1 A;  4NLS A;  1QE1 B;  2EG1 A;  2KFZ A;  1QUV A;  3CT9 A;  4ELU A;  4M5D B;  5IM0 A;  1N34 F;  3FUY A;  3KG0 A;  3M2R A;  5KT6 A;  1HHT P;  2F9D A;  4FN5 A;  4C8Y A;  4DR5 J;  5FD1 A;  4QWB A;  1RHJ B;  4OJH A;  2XB2 D;  2H5I B;  2QSF A;  4KFB B;  3T6J A;  1X60 A;  4LFA J;  3LP1 A;  5EWE A;  3Q23 A;  1NKB A;  1QTM A;  4JI0 J;  4GC7 A;  1KS2 A;  3WHI A;  1FNX H;  4GVB B;  1RTI B;  2CJ9 A;  2DNR A;  3PJX A;  1JXV A;  4HDG A;  2N82 B;  2MKK A;  2B5J A;  4NZ7 A;  1LW2 B;  2ZUA A;  3HT0 A;  2KHD A;  3SSS A;  1WWH A;  2FZC B;  4ZDN A;  4I2P A;  1YLX A;  3BKT A;  2ZVI A;  2WVE A;  2DIU A;  2CJY B;  3I5C A;  4KHP F;  4UZB A;  3KNA A;  3ITH B;  3M8W A;  1IKX B;  2ZH4 A;  1Q0N A;  4FZV A;  4P9S A;  2FHM A;  4ZCK A;  1HAR A;  1YDL A;  3CF5 Q;  3RB0 A;  4X64 J;  1HW9 A;  2Q43 A;  1JLB A;  2LEA A;  2WCX A;  4ETZ A;  5T7L B;  5J2N B;  4ZCI A;  2DGX A;  4RNN A;  1T94 A;  1VQ5 S;  1ZA2 B;  4HHU A;  3T6B A;  4I69 A;  6FD1 A;  3ZTR A;  2XS5 A;  5HRO A;  2OEL A;  1HNZ J;  4GVB A;  1NPK A;  1R8H A;  1TQL A;  2XO7 A;  1UWA A;  1HD0 A;  2HFU A;  5KFD A;  3OFF A;  2DNQ A;  4OV6 A;  2HSE B;  3SCJ E;  3CXC R;  2FLP A;  4OLO A;  4P72 A;  1MML A;  5DQH A;  4A8F A;  3W61 A;  2VFR A;  2LKZ A;  2IRY A;  3AAW B;  2AMC B;  1HBO B;  1T0T V;  3A3O B;  4P75 A;  2FY8 A;  3IC1 A;  4ZPD A;  2ZOM A;  4AQY F;  1T7P A;  3OTO J;  2GAH C;  2FY1 A;  5D0H A;  4F7V A;  3OJS A;  1RTD A;  4DR7 J;  1C1B B;  1AYE A;  3DMJ B;  1M5H A;  4P73 A;  3LQV A;  2WVD A;  5KT3 A;  4TVA B;  2FD2 A;  2RQC A;  3MM5 A;  4ECW A;  1QLN A;  2GHP A;  3FMB A;  4NL5 A;  3KJV B;  1U47 A;  1HI0 P;  2DIV A;  4QWD A;  1Q4R A;  1LWX A;  3DXS X;  2FZK B;  4QIF A;  2XY5 A;  2DH8 A;  2E5L F;  3OJU A;  3IRW P;  3IG1 A;  4ED8 A;  4PG5 A;  1K8A T;  2OH2 A;  2P5V A;  4ED1 A;  3Q8S B;  5HP1 A;  3ZZU A;  4DPY A;  3AY0 A;  1T8E A;  2UP1 A;  2QA4 G;  1X8D A;  1FER A;  3IR6 B;  3MM9 A;  3AJD A;  4Y2C A;  5KOX A;  3G8Q A;  4NCA A;  1LWF A;  4O44 B;  2WAQ D;  3ZNJ 1;  1XMQ F;  2OI2 A;  4LF4 F;  1HWU A;  5CAA A;  2DCL A;  4NCG B;  1RHM B;  4F4A A;  5GAD U;  2MYF A;  4R0J A;  2RUS A;  5CYM A;  2KG0 A;  4K4V A;  4RU2 A;  3FDS A;  3D1H A;  1NDC A;  3MMC A;  1S99 A;  2V8P A;  1S1X A;  5DDP C;  1JNR B;  1EQ0 A;  4DEZ A;  5HN0 A;  3GII A;  2PMW A;  4OI1 A;  5F41 A;  2JOQ A;  2OEJ A;  2W4C A;  4BCA A;  4CLL A;  3MR5 A;  4HEA 9;  5A2Q U;  1AXQ A;  2BRL A;  2GHV C;  2X1A A;  1I6J A;  2OAU A;  2IFX A;  4K0K F;  1JMT A;  2LQJ A;  4PR6 A;  4DS5 A;  1VQP S;  4OZN A;  2CPE A;  2MQP A;  1VQO S;  2G0J A;  2VU5 A;  4DX7 A;  3X1L B;  1IKW B;  2V2V A;  2CPI A;  2W4D A;  3BDE A;  4HVZ A;  1FNM A;  1NJI T;  2IY5 B;  1T02 A;  2XHC A;  5H9E J;  2HBY B;  3NOG A;  1U1L A;  4OZ1 A;  3QT7 A;  4ZMM A;  4DCP B;  4OI0 A;  4U8V A;  3ISN D;  1HNW J;  3RAQ A;  5AJ3 F;  3BR8 A;  2G4B A;  1RJJ A;  4DL6 A;  3H59 A;  4C4W A;  2EK6 A;  3HF5 A;  4OIX A;  4NE9 C;  2J0X A;  4WZM A;  2PGC A;  3SDE B;  2AX0 A;  2PA8 D;  1KN6 A;  2YWH A;  3VF0 B;  1QD1 A;  3WIU A;  2ZH6 A;  3C19 A;  3KXD A;  2MKC A;  4J37 A;  5JXS A;  2DK2 A;  3QSY B;  1PSD A;  1KHV A;  4P71 A;  1N5Y A;  5T41 A;  2QGF B;  5SZT A;  4X2B A;  1V5I B;  4ED7 A;  1DFD A;  2QT7 A;  1TR0 A;  1OY6 A;  2GV1 A;  1GFW B;  3SQG B;  5LMU J;  3V6J A;  4DUT A;  2R8G A;  1RT2 A;  2DHA A;  2DNK A;  3K5L A;  3RTV A;  1X9M A;  3QRR A;  1FJG F;  4HL9 A;  2WOM B;  3BYP A;  1S59 A;  3GFY A;  1I94 F;  2EFQ A;  5HVF A;  2WOM A;  3FKB A;  4NLG A;  3PYG A;  1LWE B;  3EVM A;  2EC0 A;  3CD6 S;  1FJ7 A;  2O66 A;  1RT2 B;  1ZOT A;  3GTY X;  4LSZ B;  4C8Z A;  2HHW A;  2NR0 A;  5I3P A;  1RSC A;  3QGH A;  2XG8 A;  3BBF A;  1MLA A;  2GA7 A;  3D9B A;  4KAI A;  4OYM A;  4YN3 B;  5EHH A;  2GO8 A;  4MKY A;  1H7W A;  3GYX B;  4O4G B;  3E8O A;  3T19 A;  1IKV B;  2KVQ E;  2WVB A;  1ULR A;  2LVW A;  1YI2 S;  2GHW A;  4CO4 A;  1SJ4 P;  1UW9 A;  2NXJ A;  3IAS 9;  3U1L A;  2JEJ A;  4MKV A;  3KMS A;  2XYG B;  2D41 A;  1A0O B;  2ZBQ A;  4PXD A;  3CCM S;  3AB2 B;  1YIT S;  2D3O R;  4LSL B;  3US5 A;  4UST A;  2ROP A;  3ZNU A;  3LGN A;  5IV4 A;  4DF4 A;  3PTW A;  3I9V 9;  3CIZ A;  1J5O B;  5E41 A;  1M5O C;  2CJQ A;  4RW9 B;  3BV8 A;  3TR5 A;  2R7U A;  1M1H A;  1EP4 A;  1NXI A;  2I1R A;  4RNH A;  5AXM A;  3R5D A;  2QC3 A;  5KFI A;  4I68 A;  2PDA A;  2YTC A;  2DXD A;  2HS4 A;  3DOM A;  1PBA A;  1PG5 B;  3EZO A;  1FRM A;  4O3O A;  1NK0 A;  3MHY A;  2PSZ A;  2G1H A;  4DV1 F;  4ECY A;  4PG6 A;  3KFW X;  4WE1 A;  3CB4 A;  2WON A;  3WQP A;  4TY9 A;  2DGS A;  4KV8 B;  1U1O A;  1SH2 A;  3MMC B;  3DLK B;  5KOW A;  1MMN A;  4EZ9 A;  4E98 A;  2Q79 A;  3H5S A;  5FLX U;  2GS8 A;  1FDD A;  3Q83 A;  4USH A;  3W8P A;  2V9K A;  4U6P A;  2PT0 A;  1T11 A;  2QYG A;  1V9O A;  4MYU A;  3Q8Y A;  3GFH A;  1F3F A;  4O44 A;  4OV1 A;  4WP3 A;  3FC9 A;  1FKO A;  1CQM A;  2B6A A;  1QSL A;  4I64 A;  4TNO A;  4PG8 A;  2WBR A;  1YJU A;  4E0D A;  1SV5 A;  2HVE A;  2DRD A;  4RW6 B;  4LFA F;  3KK3 B;  4LFC J;  2XS7 A;  2HQ3 A;  4GKK F;  1TUW A;  2Y0B B;  1X31 C;  3NY0 A;  9RUB A;  1EHW A;  3TI0 A;  1M5S A;  1XR5 A;  5D3G B;  4CDI A;  1K0V A;  1K44 A;  4R5P A;  4DSL A;  1BWV A;  2DY1 A;  1T9W A;  2YQ1 A;  3B4D A;  1CC7 A;  4ED4 A;  2WW4 A;  2LU1 A;  4WYW A;  1UL3 A;  5CYQ A;  1RBA A;  3MFH A;  1NHV A;  3DDK A;  3GE9 A;  3JSM A;  2VG7 B;  1PAU B;  3KJV A;  4QIE A;  2A0F B;  3MM5 B;  4KHP J;  3FGV A;  2A3J A;  3PEJ A;  1IR2 A;  3MDF A;  2HBR B;  5MLC V;  1FTC A;  3FQK A;  1IBK J;  1VFJ A;  2DR5 A;  1LKZ A;  2G2O A;  3AXK A;  4N47 A;  2OIH A;  1HYS A;  1CSJ A;  5L1I A;  4CLY A;  3PAC A;  2VBY A;  2EFG A;  3MMA A;  2D9O A;  2MJN A;  3TZZ A;  3UR3 C;  2L9D A;  2YX4 A;  4ZJL A;  1Y9O A;  2UXC J;  3DRP B;  1PC5 A;  3MR2 A;  2DNO A;  3L7U A;  3MD1 A;  1JLC A;  2HPU A;  4IFY A;  5HRO B;  4RUB A;  4K4U A;  5ITH A;  3FFI A;  3CJK B;  5L8R C;  3OBI A;  2NS1 B;  4LF8 F;  2ILZ A;  1JLB B;  1Q78 A;  3W62 A;  4BWM A;  1Q79 A;  4CH7 A;  4IR9 A;  1GX5 A;  1NH7 A;  5M2U A;  5D15 A;  4X4U A;  2VBW A;  3VVU A;  4ZIW A;  5F8I A;  4JI7 F;  1WAC A;  2V6A A;  4KGZ B;  1Z2Z A;  4KH0 B;  2HZC A;  2BJE A;  4IG3 B;  2VG6 A;  4LUB A;  2GAG C;  5I42 A;  1VCT A;  4W90 B;  3K7R A;  4DDF A;  2LA6 A;  3UW1 A;  3MUR P;  3VGS A;  1ZYQ A;  3P5T L;  2AJ4 A;  1GMW A;  1P1L A;  1CC8 A;  1R8P A;  1URR A;  2EWH A;  4DX6 A;  1HR0 J;  3NMA A;  5CH7 B;  2CKW A;  4P6Q A;  4CLT A;  2ZZN A;  1SB6 A;  3G9C A;  2H48 B;  2CWX A;  2W2M P;  3DRS A;  3TW0 A;  5DLG A;  1HHQ A;  2MKI A;  3CCW A;  5IM0 B;  1XMQ J;  3D3B J;  5CZV A;  3EDQ B;  3TA2 A;  2XMK A;  2NQP A;  1NDL A;  3OVB A;  1W25 A;  2DBB A;  3ONQ A;  3HKZ D;  9ATC B;  4FF2 A;  1YIJ S;  3IGV A;  1ZM2 A;  4Q0B B;  3R1L A;  5L9N A;  2FZG B;  3IBC B;  1D8Y A;  4QIW D;  1GTH A;  3QBC A;  2LQ8 A;  4URS A;  3ZZZ A;  2IM3 A;  2HFZ A;  3I9Z A;  3ULH A;  4CNZ A;  3UN5 A;  5HVG A;  1HW8 A;  3NAI A;  3WZ0 A;  4AUK A;  5B08 A;  2V9W A;  1NB2 A;  1RZM A;  1RLC L;  4UOH A;  2KZM A;  2XTJ P;  2AJ2 A;  3MZI A;  1UJ4 A;  4U67 Q;  5D3G A;  2W9C B;  1FDN A;  1S6P B;  3HT3 A;  1LEO A;  3VQT A;  1NDP A;  2CIM A;  1KKH A;  4DR4 F;  4RBV A;  6AT1 B;  1SKR A;  1YRU A;  4KRW A;  1O6X A;  1FKO B;  1X4H A;  3CJQ A;  4M5M A;  3W66 A;  2VJV A;  2JDJ A;  3BGR B;  4EBC A;  1JLF B;  1NBE B;  3S1T A;  1WKJ A;  4XDD A;  5HVH A;  3HSZ A;  2UUC J;  2PE8 A;  3G8T A;  3N6M A;  5L1K A;  2YNI B;  2R7O A;  3AD8 C;  2E29 A;  2DO4 A;  4RW8 A;  1U6F A;  1DTT B;  1NZA A;  2CPD A;  2W24 A;  1U6Z A;  3KG4 A;  4L76 A;  3BF4 A;  3R7B B;  3TYT A;  3U27 A;  5HMZ A;  2YY3 A;  3CIM A;  2G13 A;  5AT1 B;  2BW7 A;  1TL1 B;  3HHD A;  2DB1 A;  2W7O A;  1NJZ A;  3HHN B;  2Z0G A;  2FC9 A;  2NUH A;  4B3M J;  3H2V E;  4NCB A;  2CVE A;  2DTJ A;  3ILL A;  1OPZ A;  1F60 B;  1XN9 A;  1Q8B A;  1A7G E;  2ASD A;  1KVJ A;  3J7Z 5;  4O23 A;  1BY9 A;  2N4C A;  1NK7 A;  1C0U A;  3U7J A;  1GMW D;  1U7L A;  3ZZ0 A;  5KG2 A;  1HNI B;  2Y9H A;  5FDL A;  4ZVR B;  4DR1 J;  2XNR A;  3KWM A;  3CCS S;  4FF1 A;  1YBU A;  2DHH A;  3FZB A;  4M5L A;  1QUP A;  3HVW A;  3L4B C;  1RTH A;  1TTH B;  4FPR A;  2EPI A;  3M2U B;  3QQC D;  3RRH A;  2XBP A;  4LRE A;  5SUH A;  4QIG A;  3MEG A;  2QLF B;  3CC7 S;  4UY8 5;  1NJY A;  3EM1 A;  1RHR B;  3RAX A;  2YKP A;  1T9T A;  2BMB A;  5B0G A;  4WFN Q;  2G2Y A;  4RW7 B;  1T9U A;  3D67 A;  4MFB A;  2ZOG A;  3AD7 C;  4DN9 A;  4O4G A;  4TXS A;  2AGO A;  4FF3 A;  3PRV A;  3KLE B;  3RB6 A;  1W7W A;  2RS8 A;  1RT5 B;  1HMV A;  1S1V B;  3BYR A;  2B56 A;  4JI3 J;  3GWC A;  4I1T A;  3G96 A;  4USW A;  3HZE A;  4R0E A;  2YNF A;  1RCO B;  2FIU A;  5KT4 A;  2B7C B;  3D0I E;  5HO4 A;  1RP5 A;  2LFV A;  3KLG A;  1FXD A;  4B3O B;  2HMI B;  4IRD A;  3LAM A;  4DPW A;  1DAX A;  5ETP A;  5L1L A;  3CJS A;  2QX0 A;  5IQ6 A;  2AGP A;  4CCH A;  3EGZ A;  4NLT A;  1CQN A;  3HLU A;  2HFS A;  3MEC B;  2L08 A;  1U24 A;  2W7A A;  4FYV B;  1J27 A;  4MJK A;  3HFV A;  4ZVU B;  1JLA A;  5EUH A;  3KJF B;  1F2G A;  2FJB B;  2VD3 A;  2QEX S;  4ZK7 M;  2RIL A;  3DGP A;  3FBE A;  1RWO B;  2NXN A;  3MR7 A;  4DFK A;  1QAI A;  5KG0 A;  3C15 B;  5K14 A;  5DLF A;  1KD1 T;  1JJ2 R;  3MTK A;  4PCQ A;  2BUN A;  3P96 A;  3R8Y A;  4DXL A;  2CNL B;  2PEB A;  1WOS A;  3Q2T C;  2B7B B;  3HI9 A;  3ZZP A;  3AT1 B;  3I0S A;  5KG3 A;  1VLO A;  1RT3 B;  4TQR A;  2UXD F;  5I4M A;  5KFM A;  5KFU A;  1C0T A;  4ZCL A;  1L5U A;  4LRA A;  4XO0 A;  4GKK J;  4M5G A;  3RR7 A;  1S1U B;  2UUT A;  3RB3 A;  3UN2 A;  2ROG A;  3DM2 A;  5BR8 F;  1FK9 A;  1IKY A;  1PBU A;  2M52 A;  1Y5N B;  3BKU A;  3BPD A;  4P74 A;  7AT1 B;  7FDR A;  2KH9 A;  3KYL A;  2MB0 B;  2RH3 A;  1PCA A;  3MM6 A;  3ILO A;  2M8D B;  1RT7 B;  1RT4 A;  1HWI A;  3QGP A;  2YPZ A;  1OS5 A;  4HAC A;  1I51 B;  3QIP B;  3NCP A;  1RT4 B;  1FDB A;  1S1W A;  3RGI A;  3RYL A;  3TVK A;  4RPF A;  2JLF A;  1S6O A;  2Q6B A;  4A47 A;  4LQ9 A;  5CYM B;  3WIV A;  1HNZ F;  4ZPA A;  3VAK A;  3HZG A;  2CA9 A;  5LOQ A;  5GME A;  2RQ4 A;  3OPK A;  3KHG A;  4DV7 J;  1CJT A;  3BH7 B;  3BSC A;  2OJ3 A;  2PEH A;  2XZW A;  4EEY A;  2FGC A;  3THT A;  4OYW A;  2XLJ A;  2HMI A;  1RT3 A;  2IAJ B;  2D74 B;  2C2Z B;  1YBA A;  2MPU A;  3JAM Y;  4K4S A;  1N36 J;  3J7A N;  2IJR A;  2LXF A;  4OJG A;  1UEU A;  2KO1 A;  4OJ3 A;  4DR7 F;  3MCN A;  4PKD B;  5F9L A;  3IG1 B;  3CDU A;  2LA4 A;  2M88 A;  4A8Y A;  1CPZ A;  2R2S A;  5GAH I;  2ZDO A;  2MZR A;  4RX6 A;  4XTT A;  4J9L A;  1G4C A;  2E5L J;  3OTD A;  4LRD A;  4O3Q A;  1RHK B;  2K2P A;  2ZH7 A;  1BQN B;  5DM6 Q;  1RTD B;  2QV6 A;  2DNL A;  3BSA A;  4WFZ A;  1Q5Y A;  1QM9 A;  2C2N A;  4PUO A;  2E7V A;  1QVF R;  3V81 A;  2ZWO A;  4NOH A;  4PEO A;  1SJR A;  4O0N A;  1HBO A;  2IVY A;  4OZ3 A;  1VS3 A;  2K1R B;  1SKU B;  5C24 A;  2Z4P A;  3P8B B;  3FEZ A;  3R1H A;  2W2N P;  1LXN A;  2V50 A;  3FSI A;  1X4E A;  1NB7 A;  3OD2 A;  1S6U A;  2I8E A;  2OHD A;  3V5R A;  2LEC A;  2DNZ A;  1JXE A;  2NSB A;  4UW2 A;  2RE1 A;  1FXL A;  4DL7 A;  2DY9 A;  5A8K B;  3PZP A;  1ARO P;  1HMV B;  2XMT A;  1SKW A;  1TU0 B;  4JI1 F;  4N77 A;  1SQE A;  3NKY A;  2BQR A;  3ENA A;  5J2N A;  5T7L A;  1Q8L A;  3CD7 A;  3CUN A;  3UD3 P;  2MQ8 A;  2DR7 A;  2IDL A;  4ETX A;  4WTO B;  2G9O A;  1A9N B;  5KFK A;  1HBM B;  1FCA A;  1IR1 A;  2VBZ A;  3BN7 A;  3ITH A;  1QAJ A;  2CQH A;  2VDI A;  2PD1 A;  3VR1 A;  1U2C A;  3EXY A;  2EK1 A;  3FNN A;  4CT9 A;  1TUG B;  1R27 B;  2M4M A;  2VB6 A;  3DLE A;  4DCO B;  4K0K J;  2V34 A;  3HHE A;  3U1M A;  1N48 A;  2VFU A;  4DUY F;  1BGX T;  3NMR A;  1WKK A;  1RTZ A;  1CJV B;  1VHF A;  4RLE A;  2JLE A;  1C0U B;  4WJB A;  3HSD A;  3UO0 A;  4ALZ A;  2VQE J;  3WC2 A;  3ISN C;  3D66 A;  1HQ2 A;  2HGN A;  2HRT A;  3C16 B;  3QWP A;  4UUW A;  2R2T A;  1PJ6 A;  3VVT A;  2WW8 A;  1P6T A;  5JVG Q;  3WC0 A;  4DBQ A;  2VH7 A;  3M2R B;  3MPD A;  3NGT A;  1N32 J;  1RWV B;  3R5J B;  4RWX A;  4EK2 A;  2HQD A;  4DL4 A;  5KFS A;  1TL1 A;  1VRQ C;  2XSJ B;  1JLQ A;  1SH3 A;  4C3K A;  4I4B A;  5A8R B;  5BXI A;  4Q44 A;  3QJL A;  3I31 A;  3MM8 B;  1P9Q C;  3QSI A;  4NYO A;  2V8V A;  4ILR A;  3HXM A;  5G0R A;  2DRA A;  4S0M A;  2JVR A;  3RBD A;  1FDA A;  1HI8 A;  3TAQ A;  4A8O A;  1JLF A;  2OPQ A;  1IVZ A;  2MKS A;  4M63 A;  4QYR A;  1U4B A;  4DPU A;  2E9Z A;  3PVX A;  1VQ8 S;  1RHQ B;  3MAQ A;  4ITS A;  1K1Q A;  3R7N B;  4M5H A;  2AHO B;  1F3V A;  2IVF B;  4F3M A;  2QMX A;  3AQO A;  1UEV A;  2PI5 A;  1WDD A;  2V4R A;  1H0H B;  4YQW A;  1CUL A;  4L74 A;  3PNI A;  3JYT A;  1XMO F;  3BBC A;  2IYI A;  1EKR A;  2BRK A;  3FK4 A;  1FO1 A;  2JSX A;  4KB7 A;  2ADB A;  4YY3 F;  3NAH A;  2GVZ B;  1OSC A;  4RUA A;  3I5A A;  4W98 A;  2ZM6 J;  3GZ7 A;  2GMH A;  1VQN S;  2GGP B;  2V8D A;  2X3D A;  3W9I A;  1FF2 A;  1GX6 A;  5D6G A;  1SL0 A;  2EI5 A;  5E5N A;  4CLK A;  3OVS A;  1D09 B;  2WSF C;  3CMQ A;  1YG0 A;  4GO5 X;  3IR5 B;  4A8S A;  3KDN A;  1IWG A;  3BN4 A;  2VON A;  5ETS A;  1N33 F;  4C3M A;  2BAB A;  2ZVS A;  2BQ3 A;  3MUM P;  1Y11 A;  4NA1 A;  1RAO A;  1Y0H A;  1G2E A;  5C42 A;  2M3D A;  2Y3Y A;  2BOP A;  3DRS B;  3V6D A;  4JI3 F;  4WP8 A;  1UVJ A;  2XLK A;  1F2H A;  2CQB A;  2DKO B;  1ITP A;  4ZJQ A;  1RAI B;  1UFL A;  5A0Y B;  4YHH J;  1NK5 A;  3CCZ A;  3FEY B;  3QGI A;  5D78 A;  4GO7 X;  4YME A;  2HRU A;  2W9A A;  2R3V A;  4DV1 J;  1S4E A;  3QJJ A;  5C25 B;  5J2Q B;  3PKY A;  3L7O A;  1UVK A;  2XNQ A;  1RIS A;  2VUG A;  3NS5 A;  3C66 A;  4ZIV A;  3T5J A;  4YS2 A;  5J2P A;  1W26 A;  1FWP A;  3A3P B;  4NLR A;  1FFS B;  1SVD A;  2WVF A;  3NGD A;  4F2S A;  1K1S A;  3Q8U A;  4ZIT A;  2LQB A;  4IQM A;  2JVO A;  4FXW A;  4NLV A;  4F3Q A;  1B7F A;  3N5B A;  5KFY A;  4RNO A;  4UOF A;  3FFI B;  3TQE A;  4NEZ A;  1FJE B;  4ELT A;  2ZEJ A;  3DOK B;  2RRA A;  1XQI A;  1JLC B;  4ZOS A;  1VIS A;  4LBI A;  4PAB A;  4JI5 J;  3L95 X;  4JOU A;  3TWZ A;  3RB4 A;  2VPY B;  4ID8 A;  3O2I A;  3IWL A;  4F4Y A;  4MTP A;  1T95 A;  3GCW P;  2RU9 A;  3H25 A;  4CLZ A;  4HTI A;  4OX9 J;  2MGZ B;  2ZZM A;  1Q86 T;  4DL3 A;  4C97 A;  5BR8 J;  4PUO B;  3AD9 C;  1E6Y A;  3GLJ A;  2F40 A;  2X1G A;  4QCL A;  1U2R A;  4FBU A;  3E51 A;  3N5F A;  4DX5 A;  1VGY A;  2MXY A;  4WFB Q;  2HWH A;  1KRP A;  4F4X A;  1WG1 A;  2OGU A;  2QA1 A;  1N0U A;  2C2O B;  3W2W B;  2QMW A;  1BQX A;  3AA8 A;  2CPY A;  2KT3 A;  4X66 J;  4U95 A;  1ZTT A;  2DJW A;  4G1Q A;  1YWX A;  3NNC A;  1HBN A;  2MHN A;  1S1T A;  3FSY A;  1WJ9 A;  1BUX A;  5F8L A;  1Y7P A;  4GMK A;  1NO8 A;  2BA9 A;  2RRN A;  4DV0 F;  3UD4 P;  2L3M A;  1WG5 A;  2RS2 A;  4J9N A;  2IRX A;  3H4B A;  4Q43 A;  4DLE A;  2KTQ A;  4NAS A;  4HI1 A;  2QA2 A;  2PI4 A;  2LXU A;  2VF3 A;  2MKH A;  2UV8 A;  5BYR A;  1H73 A;  1KLM A;  3P45 B;  2P2C B;  4ILM A;  4O3N A;  4IG0 B;  1U26 A;  2D69 A;  2CRL A;  5D4L A;  5GAG I;  1RHU B;  2FC8 A;  3HJV A;  1C4C A;  3I0R A;  3MD3 A;  3CCU S;  2NYH A;  2H4W B;  3CDE A;  4I6Y A;  1V5V A;  3CMA S;  2V4J A;  3CC2 S;  2NRE A;  4K4Z A;  4DU7 A;  1RLD A;  3K2Y A;  3MAA A;  1K47 A;  2JJ4 D;  2VKZ G;  4KV8 A;  2VFS A;  3GFZ A;  3IWX A;  2WON B;  4MMO A;  5KFO A;  3MAA B;  1RT7 A;  2MMY A;  3ZTQ A;  2HFV A;  1GXT A;  2GQC A;  3A8E A;  3O44 A;  2I0X A;  4FVC A;  2R8K A;  3LO3 A;  2ZH3 A;  1U2F A;  2LP4 A;  3EIC A;  5E3A A;  3TNV A;  4LF5 F;  2B4O A;  1WHW A;  3DOM B;  3SEO A;  4DCJ B;  4YR2 A;  4H4M B;  5IT4 A;  1ZZN A;  4W92 B;  2WB4 A;  1FWL A;  5J2M B;  4QW9 A;  2YKN A;  2FGO A;  3BQ2 A;  4A8M P;  3VCD A;  1D1U A;  1ZPW X;  4N76 A;  4RW9 A;  2CQG A;  5DGB A;  2B9Y A;  4F0M A;  1J5E J;  1EAY C;  3BM7 A;  4IH6 A;  3QT8 A;  4KHM A;  1AUS L;  4ZA1 A;  2Z30 B;  4V1A k;  2WTF A;  3VAM A;  1FEE A;  2AYG A;  4DZD A;  1AFI A;  2MTL A;  1S7I A;  5KFA A;  3PW0 A;  3QAE A;  4YDD B;  2IC3 A;  4FYX B;  1SCJ B;  4C8M A;  4A8W A;  4DUZ J;  1S0O A;  2EBE A;  3H5U A;  3RZA A;  4KTQ A;  3V2U C;  3O8W A;  1RAB B;  2CZV C;  2XHW A;  3B8H A;  4USV A;  4YUD A;  2GJI A;  5B0D A;  5J1E B;  4X4V A;  3D0H E;  4F26 A;  3VAF A;  4J9K A;  1TAU A;  4DL0 C;  4Z7C A;  3M32 B;  3UNY A;  2DH9 A;  5LT5 A;  3C46 A;  2B4U A;  2KXH A;  2NZC A;  3OSP A;  4EMD A;  1EJ7 L;  2V67 A;  4KPY A;  4B02 A;  4FBT A;  2VFT A;  4G1I A;  2SXL A;  1IQT A;  3GYG A;  5B7W A;  2B8Q A;  1SH0 A;  1EB0 A;  2DT9 A;  3D7S B;  1N6Q B;  1X4C A;  3DOK A;  4KIA A;  3VGU A;  4C2M A;  3A8I A;  3SQG A;  4IYQ A;  2FUG 9;  5D0E A;  1N56 A;  1F0X A;  4IRC A;  1XIQ A;  2C3P A;  2RDI A;  1Q5V A;  4WU2 A;  5BYS A;  2R2R A;  2A6O A;  1M90 T;  4MIW A;  3HK2 A;  5KFN A;  2ZIT A;  4UY8 T;  3T5L A;  1T3N A;  3B6B A;  4I2Q B;  4RUH A;  3MEG B;  5J2P B;  3IP0 A;  3EZU A;  5KG1 A;  4KY3 A;  1KOO A;  3CO0 P;  3LP0 B;  4TYA A;  4Y0F A;  3SV3 A;  4LF7 J;  1VOM A;  5J2Q A;  3C6T B;  2AJF E;  3CJ8 A;  3SSR A;  3W7B A;  2ROE A;  2BE7 D;  3PIP Q;  4DR1 F;  1K73 T;  4HKQ A;  1UVL A;  1JLE A;  1UVI A;  4U96 A;  3J7Z T;  3UVJ B;  2G1D A;  1O8B A;  4R25 A;  1DLO A;  4ED2 A;  2QJ3 A;  2NLW A;  2WVC A;  3W63 A;  2D3U A;  2J9D E;  3POT A;  4WFY A;  4YY3 J;  4BS2 A;  3W5Y A;  4F0H A;  1HQU B;  3DLG A;  4JYA J;  3N01 A;  3HVR A;  1FT8 A;  3H90 A;  1TK8 A;  3M05 A;  2MQL A;  2QFI A;  5ETN A;  2CJK A;  2XSF A;  4X4S A;  2VQF J;  2CPJ A;  4ECT A;  2HIY A;  4G1P A;  2XLI A;  4RW8 B;  2EFP A;  1S0V A;  1RBL A;  2B4P A;  2IMO A;  4NCG A;  4RR5 A;  3BGR A;  3A12 A;  2OD6 A;  5J1P A;  1FJC A;  2BJD A;  3DDN A;  4WK1 A;  1YZ6 A;  3MEE A;  3F44 A;  1FWK A;  1RDR A;  3OR2 B;  3ENW A;  2RB7 A;  4ECZ A;  4ZPC A;  4D3H A;  3OSN A;  1VBX A;  4B9U A;  3EGN A;  2RQM A;  5KFR A;  1BWE A;  1S79 A;  4F0K A;  2ALY B;  1S6P A;  4KYZ A;  5D4P A;  3MUT P;  2ATL A;  3I4P A;  4IFV A;  4ES1 A;  2BOA A;  2OKQ A;  1VC5 A;  2E1M C;  2H5E A;  3C8Y A;  2OUG A;  2HND A;  5ETV A;  5KTQ A;  4CH0 S;  3TZW A;  1ROF A;  2CQI A;  2WBM A;  4PWW A;  2X51 A;  2QZ8 A;  1RQ0 A;  5IQQ A;  5LSL A;  1LFP A;  2HVD A;  2CUY A;  4PQU A;  2BEF A;  5HAT A;  2XYH B;  1VR6 A;  1FA0 A;  3GSI A;  3DLB A;  2KXN B;  1HNV B;  1DQA A;  1HNX J;  3ZO7 A;  3H0P A;  1I5O B;  4CLP A;  1HD1 A;  1WC3 A;  2AYB A;  4D3G A;  3AJ2 A;  1XR6 A;  2GX8 A;  2QTW A;  2F4V F;  1DJ0 A;  2BJ7 A;  4IQX A;  2LXI A;  2QO3 A;  1JLG A;  5E3C A;  3M30 B;  1MRO B;  1IBM F;  4NA3 A;  2W01 A;  5U47 A;  2MQQ A;  1OYE A;  1Q8I A;  1X0F A;  2BAN B;  2DGO A;  1RYS A;  3S8S A;  4EBE A;  2FLN A;  1Z1Z A;  3IAM 9;  1P9Y A;  3Q2S C;  4M8L A;  3UVJ A;  4MIB A;  1T05 B;  2RDJ A;  5KT5 A;  2QIF A;  4Q2M A;  5IV3 A;  2KRB A;  2RHS B;  4DR2 J;  1D9D A;  4A48 A;  2C1E B;  4RBU A;  4QU6 A;  1SI9 A;  1TL5 A;  1F5C A;  1U09 A;  2BKN A;  4Y2I A;  4C7Q A;  1S10 A;  2RU3 A;  2MDA A;  1M1K T;  5JJB A;  3GQC A;  4YDX A;  5F0W A;  4FPI A;  2UVR A;  2X3G A;  3FCV A;  3I96 A;  2PO4 A;  4I0W A;  5FII A;  4X64 F;  3JAM U;  1NK6 A;  2UU9 J;  3IFE A;  2BX6 A;  1P27 B;  1UPM B;  2I5J A;  4W4M A;  5G4D A;  4CH1 A;  4F50 A;  2B5J B;  2HIQ A;  4KKO A;  3O3L A;  3CJK A;  1B70 B;  1UKU A;  1RTI A;  2OML A;  2VC1 A;  5CZX A;  1HIY A;  1Q53 A;  3QID A;  1SQF A;  2GML A;  4ZVT B;  4NLD A;  5A8K A;  1L3K A;  3A3N B;  6FDR A;  3OL8 A;  1N6Q A;  2HRY A;  3GYN A;  3DRP A;  3QFW A;  3SFU A;  1REG X;  2JFD A;  3KKF A;  5HQL A;  4FYW B;  2QLW A;  4B08 A;  2F8H A;  5A6P A;  3MR6 A;  2AJQ A;  1AA1 B;  3K89 A;  5A8W B;  3WX8 A;  3IM8 A;  5KAK A;  4M5D A;  1TV6 A;  3G6Y A;  3SCL E;  4XK8 C;  3FRY A;  2ZD1 B;  4K2X A;  1KVK A;  4EZ6 A;  4KT0 C;  1FKP B;  4ZVE A;  2UXB F;  2HHS A;  3DYA A;  3B82 A;  3CDW A;  1RA6 A;  3CWJ A;  3M6W A;  3R27 A;  2DEJ A;  5HI7 A;  3JSM B;  4ILL A;  2IM1 A;  1FEH A;  2QFJ A;  1B4S A;  3QT6 A;  5KT2 A;  2R7R A;  3TZY A;  4DS4 A;  1FI4 A;  3C3L A;  4NLW A;  3EE3 A;  3CDB A;  1FTR A;  2C3O A;  3QRP A;  4HDH A;  5A6W A;  3OTB A;  2YKQ A;  3OW2 R;  2UVU A;  3JTN A;  1NND A;  3QMQ A;  1GXU A;  1I1G A;  4N7T A;  4EYI B;  5H1S V;  2R8J A;  2IAJ A;  3IRX A;  2D9P A;  2DR6 A;  3I32 A;  4WK3 A;  3KHH A;  4J9O A;  3D6F B;  4PXE A;  1NPP A;  5GAE U;  1GAO A;  2UV8 G;  4FP9 A;  2A6M A;  1B7Y B;  2YNG B;  3LAL A;  5M2R A;  5K8M A;  4LF4 J;  1S77 D;  4JI6 J;  1CJK A;  2AEM A;  1YJV A;  4HI2 A;  2HFO A;  1RUS A;  1H3D A;  4USJ C;  5LL6 d;  3V4I B;  2D3O 1;  3VQS A;  1ZM9 A;  4UTG A;  2J0Q D;  5AXL A;  4UUX A;  1WOP A;  2FJW A;  3QIP A;  2E5G A;  4URQ U;  3NS6 A;  3OR1 B;  3OVA A;  2VOO A;  1RT1 A;  3R7S B;  3M8R A;  2ALZ A;  4JI4 J;  3I5B A;  2JC1 A;  3BBB A;  4K2J A;  4M5K A;  4OMF G;  3VWS A;  1BHN A;  1WEL A;  3LGM A;  4BLG A;  3PV8 A;  3DM2 B;  4JI2 J;  4LSN B;  2M70 A;  5K5M A;  4C8N A;  2KM8 B;  3TUJ C;  2DNG A;  2RDD A;  3RG6 A;  4N8O A;  3K57 A;  1PIE A;  1SL1 A;  1HLW A;  3HHK A;  2JEG A;  3RJM B;  5K9F A;  3JQJ A;  2MST A;  2UUA J;  5LJ5 Y;  1ZPV A;  3UNG C;  2BDP A;  1RAF B;  1O5J A;  2KYX A;  2OFG X;  3TEH B;  4EFA C;  3L9Z A;  2LU2 A;  3FMW A;  1EKS A;  1TAQ A;  2ZBI A;  3CJ4 A;  5HJX A;  3N4W A;  4LSL A;  1S0M A;  1K0T A;  5KFX A;  4DV4 F;  1U8S A;  2CQP A;  1VQ4 S;  1UWB A;  5L39 A;  3F0N A;  2OPS A;  3DU5 A;  1VK8 A;  4DJB A;  2XCA A;  2IYG A;  5RUB A;  4IO9 Q;  1SUQ A;  1JLA B;  2V0N A;  4YB5 A;  2KT5 A;  4ED3 A;  1IBL J;  4NRU A;  1WHY A;  2ZE2 B;  2XZD B;  3MM7 A;  3PCO B;  2J9E A;  4DPO A;  5AE1 A;  3IN5 A;  3X3U A;  2QLX A;  1S72 S;  2HZV A;  1KSP A;  5DDO C;  2MZT A;  1PAE X;  1WOO A;  3AQP A;  4GKJ J;  2H5J B;  1XMO J;  2BR0 A;  4MH8 A;  2LDY A;  2RIJ A;  3OXG A;  3CCR S;  1I94 J;  2VA3 A;  2PFF B;  2CQD A;  1GMU A;  2MZS A;  2CWK A;  4BC9 A;  2IM0 A;  2HHH F;  5DRK A;  4WP9 A;  3OUY A;  2ZM6 F;  3GPA A;  4AXI A;  3BKF A;  3MPW A;  3N28 A;  4JB8 B;  1NJX A;  4O3R A;  4Q2L A;  1X0P A;  3P3D A;  3LW5 C;  3K5N A;  2XY6 A;  5CXT A;  4C11 B;  3Q89 A;  4DF8 A;  2WB1 D;  4P10 A;  4CT8 A;  1N5Y B;  5C5J A;  4TU9 A;  4NLY A;  2W25 A;  3G4S S;  3RRG A;  1RAC B;  2XQC A;  2OPS B;  4U7U D;  4OZL A;  3ZC4 A;  4OQJ A;  4O3S A;  3MPU B;  1NH8 A;  4OX6 A;  1QY7 A;  3A1Y G;  4HHJ A;  4USK A;  4WKR A;  1U02 A;  1UWB B;  2NYI A;  4OHV A;  5B0C A;  1URN A;  1KON A;  2C3U A;  1KR4 A;  2JRS A;  1NCL A;  1RTH B;  1VI7 A;  3MCO A;  2OLW A;  1KQK A;  3MWB A;  4IH5 A;  4KR0 B;  1VQ7 S;  5GAE I;  4IKA A;  2DNH A;  3DRR B;  5KFT A;  2JH3 A;  2HHP A;  2ASY A;  2ZC3 A;  3EGV A;  3G2X A;  2XMA A;  1VQM S;  2QA4 S;  4ENO A;  5LXR A;  1WSR A;  1ZAV A;  2J6U A;  4NXN J;  2DEI A;  1VMB A;  2NXE A;  1FVQ A;  5CA5 A;  3C6U A;  5D77 A;  2Y1J A;  4LQ3 A;  2V94 A;  5E3Q A;  1IM4 A;  2I6W A;  5C42 B;  4ZLJ A;  5JVH Q;  3ZTP A;  1S12 A;  1B3T A;  5EN1 A;  1Q81 T;  4K5R A;  1JIH A;  1RWK B;  4IDK B;  4CWB A;  3OXL A;  1R0B G;  4NA2 A;  2ATC B;  4O4R A;  2DGQ A;  8ATC B;  4G6V B;  2LQ5 A;  2POK A;  4OFZ A;  2KJV A;  3AOB A;  3EPI A;  4OZJ A;  4B9V A;  2J0S D;  1SIZ A;  4QU7 A;  4ATN A;  3P5B P;  1UFK A;  3H98 A;  2BE9 B;  4RJV A;  1R0C B;  4J9M A;  1SJF A;  2W2O P;  1UTA A;  3V4I A;  3H20 A;  3KJN B;  2XWX A;  1JJH A;  3VTI A;  1YSJ A;  5HLF A;  2GZO A;  2VG5 A;  2YNG A;  1SQG A;  2ZH1 A;  1G3O A;  1UCN A;  3MM9 B;  2L9W A;  1U6B A;  1TMM A;  3K58 A;  4JBC A;  1DQ9 A;  4HT7 A;  1M5V C;  3J7Y I;  3MCS A;  3VHQ A;  1CUL B;  5DG8 A;  2OPR A;  1S97 A;  2KJW A;  2RSQ A;  4OX7 A;  3M8Y A;  3BO4 A;  4AXJ A;  4RL1 A;  3SYZ A;  3Q0A A;  2DGT A;  5LJ3 Y;  3GIL A;  1OIA A;  2JZ5 A;  1R6V A;  2KU7 A;  2OSR A;  4M5J A;  2XCP A;  3GIJ A;  4YOE A;  2AX1 A;  4EU0 A;  3KLE A;  3G6V A;  1PYO B;  4EBD A;  5I3Q A;  1HBU B;  4J9Q A;  2ZOF A;  1FRI A;  2YKM A;  3FJ2 A;  1WG4 A;  2GCF A;  1SC4 B;  5CHC B;  4U7C A;  3PW2 A;  4Q0B A;  1MSW D;  2XGP A;  1C1B A;  1FKP A;  2YPY A;  5GMD A;  5IC4 B;  2KFN A;  1DY3 A;  2OPP B;  1SBR A;  4KO0 A;  4ZVH A;  4DV0 J;  2OEM A;  2R9L A;  5ADZ A;  4DOZ A;  3PM9 A;  5L38 A;  4NXM F;  3S01 A;  2J9D A;  5B09 A;  3C16 A;  2E9T A;  1X5O A;  2M8H A;  3CNQ P;  3LH2 S;  5CAB A;  1UP1 A;  3HPO A;  2Z2Z A;  4U8Y A;  2AGQ A;  1KQS R;  3D5M A;  4CYU B;  4A8X A;  3KUE A;  1XNR J;  3ENV A;  3IS9 A;  3H8Y A;  1CVJ A;  4CTA A;  5HL7 Q;  3EYZ A;  1GXL A;  2UVV A;  1XNQ F;  2I5J B;  3CGI A;  4LRF A;  4ZLL A;  2W2P P;  1JKH A;  3UWT A;  3HP6 A;  2HZA A;  2C2K B;  1OO0 B;  1PGZ A;  2I9S A;  4K8R A;  2PMZ D;  1NEE A;  1YZ7 A;  4HTJ A;  4ZCM A;  3T1H F;  3BR9 A;  2AEF A;  3BQ1 A;  4ERD A;  4LF5 J;  4F04 B;  2E7X A;  1N54 B;  3LTO A;  3KOA A;  1V3R A;  3CD0 A;  4C0H A;  4LF9 F;  4KJI A;  4UOG A;  2QRR A;  1DZ5 A;  2V8H A;  1KP6 A;  1XEZ A;  4P52 A;  4WTY A;  2OFH X;  1HR0 F;  1VQ6 S;  4ED5 A;  1PJ7 A;  1VJW A;  3QJP A;  2Q66 A;  4ZVO B;  1IN0 A;  1NDK A;  2DRB A;  2F4F A;  2WSC C;  3WDO A;  4B9S A;  1WI8 A;  3HHL C;  5A76 A;  2FJE B;  1NU4 A;  1S49 A;  3EJM A;  2DNY A;  5CCM A;  1SIW B;  4QZV B;  3VAH A;  4DL2 A;  3R3T A;  2VPW B;  4DR5 F;  2JEI A;  1TUV A;  3EX7 B;  2VL1 A;  2A1B A;  3MUV P;  2MY7 A;  4JI0 F;  3I6P A;  1KNZ A;  2QSW A;  2V5H G;  4CM0 A;  3D0G E;  4ZPT R;  4RZR A;  2YKA A;  2NZ4 A;  4WPA A;  1WTF A;  1U0S A;  1RXO B;  1R8C A;  3VAL A;  4A8K A;  2D3Z A;  1RT6 B;  4NLO A;  4L3N A;  8RUC A;  1VHI A;  1UAW A;  2EC2 A;  1IJF B;  1N0V C;  3QLH B;  3ZFV A;  2DNM A;  3G82 B;  3D1O A;  3CVK A;  3GR1 A;  3J7Y U;  3M6U A;  3M9M B;  3OFG A;  4CLS A;  1N52 B;  1FNO A;  1Z4U A;  2XI3 A;  4ZLN A;  1RWN B;  3THP A;  4R5P B;  2KFY A;  1NKE A;  3LAK A;  1HA1 A;  3HDS A;  2B3T B;  3IBF B;  3UDE A;  1XER A;  3THV A;  4LF1 A;  5AJ3 J;  1NLK L;  4Y28 C;  3W9H A;  1YTY A;  2FJX A;  2R7V A;  2LYV A;  2VAS A;  1ZM3 A;  2Z58 B;  4DL5 A;  2K7K A;  1CJT B;  2IVM A;  4Y6I A;  2B43 A;  2VG5 B;  4QR2 A;  5JUM A;  3BSO A;  1KQF B;  4ANC A;  5E7O B;  1TK5 A;  3ILI A;  2ZJR Q;  4M95 A;  3UE2 A;  2GJF A;  4B9L A;  3MOZ A;  4ANE A;  2FB0 A;  1NHU A;  4ZVS B;  4C48 A;  4B3R F;  4AQY J;  3LPE A;  1VQL S;  5DZ7 A;  4Z37 A;  2B4V A;  5BJR A;  1ZA1 B;  1IBL F;  4IDK A;  1FJG J;  3W65 A;  5DG9 A;  4ZJO A;  4JV5 J;  3AOA A;  3I87 A;  5KFG A;  2ZWP A;  3ISZ A;  4MK7 A;  4PXB A;  4YB7 A;  4AD6 A;  1U49 A;  3NNH A;  1OYD A;  2DGU A;  1DLO B;  2HQI A;  2GW8 A;  3C6U B;  1D9F A;  1S1U A;  2MZJ A;  5ETM A;  3ZXW A;  4N56 A;  4ZN1 A;  1EP4 B;  1JLE B;  5DJB A;  2YH0 A;  1J2V A;  1KFD A;  3LPY A;  2A10 A;  7FD1 A;  2CG8 A;  1XBW A;  3DRR A;  4YP3 A;  3AHP A;  3I0S B;  3JTO A;  1TZ0 A;  2IHR 1;  3SIP B;  2DNP A;  5DG7 A;  3K5M A;  1MG7 A;  2GJ2 A;  4XPE A;  1W2I A;  3BGF A;  2IJN A;  2R2U A;  1GTE A;  3MF5 A;  3C15 A;  1TL7 A;  1IJE B;  3C14 B;  5K14 B;  4Z7Y A;  1SKS A;  1BXN A;  2APO A;  1FXR A;  4HHH A;  1Q7L B;  1VBY A;  4NLU A;  3T9N A;  1FFW B;  1LK5 A;  3M7V A;  2Y8W A;  1FE4 A;  1M0S A;  1I3O B;  1YJT A;  3EVW A;  4J9V A;  4P2F A;  3M1V A;  1WC1 A;  4RW4 A;  1TL4 A;  3PFE A;  4P2S A;  2R7Q A;  3T1A A;  4DPX A;  5HAO A;  2HUR A;  2VHG A;  1S57 A;  1RTJ B;  3CJ3 A;  5HJY A;  4YB1 P;  2VBX A;  2K7J A;  4DQR A;  5IS2 A;  2BJ9 A;  2OSQ A;  2RD5 C;  5DM7 Q;  3R2D J;  4BBY A;  4OL8 A;  3GB0 A;  4DWI A;  3CJ2 A;  3OUY B;  4B3O A;  4RO0 A;  4BWJ A;  1S9E B;  4B9T A;  4C8L A;  4IO1 A;  2EEY A;  2VIC A;  1O0P A;  1VC6 A;  3GCX P;  2C2R A;  4B17 A;  4HYK A;  3R97 A;  3BSN A;  2FHJ D;  4F36 A;  1V3Z A;  3Q24 A;  4WYL A;  1RAE B;  2GIF A;  3M8P A;  1Y00 A;  5J1E A;  4DV3 F;  4OYO A;  5F8N A;  4WII A;  2MEW A;  3I82 A;  4TYB A;  5E33 A;  1U1N A;  4QOT A;  4MFB B;  4WF9 Q;  1VQY A;  1YQH A;  1RAD B;  4H54 A;  2DVI A;  4LF6 J;  1G1X A;  3M2V B;  1TL7 B;  3C14 A;  2IC3 B;  1IR0 A;  2YWF A;  3M2U A;  4XDC A;  5DQI A;  2BYC A;  3KK2 A;  4LFC F;  2OEK A;  4OI3 A;  2D1C A;  2N7C A;  3U1N A;  5H9F J;  4QQB A;  1U1Q A;  2UXD J;  1UPP A;  3KLI B;  1GNK A;  2RHQ B;  2BJ8 A;  2PII A;  3SFG A;  5LMU F;  1C1C B;  4LR8 A;  1IKW A;  2FPH X;  3BDP A;  3K8V A;  1H6K X;  1T9V A;  2BE2 A;  3NBP B;  4H4M A;  5HQ8 A;  2V63 A;  1KBR A;  4V19 J;  4Q7A A;  5IZH A;  2OTL S;  1YHQ S;  1FKA F;  4DN0 A;  5AXN A;  2YBV A;  5DZ6 A;  2O3D A;  4KGX B;  1HQE B;  5H9F K;  5FLX Y;  4RKU C;  4FNI A;  3W8G A;  1S1X B;  4KH1 B;  2FJA B;  3PIO Q;  2PMH A;  1YGY A;  2IIH A;  4JV1 A;  4MK9 A;  3NRB A;  2BQU A;  3A8J A;  2UXC F;  1CJU B;  1WF2 A;  2R7W A;  2GIQ A;  3JTP A;  2I38 A;  4IG0 A;  2UU9 F;  3M9O B;  2I2Y A;  3ILJ A;  2ZBP A;  3JSY A;  2BKO A;  1WEY A;  2PA3 A;  3UQS A;  5DET A;  3IRX B;  1M1G A;  3NCQ A;  1WF1 A;  2AWZ A;  1DBD A;  4TU8 A;  3NP5 A;  3PR4 A;  5HP1 B;  1N8R T;  2X1F A;  4O0I A;  2AW0 A;  3K59 A;  2JWN A;  2MKY A;  5IWA F;  2AKW B;  3PW7 A;  4PYD A;  3HHL B;  1XNQ J;  4N5S A;  2DGV A;  3M8Q A;  1CBK A;  4L72 B;  5HMX A;  4ECV A;  3QLH A;  1AFJ A;  2KL8 A;  4IUF A;  4FNH A;  1YJR A;  2HKE A;  4TY8 A;  4O3P A;  2G2Z A;  3PHT A;  4AYB D;  2M9K A;  2PN6 A;  3NXZ A;  2XMJ A;  1LWC B;  1MU2 B;  3DYA B;  3T1H J;  2KVI A;  3OTE A;  4C8O A;  1S9F A;  2ZDP A;  2RVJ A;  3DKD A;  4QYZ J;  4DR6 F;  2GQQ A;  4WXW A;  3VZI A;  1T3O A;  3GON A;  2DPI A;  1XJW B;  1IQZ A;  2CYY A;  1Y3K A;  2E1A A;  4PG7 A;  4CLW A;  5A8W A;  3OV7 A;  4DSF A;  1OSD A;  1Q8K A;  2C3Y A;  2BAC A;  2Q6C A;  3W5X A;  1GEH A;  1QJH A;  2HFN A;  4DMZ A;  2AQ4 A;  1Y5L B;  1RU1 A;  1SPB P;  4ZHR B;  3KLH A;  3KK1 A;  4A8Q A;  1KLN A;  1PIL A;  2HVZ A;  1UVM A;  4DFM A;  4ZS6 A;  3OLA A;  4ZVF A;  2AP6 A;  3FQL A;  5I42 B;  4C9D A;  2ZH5 A;  2OP5 A;  2XMM A;  1N5S A;  3M6X A;  3MEK A;  4DQS A;  4JI4 F;  1WNE A;  4C0O C;  2EKY A;  1SC6 A;  1TKZ A;  2DD8 S;  1S48 A;  4FS2 A;  1R43 A;  2M5Y A;  3HCX A;  4OYA A;  1XTZ A;  1LNQ A;  4JI2 F;  1JKH B;  3QAU A;  4ID5 A;  2GQ2 A;  3CPW R;  3TVZ A;  2B9W A;  3SCI E;  4DR3 F;  2CAJ A;  3S7R A;  4K5S A;  4J90 A;  1LFW A;  3LOU A;  4CTA B;  4EUV A;  2GO9 A;  1XR7 A;  2IA0 A;  5K8O A;  2VQE F;  2UUA F;  2DCU B;  1JQG A;  2IDE A;  4IFY B;  1DTQ A;  1QAY A;  4CI0 B;  5A2Q Y;  4DLG A;  3R6G B;  4JV2 A;  3H42 A;  1VJQ A;  4YFU A;  1UFW A;  3K0J A;  3TOQ A;  4M5I A;  3V6D B;  3E2E A;  5HAN A;  1B99 A;  2XY7 A;  2ZHO A;  1MRO A;  2BJ3 A;  2ZBR A;  1JLG B;  2GIR A;  3EDR B;  1QE1 A;  2H54 B;  4K7Q A;  4ES2 A;  3OTO F;  3CJ0 A;  2CPX A;  4KGK A;  1YJW S;  4FYD A;  1LWC A;  1MU2 A;  3MPY A;  1H2T Z;  4TLQ A;  1HBU A;  1Y3J A;  4OLP A;  1GQE A;  2V68 A;  3CC4 S;  1NSQ A;  1FRJ A;  4GKJ F;  1UJ5 A;  4PQA A;  5CYQ B;  3DOL B;  2C2E A;  3HHL A;  1P1T A;  2F1F A;  4F25 A;  4OYI A;  4G65 A;  3PX6 A;  2H65 B;  3CD5 A;  2VA2 A;  2RF2 B;  3ZZT A;  3PKM A;  4KPC A;  1H72 C;  4H4K A;  4LVO P;  5KFZ A;  3T1Y J;  5E3R A;  2FVQ A;  3NGK A;  5E2Q A;  3L09 A;  3KK3 A;  1RE1 B;  3ET6 B;  4OZ2 A;  2B9E A;  2NXU A;  2J7W A;  3AH6 A;  1VRT A;  5D0R A;  5B0E A;  2NPI A;  3GU0 A;  1SJ3 P;  3OR2 A;  1RKI A;  1D0E A;  1RB0 A;  2ZH8 A;  2PFD A;  3EGW B;  4YEA A;  4MKB A;  5J1N A;  3CCL S;  1XWL A;  5HLF B;  2OPQ B;  2K8G A;  2J5A A;  4UF4 A;  4L75 A;  4L6V 3;  4PWU A;  2HAF A;  3CSK A;  4OYZ A;  3DNC A;  3W1Y C;  2HNY A;  3DRY A;  3OHA A;  4C8K A;  3B78 A;  1YX2 A;  4OI4 A;  2XMV A;  1YJ9 S;  3QYY A;  4K59 A;  5DS7 A;  1JLQ B;  1OPI A;  2FHK A;  2XSJ A;  5CD4 H;  1PO6 A;  3IGN A;  1UA0 A;  4J91 A;  5HK4 A;  4TN2 A;  4EGL A;  1NK8 A;  1IWA A;  1HQU A;  3DLG B;  2FHO B;  4DSJ A;  4XPC A;  1AZS A;  4NXN F;  4QJV A;  3DFE A;  3GJT B;  1RWU A;  1TKX B;  1TL3 B;  3NGU A;  3IA0 A;  4FKY A;  5L46 A;  1CS4 A;  3NBP A;  2BE2 B;  1OQ6 A;  2AT1 B;  3DRX A;  3G86 A;  4YHH F;  3H4D A;  1EET B;  4ZVP B;  1CJV A;  1ZET A;  4OYX A;  1X4G A;  2W8K A;  1SC3 B;  1EAR A;  2GC8 A;  3C6T A;  2ZH9 A;  1RWX B;  2X7I A;  2Z57 B;  2QE5 A;  1E6V B;  5F8H A;  1A6L A;  3NG8 A;  1MWY A;  1RAJ A;  3AOC A;  4USI A;  4X4Q A;  1NK4 A;  4KSE B;  1R6Y A;  3SCK E;  4TQS A;  4IR1 A;  1EIY B;  3M2V A;  1YJ7 A;  1BE4 A;  3J80 Y;  1DUR A;  3N79 A;  1F5B A;  2M7S A;  3MPV A;  2L41 A;  1Y10 A;  1HBM A;  5ETR A;  3QO9 B;  4X62 J;  2JEF A;  4OHZ A;  3HVT A;  3MFI A;  5MAO A;  5EGY A;  2AU0 A;  2IM2 A;  5KFE A;  3R2C J;  2Y1R I;  3M8P B;  5KFQ A;  1B0P A;  3MED A;  3QNW B;  5ETT A;  4JI5 F;  5D4O A;  2HHQ A;  1EZZ B;  1LWE A;  1QDU B;  3W2W A;  4DV5 F;  1TKD A;  4HR2 A;  2EXU A;  5C24 B;  1O51 A;  2EFN A;  2K1R A;  4V19 X;  2CAD A;  1FX2 A;  5LSO A;  4P7V A;  5ETQ A;  1LXJ A;  2BBE A;  4R8U A;  4KC5 A;  1H74 A;  5C2G A;  3KHR A;  2ASJ A;  3M32 A;  2HHU A;  2Z2Y B;  3QRQ A;  1F9E B;  2FVC A;  2MQM A;  4WWS A;  3J81 j;  5HMW A;  3OL9 A;  2IPO B;  4ICL B;  1XC9 A;  2YWG A;  2FTR A;  3M1V B;  3F41 A;  4RW4 B;  4FS1 A;  1ZZF A;  2GVD A;  2UUW A;  2YX7 A;  4PPZ A;  2WSE C;  4X66 F;  3PO4 A;  4F4Z A;  2MHE A;  4CP5 A;  2HHT A;  3PG9 A;  3EWG A;  2YQ3 A;  3MMB B;  1WEZ A;  3J81 U;  4IOB A;  4TU7 A;  4NXM J;  1U0H A;  3DCA A;  1IBC B;  1RWM B;  4KGV B;  2LCW A;  1F9F A;  1N36 F;  5FJ4 A;  2CQ2 A;  1Q1K A;  2QYC A;  1U8W A;  3T5K A;  2P9C A;  2J7U A;  1RA7 A;  3GR0 A;  1RGV A;  1EQM A;  4I67 A;  2WK4 A;  3DHX A;  4FXD A;  2YKN B;  2XUL A;  2HBZ B;  3MMJ A;  1ICE B;  4DG1 A;  5CYJ A;  4LSN A;  2DHS A;  4U9R A;  2AYE A;  3VGV A;  1G6B A;  4RNF A;  5CD4 A;  1WKL A;  2HGM A;  3Q8R B;  1R0A B;  1Q82 T;  4Q5V A;  1FX4 A;  1SJ1 A;  3HX9 A;  1R31 A;  1WI6 A;  1H7X A;  4P7T A;  1FRK A;  4QPT A;  4B9M A;  3O5T B;  4HAC B;  2E7W A;  2EW9 A;  2AJ0 A;  3MM6 B;  3PY8 A;  1VC0 A;  1OWX A;  3JSR A;  2DXE A;  2MLX A;  1JJC B;  2HQG A;  1R0A A;  3LWL A;  1FK9 B;  4DR6 J;  3SMZ A;  3D1Q A;  4CM2 A;  4J9P A;  3TA1 A;  1CJK B;  4DG1 B;  2E5J A;  2CVI A;  3NGS A;  2H51 B;  1LWF B;  3TQ1 A;  3MI7 X;  1MN9 A;  1N4L A;  2Y1L B;  4N41 A;  1N5Q A;  1C0T B;  4GRS A;  3GV5 B;  3KTQ A;  4JI1 J;  2ZH2 A;  4GVL A;  5EWF A;  2XWY A;  3J80 U;  1TFY A;  1F9H A;  1YJN S;  2YNH A;  4ELV A;  3CJ5 A;  3GFX A;  1ZAW A;  4LFB J;  2BVZ A;  2FQQ B;  2Z2M A;  1LQ9 A;  1U0H B;  4HLB A;  1UMJ A;  1X4A A;  1UA1 A;  1BQM B;  2F7V A;  2P9E A;  4G1Q B;  3TA0 A;  3PW5 A;  2ZHB A;  2GVD B;  2HBQ B;  1EX8 A;  1PYS B;  4MKA A;  2NXC A;  4WIQ A;  4DUY J;  1KHW A;  3B4M A;  5GAH U;  4OHY A;  1BD6 A;  1LW0 A;  1FRH A;  4USM A;  2W9B B;  2H9Z A;  2HNZ A;  1R8B A;  3KHL A;  1IBK F;  1GMV A;  4Y2M A;  4J9U E;  3UDL A;  4Y00 A;  5IFM A;  4DR3 J;  2VC0 A;  2MGZ A;  4R8U B;  4ZP6 A;  1MMD A;  3JXO A;  3KLG B;  2JNJ A;  5L9X A;  3UI3 A;  1FRX A;  4I6A A;  2DH7 A;  2DGW A;  2OTJ S;  4OYP A;  2DPJ A;  1WC4 A;  3BH6 B;  5F8M A;  3H5X A;  3TUP A;  4DHV A;  1LOU A;  2HLT A;  3MED B;  4DV7 F;  4ZPW R;  2WRM A;  3AJ1 A;  3KJQ B;  1S4F A;  4KKO B;  2ERR A;  5KFH A;  5IC6 B;  3SBM A;  4B3R J;  1AT1 B;  2KRR A;  4QW8 A;  3G87 A;  3GV8 B;  2IBK A;  3QO9 A;  3TX8 A;  2F65 A;  2RUG A;  3HO1 A;  4UT4 A;  2ILY A;  3GIR A;  5B0A A;  3BQ0 A;  2CNN B;  4JV5 F;  4LRC A;  2W1B A;  2VV5 A;  2LEB A;  2FVP A;  4JI7 J;  3BJY A;  4I2P B;  3IWN C;  5F8J A;  3D4J A;  4Q8E A;  1NHK L;  2CDQ A;  1R89 A;  1X7V A;  2UUB J;  4DSK A;  3JQM A;  4ZPB A;  3HJF A;  5E3P A;  1KOH A;  3UDV A;  3L3C A;  2VKR A;  1NUE A;  1T9Y A;  3PX0 A;  4OI2 A;  3VZH A;  1HNI A;  5H9E K;  4CYU A;  4DSI A;  3ENQ A;  1EET A;  2MQN A;  4QIV A;  3T1Y F;  2KZZ A;  2P6T A;  3CTR A;  1RKJ A;  3LP1 B;  4WXO A;  1KQG B;  2BAN A;  3I55 S;  1UEK A;  3Q86 A;  4JI8 F;  1U1K A;  1CEZ A;  2JL9 A;  3KLV A;  3TUI C;  4H4K C;  3M30 A;  2VOD A;  3FCW A;  4KO0 B;  4L3K A;  5AE2 A;  5KFW A;  1X5S A;  3M6V A;  4DU8 A;  3J81 Y;  3UFC X;  3K8W A;  3KLF A;  3FVY A;  5GMK a;  4J7C A;  1S0N A;  2L48 A;  2W4P A;  1L3T A;  3RU0 A;  2MZ1 A;  4IOA Q;  3HD2 A;  2BKP A;  2O01 C;  4QWA A;  4PQU B;  2R4F A;  4LR9 A;  2G0C A;  2HND B;  3CCV S;  1GH8 A;  1AUD A;  1UVN A;  1HFE L;  2J76 E;  1ZBT A;  2VPX B;  3E01 B;  4CLF A;  3EVO A;  1REV A;  2FHJ A;  4FXV A;  5B0B A;  1X4B A;  2J0W A;  3R5A A;  2BM1 A;  2RRB A;  1RWP B;  3OQ2 A;  4I6W A;  3J7A 1;  1C4A A;  4DR4 J;  1RBO B;  3T41 A;  1QAX A;  3M4X A;  3NS7 B;  2HVH A;  2B9X A;  4NMX A;  3FEX B;  3TAN A;  2QG9 B;  5G0R B;  1W2B R;  3TJ9 A;  2EFO A;  2CJB A;  1D9A A;  4RUC A;  2C22 A;  2DNN A;  1U48 A;  1ZS6 A;  1SC1 B;  3D6H B;  3GG1 A;  5KG5 A;  1TKT B;  2MJU A;  1G7C B;  1U1M A;  4TLR A;  3I56 S;  3GP9 A;  4RNM A;  1BMQ B;  3ETO A;  1IBM J;  4LF6 F;  2QMU B;  3N9U C;  3AXM A;  2B8P A;  4KHR A;  4DV6 J;  3POT B;  1D3W A;  2EBG A;  2VIH A;  4OHX A;  2ASL A;  4OX9 F;  5HBM B;  4NYZ A;  3UCZ P;  3CCQ S;  3CJT A;  4M94 A;  1XMB A;  1S6Q A;  2KKH A;  3QGG A;  1NSP A;  4KE5 A;  3TO8 A;  1VYA A;  2BZ2 A;  4CZC A;  1DTQ B;  3GV7 B;  2DR9 A;  4WFX A;  3ZTO A;  3BB5 A;  3DI6 A;  2DYA A;  5F0U A;  3PEH A;  3HHL D;  3IXQ A;  1SXL A;  3MXH P;  3DLE B;  1NPR A;  4J9R A;  3DDI A;  3G6E S;  1VRU A;  2VG6 B;  4IG3 A;  1IUJ A;  1TKZ B;  4KBI A;  1RAA B;  4LBH A;  2RAQ A;  3ICL A;  4Y65 A;  4L73 A;  4NI2 A;  5ETL A;  4A4J A;  3D6T B;  3VAI A;  1VIX A;  1ACM B;  3DLJ A;  4ZP7 A;  1Q7Y T;  3RW7 A;  2O67 A;  1FHT A;  3LUY A;  4MAK A;  5I3U B;  2E5I A;  4I7F A;  4Y3C A;  1WEX A;  4P2X A;  3TX0 A;  3QPI A;  2YWE A;  3JQK A;  4ZPV R;  4C11 A;  2C2D A;  2AF6 A;  4ECQ A;  2CPF A;  4ZHR A;  3KLH B;  2WZ1 A;  3HFK A;  2GFF A;  2XYP B;  3KK1 B;  2MLZ A;  1N33 J;  2MSS A;  3GIM A;  4CO3 A;  1WTB A;  3ELH A;  4OX8 A;  4QPX A;  4K4W A;  2C28 A;  3IMQ J;  3DLH A;  5IWA J;  1DHM A;  3LP2 B;  2Y0S D;  2MQO A;  4X4T A;  2B51 A;  1S76 D;  3QFH A;  4NEY A;  4JI6 F;  3R9L A;  4UOC A;  2ZNY A;  1S9G A;  2HWI A;  2R42 A;  5CCL A;  3QZ8 A;  3HD1 A;  3V81 B;  4PYA A;  4GC6 A;  3JB9 k;  2YKO A;  1HYS B;  1UET A;  3CJR A;  3D6M B;  4NLQ A;  4C0B A;  4K4Y A;  2H1Y A;  1LW0 B;  2W9B A;  4EWT A;  2ZFH A;  4QR0 A;  3R5G A;  2F5G A;  4ZVG A;  1SUQ B;  1X5P A;  4WU3 A;  3VV2 B;  2VG7 A;  3TJA A;  3CME S;  1V6H A;  3PJW A;  2J9C A;  1PYT A;  2M2B A;  2F3J A;  3GSD A;  2ADC A;  2KDO A;  3OL7 A;  4B3T J;  3MTJ A;  2KM8 C;  3FBB A;  2H4Y B;  2CQ0 A;  4EYH B;  2AEJ A;  1J5E F;  2Y8Y A;  4B3S J;  2DO0 A;  2J6T A;  4OYB A;  1HKA A;  1QTN B;  2QLB B;  2IBO A;  2YNH B;  4G3I A;  5IT0 A;  1SV5 B;  2F8M A;  3GG0 A;  3D68 A;  2V8G A;  1N5T A;  1NSK L;  1VLY A;  2B6A B;  3BEG B;  5GAG U;  4LFB F;  2OMO A;  3A13 A;  3GJR B;  3N0V A;  3NOC A;  4ZKA A;  2P6S A;  2N4D A;  4X65 J;  3M8S A;  3W9J A;  3V6H A;  4X4N A;  4KGM A;  3HSG A;  1PKU A;  4CO5 A;  2OO4 A;  1WOR A;  2VDH A;  3VAJ A;  1RT1 B;  4DQI A;  1ZTW A;  4TKT A;  2Z8Q A;  4OJ1 A;  2YWW A;  3A8K A;  4WE1 B;  3PO5 A;  2YH1 A;  3UCG A;  4HH0 A;  2V4J B;  1DRZ A;  2ZJQ Q;  4ECX A;  2JLG A;  2IJF A;  1B64 A;  2HW3 A;  3P4U B;  2CXE A;  1KLM B;  4MIA A;  5KT7 A;  1CG2 A;  3FRZ A;  4ER8 A;  3W64 A;  1C1C A;  1WSV A;  2BW2 A;  5E0O A;  3RW6 A;  3VGT A;  1NKC A;  1J5O A;  4ZP9 A;  4WZQ A;  3KLI A;  3ZZY A;  4PRF A;  1APS A;  2E1C A;  3AB4 B;  3LAN A;  2YQ0 A;  2FVR A;  4J9S A;  3KK2 B;  1K9M T;  2HVI A;  2Q1L A;  1GK8 A;  5K8N A;  1RWW B;  4ECR A;  3BGL A;  1NK9 A;  4CO2 A;  3MMB A;  1IXK A;  2IA6 A;  4DV2 F;  2CG4 A;  4YB6 A;  3C2P A;  2ZKU A;  1S5Z A;  1Z2L A;  2ZBC A;  1HWL A;  2DHG A;  3NWG A;  3RBX A;  3UD5 A;  1WUU A;  1S7H A;  3BPS P;  3ZZO A;  4YR0 A;  4UQG A;  2KG1 A;  4ED6 A;  4AL6 A;  4IRK A;  4ICL A;  3QWU A;  3PX4 A;  1L3V A;  4PWD A;  5AXK A;  2E66 A;  2CNK B;  4XAK A;  1E6Y B;  1B0T A;  2B0G A;  3DN9 A;  5K20 B;  1JWW A;  5IT9 Y;  2VOP A;  3KNG A;  3R6L B;  2UUB F;  1TV6 B;  5HMY A;  3G6X A;  1YRX A;  3NGR A;  5KFB A;  3CE8 A;  1H38 A;  2HHH J;  1RI7 A;  2U1A A;  1QSS A;  1RK8 A;  2FLL A;  2HEK A;  3UPF A;  1KTQ A;  3OFH A;  3CDA A;  2E1R A;  3ETM A;  4Y2A A;  2HS3 A;  1TFW A;  3PYF A;  3M9N B;  4QYZ K;  1FFG B;  1JJ4 A;  3Q22 A;  4QWE A;  5K8P A;  3OHB A;  1N88 A;  2VQF F;  3HM9 A;  1RT5 A;  1S1V A;  2U2F A;  2LDI A;  3GJQ B;  2W2Q P;  4JP8 A;  2MZQ A;  1JNZ B;  1GT8 A;  2XZT B;  2JC0 A;  3PRB A;  4ZLP A;  3D2W A;  3SZ2 A;  1KFS A;  1H2V Z;  1TP7 A;  3FCH A;  2BJ1 A;  4ZN3 A;  3HVT B;  5THW A;  3FBF A;  3T9Z A;  5I3U A;  2VPZ B;  1AB8 A;  1NJW A;  3EPG A;  3AOD A;  3BGU A;  4RW7 A;  3SQO P;  3QAT A;  3SDE A;  3R5B A;  4NI2 B;  4K4X A;  2HQF A;  3OXF A;  4NX9 A;  2QN6 B;  4Y34 A;  1VRU B;  4LJM A;  3MOJ B;  4H4O A;  2CZ9 A;  4DUZ F;  4NWB A;  1VK3 A;  2CQ1 A;  2RML A;  4NML A;  4C3L A;  2HYI B;  2QL5 B;  4JUZ A;  3DI6 B;  2KB2 A;  3NCR A;  3FZ2 A;  5A0Y A;  3TJ8 A;  1T05 A;  4ED0 A;  4IOC Q;  5C2C A;  1S6Q B;  4B9N A;  4LIR A;  1UW4 A;  2RKI B;  3K17 A;  2KI2 A;  1Y5I B;  1CS4 B;  2CQC A;  2DXF A;  2KHC A;  1FE0 A;  3D3C J;  2Z2L A;  3DGV A;  3KDO A;  5D4N A;  2GNK A;  4DX8 H;  1AZS B;  3DU6 A;  4FKX A;  1XK8 A;  3NLC A;  2AIR B;  2QL9 B;  4E2F B;  3G71 S;  3LA0 A;  5HSP A;  1N32 F;  1TKT A;  1HNW F;  3CCT A;  2AZ3 A;  4F3O A;  3V6K A;  1DTT A;  3HMJ G;  2V69 A;  2PC6 A;  2F63 A;  2HNY B;  4FDF A;  1HNV A;  2FDN A;  4M1K A;  3UN3 A;  1YRT A;  3Q8P B;  3PYD A;  2VJU A;  3H2U B;  5LMN J;  2JX2 A;  3D54 A;  3D28 A;  5F3T A;  4DV5 J;  3HKW A;  3IBW A;  3TRG A;  1T9X A;  2N3L A;  4DV6 F;  1T03 A;  3NL0 A;  1OQ3 A;  3EZ5 A;  1VRT B;  4DR2 F;  5GAD I;  4IFV B;  5AE3 A;  2KN4 A;  2UVW A;  8AT1 B;  3RRK A;  5LXY A;  2KT2 A;  3PYE A;  1KC8 T;  2CQ3 A;  1FVS A;  3TUZ C;  4X4R A;  5KG4 A;  2W9C A;  1M5P C;  2KXF A;  3PJ9 A;  1FD8 A;  5KG6 A;  2RF2 A;  3PRD A;  2R8I A;  4DPT A;  5KFV A;  1F6T A;  1T03 B;  1LV5 A;  1UJ6 A;  5DDR C;  3DHW C;  3MEE B;  2W7P A;  3KMQ A;  3DOL A;  2RJZ A;  3K5P A;  4LRB A;  4F2R A;  4CO1 A;  2HG4 A;  3Q8V A;  1F5A A;  3ADA C;  5F9N A;  3HSJ A;  3ZZR A;  3AA9 A;  1FRL A;  4WBF A;  3SV4 A;  2E5H A;  3BGO P;  3DMJ A;  2ZJP Q;  3KLF B;  3R5C A;  5A8R A;  2R7S A;  1TEL A;  1V3S A;  5B0F A;  1U45 A;  3P49 B;  3WX4 A;  3BS9 A;  3E3X A;  5EX3 A;  3NNA A;  1MNE A;  3PXG a;  4LIW A;  1U25 A;  1MWZ A;  1VBK A;  2JFK A;  4CQ1 A;  2YVS A;  1UZH A;  5C7P A;  2BXJ A;  2EKN A;  2YX1 A;  4ECU A;  3CCJ S;  2R8H A;  3CUL A;  5F3Z A;  2JHE A;  1WHV A;  2RKI A;  5KFP A;  3GIK A;  1RAG B;  4X4P A;  1OY8 A;  1XNR F;  1WC6 A;  2HK2 A;  2HGL A;  2P8I A;  2RT3 A;  2ZNZ A;  4X84 A;  1QVG R;  4K4T A;  2HK3 A;  3EXC X;  2ZUG A;  3EMT A;  1X4F A;  3TP2 A;  3W60 A;  4K50 A;  3LP0 A;  4ID5 B;  4RWW A;  2RQK A;  3O6Q A;  4H4O B;  2ACY A;  2XO6 A;  3MR3 A;  2F9J A;  4FF4 A;  1P8G A;  1HL6 A;  1IKX A;  2HLU A;  2X1B A;  4I2Q A;  4PXC A;  2VZ9 A;  5ETK A;  1MN7 A;  1ZH5 A;  1DAR A;  4WCE Q;  3PHE A;  2K3K A;  3N6L A;  2E9R X;  3NEK A;  5KFJ A;  3H5Y A;  4QBU A;  1VQK S;  1MW7 A;  2XMW A;  1M5K C;  1LW2 A;  4NZ0 A;  3F73 A;  3BZQ A;  3BO2 A;  3SI8 A;  1WD6 A;  3G8S A;  1HNX F;  1N34 J;  2J8S A;  3IS9 B;  4B3S F;  3OL6 A;  1KTV A;  3HUL A;  4LT6 A;  1KVI A;  2F4V J;  2ZC4 A;  2C3M A;  3UDC A;  4DQQ A;  1YVF A;  1VQS A;  2CJX B;  4KFB A;  1SJQ A;  4FVM A;  1HWK A;  4URG A;  3BO3 A;  2EVZ A;  2G0I A;  1FES A;  3W5Z A;  3MMA B;  2J7K A;  3F56 A;  4X65 F;  1NZ8 A;  2F8E X;  2O1P A;  1F1B B;  2UZA A;  4I56 A;  1NAQ A;  1JB0 C;  2LLZ A;  2OPP A;  4AND A;  3PFO A;  1BC6 A;  2HNZ B;  2A2C A;  4PWD B;  1BQN A;  3I4H X;  3T3F A;  4M5N A;  4DZ6 A;  2AD9 A;  2MKJ A;  2YKM B;  2J6S A;  3NWR A;  3L7P A;  4TY8 B;  4DI6 A;  1L3U A;  4NPO A;  3LWM A;  1X9W A;  3AFG A;  3M8Q B;  3LGH A;  2R7X A;  1NRK A;  1BQM A;  1R8A A;  3DXB A;  2HWT A;  3GMG A;  3SSQ A;  2XS2 A;  5KFL A;  1Q95 G;  2Y1I A;  1WC5 A;  2LMI A;  1JX4 A;  3CCE S;  3DC2 A;  2OPR B;  5EDW A;  4MYT A;  4DV4 J;  4RW6 A;  4USU A;  1BLU A;  3CW2 C;  3P6Y C;  2P9G A;  5KFF A;  1ZAX A;  2ABY A;  1OJ4 A;  2MLY A;  3RUB L;  2DHX A;  5J2M A;  2HAI A;  4OZ5 A;  1JK9 B;  2AJ1 A;  3O1L A;  5CQG A;  4DFJ A;  4JV0 A;  2KYZ A;  4RBT A;  3CED A;  1CJU A;  1R3N A;  1R7I A;  4Q45 A;  4NZ6 A;  2IMW P;  3TZX A;  1VIO A;  4WFA Q;  4DV2 J;  1B0V A;  3DLK A;  1HI1 A;  4LF8 J;  4DSE A;  1S1W B;  1HHS A;  4OI6 A;  4Z2X A;  1HQE A;  3M8Z A;  4Y2K A;  4NYP A;  3TAP A;  1JXL A;  4IH7 A;  3W2V B;  1U1R A;  4PPD A;  4F4W A;  3T5H A;  1VBZ A;  2UXB J;  4PZV A;  1IKY B;  2NUU G;  2VFV A;  3I0R B;  4LBP A;  1YBT A;  2NPF A;  5DGA A;  2Z56 B;  5IT9 U;  3MCM A;  5L1J A;  4PG4 A;  2E44 A;  5F8G A;  2XEX A;  1MWQ A;  1RCX B;  4X4O A;  3IM9 A;  4JI8 J;  2R7T A;  2CDR B;  2FVS A;  2DR8 A;  3H40 A;  2E1P A;  5KFC A;  4XIU A;  4YR3 A;  3TAM B;  1WC0 A;  2M0G B;  2A18 A;  3OLB A;  3UCU P;  3V4M A;  1C2P A;  3KUG A;  1TMJ A;  3QZ7 A;  4CRJ A;  3OFE A;  1TVR B;  2GMJ A;  2N7Y A;  5DQG A;  4P2M A;  1S1T B;  2N3O A;  2K06 A;  4A46 A;  1HBN B;  1QSY A;  2BV3 A;  2FJV A;  1HWJ A;  1UZD A;  1WHX A;  2O5D A;  1HPZ B;  2A2D A;  3BRE A;  3DGP B;  1IKV A;  1WF0 A;  2YXL A;  4FYY B;  1NM2 A;  5IOL A;  4ZP8 A;  1KDN A;  1NSA A;  3MAH A;  2OD4 A;  4EO6 A;  2XMU A;  2CPH A;  5D8H B;  3MEC A;  4MK8 A;  1H2U X;  2LQ9 A;  3PW4 A;  4AL5 A;  5HQM A;  3N6N A;  3RBE A;  2MY8 A;  1S9G B;  2RNE A;  3K5O A;  3A4T A;  4J5O A;  2CPZ A;  4ZVQ B;  3LP2 A;  4HT5 A;  1PC4 A;  1FD2 A;  2V2Z A;  2YNF B;  2ZKT A;  1S9E A;  2XGQ A;  3VAG A;  5LSR A;  3HFZ B;  3PDN A; 
#chains in the Genus database with same CATH homology
 5ETM A;  3UDE A;  5ETL A;  3KUG A;  5ETS A;  3ILJ A;  1TMJ A;  1RU2 A;  4CRJ A;  3ILL A;  3QBC A;  5ETN A;  3UD5 A;  3HD2 A;  3KUE A;  4CYU B;  3HSJ A;  2CG8 A;  5ETT A;  5ETK A;  1RAO A;  1EX8 A;  2F63 A;  4M5J A;  4M5N A;  4M5I A;  3HT0 A;  3UDV A;  4CWB A;  1RTZ A;  1KBR A;  3ILI A;  3IP0 A;  4M5H A;  4CYU A;  1EQM A;  1RU1 A;  1F9H A;  1RB0 A;  3HSD A;  4F7V A;  1IM6 A;  1HKA A;  1HQ2 A;  4M5L A;  4M5G A;  4M5K A;  1CBK A;  5ETQ A;  4M5M A;  4PZV A;  5ETP A;  1Q0N A;  1EQ0 A;  2QX0 A;  1DY3 A;  3HSZ A;  3MCO A;  3MCN A;  5ETO A;  3KUH A;  3MCM A;  3ILO A;  2BMB A;  5ETR A;  3HD1 A;  4AD6 A;  1TMM A;  3HCX A;  3HSG A;  2F65 A;  1G4C A;  5ETV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...