3HT3A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus v713p mutant bound to g:dctp
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
579
structure length
579
Chain Sequence
b'KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I, large fragment
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ht3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ht3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ht3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ht3A01
1WCNA 4P4MA 4F91B 4ECUA 1HQUA 2X6NA 1RCHA 4FO6A 3K75D 4FXDA 1ZQPA 3KD1E 2KW4A 4TQSA 4Y1CA 4ED1A 3NF7A 3AA2A 1Y88A 5DGBA 1RBSA 3HX0A 2ATLA 4IQUA 2B21A 3EPGA 4KI4A 4BDZA 1KFDA 4CJRA 1D8LA 4G1QA 4GXKA 4RQ3A 1U48A 1JLCA 4QCLA 5HP1A 2ZJAA 3AVMA 5IIJA 4PGQA 3V1OA 2W9CA 2EX3A 3OHBA 2HVHA 3TANA 5KFAA 5L1LA 3QEAZ 3RB6A 4UB2A 1JKHA 3V4IA 3QEBZ 3C1YA 1EKEA 9ICQA 3AVLA 2IDOA 2FMSA 4JV2A 3ZT0A 4LZGA 4J9PA 9ICRA 4AHTA 3OS2A 2ZJ5A 4Q43A 2M9NA 4GC7A 5KGWA 3GFKB 4PHAA 2IS3A 3V1RA 3NF9A 5KRTA 4FJXA 3B6PA 3I0RA 1TAUA 4Q45A 3VQ5A 3RAXA 3HP9A 3TI0A 4M42A 4CHNA 5CP2A 1BQNA 4MEXA 3LAMA 3N97B 4CGJA 1BISA 9ICMA 4FM0A 3PW7A 3QIPA 3M8SA 4B8CA 4DOBA 1X9WA 4OVLA 1A5XA 2RKIA 5FRNA 3SZ2A 4DL7A 5DB7A 1T05A 4CGDA 3LDSA 3BQ1A 4DLGA 4PGXA 1ZBFA 1TFRA 3AU2A 1ZQQA 3AVHA 4O3QA 2BPFA 5KT5A 8ICEA 3PMLA 2BQRA 4QOZB 5KFYA 1QTMA 1TL3A 8ICLA 1J5OA 3OYEA 4LVSA 1RDBA 4KHYA 1BL3A 4RQ2A 3SI8A 3U3YA 4IDKA 1S0OA 2HHXA 1JLGA 3DMJA 2IC3A 4J2EA 3KIOA 1TK8A 2DY4A 3RRGA 3MGHA 1UT8A 3OYHA 4KB0A 1ZQMA 2EHGA 1KVCA 4Q44A 4R8UB 2G8IA 3M9MB 4I2HA 4CIGA 3MR6A 3DYAA 5DMRA 9ICPA 2D5RA 1K6YA 2I5JA 2ALZA 1UT5A 1S6PA 4KLTA 1UWBA 4OJRA 3HPHA 1MC8A 4QZ8A 4I29A 3KK1A 4O3NA 3TARA 9ICWA 1QS4A 5C25A 9ICAA 4MFBA 3OYGA 3RH5A 4P2HA 1BPBA 1BIZA 1MU2A 2X78A 4ZTFA 4HUEA 1S6QA 4KLUA 5KFVA 4MF2A 4Z4IA 4XQ8A 2W9AA 4ECWA 4I2QA 1XC9A 2RPIA 4CGHA 1BPXA 1RDDA 5DB6A 4CEAA 3GILA 3QZ8A 4W5NA 4LSNA 2YNHA 2ASDA 2DFEA 1Y97A 4UAZA 4O44A 4J9LA 5F9NA 2NRWA 4I27A 5DG9A 1RBVA 1WSIA 1ZQBA 2KTQA 3LWMA 4Z6EA 3IHQB 4JV1A 2YKMA 4CERA 3SI6A 1WCLA 1SL2A 1VSDA 4M3XA 4UB4A 3NF6A 5KG6A 4YG2A 3ALYA 1SUQA 5J2GA 4ED2A 3V9ZA 5I42A 4BWMA 1SKSA 1VK0A 2A1RA 1ZQZA 4YMOA 4O3PA 3EPIA 1A5WA 2VWKA 5I3UA 4DTXA 3SCXA 1TK0A 2KZ3A 5J0RA 1RILA 4IBNA 3OYIA 1ZETA 5KT3A 5IIKA 2G8UA 3M8RA 8ICJA 5KT7A 4HHTA 7ICNA 1LW2A 1NJXA 3T1AA 3ZSOA 1VSHA 4LY7A 3ZD9A 4FS2A 4QWDA 7ICRA 2ZD1A 1ITGA 1BI4B 3AA4A 1QLNA 5KGXA 2LYHA 3MR2A 2JEJA 1B92A 1ZQGA 4EEYA 4E7JA 4N56A 4FK0A 5J0SA 3MXIA 8ICAA 3RWUA 1KLMA 3H8JA 4F93B 3VA0A 3QZ7A 4QWCA 5J0WA 2A1JB 4K8ZA 4M6WA 3BQTA 1B9FA 5DGAA 4FJKA 4CHQA 4QZFA 1RYRA 3KHHA 1NK6A 1D5AA 4N76A 4J9KA 4CFAA 5F9LA 3NGDA 2RDJA 3HPOA 4F5OA 3SNNA 3U6FA 1U49A 3ZDDA 4OGEA 2ZUCA 4RQ4A 3QNOA 3D45A 5CR0A 4QZBA 5L1JA 1T4GA 4PA1A 5J2FA 4KREA 2JLEA 4M9LA 1TKXA 4I9LA 3OYMA 1JLFA 2AQ4A 2UVWA 4O5EA 1PZNA 1BPDA 7ICJA 4DOCA 4FM1A 7ICIA 4OGCA 4KTZA 3OYKA 2W42A 5HLFA 4KLJA 4YR3A 1A77A 8ICHA 1Z00A 5KFTA 2KN7A 4MF8A 4JV0A 1MSWD 4W5OA 4FK2A 4CJLA 4B9SA 1RT1A 2GWSA 2W9CB 2AGOA 1ZQHA 3RJEA 4Z0UA 2Z1HA 3OHAA 4ECSA 2BQUA 3HYFA 4QZDA 1VSFA 2GUIA 3JPQA 5HRNA 2JZBA 4FJMA 9ICJA 5EWEA 2V4RA 3PR4A 4DL4A 4DQPA 1AROP 8ICQA 3PO5A 3SYZA 2VG6A 1IG9A 4CIEA 4FM2A 4DTRA 1RXVA 3ZDCA 5KG2A 1NKBA 3V6KA 2Q3SA 2BQ3A 2X74A 2NRXA 5C42A 1ZQSA 3C23A 4F4YA 3ZT1A 4ELUA 3RJKA 5KFNA 5J2JA 3PV8A 2RDIA 1UOCA 4FZZA 3KHLA 1WSHA 4DSKA 4ECQA 3AU6A 8ICPA 1BQMA 1HMVA 1DTQA 3ZCMA 1WN7A 5J2IA 3VQEA 3SUNA 3KTQA 3QEPA 3VQAA 3NF8A 4FCYA 4ICLA 1COOA 1S97A 3P1GA 4YVZA 5IIOA 3AVNA 5KFXA 4CJSA 5DG8A 3PW4A 1CXUA 4DF8A 3L2VA 3DLHA 4ELVA 1WSFA 3Q8QB 4ECVA 5DK5A 3VQQA 5J0QA 3AVAA 5DB8A 4UQGA 3E2EA 1TK5A 1FK9A 1WSJA 3G6XA 4CJPA 4CJWA 4DTSA 4RQ7A 3Q8KA 1CUKA 3LPTA 3O4QA 1JIHA 4QZGA 4E89A 3VQPA 3HXMA 1VSIA 4O55A 3SUOA 1EX4A 4I2DA 1VSJA 4TUQA 1CZ9A 4IKFA 4F8RA 1W0HA 3OYJA 4F4ZA 4AHUA 4E0DA 4O4GA 3K5NA 4DTUA 5KFCA 1ZJMA 4I2EA 3CFRA 4FJ8A 3DM2A 3DLBA 4W5QA 4K4IA 1N5YA 1S9FA 4RW8A 3OYBA 1K1SA 3Q8SB 3H40A 1IKYA 4KV8A 4RW9A 2ZTEA 5HNKA 4K8XA 4YFKA 2E6LA 2BANA 2VA8A 2ZTDA 2R8HA 5J2HA 3TWHA 1J54A 2W9BA 4YMNA 4UBBA 1VSKA 3HM9A 4UB5A 4I9QA 3RBEA 5BPCA 1RDCA 3OYAA 3JPSA 4KLEA 3ZDEA 1JLBA 2HHSA 3ISNC 4YNQA 3OS1A 2IA6A 2BGGA 3UXPA 1NK0A 1ZBIA 4Z4GA 4FZXC 1Z25A 4UAWA 2FLLA 2Q0ZX 3LZIA 5CA7A 5EOZA 4ZTJA 1KTQA 4CK3A 8ICNA 4HUFA 4E7KA 1WNSA 2ZQBA 4L8RB 3QERA 3OY9A 9ICUA 3DLKA 4I28A 5D3GA 1LWEA 4GXJA 5EU7A 4OKJA 4IG3A 3JPRA 4CF1A 2J6TA 3I0SA 1X9MA 3KKSA 4M3TA 4F50A 2AQ0A 4M2YA 4M0AA 5IIMA 5DQHA 2BKEA 5IILA 1HUZA 3RJFA 3ETLA 4F5RA 1KVAA 3KLHA 4FLWA 3EWAA 4CJ5A 4CHOA 2DTUA 1HYZA 3SPYA 3K59A 3RB3A 3ZDAA 4AHCA 1QSLA 5DQIA 3Q8LA 4KLFA 1T8EA 2IHMA 4MFCA 3MAQA 3H7IA 1S1TA 4M6WB 4FLVA 1RT2A 3ZSWA 3PY8A 2WOMA 1LAWA 3IS9A 4Z4CA 4B9LA 1BIUA 2KZMA 4B9MA 2YNIA 8ICWA 9ICTA 3G6VA 2PY5A 2IHNA 3L2UA 3QO9A 2ISOA 2Z1JA 3ZD8A 3T5JA 4TQRA 4FLZA 3K58A 2IMWP 3UPQA 3VQ9A 1ZBLA 4R66A 4NLGA 4CHPA 2P5GA 5KFFA 1RT3A 1S1XA 4DU4A 4DSFA 4MEYA 1U45A 5KFZA 2VA2A 4GC6A 4YN4A 5KFGA 5JS2A 4DEZA 3JPOA 4KI6A 3SPZA 4KLOA 2NRZA 1EETA 1UAXA 4B3OA 4UAYA 4I2BA 1J9AA 3LP1A 3SQ0A 4QWAA 4AHRA 3MBYA 3H08A 3SQ1A 7ICVA 3NH1A 1NJZA 5J29A 3UXNA 4J9QA 1SL0A 3AVJA 4BGDA 4DTMA 5JUMA 2UVRA 9ICNA 4O0IA 4LD0A 4CEOA 1LWCA 3BJYA 1ZQUA 2B4JA 3NFAA 2BCSA 1MQ2A 3M8PA 3G6YA 2ATQA 1C6VA 1XHXA 5CYQA 1JL2A 5DDMA 3BGRA 3SQ2A 4RUCA 4YD2A 4KLDA 3KLGA 3NAEA 1SV5A 3LK9A 3S3MA 4C8NA 4EBDA 3LANA 3RMBA 2LSNA 4J2DA 8ICCA 4EP4A 2P51A 4HUGA 3ZT3A 2FMPA 3Q8RB 3AO3A 4CFCA 4KPYA 4PWDA 4OPJA 4FJNA 4NCAA 4RPYA 1WLJA 3V6DA 3H4DA 7ICPA 4KHQA 4DMNA 3G10A 4CHZA 5IIIA 5KFUA 4FK4A 3V9XA 5KG3A 5D46A 3RMAA 2F1IA 1WAFA 4CJ4A 7ICFA 2BPCA 1SKRA 3T19A 1SL1A 3LPUA 4CESA 5EWFA 4Z4EA 1ZQVA 3DRPA 1WSGA 5JS1A 4FJ5A 2D0AA 4RPZA 4DSEA 1LV5A 4TSXA 3EW9A 3THVA 3OYFA 2XY5A 1BVSA 2VANA 1ZBHA 4I2GA 2WONA 4J2AA 3PX4A 8ICBA 2XY8A 4Z4HA 4CF8A 2KFZA 4BXOA 8ICYA 3MR3A 2HVIA 4RQ0A 4B9VA 4JWMA 7ICOA 4O5BA 3RJJA 1VRTA 2P1JA 1SKWA 1XWLA 2AGPA 1ZQOA 1D9FA 2R8IA 1VRUA 4B9NA 8ICZA 4DL2A 4KLIA 4JK1A 3RR7A 1NK7A 2YNGA 9ICCA 5DBCA 5C24A 5J2CA 1UA1A 3P83D 4DU1A 1RZTA 1ZQAA 2ASLA 4JS5A 1L3UA 1D8YA 4N41A 4KHWA 3BQ2A 4ED3A 8ICGA 4DSIA 3NTUA 4CK2A 2VWJA 4CGIA 2JEIA 5HRPA 4H4MA 4FZYA 3QEVA 3VQ6A 4BDYA 4O5CA 4C8MA 2G8KA 3KK2A 4BACA 1ZQWA 5J0XA 3PX6A 3KD5E 3HVTA 1LWFA 4KO0A 4F5QA 5DG7A 1I3AA 2X6SA 1KSPA 4CFBA 3HSTB 2R8JA 5CYMA 3H4BA 1C1CA 1RBUA 3ISDA 1YVUA 4BE1A 2BCUA 2D0CA 1Z26A 2ZTCA 4IRKA 3PNCA 4KLMA 4FJ7A 1Q8IA 3DRSA 4B08A 3WNGA 3L3UA 4E7IA 3RBDA 4EBCA 1S1WA 3GIKA 4KN4A 4K4GA 7ICSA 4AHSA 5KFIA 5KG7A 1YT3A 2A1SA 4KHUA 3GV7B 1RT4A 3AVIA 4DL5A 4GW6A 3T5LA 5J2BA 3PW0A 2I1QA 4PGYA 3VQDA 3RMCA 4JS4A 4E19A 3TAMA 4Z6DA 3JSMA 3K57A 1HUOA 3KKRA 1TAQA 3QEIA 2KQ2A 1S10A 4IG0A 4R64A 2AU0A 5IINA 5D49A 2C28A 1XSLA 1Q9YA 5L1KA 1J53A 5DKWA 5KG1A 5KG0A 5HRRA 4ED6A 4N47A 5CB1A 4CEZA 4Z6FA 3T5KA 1ZQDA 4MFFA 2C22A 3TABA 5J2AA 4CECA 3B0XA 3QEXA 3V6HA 1S0NA 3CFOA 4G3IA 2VG5A 4PHPA 4RNNA 2AGQA 4LZDA 3GIJA 2OYQA 4PH5A 3DOKA 3AVBA 2D0BA 3V1QA 3RH6A 5KFDA 4M9NA 3DI6A 1X1PA 1QHTA 1S0VA 3L2RA 4BDPA 3B0YA 4JRQA 3ULDA 3ZSQA 4J9NA 2VG7A 3AVKA 4N5SA 4AH9A 2P5OA 3ZT4A 4DFPA 3QLHA 2YV0X 4CE9A 2VA3A 1YTUA 2P6UA 1GOAA 4DL6A 3RAQA 3CG7A 3OJUA 4DS4A 1HRHA 2E6MA 2G8WA 5KFWA 4FJJA 4DL3A 4I2PA 2ISPA 4RT2A 1EP4A 4CJ3A 4Q8EA 1RTJA 4BE2A 1JXLA 5J2PA 2W9MA 4M04A 3OJSA 4FS1A 4F2RA 3EZ5A 3PW2A 3SUPA 2PI4A 1ZQFA 1ASUA 8ICRA 2HNYA 4CJKA 4P4PA 4QWEA 3RB4A 5J0UA 4KLGA 5KFOA 4E1MA 1RPLA 5KFRA 2YHBA 1TKDA 1XI1A 4QZ9A 2Z1IA 4BE0A 3S3NA 8ICIA 4O9MA 4NLNA 8ICSA 4Q8FA 1W9HA 4PUOA 2NRTA 2W8KA 4RQ6A 1IKXA 4EYHB 2IOCA 4F4WA 3CYMA 4PHDA 1HNIA 2C2RA 3SV4A 1TV6A 3RJGA 1ZQTA 2MUTA 3LP3A 4KLHA 2Z1GA 1C0UA 3HVRA 2QKBA 8ICKA 3OS0A 4DSLA 4OKKA 2PFOA 2KFNA 1JLAA 4DFKA 2PZSA 5KFPA 3TFRA 4F5PA 3TAQA 1S9GA 3QETA 4I2FA 3C95A 3D0PA 4NYNA 2H5XA 4R8UA 9ICGA 3KJVA 1NK8A 8ICVA 4QZCA 3RH4A 4IRDA 2DPIA 4BXOB 1XO1A 4RT3A 4QW8A 3LWLA 1DOQA 3PR5B 3IM1A 1TV9A 3OYCA 4FLXA 4ED7A 1KVBA 4MQ3A 4Z6CA 1BCMA 3ZSVA 5J2EA 7ICHA 2YNFA 3O4NA 1O1WA 3FYHA 3ZSZA 4CJTA 4HCBA 1N56A 1A76A 5L1IA 1MQ3A 4M47A 2HNZA 4FBTA 5FROA 3WNEA 9ICLA 2PFNA 2G8HA 4JWNA 3BQ0A 2HMIA 3AO1A 1RYSA 4OPKA 2FBVA 1Z3EB 1XHZA 3F9KA 3OYDA 3RMDA 2QK9A 1TKTA 3JPPA 3LP0A 4CGGA 4F92B 4YR2A 1NK4A 1B9DA 1XSNA 4KFBA 2KZZA 1BPYA 2YHAA 4HCCA 4PY5A 3HK2A 3I8DA 2HHTA 1KCFA 8ICUA 4RW6A 3MFHA 5KT6A 4DO9A 2HB5A 1H38A 3NH2A 1RT5A 4OKEA 4ZHRA 3L2WA 3TAPA 4ECTA 3S3OA 4O0JA 4CEQA 4DWIA 2XCPA 3TAEA 2BPGA 4F3TA 5DBBA 4IFVA 4I2JA 4P4OA 4B8AB 2XHBA 4E7LA 3V9UA 3WNHA 4IFYA 3RR8A 1DGSA 3V6JA 4NM1A 1CLQA 1C1AA 3JPNA 2PYJA 4F5NA 3BDPA 5HMLA 5J0PA 4FJHA 9ICIA 2OPQA 5D4BA 1U4BA 2R7YA 1F21A 3AUOA 4Z4FA 4QAGA 3OGUA 4FVMA 4EBEA 1JL1A 1BCOA 2F1HA 4J9OA 4ZH4A 7ICQA 5FRMA 5KFLA 3T3FA 3K4GA 4B9TA 5E41A 4CEBA 3FDSA 3C5FA 4M3ZA 2IAJA 3O3FA 4RW7A 4M3YA 4DTOA 4WE1A 3KHGA 3VQ7A 4QW9A 5HRSA 5DDYA 3V9WA 4DQIA 5T7BA 2F8TA 1TGOA 4KKOA 1Z00B 4GMJB 2I9GA 2HHWA 4RQ8A 3A2FA 3ZSXA 2BDPA 3MXMA 1QE1A 3C2KA 2GBZA 4I2CA 9ICXA 4NCGA 4CJQA 1X2IA 2NRVA 3KLIA 1NJWA 1FKPA 4CK1A 1LAVA 4DFJA 4KLQA 3K2PA 2ZJ8A 5KFEA 2JZBB 2PFQA 4F2SA 4CJEA 4F4KA 3FFIA 3QEWA 1EXQA 3HT3A 1R0AA 1C0MA 5BOMA 2FMQA 3IRXA 1HJRA 3JYTA 1GOBA 4NLZA 4R63A 1C0TA 4PPXA 3LDAA 1IXRA 4QZIA 3NBPA 3Q8PB 3OSNA 3EYZA 4DLEA 4LSLA 3M8QA 4ECZA 4YQWA 4DS5A 1ASWA 2BE2A 3MEDA 3UXOA 9ICFA 4ED8A 4X5VA 3MABA 1VSLA 2G8FA 2BR0A 3VQ8A 2QXFA 3HL8A 4RNOA 1L3SA 5DLFA 4M9HA 3ASMA 4CHYA 1K1QA 4IQTA 1RT7A 1RTIA 1V9PA 3V7KA 2XC9A 7ICTA 1IKWA 8ICTA 3NH0A 1ZJNA 4C8OA 3NGIA 2ITGA 3M9OB 4O3RA 1ASVA 5L9XA 1CXQA 1JN3A 4NM2A 4ECYA 2OZMA 3AO5A 5KFQA 9ICBA 5SWMA 1T03A 1CEZA 1LB2B 4DG1A 3QESA 4CEEA 4FLUA 5KFBA 4C8LA 3CM6A 3ITHA 4M3WA 4E1NA 3CQ8A 3PW5A 5KRSA 4I2AA 4DQQA 3C2LA 1FKOA 2MUTB 3LZJA 3U3GA 4HTUA 3NGYA 9ICSA 3NHGA 4BWJA 4NLKA 4M41A 3HJFA 4CGFA 4W5RA 3K5OA 2OA8A 5J2QA 4KITB 1BHLA 2NUBA 3CM5A 1L5UA 1UA0A 2FLPA 2F96A 4QZAA 1ZQJA 4M45A 1S1UA 4NYFA 3CFPA 1RBRA 2F1JA 4J9MA 1S77D 3KLEA 8ICFA 3JPTA 3O3GA 1XU4A 4I2IA 4C8KA 4JUZA 1RT6A 5CWRA 1B43A 1IM4A 3QINA 3MDAA 4DOAA 1CZBA 2OZSA 4TURA 4H8KA 3MFIA 9ICHA 1ZQRA 2JEFA 5J2NA 3VN5A 2RN2A 3E01A 5CJ7A 4AILC 1C7YA 3LALA 2BGWA 4H4OA 3KHRA 3SUQA 2W9BB 2O4IA 4CF2A 3C2MA 2BCQA 2DPJA 4XA5A 5HROA 3RB0A 1ZQNA 4CJUA 3ZDBA 3AVCA 3DLGA 1JMSA 1ZQEA 4RU9A 4CEFA 4RW4A 1KRPA 3AO2A 1NOMA 3IG1A 1L3TA 2IBKA 5TZVA 1HYVA 3HP6A 4EZ6A 3TAGA 4NCBA 3AA5X 4J2BA 3IAYA 1IH7A 1U04A 3P5JA 3GQCA 1ZQXA 4F3OA 5SZTA 4KTWA 5DBAA 2P6RA 1RXWA 5KFKA 1BGXT 1ZQYA 5KFMA 4KLSA 2B5JA 1T7PA 4RG8A 3MDCA 4MFAA 1S9EA 3L2QA 4F4XA 3C1ZA 2FPKA 3ISCA 5HP4A 3C6TA 2F8SA 4IQWA 4UBCA 4ID5A 3V9SA 4M3RA 7ICMA 3V81A 4GLXA 1N48A 2XY6A 3NCIA 3TAFA 2J6SA 4KLLA 1KDHA 2BHNA 8ICMA 1JXBA 1HYSA 2XGPA 1N6QA 3DOLA 4HYKA 1NOZA 1RDAA 4RPXA 1HJPA 4KMUA 3AA3A 1S1VA 1JLEA 3ZSYA 4IRCA 3RTVA 2J6UA 4CJFA 2R8GA 4FW2A 3PVXA 3K5LA 4YMMA 1I39A 4YR0A 5CZ2A 3GV5B 4RNMA 2ZE2A 3VA3A 2FBXA 2B6AA 2IGIA 2O4GA 2BCRA 1ZQLA 4QZHA 3ISBA 4O3OA 5KI6A 2MAXA 3N4MB 4RZRA 1A5VA 4OLBA 3F73A 3T5HA 2DFHA 3LP2A 4TUPA 4CCHA 3MGIA 5DQGA 4PHEA 2FC0A 3V7JA 1Q9XA 2ASJA 3NGZA 4ED0A 4DTNA 4LH4A 2OWOA 4R5PA 1KEJA 4EZ9A 1TVAA 3OSPA 4FJGA 2XCAA 2HNDA 3RJHA 4XRHA 4Q5VA 5J0TA 1X9SA 3PMNA 3LAKA 4DSJA 5HHIA 4TUSA 5J1EA 4CFDA 4RQ5A 4O5KA 9ICKA 5J2KA 3PO4A 2XGQA 5CZ1A 1YTAA 1U9LA 2YKNA 5KTQA 1ZQKA 3NE6A 1IO2A 1REVA 1KFSA 5K14A 2P66A 4LH5A 1TL1A 4YXMA 4Y1DA 3L3VA 3WNFA 4J9RA 1U47A 3ZT2A 3C94A 3RRHA 4OLAA 4GVMA 3UQ0A 4KN7A 1BPZA 4JRPA 1FXXA 1XSPA 3UIQA 4FJ9A 2OPRA 1TKZA 2QKKA 5BOLA 3HPGA 1D9DA 3TFSA 3K5MA 1JLQA 4E7HA 5J2MA 2PFPA 1B22A 2JEGA 1EXNA 4DFMA 3HW8A 4DTJA 4YXJA 4CF9A 5KG5A 8ICXA 3C5GA 5DLGA 7ICGA 4YD1A 4ID1A 1JXEA 7ICKA 1QQCA 5C5JA 3MEEA 3SQ4A 2C2EA 1HQEA 2GV9A 2JGUA 3PUFA 1L3VA 4W5TA 4FW1A 1QSYA 5HHHA 3HO1A 2FPMA 3PX0A 2HHVA 1G15A 3SJJA 1RTDA 5KFJA 3GIMA 4CEDA 4KHNA 3TQ1A 3KK3A 1ZYQA 4PQUA 5DB9A 3QNNA 1TVRA 1HPZA 1NKCA 3AO4A 2V9WA 7ICUA 4HVJA 1KLNA 1NK9A 4UB1A 2FBYA 2G8VA 2BCVA 1ZQCA 4RQ1A 2PXIA 5FDLA 1S76D 4EP5A 4I7FA 2HHUA 4ECRA 3ORYA 2W8LA 1QSSA 3OVNA 2DFLA 3VQBA 3C6UA 3VQCA 4FJIA 4B9UA 2HHQA 3AVGA 3V7LA 4IR9A 2Y1IA 4DF4A 4E3SA 4R65A 4KRFA 1NJYA 2RF2A 4FJLA 1XS9D 9ICEA 3UQ2A 4M9JA 4DQRA 4UB3A 5KG4A 3GIIA 1KFTA 5HBMA 3NDKA 3S9HA 4J9SA 5CHGA 2XRIA 2FPLA 5CY4A 8ICOA 2PI5A 1WSEA 3MXJA 4JLHA 1GOCA 2WTFA 1HNVA 7ICLA 2PYLA 4IR1A 2UVVA 5KT4A 1NK5A 1ZQIA 4RUAA 2XY7A 4FYDA 4KHSA 1DTTA 3TR8A 1WAJA 4EYIB 9ICOA 1C1BA 3MECA 4NXZA 4KTQA 1VSEA 2AJQA 4CJVA 4FBUA 4DU3A 1IKVA 5KFSA 4YCXA 4QWBA 4ECXA 4XUSA 7ICEA 3AV9A 3M9NB 3O3HA 1RTHA 4GXIA 3ZSRA 4XIUA 4KB1A 4O3SA 4Q0BA 1VSMA 3RJIA 2FLNA 1S0MA 9ICVA 4DTPA 4FLTA 3GDXA 1T3NA 3GV8B 1NOYA 2OPSA 1LW0A 3OYNA 2XO7A 3L8BA 4CF0A 1S5JA 4ELTA 3QE9Y 2C2DA 4QZEA 3AVFA 1RNHA 4M9GA 5HMMA 3MR5A 2ETJA 3OYLA 4DQSA 3VQ4A 5KFHA 3V72A 2HW3A 1BPEA 2V4QA 2Y1JA 4NY8A 3MEGA 2OPPA 1JX4A 3DLEA 4AHVA 2R8KA 4IQVA 3C21A 5J0OA 3B6OA 3QIOA 3HWTA 3G0ZA 2E4LA 1BI4A 2FBTA 5EWGA 5J2DA 2DFFA 4CIFA 2ZUDA 4FLYA 2UVUA 3SV3A 3KLFA 5KT2A 4KAZA 4M3UA 3H8WA 3DLRA 1RBTA 1NKEA 1ZBUA 1SZPA 2A1JA 5J0YA 1DLOA 2ZUBA 3H8SA 3EY1A 3DRRA 4YP3A 3Q8MA 4K4HA 4YFUA
chains in the Genus database with same CATH superfamily
3QATA 1WCNA 1VQYA 4P4MA 1XMBA 2QWQA 2X6NA 4CGZA 1TUWA 2IA0A 1SV0C 1HBNA 2MXYA 3AQOA 3K75D 3W2VA 3TZYA 4FXDA 4CZMA 2QX0A 3UDCA 1NBEB 4ILMA 2DR8A 2AP6A 2AZ1A 2QFJA 4Y1CA 4ED1A 2M8HA 3B54A 3HKZD 5B0GA 3U7JA 3KFUF 2E8AA 3AA2A 2HNDB 4IQUA 2H5EA 2B21A 5CD4H 1F9HA 1X7VA 1KFDA 1FWLA 4G1QA 2EK1A 4X84A 4RQ3A 2DHXA 4NWBA 2YKOA 2HCFA 3IFRA 3M6KA 5K14B 4JHDB 2GGPB 4PGQA 2E2PA 2OSQA 3OHBA 3ZEUB 2HVHA 1KQFB 5KFAA 2E8MA 3V4IA 1ELOA 5E2QA 1XNSA 1EKEA 3G8SA 2CGJA 3IP0A 4RCHA 1WF0A 2KKPA 2IDOA 3LO3A 1NZPA 2QSWA 4WIIA 1RTZA 5G4DA 3OL9A 2HMPA 3ZT0A 4J9PA 2WHEA 2KVIA 2CXEA 3A0BU 4PYDA 4Q43A 2M9NA 3HVAA 3GFKB 4PHAA 4ISFA 2GQCA 4LUBA 3JTOA 2CGLA 5KRTA 2EWHA 3V2UC 4FJXA 3I0RA 2KSOB 4NPOA 3CDUA 4DPUA 5BRFA 3BGUA 1TU0B 5BR8J 5L8RC 2JGAA 1AXQA 9ICMA 2P9NA 1IUJA 1V3ZA 5AK5A 3PW7A 2FGOA 5ALFA 2CPJA 3Q2TC 2L9DA 2F3JA 1X9WA 1RA6A 1FJGJ 2XMUA 2YY3A 2Q0UA 4KH1B 2CJXB 4J9VA 3SZ2A 4DL7A 4LMZA 1XNRF 1T05A 2E9ZA 4PGXA 1ZQQA 4PQUB 1SI9A 3PMLA 2C2NA 8ICLA 1J5OA 4LVSA 2CPDA 1Q81O 5DM6L 4AT1B 2BE9B 4JP8A 4GVLA 3PRBA 4IDKA 3OL7A 1N8RO 2H4YB 4UAUA 2EXUA 3DMJA 4A8XA 1X60A 2IRUA 2P5VA 5IC6B 4WK3A 2M2BA 1WOSA 1VQPN 4O23A 2BKOA 1IBLJ 3K5PA 3WZ0A 1WELA 1FKAF 5DMRA 4A2BA 3D67A 4KJIA 1YBAA 2ALZA 1QCKA 1S6PA 4KLTA 4ZPWR 1UWBA 4OJRA 1C0GA 4LRAA 3WKCA 2XYHB 4GO5X 1PVQA 4MH8A 3CJ8A 1DT9A 9ICWA 1QS4A 3TOQA 2JRSA 1MU2A 4P2HA 2X78A 2LVWA 2ZGZA 4QJVA 4ZTFA 1EWRA 2F63A 1AW0A 2Q36A 2KB2A 2HBYB 4XQ8A 4I2QA 4ECWA 1XC9A 2RPIA 1UJ6A 1SH0A 1G4CA 1T6DA 4KH0B 3MECB 2IVFB 4LSNA 1E6YA 2ZOFA 1KKXA 3CO9A 2DFEA 4O44A 1IKVB 1S72N 5A0LA 3NXZA 1BWEA 2D9OA 3R7BB 4I27A 1SAZA 5DG9A 5A6WA 3R3TA 1ZQBA 4CDGA 2EW9A 3LWMA 3IHQB 2PKEA 3C14B 5I4MA 1RI7A 3FC9A 4NZ0A 4M3XA 1IBKK 5JU5A 2E7VA 5KG6A 4YG2A 4TKTA 4BWMA 1NB2A 1VK0A 1RT5B 1N5WA 4YMOA 4QQBA 5FLXU 4H5NA 1EZZB 3BM7A 3SSSA 5I3UA 4NL9A 3SCXA 1RWKB 4IBNA 3OYIA 4O5FA 4B1XB 2P9LA 3GDQA 1DBDA 1RSCA 2OPPB 2HVDA 9RUBA 2N1RA 3H2LA 1N34J 2XEXA 2H9ZA 3QFUA 4XDDA 3ZSOA 4ZP8A 3QGGA 1CULA 2NO4A 4QWDA 5KGXA 1B92A 2RHQB 2CQ2A 4BRNA 1VBXA 1UFKA 2DY1A 1TELA 2ALYB 3RWUA 3KLFB 2J4RA 4F93B 3N7PD 1M0SA 1SQFA 5GINA 5DGAA 3DNCA 1QAJA 1F3FA 1LK7A 1U2CA 5F9LA 2RDJA 1UEVA 2VUGA 1XERA 2MJUA 4RR5A 3ZDDA 2QA2A 1TUYA 1UFWA 2DISA 2BKPA 3VHQA 2CQ1A 4KKOB 1ILYA 3UQSA 3L9ZA 2GA7A 4K2XA 4PA1A 3R2DJ 2WAQD 3DGPB 1XMOK 5B0CA 4DOCA 7ICIA 1BNOA 1HBMB 2GV1A 5LMNJ 4W5OA 4ZVOB 4ZN3A 3J81O 4QS9A 4R0EA 4PZOA 3QFHA 2GJIA 1RT1A 2AGOA 2MZJA 5B7WA 1F3VA 2Z1HA 1DXSA 2BQUA 4PXEA 4P0PA 2C3UA 2RUGA 3JPQA 2QE5A 3UKRA 2ACYA 1C0TB 9ICJA 5EWEA 4HACA 2E5GA 4ZCLA 4DQPA 1KHWA 4AP9A 3P4IA 2GJ2A 4CIEA 4FM2A 1HNWK 4DTRA 3ZDCA 4JI7K 1M1HA 4IOBA 2BQ3A 1B3TA 2X74A 2GZOA 5C42A 4F4YA 3RG6A 2ZXHA 2E1CA 2VKQA 3BREA 2RHFA 1YJTA 4CLTA 3DLLL 2V0NA 3Q89A 4U7UD 2HWHA 5DDRC 1RWPB 2VICA 3K8WA 4MJKA 1HMVA 4JI0F 2ZVIA 4PKGA 5J2IA 1O13A 4OX9K 4B3TK 5D0EA 5E3CA 4DR4J 3VQAA 4FCYA 4ICLA 1DKGD 5IIOA 3FNNA 4ZIWA 1L7MA 3JSBA 3G25A 1HWJA 2V8PA 5IQQA 4Y00A 3L2VA 3AY0A 5C2FA 5CR4A 1IBMK 2F4VK 4CH7A 4K7QA 3R97A 5F41A 1AUDA 1RU1A 2CNOB 3AFGA 3AVAA 3NMUA 1TK5A 1NMEB 4NRTA 2HMXA 1VBZA 1URNA 4LQ9A 4DTSA 4OYOA 5J2QB 5AQIA 3H1VX 1UAWA 4E89A 4CI0B 4J03A 3OXLA 4LRCA 5JVGQ 4W90B 4AFFA 1EX4A 4DV7J 3ZI4A 3MN7A 3B4MA 4F8RA 3BV8A 2LXFA 3QYYA 4AHUA 1VBKA 1TAMA 4DTUA 2PT0A 1ATNA 4D3HA 1ZJMA 5HL7L 2Q2RA 4JYAF 1VJ5A 4ANDA 4C98A 4FJ8A 2FTRA 2ZHAA 2YQEA 3E01B 3CCES 5AKIA 3QX7A 2IRXA 3D6RA 1S9FA 3G86A 2AJ2A 3C7NA 4JI8K 5AK6A 4CO3A 2UV8G 4KV8A 3UB5A 3DLGB 2ZTEA 3H25A 3MPDA 2BANA 4DV5F 2KRRA 4A8QA 3MN6A 4HDGA 4YMNA 4ES3A 3AB2B 4DUZK 3K0SA 5K8MA 4MAKA 4DCJB 4I9QA 3RBEA 3V4MA 4JK8A 4JI1F 3MPYA 1Q7LB 2YB1A 3O1WA 2FQQB 2QL7B 4XAKA 4OI6A 2J0XA 4CO2A 4A8YA 3UXPA 1ZM2A 4LF6K 2IVOA 2EZZA 5AIBA 1Z25A 3AD8C 2Q0ZX 4DR5J 5EOZA 4ZTJA 4CK3A 8ICNA 3K8VA 1WNSA 3BKFA 4QOTA 1SC1B 2AA4A 2APOA 1LQ9A 1WKKA 2KG5A 2K8BB 1LWEA 5EUHA 1EJ7L 4IG3A 1WUDA 5AICA 3H46O 3JPRA 2C1EB 2ZDPA 3I0SA 1ZAWA 4M3TA 2AQ0A 3SAHA 2HFSA 1LW2B 2MKHA 3HKZC 2E9TA 3CDAA 4F5RA 1S7HA 5G0RB 3KLHA 3EWAA 2DNNA 1HNZF 4CHOA 2MY7A 3MTJA 3K59A 1NU4A 4CJ7A 4QIFA 1KLMB 2P9SB 4DUYF 4AHCA 3ZYYX 1QSLA 2IHMA 5AZIB 4MFCA 1FEEA 4FF1A 3QSYB 3IS9A 3LP2B 1PYOB 5HMXA 4Z4CA 4O3MA 2DEJA 1DK3A 1FDAA 4FPIA 9ICTA 2XHWA 5HL7Q 4PRFA 2Z1JA 2UUCJ 4FP9A 2IMWP 4A62A 2VC1A 2JFDA 3UPQA 3VQ9A 5AQLA 1N36J 5KFFA 2VOOA 4MK9A 4ISEA 1VISA 3CQYA 1I5OB 1T9WA 4F7VA 4QS7A 3HOTA 5J8YA 4X62F 4BROA 5KFGA 4R0JA 4DEZA 3JPOA 3HKZF 2V6AA 4P0QB 2LCWA 1NHVA 3DAWA 4KLOA 4DR6J 2QWLA 4FF3A 4AL6A 3O5BA 2P9PB 2BJ8A 5E26A 2FC8A 1YI2S 4QWAA 2DO4A 4WFAQ 4X66K 3SQ1A 2VFRA 2OSRA 2J9DE 1B7YB 5DS7A 1R6YA 4NI2B 3MWTA 1FFGB 1RWMB 2LPEA 3FCWA 3NUQA 2QEXN 4L3KA 3DRXA 3SQGA 3BJYA 1ZQUA 4LF9K 3NFAA 2NO5A 3CCRS 2EFGA 1RTDB 3JQKA 3GR1A 4UY85 3WK4A 2NZ4A 1M5OC 4KPCA 1C6VA 3UNGC 2ILZA 2Q79A 3GFZA 1K0TA 2M88A 1N5SA 4A57A 1RM6C 3O80A 1SV5A 3LK9A 4K5RA 3NGRA 3S3MA 2R3VA 2WVBA 3KKAC 3LANA 2V63A 4J2DA 4OL8A 8ICCA 2FF3B 5HI7A 4ZLNA 2P51A 4PWDA 3AO3A 4CFCA 2AF6A 2ZJRL 4FJNA 3EE9A 1IV8A 2QYGA 4C1NK 1XR5A 2YWEA 3VF0B 5KFUA 2J0SD 4BVPA 5B5EU 5EE3A 2Y8YA 5D46A 3BS7A 3NOCA 2N3OA 3T1YK 4A2AA 3IM8A 3FZHA 2FVPA 3I96A 2MKKA 4CJ4A 1KN5A 3T19A 4WPAA 4Y2SA 2KLAA 3VGLA 3M2UB 1PYTA 4ZPDA 5G5HA 4FSVA 2L9WA 1WSGA 1U2FA 4FJ5A 1UCNA 1YUWA 3THVA 4UUXA 2VANA 5ALWA 4GFJA 2Z2YB 3R27A 8ICBA 3OFHA 5F3ZA 1ITPA 1UFLA 2KYZA 4LJMA 1WBBA 1NPPA 4JV5K 3CJ7A 4OYWA 2KFZA 4DCPB 3UFCX 2Q1LA 3VQSA 7ICOA 3HFVA 1N5YB 3E8OA 2Z58B 4O5BA 3RJJA 1DY3A 1WC4A 2A5XA 1FVQA 1I94J 4JI3J 1YIJN 3ATUA 1XWLA 3CCSS 3H8MA 3J80U 4B9NA 4RW9B 5AI5A 4DL2A 3RR7A 1NK7A 4UB8U 4GMKA 4FYYB 2OMLA 5DBCA 3IAM9 3IBFB 5J2CA 3P83D 3ZTOA 4U9RA 1I3OB 1RTHB 3CULA 3OTCA 2ASLA 4HTLA 4JS5A 1L3UA 1HA1A 3HZGA 1SB3C 3NTUA 4EK2A 5AKYA 4OI3A 3BO3A 1NGAA 2KJVA 3L09A 3MD1A 1Y3KA 2FUG9 1XN9A 3HKWA 3J81j 3PX6A 2LI6A 4KO0A 3ADAC 3R7SB 3OVSA 2X6SA 2F65A 2R8JA 5CYMA 1VQ6N 2RMLA 3H4BA 1C1CA 5E84A 3QNMA 4BE1A 4K43A 3OBIA 1DZ5A 1VLYA 5A8WB 2KKVA 1KQGB 2ZJRQ 4M63C 4B08A 3WNGA 2WAQC 1H0HB 3PYGA 3CD7A 1QH9A 3UM9A 3BO4A 1WNEA 1RAGB 1D8BA 4KN4A 1WG5A 4MYTA 4YDDB 2R7VA 1KEKA 3T1HJ 4DR7F 4ILRA 4AF1A 3CCZA 3CDWA 3MM6B 4HH1A 2I1QA 1IWAA 1RFQA 3QB0A 4GKKF 4C48A 2RQKA 1YJNN 3H42A 4JS4A 3OUYA 5HR6A 2YNIB 4QU7A 3TSQA 2O8FA 1KN6A 1S59A 1RABB 3KKRA 1COKA 3H1QA 1HW9A 3B78A 1M1KO 5D49A 1ZAVA 4P71A 2G08A 1GTHA 1Q9YA 1VQ5S 1J53A 2BTFA 5TKYA 4X64J 1RDUA 3KD3A 5CB1A 4CEZA 4Z6FA 3T5KA 1YZ7A 4GVBB 5EHHA 4IOAQ 4DR3K 3QEXA 4G3IA 3K9JA 1RWUA 1K47A 4AL5A 1BG3A 3CF5Q 3R1LA 1VHFA 5D4LA 2AGQA 2D8CA 1FWKA 5ALLA 4TXSA 5LSLA 4OZNA 1GO3F 4AQYJ 2WAQF 2CPZA 1B0PA 3JTNA 2GGPA 1YLXA 3WKEA 5F3TA 2VBWA 4BDPA 3B0YA 3ULDA 1ZRMA 4J9UE 1RYUA 2VG7A 1VC0A 2OM6A 2LDYA 3LP1B 3L6QA 4U96A 3CJ2A 2P5OA 3ALRA 2UXBJ 2KU7A 4UT4A 4DFPA 4GIBA 4DR1F 3A5OC 1J6ZA 5KPZA 2P6UA 3RAQA 3CG7A 3OJUA 4DS4A 3W9HA 2E6MA 1VQON 2CJBA 4N8NA 3BQ7A 2ISPA 4BRFA 3ZZYA 3US5A 1RTJA 4DU8A 4LR7A 1JXLA 2KSOA 4M04A 4FFDA 3CCQN 2A6AA 2V8VA 3EZ5A 3FE1A 4DV4J 3A0HU 8ICRA 4AXJA 3KLGB 1KL9A 1HFEL 5DDOC 3RB4A 1R8PA 4KLGA 1XI1A 2W7OA 3FEYB 4QZ9A 1GLCG 3FZLA 3FEXB 2RD5C 1YBTA 3S3NA 8ICIA 3V6DB 1Z05A 2XI9A 2O8EB 4O9MA 4NLNA 4XO0A 2NRTA 4IKAA 3ENHA 4BR0A 2XWYA 2AYGA 1Z4OA 5F0WA 2ERRA 4BX9C 4WCEQ 4KHPK 1VYAA 1RWOB 1T3VA 1W2BM 3HVRA 2EDUA 3BP8A 2A3ZA 1ZS6A 2PFOA 2DR5A 1JLAA 3DYAB 2ZG6A 4KBOA 2WF9A 5E33A 2I5JB 3WU2U 2H3FA 3TFRA 2QTDA 3LM9A 3MCPA 3TAQA 4I2FA 1FHTA 3KJFB 4NYNA 2ZXIA 2DR7A 3KK1B 3KJVA 5HO4A 1NK8A 3MM7A 4IOXA 3FRYA 2WONB 3WC0A 1OY6A 5HAOA 3FBBA 2DNYA 4J7CA 1UHUA 3MM5B 3MMBB 4BXOB 4XDCA 3RFAA 1WTBA 4JKDA 4BVOA 4FOEA 3LWLA 2FSJA 2WTUA 4I6MA 4Z2XA 3IM1A 3DCAA 1VLBA 5A2QY 4PG4A 1VRTB 4CLLA 2KHDA 3Q23A 3UMGA 4B3RK 4KC5A 1XR7A 3O4NA 2A2DA 2YNHB 1Q53A 2D0OA 4MMOA 3ZZTA 2HSTA 3R8YA 4M47A 4JI5F 4RNHA 4M7XA 4F4AA 4K4WA 3S7RA 3MR7A 1Q82T 1PCAA 3MWBA 2KG1A 1KAXA 4EAHD 2G8HA 2RLTA 1FX2A 4RQNA 4B3SK 1UZDA 3AAWB 5B8HA 4LR9A 2D3DA 2HKEA 2XVTA 5AM2A 2QK9A 4CGGA 2WF5A 4H4MB 3LVWA 4YR2A 4EEKA 1IBCB 1ACMB 3HHLD 3CJ9A 4QJFB 4HCCA 1JCGA 3ZLJA 3MAHA 1CJTB 1UW4A 3UE2A 4FWPA 8ICUA 3TVYA 5KT6A 4CTAB 1H38A 1YJ7A 4DQ8A 5AQSA 1RT5A 3IP4B 4ECTA 3M6UA 3M32A 8AT1B 3TAEA 1NSPA 2C3MA 3OTOF 1PAEX 5DBBA 2NZCA 4J91A 2BJDA 2UUTA 3DRSB 4P4OA 4DXLA 2XHBA 1YJWN 3P39A 4E7LA 3ENOA 4LF7F 1KD1O 3RR8A 2EQYA 2DXFA 4DCOB 4CZLA 2VIHA 4CLYA 2GVZA 1HKCA 5J0PA 2XQCA 5D4BA 3TA0A 2WF7A 4Z4FA 4OI2A 2K1RB 2WSCC 3OGUA 2CQ3A 4EBEA 1JL1A 2EFOA 4J9OA 4ZH4A 2CDQA 3JSMB 3MMAA 3T3FA 4B9TA 3QSIA 2NPFA 2V8HA 2IAJA 3NNAA 3BEXA 3O3FA 1JLFB 4RWXA 4M3YA 1BLUA 4DTOA 2ZZNA 1MMLA 2DNHA 1D9AA 2MRLA 4I68A 5DDYA 5T7BA 3THYB 1TGOA 4KKOA 1Z00B 2EEYA 2N82B 4GMJB 4RQ8A 1RAHB 4G1PA 2BDPA 3A2FA 3FUYA 4DI6A 3C2KA 3A1YG 2KE7A 4NCGA 4FE3A 2NRVA 4RNFA 3HHDA 2MLYA 1TYQA 1H98A 1NJWA 1FKPA 4JKHA 1HBMA 1WHYA 2NYIA 3DI6B 4F2SA 2B4PA 1RXOB 2QLXA 2A1BA 1UVMA 5J1PA 1HJRA 3C46A 2K8CB 1PC4A 1C0TA 1IXRA 1YQHA 3NEKA 3D0IE 1E3MA 2WVDA 3MEDA 1LWXA 9ICFA 5ALRA 4I2PB 3MABA 2W40A 1VSLA 2VC0A 1FO4A 2HBMA 3D7EO 1VQ8S 2QXFA 4NLCA 2P9KB 4C7ZA 1FX4A 3B82A 4USJC 3ASMA 4CHYA 1FJEB 3PCOB 1JJ4A 4IQTA 5JICA 3V7KA 2MMYA 2XC9A 1YWXA 7ICTA 4ZVUB 2ASYA 2LECA 1JQGA 3NH0A 4C8OA 5HJYA 3KWMA 3M9OB 4P73A 1JN3A 2PMZC 2FY1A 2GOLA 4ECYA 1L6NA 1VQLN 1BWFO 3ATVA 3VAIA 1CEZA 2MSSA 2B7BB 3D6MB 4WTOB 3QESA 4FLUA 3D2NA 1FK9B 4FYWB 2O8BA 3CM6A 2W2OP 3FZBA 1UPMB 1IBKF 1HNXK 3TUJC 3PW5A 4I2AA 4MLEA 4DQQA 4U8YA 3LZJA 2HBJA 1VQKS 3U3GA 4WU3A 4HTUA 1ATSA 2HQ3A 4OJ1A 1IR2A 4M41A 2GWJA 2DHGA 4CGFA 2ROGA 5J2QA 4KITB 2NUBA 2FLPA 2F96A 2W2QP 3ZZOA 1J97A 1KS2A 5IZHA 2ZITA 3CFPA 2MEWA 1RBRA 1JNRB 1GNKA 5A2QO 4Q7AA 2DL0A 2OTLS 3O3GA 3DM2B 2Z56B 4YDUC 4I2IA 2CJQA 1IM4A 3QINA 2NREA 3MDAA 1CZBA 4H0XB 3O3LA 4RQMA 4IQMA 4ANCA 3VN5A 3E01A 5CJ7A 5JMVA 1H73A 3ENBA 2VKZG 4NEZA 3R5BA 1ZRNA 5AQUA 1SJFA 4BLGA 4H4OA 3KHRA 2QB0B 2QO3A 2KXNB 2HBQB 5EVZA 3IFEA 1HWKA 4CP5A 4CJUA 3P31A 3A8KA 3AVCA 3DLGA 1ZQEA 5A8KA 4RU9A 3PM9A 2ZH9A 1NWKA 3MHYA 5D8HB 3BBBA 1PJ6A 3VEOA 1WUAA 2IBKA 4K41A 4I67A 3VAJA 1U1RA 4P2MA 4EZ6A 1Q5VA 4DHVA 1RWVB 4TU9A 4NLRA 1WD6A 1M90O 3IAYA 3I56N 1E6VB 3CCLN 1RB0A 1BGXT 4OZ0A 2BJ9A 4YB5A 1T7PA 5AHXA 2D1KA 5GVQA 3RW6A 1ED1A 1VC5A 6FD1A 2FSKA 4MFAA 3MM9A 4PHTX 1WC6A 1LXNA 4UBCA 3V9SA 4M3RA 1W2IA 1Q8KA 3QJPA 2W4PA 2J6SA 5GAEI 8ICMA 2MSNA 1H2UX 5KOWA 2XGPA 1N6QA 2EC2A 4BJQA 1CQNA 1OJ4A 1RE1B 3MX2A 4NRUA 1RDAA 4IO9L 3BS5A 3IR6B 3AA3A 5JXSA 3M30B 3LDOA 1A0OB 1WJ9A 4HVZA 3ZSYA 4DV1J 1HNWF 4JI7F 3MMJA 4TU7A 2J6UA 1Y5LB 2NNWA 3O9UA 4FW2A 2BX6A 3PJ9A 3K5LA 1FW6A 4FNHA 1V5IB 1KQSM 3GV5B 4RNMA 3VA3A 4LFAK 2O4GA 1ZQLA 3O1BA 4MK7A 2KT2A 2P9SA 3KBBA 1OH7A 2MAXA 4PKDB 4RZRA 3RU0A 5AZIA 4OLBA 3VTHA 5BRDA 2MTLA 1BOTO 5L1MA 1FNXH 3LP2A 2DFHA 2JFKA 4TUPA 1SH2A 4OX9F 3MGIA 1VI7A 2Q31A 3BUZB 3A4TA 1Q9XA 2ASJA 3NNHA 3NGZA 4ED0A 1Q8LA 4YORA 4DTNA 2JC0A 2OWOA 1GXLA 4EZ9A 4NE9C 2QC3A 3RJHA 2D6FC 3SEOA 3LAKA 4DSJA 1NGIA 4RQ5A 4WFYA 2F4VF 5J2KA 1G7CB 5K20B 2CRXA 1ZQKA 3A13A 1KFSA 2COLA 3L3VA 1EETB 4J9RA 4B3OB 3C94A 2ZBPA 1X42A 3TACB 2LFVA 5D78A 4JI6K 4GVMA 4YHHK 2GS8A 4Z7YA 1ZTWA 1PVRA 2HQCA 3DDHA 3IRXB 4P0QA 1T95A 4JRPA 1FXXA 3UIQA 2E3TA 1MWYA 2OPRA 4DKWA 2F76X 2CQDA 2V9KA 5B0AA 2BM0A 1D9DA 3TFSA 3EEQA 3L3FX 4ERDA 1O0PA 5JJBA 1B22A 2BE2B 4X65F 4YXJA 4KQZA 3RJMB 4DDFA 3G8QA 3SMZA 7ICGA 1SV0A 2YX6A 4K42A 3O6QA 5IT4A 1QQCA 4NI2A 5AQNA 2FJ6A 1BY9A 1WSVA 2GO7A 1RT7B 4JI8F 3C66A 4Y2VA 4CO1A 2KP7A 2FPMA 2HHVA 5ALGA 2D3UA 3SJJA 1RTDA 3KMQA 3GIMA 4A8SA 3A8IA 2IM1A 5ADZA 4C80A 3KK3A 4DUZF 4NO7A 1VQMS 1VQ9S 3AY9A 1U2VB 1NKCA 1XNRJ 3AO4A 2D3ZA 1T9YA 1XTZA 2QWNA 2ZIVA 3W61A 1UCVA 4OJPA 4ZA1A 1FKOB 4OHZA 3QAEA 4ETXA 4RQ1A 2ZC4A 1IR1A 2HBZB 1S76D 4U67Q 4I7FA 2HHUA 4FPBA 1Z2LA 1QSSA 2MZTA 3DRPB 1J5EJ 1H1VA 2DFLA 4KIAA 2R7OA 3VQCA 2MU2A 3W5XA 1S1UB 2HAIA 4DF4A 1N61A 3KLEB 2QA4G 1BU6O 5IS2A 2XTJP 1NO8A 1SQGA 3M2UA 1NJYA 5BJRA 3CVKA 5BR8K 1XS9D 5JMNA 2D0PA 4AUKA 3EM1A 3QRRA 1KFTA 3HHLC 5D4PA 1G6BA 2EVZA 3I5AA 1ZAXA 4CO0A 5CY4A 3CXCR 2PI5A 4JLHA 3P8BB 1GOCA 2YNGB 2C2OB 5KT4A 1ZQIA 2E88A 3CDEA 5C24B 4FYDA 4KHSA 1DTTA 3EICA 1Y10A 3LDPA 1WAJA 3U27A 4C8YA 5ALSA 4DPOA 1H72C 2VBYA 3VOVA 3RRKA 3V5RA 2DRAA 1BA0A 4DU3A 1BHNA 2IBOA 4YCXA 2FYXA 4XUSA 2NSCA 3AV9A 1RTHA 4GXIA 1QM9A 3E9PA 2ZH7A 3OLBA 4KB1A 1M5PC 1X5TA 4WXOA 4LFCJ 4FZMA 5GMEA 4B9QA 1VSMA 2LBOA 2V8GA 3LH2S 2U1AA 1RHQB 4ES1A 1VQPS 4IWVA 3VERA 4CI6A 9ICVA 4OI0A 4A47A 4KRWA 3GV8B 3HOSA 1NDPA 4XPCA 2OPSA 2ZF5O 2RRNA 4LFBK 4NJ8A 3FJ2A 3C6TB 4MO5A 4ELTA 4QZEA 1HHSA 2JH3A 2CPRA 3MR5A 2ETJA 4DQSA 5KFHA 3FZKA 1IXKA 4DCHA 2BDUA 1WEXA 2V4QA 5F0XA 3DDKA 3W8PA 2Y1JA 2ZIUB 4NY8A 3MEGA 3W9IA 4UW2A 1FWPA 2AXTU 2VFUA 3MX5A 5J0OA 3QIOA 3HWTA 5LMUK 4ZJOA 3TKAA 1WSRA 4X66F 1BI4A 3ISND 5J2DA 2MQOA 2DFFA 2UVUA 5MLCV 2I6XA 3NS6A 3QFWA 1SZPA 1S72S 2VPYB 1X4FA 4RBTA 5HMYA 2A0FB 2ZUBA 3SDEA 4ZMMA 1IG8A 5AK4A 2W24A 4TVAB 5C10A 1GX5A 2ZHOA 4ECUA 3LPEA 4UB6U 3PKYA 4OFZA 2ZJQQ 3IWXA 3DJCA 3LYSA 5DGBA 4OI1A 1RBSA 5D0HA 1KQKA 1FDDA 3EPGA 1YTYA 4FWMA 3SIPB 4GVBA 1CZAN 3QWPA 1U48A 1D4XA 1N34K 4O8UA 5HP1A 4IZ9A 2VFVA 2JJ4D 3W63A 3CJRA 5IIJA 4PABA 1U8SA 4WBFA 2EX3A 3O9RA 3R8EA 4H0TB 1NJIO 2XB2D 1HHQA 2AEFA 2NRHA 3TEGA 3TANA 2ZIXA 3QEAZ 1DARA 1SVDA 4OIXA 1NAQA 1F9FA 2XS7A 2FMSA 1HLUA 4E1JA 5LJVA 3CB4A 3THXB 3GG4A 4AHTA 1JLQB 2HZVA 5ADXH 5J2MB 2Q66A 5KGWA 4GC7A 3IV6A 4JV5F 1U1OA 4RUBA 2KIWA 2NSBA 2M3DA 3MF5A 4NMLA 3B6PA 2QM1A 4Q45A 3TI0A 2H4WB 2VONA 4CHNA 4MEXA 3POTB 1HQEB 1OH6A 3N97B 3KJQB 4CGJA 3VVTA 1BISA 4A5BA 2VFTA 4FM0A 4GV6A 2YJEA 1MMNA 3QIPA 3M8SA 4B8CA 3WK7A 4OVLA 2V2ZA 2HQDA 4JI0J 3ZZZA 8ATCB 2BA9A 2P9CA 3CCEN 5AJ3K 1TFRA 3GOIA 3HILA 4O3QA 3JAMY 4PUOB 4CH1A 4KGKA 1TVRB 2BQRA 4IH5A 5KFYA 2H54B 4BRGA 1RHUB 3IWLA 2JHDA 3OYEA 5ALKA 1BL3A 1RQLA 1HNIB 4G1IA 4RQ2A 4R79A 2FVRA 1JLGA 2EKYA 1PJ5A 1RAJA 4DX6A 1F0MA 4F0KA 2CQPA 2VQFJ 3GCWP 4WIQA 4AXIA 3NCQA 3VAGA 1S7IA 3QU2A 1KVCA 1RGIA 3CI5A 3LDNA 2DNGA 1ESVA 4R8UB 2BEFA 4KGXB 3M9MB 3MR6A 3DYAA 9ICPA 2DO0A 5CD4A 4NZ7A 2D5RA 1NPKA 2P9IA 2I5JA 3A5MC 1UT5A 4KMOB 2R2TA 3SCKE 3WIVA 2HBLA 3R9PA 4RPFA 4QIWD 4F72A 3KK1A 2E8PA 3MAAB 4ITSA 3OYGA 1JNZB 3MMBA 4HUEA 4KLUA 2JVOA 4F0HA 1PBUA 4MF2A 4NXNJ 4KGVB 2XNRA 2GC8A 2OP5A 1SXLA 3GILA 3QZ8A 4W5NA 3KUHA 2WBMA 1KOOA 2YNHA 1PK1B 3CTRA 4ZK7M 4UAZA 1Y97A 5F9NA 2E5SA 1XNQK 4DV5J 5ETTA 1RBVA 3EUNA 1RAFB 2KTQA 2WB1D 1WWUA 4JV1A 2YKMA 1E4GT 4CERA 4HL9A 1SL2A 2DD8S 1FD2A 2B4VA 4WKRA 3ALYA 3E9OA 1SUQA 5J2GA 4ED2A 1VDVA 1S8OA 3EN9A 3FKBA 4PYAA 4PXBA 5IM0B 3C3LA 1ZQZA 4O3PA 3EPIA 1CJTA 2KEYA 2IJRA 1X5PA 5B0DA 1AB8A 3JSYA 4DTXA 3NVZA 3C16B 2KZ3A 3A8YA 4N77A 4F36A 1ZETA 5KT3A 2G8UA 8ICJA 3ELHA 5KT7A 1MWQA 3C6AA 2IDLA 3GE9A 3U1MA 4FF2A 1AZSA 3MOJB 3T1AA 5EX5A 2R42A 1VSHA 4LY7A 4FS2A 2LEBA 2P6SA 3MR2A 2JEJA 1ZQGA 2KIVA 5B66U 5EN1A 2KHCA 8ICAA 3C19A 3H8JA 3QZ7A 3U9ZA 2ZBRA 4H03B 3OXFA 1HNZJ 5AQFA 5J0WA 4K8ZA 1B9FA 4F02A 3DRRB 4OZ2A 2YHWA 4QZFA 3OPKA 2I7PA 4UW9A 3TUZC 3NGDA 3HPOA 4RW7B 1HBNB 3SNNA 3U6FA 3W2VB 5AM1A 4RQ4A 2J9CA 2ITMA 2QSFA 1CJKB 5J2FA 3OQ2A 3DOMB 4ZITA 2PFFB 1OS5A 3CCRN 1GMVA 4I9LA 1JLFA 2A40A 4O5EA 1FEHA 2QA4S 4KTZA 2CDRB 4G6VB 2HI0A 8ICHA 1Z00A 5KFTA 2DCLA 5HMZA 2KN7A 4JV0A 1MSWD 4ZVTB 4CJLA 4B9SA 2JZ5A 1IJJA 4NMXA 3OHAA 4ECSA 1V5VA 3N01A 3ZNUA 5AQQA 4X62J 3JYTB 5ETMA 2WK4A 3MD3A 3TJAA 2GUIA 4ZVHA 2PIIA 2XLKA 4DL4A 4MKYA 8ICQA 1FRIA 1JK9B 3SYZA 2VG6A 2E1FA 3V6KA 2DJWA 2Q6BA 1FO1A 2HQGA 5H2FU 2K2PA 1Y5NB 3ZT1A 5J2JA 2RDIA 4FZZA 1F60B 3C8YA 2EKNA 1KR4A 1FRLA 4E8UA 4LSZB 3UCGA 4C3LA 8ICPA 4B1UB 2OKQA 3H0PA 2P9NB 3JAMO 3VCDA 3ZCMA 2P9KA 3VV2B 2FJBB 3KTQA 5AE3A 2OCEA 2A6OA 4Y2YA 2ZKUA 4B1VA 3UMCA 1COOA 3GJQB 4DZDA 4X4QA 1T05B 3GL1A 1UW9A 3SSRA 1KAYA 4B3SF 1CXUA 3LGHA 5BYSA 4DV3K 3NVWA 4M5MA 3EE8A 4ELVA 2VCPA 3U4LA 2VODA 2F44A 5M1PA 1WSFA 2IOFK 5THWA 4IDKB 3Q8QB 4ECVA 3WT0A 1N5TA 4DR2F 2B9XA 3K0JA 4M5LA 3DMJB 2BABA 4WFBL 1OY8A 4JI4K 3WXJA 1FK9A 1RISA 4L72B 3BKTA 3MCMA 5AXMA 3VQPA 4UATA 4YOXA 1FRHA 2DXDA 1VSIA 2MQMA 4O55A 2B9YA 2DNOA 2MQLA 1K44A 4I2DA 1VSJA 4TUQA 4KBIA 3H5YA 4K4YA 2XSJB 4QR1A 5GMKa 1W0HA 2F7VA 5L38A 4E0DA 3K5NA 5T41A 3TZXA 1X5SA 1NM1A 3D2FB 4DU7A 1UWBB 2DGUA 4MN4C 4I2EA 2O8CB 4ZLLA 4N8OA 5JRTA 2YMQA 1XMQJ 2GQ2A 4MKVA 3J7YI 3DM2A 3R9KA 5HMWA 4RW8A 4DV2K 3DHXA 4FPRA 2ZGYA 3KKAA 4YDXA 1K1SA 5AM5A 1MROA 3Q8SB 5HNKA 3Q2SC 4PEOA 4P9SA 4NLTA 2D3O1 2ZZMA 2E6LA 1QVFR 2VA8A 1HUXA 2LA6A 1H74A 2F8KA 2K3KA 2LQ5A 4LSNB 5J2HA 3TWHA 5ETVA 3THTA 1E6YB 4B3MJ 4JKFA 4O44B 3HM9A 3G4SS 1U8WA 4Y2RA 1RDCA 2CGKA 4KLEA 2MZRA 4NYOA 2W04A 1FE0A 4OX6A 2HHSA 2BUNA 3ISNC 3IBWA 3ICXA 3O9QA 3OS1A 3THPA 4DV6J 2QL5B 2BRLA 1IVZA 3DHWC 4CDIA 4UAWA 2MY8A 1T02A 2XZTB 2P9UB 1QDUB 2DEIA 3TJ8A 4HUFA 4E7KA 4OJLA 1QY7A 5I3UB 2ZQBA 2JV3A 4L8RB 1VQ5N 3C2PA 3OY9A 4M8LA 2B0GA 2A10A 9ICUA 2J7KA 1YHQN 4HT7A 4FPAA 2V4JA 5D3GA 2KOBA 4GXJA 5EU7A 5AQWA 1U0HB 2KICA 2J6TA 5K8OA 4F50A 1FIQA 3VC8A 1I94K 4ZJQA 3SAFA 2DIUA 3CE8A 4X4UA 1CBKA 1CULB 2BKEA 5IILA 2XO6A 1SXEA 3D3CJ 1NH8A 1KVAA 4FLWA 1V6HA 4CJ5A 1P8GA 5JVHL 1UWAA 2B6AB 3PYEA 4BR5A 4CE6A 4W98A 4WFBQ 1DGKN 3DV9A 2B43A 2G09A 5ALHA 3VR1A 1N88A 3MN5A 2UUBF 5AKKA 4EHTA 3PY8A 5ETKA 3H5UA 4BCAA 1PGZA 1BIUA 5DDPC 4PL7A 3MK6A 2NUHA 1NMDA 4A4JA 2BBEA 2PY5A 4OJOA 2ISOA 1ECWA 2GWKA 3ZD8A 3T5JA 1AT1B 2LEPA 2ZNYA 3WUHA 4FLZA 5J1EB 4JI1K 2JOQA 2QXLA 1ZBLA 4NLGA 4EX7A 3AAQA 4BG8A 4DU4A 1REVB 3M6WA 1P7DA 3T9NA 4DSFA 1Z2ZA 4PG7A 3CC2N 1HNXF 5LJ3Y 1U45A 4P72A 5KFZA 3UDEA 4M63A 1MA9B 4YN4A 4EO6A 1RT1B 5RUBA 3CMES 3H3NO 4KI6A 2CIMA 3ZZRA 1JCFA 4JKGB 3SPZA 4MT1A 4P0PB 2MQPA 1EETA 1UAXA 1MN9A 3AOAA 1TKZB 2H3VA 1W2BR 1N32J 4B3OA 2VJ4A 4UAYA 4HACB 3K9KA 4GRSA 1J9AA 3E66A 3MBYA 1KTVA 2M9KA 5EX0A 1NLVA 3VEXA 4ZPBA 3NH1A 3UXNA 1ROFA 1SL0A 2UXDJ 3MEEB 3CT9A 2KH9A 3GBTA 4DOZA 3PLAA 1YZ6A 2J7UA 1F6TA 4DR1J 2LKYA 3QIDA 4DUYK 2B4JA 3UD5A 2BCSA 1HMVB 5E0OA 3G6YA 2ATQA 3TTDA 2G5HB 2LYAA 4EWTA 1M6YA 3HMJG 2NXUA 2E8NA 3BGRA 4YD2A 1WKLA 5M1QA 3AOCA 3UPFA 2XYGB 3UMBA 2HBKA 4C8NA 3RMBA 1B0TA 3L4PA 4KPYA 3D2QA 4Q2LA 4OZ3A 4RPYA 4QIWC 1WLJA 4AQYK 4MKBA 7ICPA 3G10A 2G5IB 5IIIA 4F3QA 2HGMA 1EKRA 2FJAB 1W97L 3RMAA 2C3OA 4K4TA 3M8ZA 3CC4S 2LM4A 2HVEA 3AXKA 1LOUA 4ACOA 3D54A 1WAFA 4H5TA 1QZ6A 2AKWB 2PAVA 1YG0A 3BF4A 3H0MB 1Z1ZA 1SL1A 4OLPA 2KO1A 3LPUA 5EWFA 1ZQVA 3DRPA 2XWXA 4FOIA 4NYZA 4ZPCA 1FI4A 1OMSA 3EW9A 3GB0A 2XY5A 1BVSA 2CFXA 4WP9A 1ZBHA 2WB1C 3PJXA 2RQCA 2E20A 2XY8A 4Z4HA 3CCQS 3DFEA 3GG1A 4IC9A 3ZO7A 1JCEA 4DV4K 2HVIA 1CRXA 4Y0FA 2CNKB 3C7NB 4L6V3 4LFAF 2AGPA 2C2MB 1D9FA 4ZVSB 2R8IA 1VRUA 4KV8B 4QYZJ 4JK1A 2YNGA 2BANB 2V67A 1VCTA 2XS2A 4QIWF 1O5JA 2C3YA 5C24A 1FRJA 1UA1A 4UOGA 2NLXA 3UKUB 4DU1A 2ES6A 4NA1A 4JK7A 1X4GA 5ALZA 2K7JA 2RS2A 4X4RA 1NI3A 2M52A 3QUBA 1D8YA 4N41A 3WEEA 4K2JA 2QTWA 3AGKA 5F8IA 1Q86T 3LUYA 2VWJA 2JEIA 5HRPA 5AKEA 3NRBA 3VQ6A 4BDYA 1LW0B 4O5CA 3SQOP 2CQHA 2YKPA 1PYSB 1WI6A 1NGFA 3J7A1 1UVNA 3QBWA 3FGUA 1KVJA 4F5QA 2O8DA 5DG7A 4BR2A 1I3AA 1KSPA 3MGJA 2G1HA 2VDHA 2MKJA 1B4SA 3HSTB 2GHWA 2WB1F 2PEBA 4OHWA 3VF6A 3DLEB 4FF4A 1RBUA 1LWEB 4LF8K 2VQEF 2K4HA 4IG3B 5H9FK 1WC0A 3I0SB 1SJQA 1Y11A 4YHHF 5B0EA 2ZTCA 2WF8A 4IRKA 4CRJA 1FRKA 3IG5A 4FJ7A 5FPEA 4BS2A 1WTFA 2A18A 4LR8A 2ZWHA 2WBNA 3L3UA 2ZIUA 3R5CA 3RBDA 3AD9C 4Z37A 4X2BA 1Z19A 3KLHB 3N6LA 4USAA 1NNLA 4K4GA 4PZVA 3VGTA 4AHSA 2PMHA 5KFIA 1YT3A 4KHUA 5A8RB 2E2NA 1X0FA 2GHVC 1WOQA 1X8DA 1N8RT 3AVIA 3T5LA 1HIWA 1WI8A 3E58A 2RUSA 1YXQA 3VQDA 2BE7D 4E19A 3G82A 4NLSA 5CEHA 2XZWA 3K57A 3ZFVA 5AQTA 3ULEB 5GADI 2KQ2A 1S10A 2VJUA 1GTEA 2GO9A 1XSLA 3OFFA 4DV0K 1VQ8N 2X1AA 5B09A 5KG0A 4ED6A 4N47A 2E1EA 3TABA 4MFFA 2C22A 3VMFB 3B0XA 3V6HA 1VIOA 5AQPA 3OW2R 2AH5A 3GZFA 2JLFA 3DGVA 3PHTA 2UP1A 4PHPA 4RNNA 3PIPL 3LDLA 3VALA 4DZ6A 2N4CA 3DOKA 2LQ8A 4A8MP 1ZA1B 3GLJA 2F2AB 2I9SA 4PL8A 5KFDA 4DPXA 1X1PA 1QHTA 1S0VA 4J9NA 3ENQA 4N5SA 4FWQA 3QT6A 2D4WA 3ZT4A 4BGBA 2AW0A 4KHRA 1VQKN 2DR9A 5BR8F 3TU5A 1VLOA 4CE9A 2VA3A 2V2VA 4Y6IA 2F8LA 4DL6A 1UP1A 1T0TV 2CADA 1HRHA 4C0BA 2DPNA 3G87A 1FJGF 2RHKA 4RT2A 3TQEA 1C0FA 3NWGA 4DR7K 3QRQA 3PNIA 3BSOA 2YTUA 1R6VA 3N6NA 3OJSA 4GKKK 4CLKA 2CNLB 2RKIB 2Z4PA 3POTA 3M3ZA 2UXCJ 3HJEA 2RU3A 4BG9A 1SV5B 2DNZA 1TL4A 2BH1A 4P4PA 4H4KA 1YGYA 4RL1A 5FLXY 4LF2A 2W2NP 2VGMA 2YHBA 3PSPA 2H3QA 3W3SA 2Z1IA 4PWDB 2CQBA 1ZD5A 3SMPA 4BE0A 4TLQA 1S99A 1ZM9A 4PUOA 1S3XA 1W9HA 2W8KA 3IWNC 1IBLF 3BPDA 3CYMA 1HNIA 2Q43A 1TV6A 3RJGA 5LT5A 2FHJA 3MCSA 3LP3A 4KLHA 3CHWA 1C0UA 1HKAA 1T6CA 3R1XA 3TTCA 2QKBA 4U8VA 1IBKJ 4JKEA 1Q4RA 4H54A 4DSLA 4OKKA 1UQVA 2Z0GA 1EIYB 5KFPA 5IT9U 5H1SQ 2HIYA 2A41A 1S9GA 3LW5C 2WUSA 5DJBA 3C95A 2R2RA 3D0PA 2Z2LA 4R8UA 4MDAA 2MZSA 1QVGR 1QD1A 3CPWM 8ICVA 1R8BA 1RAIB 4MFBB 3RH4A 4NEYA 1XO1A 3PIPQ 4QW8A 1RACB 2CRLA 3SQIA 2AJFE 3GYNA 3FVYA 1TV9A 4IXCA 1MWZA 4FLXA 4ED7A 1KVBA 3MAAA 2DB1A 3LPYA 4KH5A 3ZSVA 7ICHA 2YNFA 4K4SA 4GY2B 2GW8A 1O1WA 2VZ9A 3JS6A 4AE5A 5L1IA 4EX6A 2HNZA 2FF6A 4FBTA 3CNQP 3WNEA 2E44A 2HMIA 3AO1A 1RYSA 4OPKA 2DGZA 4IYQA 4WWSA 5AQKA 1Z3EB 2W55A 2LU1A 2NUUG 3F9KA 1PK1A 4U7UK 4H5WA 3GCXP 2JWLA 5B0BA 4CBXA 1T9XA 4C6AA 5IXUA 2IVNA 1XSNA 4ES2A 2YHAA 5AQOA 3I8DA 1KCFA 3BR9A 4KO0B 4RW6A 2RRBA 3KLVA 3IAS9 1XMOJ 3IM9A 3MFHA 1N34F 4DO9A 3NH2A 2BKNA 1C1CB 4LRBA 4OKEA 1JI7A 4EELA 4ZHRA 3TAPA 5ELZA 2JH7A 2WFAA 1OQ6A 2XCPA 4F3TA 4IFVA 4CZFA 2R7SA 1VQNS 1WDDA 4NLQA 2YY6A 5HSPA 2PSZA 4CF4A 2DYAA 3ZZPA 1X0PA 4RWTA 2OANA 1DGSA 4U95A 2JNJA 1CLQA 3JPNA 2LM1A 4U7CA 1HNWJ 9ICIA 3UDVA 1NSAA 4JI7J 3TX0A 3C15B 1PC5A 2V5HG 2V7ZA 5M1FA 1TE2A 2J0QD 2N3LA 3HJVA 3KUGA 4FZNA 2O8FB 1KC8O 7ICQA 2KK0A 4JI5K 4WU2A 3I56S 2FIUA 5E41A 3Q83A 3SCJE 2GAGC 2LDIA 1LKYB 4RW7A 5AJ3F 3FSIA 5E3PA 4OX9J 4B3TJ 4WQ5C 5HRSA 3V9WA 4DQIA 1U24A 4FZLA 4AM7A 1CJKA 2I9GA 3DOMA 3L4IA 3MXMA 2JXJA 9ICXA 4C4TA 1FA0A 2ZC3A 4TU8A 4CJQA 2AX1A 2DHHA 2AWZA 3BB5A 3J7AP 1IBMJ 4X4OA 2OEMA 2F4VJ 1VQMN 1VQ9N 3K2PA 4CJEA 3KHYA 4Z94A 3FFIA 1P9YA 3QEWA 1EXQA 3R6MA 3HT3A 1R0AA 1C0MA 1F2HA 2FMQA 2VG7B 3JYTA 3ZZUA 3OTOK 3PSFA 2YKQA 4R63A 4PPXA 1XEZA 3OSNA 3M8QA 4ECZA 1B7FA 4YQWA 3HBTA 4LF7K 1KP6A 3HX9A 1ASWA 1V9OA 4X5VA 1Q8BA 4DR4F 2V68A 2MLZA 2JH1A 1BQMB 1EWQA 2G8FA 2BR0A 5HJXA 3SSQA 1RTJB 2PMWA 5KAIU 5ETPA 4NA2A 2AEMA 5FLXO 3Q8VA 5AK3A 1RDFA 1K1QA 3OVAA 1BWVA 5I3PA 3G8TA 4KX3A 2B8QA 3F56A 4FWRA 2KHOA 4NA3A 4JI8J 1ZJNA 1N0UA 2BW2A 2N4DA 4LBPA 2AD9A 5L9XA 3UVJB 3I4HX 1XNQF 2Y1RI 2YMLA 2PBDA 2D69A 1C2PA 3AO5A 2J8AA 4DUZJ 3J8AA 3NCPA 5KFBA 5KL8B 4C8LA 3QDKA 1L7NA 2FD2A 3ITHA 4BR4A 4M3WA 3TA2A 4OV1A 2HEKA 1SB6A 3KG4A 1R8HA 4WK1A 4DV7F 5E7OB 4LF4J 4QIVA 5F1XA 3NHGA 2YQ1A 2MZQA 2EAMA 3WKAA 4NLKA 2EANA 4LF6J 3KWGA 5CYJA 1JLAB 4QZAA 1JRPA 2W41A 2O3DA 3EWGA 3M2VA 3KJVB 3MM7B 3D6FB 3K17A 5K5MA 5AKXA 1XU4A 2XSJA 1GXTA 4HHHA 3WX8A 1QUVA 4JUZA 5CWRA 3HT0A 4DX5A 3D2FA 4ILHA 3WIUA 5C15A 2L48A 4I6MB 2A1AA 2O8CA 3C0BA 2OZSA 2QI2A 4K59A 1IKYB 2N7YA 4CH0S 5JLHA 2EC0A 3DKDA 4JBCA 1RGVA 3BSAA 2HOEA 2QMXA 1GLBG 3LALA 5FPNA 3Q7BA 2W9BB 1S22A 2O4IA 4NLPA 1W7AA 4TYAA 4DPWA 4XEIA 3TWZA 4CEFA 1P1TA 4JAXA 4RW4A 4YUDA 4HEA9 1KRPA 1JLBB 1U6BA 3ID6A 4HHUA 1NOMA 2G0JA 4KE5A 5TZVA 3FBFA 1HYVA 5CZXA 1X5OA 4DR5F 3EX7B 3TAGA 3E0FA 5FPDA 1IM6A 3TZWA 3G96A 3AA5X 1S12A 1J5EK 1U04A 1ZQXA 5DBAA 2P6RA 1HI0P 4TY8A 3VAFA 5DZ7A 2C3PA 2D41A 3QBXA 3F44A 3MDCA 2EBGA 2RILA 3C1ZA 2HZAA 2FPKA 3ISCA 3DLKB 5F8JA 2GX9A 1HWUA 1FJ7A 3UW1A 2P9UA 5EGYA 1GH8A 3CRXA 3M32B 1VC6A 2XY6A 2DH7A 4OV6A 1HYSA 2BHNA 1JXBA 1AFJA 4NXMJ 2B6GA 2AYBA 2W6KA 4Y2CA 1YVNA 4P2FA 4RPXA 1HJPA 1CJUA 4KMUA 1U0HA 3WQPA 4LF1A 1S1VA 5LXYA 3D6HB 3RTVA 3KMSA 3CXCM 2KFYA 2Q3PA 3BR8A 2WW8A 4YMMA 3GZ7A 2GVZB 2H5IB 2WOMB 3AXMA 2CA9A 4FYVB 2ZE2A 5CZ2A 4X66J 2B6AA 2IGIA 2BCRA 4QZHA 4O3OA 4GV3A 1HI1A 3E1YA 2UUCF 5E3RA 3MDQA 2ZBCA 4ZLPA 3F73A 2P9GA 3MMAB 4LFCK 3LOUA 1FEZA 4LF9J 2AJ1A 3QO9B 2AJ4A 2IAJB 5DQGA 4NL5A 4GKJK 2GUPA 2PEHA 4HH0A 1IWGA 5JVGL 2G0IA 1BNPA 2IPOB 3O8WA 1TVAA 3OSPA 4DV3F 4XRHA 4Q5VA 1X9SA 5J1EA 4TUSA 3ZX2A 4Y0WA 1KVKA 4DR6F 5AQXA 3L7PA 3C6HA 3JS9A 5CZ1A 4NCGB 3R5GA 1YTAA 2YKNA 5KTQA 4IJNA 2HQFA 3NE6A 1FTCA 2HQIA 1TYQB 1FNOA 2XBPA 4JKAA 1REVA 1FKPB 1RHRB 4JI4F 2EAOA 2K4PA 2P66A 4LH5A 1TL1A 2B51A 2U2FA 2HWTA 4MLHA 4JEPA 1U47A 3ZT2A 3O08A 1Q0NA 3RRHA 1ZTTA 1JJ2M 3T1YJ 1HKGA 4KN7A 2YTCA 4JKGA 2R7WA 1XSPA 3W2WB 2HRUA 1NXIA 3J80Y 2RJZA 1M5SA 2DGVA 1N0VC 2BMBA 4EI2A 3TSPA 3BS9A 1TKZA 2WVEA 2CXYA 4JNEA 5BOLA 5A76A 2DWQA 2K06A 2DNRA 3ULHA 2HDOA 2Z7JA 1TZ0A 1BC6A 2PFPA 2JEGA 1EXNA 3MEDB 3HW8A 7FDRA 2MB0B 3NGSA 5KG5A 8ICXA 5DLGA 2CG4A 5ETRA 4ID1A 7ICKA 5IWAK 3MEEA 5CYQB 3SQ4A 2YCHA 4DV2F 2QT7A 2F7TA 1L3VA 3MUVP 2HBRB 3WK8A 1QSYA 3GWCA 3GYGA 3GP9A 2HFVA 4CYUA 1L8OA 4CEDA 3F5TA 4QNLA 4NX9A 1U09A 2UUAK 1B0XA 1QHAA 3GFYA 2CZ9A 5DB9A 5AZJA 1VR6A 3VGKA 1FE4A 1HPZA 2GAHC 2V9WA 7ICUA 4HVJA 2RQMA 4UB1A 2KM8B 3D0HE 3LF0A 2O8BB 4I56A 4U7BA 1FT8A 3FBCA 4WXWA 1ZD2P 2RDDA 4X4SA 5FDLA 4Y2UA 1A6LA 4ECRA 2W8LA 3VZHA 2E8OA 3NL0A 4ZN1A 2ZEJA 4FJIA 1OW5A 2B4UA 5CHIA 4B9UA 4IR9A 2Y1IA 2CVEA 4EUVA 2KD1A 1M1KT 3CJ3A 4KRFA 2NS1B 1I94F 2OHFA 2YKAA 4JI3F 9ICEA 1RHKB 4QPXA 3SCIE 4M9JA 5KG4A 3HSJA 1Y9OA 2DGWA 3FM9A 3BDEA 4K50A 5AI4A 4PWUA 3R5AA 5CHGA 1FJCA 2FPLA 3W3DA 3NDKA 4X65K 4TLRA 1WSEA 2PFDA 3NS5A 3U26A 2UVVA 1NK5A 3HVWA 1VIXA 3KKFA 3ZTQA 4H4OB 1AYEA 3OR1B 4EYIB 2P35A 1RCOB 1C1BA 4MDBA 2LQBA 3EDQB 2DITA 5A8KB 2ESEA 3FZMA 5L39A 2HHHK 4KR0B 1VDHA 1LXJA 4FXVA 4WYBA 1SV4A 1U26A 2F9WA 4QWBA 2VPZB 7ICEA 1NDKA 4C11A 3UKUA 1HIYA 1YAGA 3ZSRA 1Q1KA 1WC1A 5A0YB 2OD6A 5HVHA 4ED4A 3RJIA 1SC3B 4WFAL 5K8PA 4DTPA 3GDXA 4GV9A 4FKYA 2AMCB 2EBEA 1NOYA 1LW0A 3L8BA 3WBZA 3MM9B 3I28A 1S5JA 2OO4A 4DR3J 3WXIA 3QE9Y 3BY5A 2DKZA 1RHJB 2R18A 1CLFA 3L3CA 3VQ4A 2NR0A 1N5VA 2W4CA 2QLJB 2VPWB 1BPEA 3GONA 2E2OA 4CLPA 4EHUA 2QA4N 1N6QB 3N6MA 3DLEA 4LREA 3T1HF 2R8KA 3BS5B 3MI7X 1SPBP 4IQVA 3ID8A 1I51B 1MNEA 3B6OA 4ISGA 2RIJA 2J7WA 2VASA 1RWWB 4P7VA 3SV3A 4YOWA 4L3NA 2NXNA 3S6EA 3Q24A 3H8WA 2A1JA 5A8RA 3WQTA 3H8SA 3EY1A 5LY3A 3D0GE 4OZ1A 4YP3A 3HSZA 3Q8MA 3CSKA 2HS4A 1Q46A 4IG0B 3PSIA 4F91B 3EZWA 3VGSA 4FO6A 2NYVA 3OBYA 2L3MA 1Y00A 3ULEA 4TQSA 2W03A 3BZQA 3O2IA 3NS7B 4OQJA 5EX3A 5D4NA 1K73T 4AQYF 1E4FT 5AQZA 4BDZA 1WWHA 2NXJA 4W4MA 1D8LA 2IFXA 3NGUA 1O08A 1WC5A 3G6EN 3AQEA 4QCLA 1O8BA 2FVSA 3AVMA 3J80O 2W9CA 3B8HA 3UN2A 1X4HA 3BZKA 1VQ7N 4KHPJ 3D7SB 1HEKA 4UB2A 1JKHA 4FWKA 3QEBZ 1RKJA 3EL2A 3C1YA 1SQKA 3M1YA 2V50A 3AVLA 2OPRB 3QLHB 1F5AA 3H0LB 3CC7S 4LBIA 4LZGA 3MMCA 9ICRA 3MDFA 3W7BA 5FP0A 5F8HA 3MOZA 4CVNE 3V1RA 3PZPA 3F53A 1HWLA 3NF9A 4DV4F 2CVIA 3N79A 2WW4A 3VQ5A 4DPTA 4M42A 5CP2A 3CQXA 3LAMA 3VPZA 2AX0A 2F77X 4USVA 3WX4A 4JN4A 4DOBA 3MPUB 3QMQA 4B3RJ 1A5XA 1XIQA 5AFUH 2IYIA 2RKIA 5FRNA 3MC1A 5DB7A 1HR0J 2Q4TA 2ZH3A 4CGDA 3BQ1A 3KK3B 4DLGA 4I4BA 3LDSA 1ZBFA 1OVYA 3AU2A 1QUPA 3FGVA 1QQOA 5KT5A 2WRMA 1Q7YO 2OTJS 2IM2A 1IKXB 1QTMA 3AARA 4X4VA 1RDBA 1TR0A 2ZIVB 4F25A 4B3SJ 1KD1T 3MURP 3SI8A 3EO3A 3PJWA 3KYLA 1FRMA 3PEJA 2Y9TA 2IC3A 4J2EA 2OELA 1RHMB 3KIOA 3G4SN 4I7FB 1H2TZ 3RRGA 1UT8A 4BRQA 3OYHA 1ZQMA 5ETLA 1APSA 3W9JA 3VETA 4Q44A 2G8IA 2ZUGA 1FVSA 4I2HA 4LF8F 2G4BA 2XG8A 1K6YA 1JMTA 2CG8A 1W25A 2YQ0A 1YX2A 4I29A 2MSTA 3NMRA 3TARA 4K4VA 4FKXA 5C25A 1ZBSA 9ICAA 3DXMB 4MFBA 4G9BA 4PKHA 1BPBA 5D0RA 4M94A 1S6QA 2BV3A 2R2SA 5KFVA 4Z4IA 4IOAL 4M95A 2W7PA 4CGHA 5H1SV 1BPXA 1DTTB 5DB6A 2GX8A 2QLTA 4CEAA 4MIBA 2CH6A 5HR7A 3CF5L 1NU0A 2B0CA 4ZOSA 1QAYA 4M5JA 4BRPA 5ADXA 1QAXA 2ASDA 2N7CA 4PG5A 4J9LA 1TKTB 4CO4A 1M5HA 4Y28C 1WSIA 1C20A 2GNKA 3M1FA 2KL8A 4DV0F 5E3QA 4KFBB 2WVCA 5BPMA 2HSEB 3GPAA 4Z6EA 4Y3CA 3HZEA 3SI6A 1WCLA 6AT1B 2ZDOA 3JXOA 3NF6A 5I42A 1SKSA 3NNCA 1CQMA 1TUUA 2OPSB 2AJ0A 5C2DA 3HD2A 1A5WA 3D2EA 2VWKA 3HRDD 2CUYA 2OHDA 3R6GB 5GAEU 5BPLA 5J0RA 5MLCQ 1XMQK 1IN0A 1UVIA 4P75A 3MEGB