3HT3A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus v713p mutant bound to g:dctp
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I, large fragment
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ht3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ht3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ht3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ht3A01
3JPTA 1WSEA 4F3TA 4QW8A 1WAFA 2JEGA 4RPYA 3I0RA 1RT4A 4E7LA 4J9MA 4BE2A 3HP9A 7ICJA 2ZUCA 4FM1A 4TURA 4NYNA 4O5BA 3OHBA 1UT8A 5J0RA 1ZQIA 4FJKA 1KLMA 4J9LA 4GC6A 3OSPA 1ASUA 3RH6A 2OZSA 4JUZA 5KFEA 8ICHA 3AVJA 4F2SA 1JXBA 2HHWA 4O3OA 4LZGA 4UAWA 8ICWA 4PHPA 2NRVA 3PW2A 1IKVA 3SNNA 3FFIA 1PZNA 4KTQA 3EPIA 1S0NA 5J0UA 1ZBHA 3HVRA 3QZ7A 4B9TA 3T5LA 3QIPA 2ASJA 1ZQFA 5KG4A 1S9EA 4IQVA 1CEZA 3K4GA 3NGDA 3NGIA 4FM0A 1ZQDA 4MEXA 3RBEA 1WSHA 3THVA 3O3GA 1S76D 2OA8A 4IQTA 5J0YA 3V1RA 2FPKA 5HHHA 5KG2A 2KQ2A 3PY8A 3UQ2A 3OJSA 3ITHA 3K5MA 1ZQJA 3H08A 3AVNA 3K5NA 3S9HA 1SKSA 3RTVA 4TUPA 4ZHRA 3PW0A 1Q9XA 3B0YA 4M9NA 8ICNA 4P4PA 1TL1A 4LZDA 2XCPA 3FYHA 1QQCA 1NK0A 3SQ4A 3QEBZ 2V4QA 4BGDA 1VSKA 4FK4A 3G6VA 8ICZA 2WTFA 5CYMA 1XC9A 5CYQA 2DFEA 5IIKA 1NKBA 2HHUA 4CIGA 1HUZA 4YR0A 3QLHA 1HJPA 4CHOA 1HJRA 3RAQA 2ETJA 1TK5A 2B21A 3ZDDA 2BPCA 3MEGA 2EX3A 1NJXA 4YXMA 1WAJA 1KFDA 8ICPA 5J0PA 4KLEA 1JLEA 4YFKA 1HMVA 4DQQA 1KEJA 4NLNA 1RT6A 2DTUA 1N6QA 1ZBUA 4RNMA 3PMLA 4CGDA 4DL3A 4Z6CA 2BGWA 2GV9A 4CJWA 1HPZA 4CK3A 4KLOA 4BDPA 3ZSVA 4E7JA 1IKWA 1FKPA 3SV4A 4CJTA 4Q0BA 3NAEA 2BHNA 4RQ6A 4UQGA 2BPFA 3TANA 5J2MA 3LWLA 2A1RA 2W8KA 3QEPA 5KRTA 4J9NA 2F1IA 3PUFA 5KT6A 2Z1IA 4CFDA 4AHSA 4FJJA 4IQWA 7ICMA 4DSKA 4EYHB 1X9SA 4F2RA 4CFAA 8ICQA 2IAJA 2J6SA 3GV5B 3B0XA 3C6TA 1UWBA 3V9ZA 4QW9A 5KGWA 1J5OA 3DOKA 2G8KA 8ICIA 4M3TA 2FPMA 5CA7A 4WE1A 3RWUA 4DFPA 3M9OB 3EZ5A 4EEYA 3ZSXA 4MFBA 3N4MB 2QKBA 4RUCA 2ATQA 4F4WA 2OPPA 4O5EA 3IHQB 2IGIA 2PFQA 2IA6A 2F1JA 4CK2A 3OYKA 3TAQA 4QZAA 5JUMA 4CJPA 3K57A 1XO1A 4ED3A 4OLAA 1C1BA 4DF8A 1T7PA 1ZQTA 7ICFA 4AHTA 3QEIA 3Q8QB 1A76A 5EU7A 8ICAA 1LAVA 3F73A 2Q0ZX 2V9WA 3PX6A 8ICGA 1VK0A 4PUOA 3PV8A 1G15A 1XI1A 4DFKA 3LPTA 1T05A 2FMPA 1SL1A 3HYFA 3MDAA 4QOZB 4KITB 4M04A 3RJJA 1K1QA 1JL1A 1Y88A 1NOMA 1NOYA 3LAMA 2HVHA 3MEDA 1L3SA 4FYDA 1CZBA 1JKHA 4OPJA 3AV9A 3HO1A 5J2FA 4F4KA 5FRMA 1JMSA 4IRKA 1U04A 3OGUA 4FJ9A 4RW4A 3RBDA 1L5UA 1RILA 4K4GA 3AVBA 4UB1A 3VQ7A 4RT2A 1DTTA 4MFCA 4DL4A 4KFBA 5DKWA 4RQ1A 4IRCA 4CGGA 2PI4A 2YKMA 1WCLA 3ZD8A 3T5JA 3AVKA 2YNIA 2VANA 1ZQYA 1WSGA 4FLWA 4BACA 1NK4A 4BWJA 5KT2A 4NM2A 8ICSA 4YMMA 4DMNA 3JPRA 4M47A 1T3NA 2AGOA 3OYJA 3KKRA 2FBVA 4HVJA 3RMDA 4EBCA 3LAKA 4YG2A 1NK5A 1QSYA 7ICIA 4FLXA 2E6LA 5DB6A 1FKOA 4F4XA 1B43A 3KD5E 1WSIA 4DTJA 3HJFA 4DQRA 4CEZA 1TVRA 4QZ8A 3BQ1A 5KFVA 1ZQWA 2ITGA 2YHBA 1HQUA 1EETA 5DBAA 1ZQKA 3AA3A 1VSHA 1BHLA 4M42A 1YTUA 4NXZA 3AO1A 3JPQA 4N56A 2W9BA 2XY5A 4YMNA 1IKXA 2PI5A 3OYFA 5CP2A 2HVIA 1S1VA 3ZT1A 2OWOA 1S0OA 2XY8A 1C1AA 4J9SA 4GXKA 3KHRA 3TI0A 4CJEA 4UBCA 4DTOA 3D45A 4L8RB 4QWDA 1IM4A 2J6TA 1ZQHA 5HLFA 1WCNA 4IKFA 3G6YA 4ECTA 3V6JA 4O9MA 4MF2A 4DOBA 3V9XA 4CJ3A 3Q8SB 4TUQA 1TV9A 3QETA 9ICIA 3KK1A 1BCOA 3DRPA 3C5FA 4DSLA 5HP1A 3G6XA 5KFGA 8ICOA 4IQUA 3K75D 1VSFA 5KT4A 3NDKA 4QWCA 4AHVA 5DQGA 3GIMA 2IS3A 2UVRA 3SUNA 1TGOA 2D0CA 3LPUA 3SUOA 4EZ9A 7ICNA 1EX4A 4FZYA 4K4IA 3TABA 5EWFA 4G3IA 1U4BA 4YD2A 2ZTCA 2IHNA 4J9OA 1NJZA 3M8SA 1R0AA 3H4DA 4ICLA 7ICSA 4J9QA 4I2JA 3QE9Y 2FLLA 5KFYA 4FM2A 4IR9A 4KLHA 1CUKA 1BL3A 1Z3EB 2Z1GA 1TVAA 3VQ6A 3H7IA 1KFSA 2G8FA 2ASLA 1S1UA 4DFMA 1RXWA 4DTNA 3V72A 2OPQA 2Z1HA 4FK0A 1LB2B 1C6VA 3V7LA 2W9AA 4B08A 3RMCA 5C24A 4IR1A 1FXXA 3ZDBA 3K2PA 3RB4A 4RQ4A 4XA5A 4GC7A 4JS4A 2ZUDA 4DTSA 4CESA 3AU6A 5K14A 2W9CA 4H4OA 3OYMA 8ICEA 4KTWA 4C8NA 5BPCA 4CFCA 3M9MB 2VWJA 3V9WA 4RW9A 5J2PA 9ICXA 1TKXA 5FROA 5J29A 8ICMA 4FS2A 2D0BA 3BGRA 3MR3A 2EHGA 4O0JA 2RF2A 4KLJA 3ETLA 3TAEA 1LW2A 3BJYA 1S1XA 4KMUA 1NK9A 4OGEA 4HCCA 1TKZA 2KN7A 3EW9A 1S97A 2IOCA 1SKRA 5SWMA 4ECXA 3LZJA 3KLIA 3PMNA 4FCYA 4CERA 1WNSA 2YNFA 1SUQA 2XY7A 1VSJA 4KB1A 2YKNA 4CEEA 5L9XA 1BGXT 3JSMA 3AVCA 4FW1A 5J2NA 4KHYA 5IIMA 3LP2A 5CR0A 5DBBA 3HM9A 3CFPA 3VA3A 5KFQA 1Y97A 1S0VA 4CJFA 1S9GA 4J2EA 3OYCA 3OYDA 3RH4A 1TKDA 2QKKA 1CLQA 3DLHA 7ICEA 1X1PA 1BPZA 4F5OA 2DFHA 2FMQA 5KFZA 4PPXA 1RT1A 2JEIA 1RTHA 1KCFA 2LSNA 4QZDA 4OKJA 9ICLA 1ZJMA 1D9DA 1QSLA 4FJ5A 3O3HA 5KG0A 7ICHA 2ZJ8A 1K6YA 4DU4A 5DGBA 2RDIA 3P5JA 2KW4A 4E0DA 3AA4A 3L8BA 1MC8A 3Q8LA 2IMWP 5KFRA 3MGIA 3TR8A 4DL7A 5KFSA 5CHGA 2ZJ5A 3WNFA 3ZT4A 2BE2A 3DLEA 4IFYA 4E1NA 2HHSA 2FLNA 3V1OA 3PVXA 5J0TA 1QE1A 3G10A 3TAPA 3QESA 2AU0A 3K58A 4QZEA 2WOMA 4AHUA 5KFWA 4IDKA 2OZMA 5KFKA 3OYBA 2W9CB 4FBTA 4DU3A 4QZCA 3DLKA 7ICGA 1KFTA 4DFJA 5HRPA 4GXIA 5J2EA 4BDZA 4N41A 5DBCA 3U6FA 3VQ9A 4KLTA 3QEVA 2VA3A 1EXNA 4PHEA 3AO4A 5KFIA 3RR7A 3JYTA 4R8UA 4F4YA 9ICEA 3F9KA 1SV5A 2JEJA 1RBRA 1DGSA 2I5JA 2VG6A 2BKEA 1BPYA 1C0UA 1DTQA 3L2WA 4F91B 4M9LA 4IRDA 5KTQA 4KPYA 2BPGA 1RTJA 1X2IA 3TQ1A 4CEFA 3RH5A 3U3GA 4RNNA 8ICLA 1RDAA 4KREA 4EBDA 3CFOA 1ZQUA 3RB0A 4B9NA 3QEWA 2G8IA 1JN3A 5KFOA 2ALZA 1BCMA 3LZIA 1ASVA 4KLUA 3DOLA 1UA1A 3OS1A 3EYZA 4O5KA 5L1LA 3OSNA 1D5AA 1KDHA 9ICWA 5J2HA 1T8EA 4RQ3A 4DTXA 4PGYA 1O1WA 5TZVA 3CG7A 3IG1A 1RDDA 4YR2A 1ZQNA 4FJIA 4O3PA 3G0ZA 3T5KA 3EY1A 1ZQQA 1ZQZA 4QZFA 3QEXA 3T3FA 1A5XA 1AROP 4C8KA 4FK2A 4FJMA 4KHQA 4LD0A 4ECZA 4FJ8A 5J2QA 3JPOA 3CYMA 4NLKA 4ELUA 5IILA 3K5LA 2NRTA 4PGQA 3C6UA 4Q43A 4CHZA 5BOLA 1ZQLA 4RNOA 3AO3A 5KFFA 4R66A 4F93B 3BDPA 5L1KA 1KVCA 3OHAA 4KLGA 1VRTA 4O44A 3ZDEA 2O4IA 1MQ3A 3B6PA 4IFVA 3H40A 5FDLA 1WSJA 5HRRA 3MGHA 4DQSA 4CECA 3K59A 4M45A 1HUOA 2KZMA 3AVLA 3S3OA 5SZTA 3T1AA 3ZD9A 1JLFA 1X9MA 4Z6FA 1HYVA 3KK2A 4I9LA 4LSNA 4AHRA 4NLGA 4Z4HA 1BI4A 9ICBA 4JV1A 3ULDA 3P1GA 2XGPA 2PFPA 2JLEA 4R63A 3ISNC 5DK5A 4KHNA 4JLHA 3TFSA 3AVMA 3AUOA 4R8UB 3RJKA 4MFAA 3MXIA 3V7KA 1MU2A 4F5NA 1ZQOA 4KTZA 9ICKA 2DY4A 3PX4A 2UVVA 4HUGA 1IKYA 2P6RA 4HHTA 3I8DA 2FBXA 1NOZA 3DRSA 3JPNA 3NFAA 7ICUA 4IG0A 3IM1A 4DL5A 1GOAA 3C94A 2GWSA 4PQUA 1H38A 3DM2A 4Z0UA 3S3NA 5KFJA 4GMJB 1ZQPA 4B9VA 4KLQA 4LVSA 4FZZA 3TAGA 1D8YA 5HMLA 2GUIA 4CHNA 3NH0A 4K8XA 3HPOA 1EKEA 1BPXA 3LP1A 1W0HA 3ZDAA 3C95A 1RT5A 1U47A 9ICHA 4CJRA 1T4GA 2X6NA 1U45A 3E01A 2OYQA 3HP6A 3QINA 4W5RA 2AQ0A 4ECWA 4I2HA 4FBUA 4R5PA 5JS2A 3SCXA 3QEAZ 2LYHA 3TWHA 4RQ7A 3PR5B 4QZBA 4B3OA 3C2LA 3RB6A 3SQ1A 4JWMA 3MXMA 3KHHA 1RBVA 4FZXC 4Q8FA 4CF1A 4JRQA 5KFBA 3GIKA 3VQPA 4Z4CA 3NE6A 4YR3A 5C42A 4GW6A 5CZ2A 2PYJA 4Q45A 1S1TA 4NLZA 2G8WA 4BXOB 2RDJA 1UAXA 4I2GA 3V9SA 5KRSA 8ICRA 5DQHA 3MBYA 3VQDA 4E7HA 1L3VA 9ICFA 4ECRA 1BPBA 5DDYA 5EWEA 3SI6A 4NM1A 4Q44A 3ZDCA 3BQ2A 1B9FA 2HW3A 2BCVA 1BI4B 4RW6A 4FJLA 3DLRA 4DLEA 4UB4A 4Z6DA 4ED6A 1S77D 3RR8A 4HUEA 1FK9A 1IH7A 4XIUA 9ICCA 4M0AA 3BQ0A 3AA5X 4I29A 4LH4A 5DLFA 3OS0A 4ED7A 1RYRA 3K5OA 1XSNA 1JLQA 4PHDA 4DTRA 1GOCA 3MEEA 2YNHA 4OLBA 1X9WA 4H8KA 3U3YA 1CXUA 1SKWA 4YNQA 2JZBB 3HL8A 1BPEA 5I3UA 2ASDA 3MABA 2AJQA 5J2BA 7ICTA 4DU1A 1KVAA 2H5XA 2NRXA 3M8RA 3RJGA 1RBSA 4DTPA 8ICFA 5BOMA 2GBZA 3RRGA 4FS1A 2JGUA 4KI4A 1LAWA 3SUPA 5JS1A 8ICUA 1WN7A 4MQ3A 1C0TA 3UXOA 5DGAA 5CY4A 3AO2A 3MDCA 3SYZA 5J0SA 1YT3A 1BQMA 4PGXA 4E7IA 4O3SA 2X78A 5J0QA 2FMSA 1BISA 5KFCA 1V9PA 4QWBA 8ICVA 1ZBIA 5J2DA 4FJ7A 3PX0A 4B8AB 4YCXA 4X5VA 2YHAA 1ZYQA 4ID5A 5EWGA 3HW8A 4I2FA 1RDCA 2FBYA 1ZBLA 4KLDA 4LH5A 1U9LA 8ICKA 1NK7A 3QIOA 5DLGA 5J2AA 3OYLA 4J9KA 5DB8A 5FRNA 3VQ8A 4AILC 3HSTB 1RYSA 2BR0A 4CJSA 4E7KA 5HNKA 1KSPA 5KI6A 3T19A 1LV5A 5IIJA 4HUFA 4RG8A 4O0IA 4FJNA 8ICYA 4RU9A 4DWIA 4XQ8A 3C2KA 3SI8A 4YVZA 1BPDA 4KHWA 1TL3A 3EWAA 4W5NA 3QO9A 4FLZA 4GVMA 4GXJA 4LSLA 4CGJA 3NCIA 5J2JA 1HRHA 2KZZA 2R8HA 4DTUA 3UXNA 5F9NA 1S10A 4DO9A 9ICSA 1J54A 3H8SA 5F9LA 4M6WA 4LY7A 2ZE2A 1ZQEA 4Z4FA 2WONA 4DS5A 4OKEA 1XSPA 4CJUA 4Z4EA 1KLNA 4B8CA 3VN5A 3N97B 1TV6A 2HHQA 4KB0A 3V1QA 3H8WA 2R8GA 1KTQA 2F8SA 4RPZA 1RBUA 4OGCA 4KLFA 4BE1A 4EZ6A 2E4LA 4YP3A 3GIIA 3AO5A 2RKIA 1Z26A 2P51A 2NRZA 5L1JA 9ICNA 4IBNA 4UB5A 4I2AA 2J6UA 3ORYA 3L2VA 3NGYA 4C8OA 2IDOA 3KHGA 1ZQGA 1J53A 1A5VA 3VQAA 1DLOA 4DQIA 2A1JA 1RT3A 4KV8A 3SUQA 4CJ5A 3HWTA 3RB3A 3RJIA 4J2DA 1NKCA 3OVNA 1VSMA 2R7YA 3RAXA 4O3QA 2G8VA 4DL6A 4ED8A 2Y1IA 5EOZA 1K1SA 2R8KA 5KFMA 3ASMA 1B92A 2PYLA 2HHXA 9ICMA 4UAZA 1W9HA 4DG1A 3JPSA 4DS4A 2G8UA 2BGGA 5KG6A 4M9GA 3KK3A 4BWMA 2C2EA 2W42A 3UQ0A 1JL2A 3ISDA 3ZSRA 4F4ZA 7ICRA 1RDBA 9ICOA 1COOA 1EP4A 3GFKB 2BQRA 4KKOA 5J1EA 1JLGA 1CXQA 2YV0X 4EBEA 4FVMA 1VRUA 4DF4A 3KLGA 4HCBA 4M3XA 3E2EA 1TAUA 1VSEA 4I2BA 3PW5A 4PY5A 1BQNA 3V6KA 8ICJA 4N47A 4IG3A 4O4GA 2FC0A 1DOQA 1Z25A 4JRPA 1YTAA 2HNZA 3KLEA 4GLXA 9ICQA 3AA2A 1QTMA 4M6WB 1KRPA 5DMRA 1TK0A 3C2MA 2VWKA 3NHGA 2JEFA 3NF6A 3KLHA 4F5RA 1XHZA 2X74A 5KT7A 4K4HA 3UPQA 2P5OA 3TFRA 3IRXA 4B9UA 3VQQA 3ZT2A 4RQ5A 4DSEA 4RUAA 3C5GA 3RJHA 4DOCA 3TARA 4KLSA 9ICJA 2XGQA 2UVUA 4MFFA 4OJRA 2RN2A 1BVSA 4CJVA 4FLVA 3NF7A 1ZBFA 2PXIA 3HK2A 2HNDA 4P4MA 1S6PA 4CE9A 1HYSA 1TFRA 4QAGA 4E1MA 2B4JA 3LALA 3KKSA 4E3SA 3RMAA 4EP5A 4Q8EA 3EPGA 2A1JB 4CEDA 2W9MA 1TAQA 2HHTA 3HPGA 3LP0A 2HNYA 4ZTJA 4M3ZA 3HXMA 2R8IA 5D4BA 4TSXA 2BCRA 5J2KA 1D9FA 1ZQSA 4QZIA 4N76A 3AVFA 4ECSA 2D5RA 4DLGA 1S5JA 2ATLA 4ED2A 4O5CA 3HPHA 2PZSA 3SPZA 3L2QA 4RZRA 5J0WA 4YQWA 3ZSZA 3V6DA 4F92B 4CHQA 2G8HA 2C28A 4W5QA 4M9HA 4J9RA 3SPYA 3MR5A 3ISBA 2DPIA 3FDSA 4M3RA 3KD1E 3IAYA 1YVUA 4Z4GA 4MEYA 3GIJA 3SV3A 4DQPA 1UT5A 3KLFA 3V6HA 3V4IA 1ZQMA 3M8PA 1RTDA 4UB2A 1T03A 1L3UA 4FO6A 3KIOA 2B5JA 4Z6EA 2ZTDA 2PFNA 2I9GA 4B9MA 4DTMA 4R65A 1ZQCA 1REVA 2X6SA 1UA0A 3SZ2A 4JWNA 4QCLA 4RQ2A 1ZQXA 5KG1A 3V7JA 1RT2A 4E89A 3B6OA 4TQRA 3NBPA 3NH1A 1XWLA 4OVLA 1RT7A 4BXOA 3DMJA 1SL2A 2ZUBA 5HMMA 2DPJA 4NCBA 8ICTA 3L3UA 4JV2A 3H4BA 1HNVA 3NF9A 2C2DA 5CWRA 4FJXA 4I2PA 3RJEA 4ECYA 4F5QA 2XRIA 5CZ1A 4Y1DA 2BCSA 4Y1CA 9ICPA 1ZQBA 3OYAA 4M3UA 1QHTA 1U49A 1HNIA 4OKKA 1IXRA 5C5JA 4I2EA 4Z4IA 5KFTA 4DEZA 3VQ5A 4R64A 4YN4A 3WNEA 4RT3A 1ZQRA 5DB7A 5D3GA 9ICAA 3PO5A 5IINA 1ASWA 4PH5A 5J2IA 4F3OA 3MECA 4AH9A 4M9JA 4CEAA 3BQTA 2JZBA 4CEBA 4CK1A 3WNGA 5DG9A 4CJQA 2FLPA 2O4GA 5IIIA 2W8LA 3LWMA 4CGHA 1J9AA 3O3FA 4QWEA 5DG8A 3C1YA 3DRRA 2Y1JA 2V4RA 3NF8A 4RQ0A 2UVWA 3PW7A 2AGQA 1N56A 4FW2A 2NUBA 4O3NA 5C25A 3QNOA 9ICVA 5HRSA 4I9QA 3O4QA 3Q8MA 4DSFA 5KT5A 2IHMA 2FPLA 2VG5A 1ZJNA 5HHIA 3CFRA 5I42A 2DFFA 2VA2A 4ZH4A 1B22A 2ZJAA 4UBBA 1JLBA 1LWCA 4O55A 4ECUA 1NKEA 3PO4A 3ZSOA 3O4NA 3ISCA 8ICXA 3RJFA 4DSJA 3T5HA 3UXPA 4DSIA 2OPRA 1RBTA 3RRHA 4YXJA 5T7BA 1XU4A 2AQ4A 5DG7A 3TAFA 4YD1A 4I28A 4ID1A 2BANA 3LDAA 1XS9D 2QK9A 2XHBA 2P66A 3VQCA 3HT3A 3GILA 1S1WA 3OS2A 5KFHA 4J9PA 1ZQVA 2XO7A 5KFPA 5E41A 4RW8A 3OYNA 4NYFA 1ITGA 2VA8A 4RPXA 1HYZA 1GOBA 2IBKA 4K8ZA 2MAXA 1CZ9A 1BIUA 3OJUA 4M3WA 3AU2A 4JK1A 2Z1JA 2KTQA 3RMBA 2QXFA 3AVGA 4BDYA 3GV7B 1N48A 3GV8B 1LWEA 3VQEA 1VSIA 4MF8A 1NK8A 1F21A 4G1QA 1LWFA 4KLMA 4H4MA 1KVBA 3DYAA 4CF9A 4OPKA 4AHCA 4YMOA 5KGXA 3V81A 3Q8PB 1TKTA 3AVAA 1RPLA 1C7YA 4E19A 1JLCA 2C22A 4CJKA 3SQ2A 3QZ8A 4NCGA 5CJ7A 4TUSA 3HX0A 3AVHA 4ELVA 1S0MA 4M2YA 3LK9A 1EXQA 1RTIA 3V9UA 3LDSA 5D49A 1Q9YA 1IO2A 2FBTA 4JS5A 4O3RA 1WSFA 1MQ2A 3L3VA 5KT3A 4KO0A 4FJGA 3NGZA 2HB5A 3CM5A 2D0AA 1U48A 4C8LA 2ZD1A 4CEOA 5KFXA 2R8JA 1QS4A 1SL0A 2P5GA 3VA0A 1JX4A 4HTUA 1NK6A 2P6UA 3L2UA 2I1QA 2ISPA 4CGFA 5KFDA 3GDXA 2BQ3A 1Z00A 1I3AA 2NRWA 2PFOA 4P4OA 3JPPA 3ALYA 3ZCMA 4CF2A 3ZT0A 4M41A 1NJYA 4KN4A 4XRHA 4I2CA 2HMIA 3KTQA 4J2AA 4KAZA 3D0PA 1S6QA 4C8MA 8ICBA 1B9DA 3ZSYA 3HVTA 4ELTA 4BE0A 4NCAA 1RZTA 3PW4A 2BCUA 4M3YA 7ICLA 5J0XA 3VQ4A 2BQUA 3GQCA 2PY5A 4W5OA 2DFLA 4ECQA 4I2QA 5D46A 2C2RA 4CF0A 3TAMA 4FLYA 3MFHA 1IG9A 4DOAA 3C23A 8ICCA 4Q5VA 2P1JA 4CCHA 3SJJA 2MUTA 1WLJA 4J2BA 3DLGA 4W5TA 1RXVA 1RNHA 3CM6A 3Q8RB 1MSWD 9ICRA 3NTUA 1S9FA 2B6AA 2KFZA 4RW7A 9ICTA 2Q3SA 3M9NB 3NH2A 3OYHA 3AVIA 1XHXA 2IC3A 3I0SA 3VQBA 3DLBA 5HRNA 4UB3A 4KLLA 3ZSWA 4QZGA 4KN7A 1SZPA 2F1HA 4KHSA 4F8RA 3P83D 4CFBA 2E6MA 2XY6A 2RPIA 7ICQA 2HHVA 1VSLA 4ED1A 1JXEA 3OYGA 4QZHA 5L1IA 1BIZA 1LW0A 3C1ZA 4UAYA 4EP4A 5KFUA 4PA1A 4YFUA 4I27A 4B9SA 3CQ8A 2KFNA 3KJVA 2VG7A 2W9BB 3MAQA 4FLUA 5HBMA 4CF8A 4CGIA 4KLIA 5KG5A 2KZ3A 4F5PA 1C0MA 4N5SA 1N5YA 7ICOA 1XSLA 1Z00B 1QSSA 4F50A 4PHAA 9ICGA 2XCAA 5CB1A 3PR4A 3QERA 5KFLA 2XC9A 4RQ8A 5HROA 3SQ0A 4JV0A 2M9NA 4B9LA 3KHLA 4CEQA 4ECVA 4DL2A 3M8QA 4XUSA 5KFAA 2F96A 4I7FA 3OY9A 2ZTEA 4CIFA 1NJWA 1VSDA 1JIHA 1D8LA 1QLNA 4NY8A 3DI6A 2ZQBA 2BDPA 3A2FA 1TK8A 4PWDA 7ICKA 4KRFA 1UOCA 1A77A 4CIEA 1JXLA 1ZQAA 5KG3A 3OYEA 1C1CA 2BCQA 4CHYA 1A5WA 5DB9A 4EYIB 4CHPA 1I39A 3H8JA 2MUTB 4HYKA 2ISOA 2OPSA 9ICUA 4KHUA 4P2HA 5HP4A 3WNHA 4I2DA 4CJ4A 4TQSA 3LANA 5DDMA 2YNGA 1RCHA 2AGPA 3L2RA 3MXJA 3MR6A 3MFIA 1Q8IA 4KI6A 5J0OA 1HQEA 5J2GA 3LP3A 5IIOA 4QWAA 4QZ9A 4FLTA 4ED0A 3OYIA 4I2IA 3IS9A 5KFNA 2A1SA 7ICVA 2F8TA 1ZETA 3UIQA 5J2CA 3C21A 3QNNA 5KG7A 4FJHA 1L3TA 3ZSQA 3MR2A 5DQIA 3ZT3A 7ICPA 4CJLA 4FXDA 3Q8KA 3PNCA 1JLAA 4ZTFA 3S3MA
chains in the Genus database with same CATH superfamily
4MMOA 1WSEA 4F3TA 4QW8A 2PT0A 2HOIA 3MAAB 4BG8A 5GMDA 1Q81T 5AZJB 5AQXA 3GZ7A 3KYLA 1KOHA 4O5BA 3OHBA 4GRSA 3K9KA 2VGMA 4ACOA 3DHXA 1IBKJ 3B8HA 1YI2N 4F71A 4GC6A 3EUNA 3J7AN 1WOQA 2UU9J 1MROB 1D9AA 4HHHA 3R8EA 2OZSA 1NNEA 4Y3CA 1JXBA 4PHPA 4UB8U 3SNNA 3CJQA 4BBYA 1N5YB 2MQ8A 4XAKA 4EEKA 1Y00A 3MM7B 2IYIA 2E1ZA 3HVRA 3QZ7A 4B9TA 2KKPA 1C4CA 3T5LA 5LJVA 3R9KA 1VLOA 4IQVA 3AJDA 4J8FA 3NGDA 1TUGB 1HNZF 2R7OA 4FOEA 1ZQDA 4MEXA 1WSHA 2HBLA 3THVA 3M8QB 4IQTA 4DV3J 1TFYA 2KQ2A 3VC8A 4CBUA 3OJSA 3AL0B 3ITHA 1ZQJA 3KZBA 2QWQA 2H3FA 2AJ4A 1XN9A 2FHJA 4ZHRA 1XR6A 4LVNP 5ETSA 3O44A 2V8VA 1L7OA 3PHEA 2XCPA 1Y11A 3MM9B 3Q8VA 4MK7A 2QGFB 2UV8G 4WCEL 2V4QA 4JKDA 2WTFA 3QNWB 2JC1A 4R79A 1K0VA 2RUGA 3Q2TC 2OIHA 3LA0A 4DR2K 1F5AA 1NKBA 4UY8T 1L8OA 4I1TA 3LDOA 2ATCB 3O9SA 1QVFM 2DNPA 4CIGA 4BG9A 1OXJA 2ETJA 3CRXA 2NPFA 1X4DA 1GQEA 1WAJA 4KLEA 3OL8A 4OPHA 2ITMA 2DTUA 4B3RK 5ALMA 2KG1A 2HAFA 5AQKA 4CGDA 4DL3A 1U2CA 4CJWA 4JI2F 2YPYA 4CK3A 1RAHB 3OLAA 3I0RB 5HJXA 4E7JA 1IKWA 1FKPA 3VGLA 1QE1B 3D2FB 3TVKA 4GV6A 3CNHA 4UQGA 2C3UA 5KOXA 2VDHA 1KLMB 2WC9A 1G2EA 1RI7A 5KRTA 4PZOA 2ZBQA 3C19A 4LFBF 4QIFA 3PUFA 2Q79A 4CFDA 4FPRA 4WKYA 2HVDA 3VALA 5IC4B 2YWWA 5TKYA 3NRWA 1WKLA 3A13A 4F2RA 2IFXA 8ICQA 2VQFF 3FFIB 4RQNA 1CSJA 3PZPA 3DOMB 3MN7A 5KGWA 2GO8A 1KAZA 2GS8A 3QSYB 5CA7A 2YKAA 1HI1A 3BF4A 3EZ5A 2D9PA 5I3QA 1NG9A 2QKBA 4RUCA 3C0BA 3R8YA 1V97A 3PYEA 5BRFA 3CDBA 4O5EA 3ENOA 4K0KK 2O8BA 2IGIA 1IBMJ 2F1JA 2A19A 4QZAA 3FZBA 1S22A 4V19S 6FD1A 4ED3A 1CQNA 4NL5A 1C1BA 1BU6O 2YH0A 3BSNA 1T7PA 2EFQA 4DU8A 3AMZA 1F0MA 3VENA 3NMAA 1XC3A 1DRGA 4K2XA 2YY3A 3VHQA 4YUDA 2E2QA 2AP6A 2YH1A 2V9WA 5CYQB 3JSYA 2CQ4A 1HA1A 4OV6A 1NGHA 3LPTA 2LXFA 1SL1A 3NWGA 5AM2A 4WKRA 1WC1A 1JL1A 1NOMA 3LAMA 3QRRA 2GIQA 1CZBA 2KI2A 3O0FA 1H7WA 3MEGB 3AARA 4DV2F 1JMSA 3FCWA 2Y9TA 1XMBA 4AD6A 3FGUA 2QARA 4CO2A 2VV5A 2RMLA 4K4GA 2ZIXA 3AVBA 2DGOA 4F3QA 1HPZB 3ICLA 4DV0J 2QA2A 4IH6A 2PI4A 3ZD8A 4P0QA 2MHNA 1NK4A 2PC6A 2QFJA 4MKYA 4XH1A 9ATCB 4DMNA 5C2FA 5IC6B 2OTJS 4ILGB 2GQCA 3QU5A 5IM0B 1M5VC 3RMDA 2LI6A 3MCMA 3MAHA 3W7BA 2UUBF 1QSYA 1BE4A 3BEXA 2KDOA 1FKOA 4C3MA 1B43A 4B3MJ 3KD5E 4DTJA 1B0XA 1WI8A 2KVIA 1UWBB 2MSSA 5L8RC 1TVRA 4A46A 5DDPC 4A48A 5IV4A 2YHBA 4LF5K 4OYMA 1B3TA 3GTYX 5DBAA 4WE1B 4USIA 3AA3A 1VSHA 3M6GA 4QS8A 2F9TA 1H72C 4KMOB 1DEJA 1Q95G 1IBKF 3KNAA 3A8EA 2GGPA 3U9DA 4UY8O 2AW0A 3HT0A 2HVIA 4FVUA 3TX8A 1S1VA 1MMNA 2KJVA 1XMQK 1N34J 2XY8A 4C4TA 4GXKA 5GADI 4DL0C 5AFUH 4JHDA 3JAMY 4CF4A 3AOCA 2J6TA 1SQGA 1WCNA 1KHWA 3ENVA 3SDEA 5L39A 1BD6A 3ET6A 4ZIWA 4Y2TA 9ICIA 4ALZA 3O4WA 3G6XA 5KFGA 4IQUA 1T05B 1XNQJ 2FVPA 4Y2SA 4DCCA 1D8ZA 2DB1A 4DV3F 3PJWA 2GOLA 2RRBA 5DQGA 3HKZC 2P5VA 3DDKA 2IS3A 2UVRA 3C2PA 3LPUA 3SUOA 2OTJN 2OEHA 5FPNA 3TABA 2V0NA 4RW4B 2VYPA 1FFGB 1YITS 1ZRMA 4NLTA 2V6AA 3HI9A 4FZVA 4ZCLA 1S1TB 1R0AA 4ICLA 4W4MA 3THXA 2WB1C 5KFYA 4OHYA 2ILZA 4IR9A 1GLEG 3CVKA 2QTWA 1Z3EB 1SJ3P 2CQ1A 3H7IA 2G8FA 5DDOC 2J0SD 1RXWA 4DTNA 5KQ8A 1YJ7A 3QBXA 2LBOA 2OLWA 3CJRA 2W9AA 1CBKA 4MK8A 2G4BA 1S99A 4CZEA 1Z6RA 5C24A 3ZDBA 4JI4F 3RB4A 2UP1A 4RQ4A 4WK1A 4XA5A 3MOJB 2VBWA 3N5FA 5HL7Q 2W6LA 5B0DA 4FF1A 1OPZA 4PWUA 4UZBA 2HOEA 1T3QA 4H4OA 8ICEA 1P27B 4OYBA 2H5IB 3M9MB 2VWJA 4RW9A 4BRDA 4M5GA 2WRMA 4QQBA 8ICMA 3WX4A 2D0BA 1BWFO 2PGCA 1EIYB 2P9SA 2EHGA 1HX1A 2RF2A 2XSJA 3IFEA 2XMVA 3DGPB 3EDQB 1QAJA 4UW9A 1NK9A 5GAGU 2W3RA 4ES1A 2IJFA 4PHTX 4HCCA 5ALPA 3EW9A 2IOCA 1SKRA 1C0TB 4ECXA 2DNKA 2ZH1A 4O8UA 4CERA 1S12A 1YITN 4FWMA 3IMQJ 1VSJA 2FQQB 4KB1A 2Y9HA 4LFCJ 5B0AA 2C1EB 3AVCA 5J2NA 5AI0A 5IIMA 1HR0K 4KY3A 5M1FA 5CR0A 4KH1B 3JB9k 1F9HA 3AFGA 4OZ5A 5F8MA 1NNDA 3P39A 5BPLA 1X5OA 4CJFA 1S9GA 8ATCB 1IBMF 1KAYA 1AXQA 5A2QU 3R5AA 2P9CA 2AJ2A 1X1PA 2DFHA 4KB7A 1FEHA 4Y0FA 4PPXA 1RT1A 2FJEB 4PYDA 1KCFA 4QZDA 3AT1B 4M63A 1QSLA 3KBBA 4CI0B 3O3HA 5KAIU 1T6CA 5FPDA 3F5AA 1K6YA 3TO8A 2PE8A 4CO4A 2C2NA 3CDEA 4DHVA 3P5JA 1RAGB 2WMMA 2RD5C 2OPQB 1MC8A 2LPEA 2BRKA 4DL7A 3J80Y 2NUHA 5CHGA 3WNFA 4B1UB 2KHVA 4Q7AA 1T02A 2H3IA 1YJTA 3L5KA 3I76A 4RU2A 1HWUA 3K17A 2FLNA 4A8MP 2XS7A 1KOOA 3NAIA 3TAPA 3QESA 2NXCA 4ETZA 2QE5A 1X40A 4QZEA 4DV0F 3UDLA 3CJ4A 5KFKA 5K14B 3OYBA 2W9CB 4FBTA 5AI4A 2WF6A 3GLJA 4FDFA 1KFTA 2CQ2A 4GXIA 2EWSA 2QN6B 4DX8H 4W98A 4N41A 5DBCA 4K43A 3QEVA 5AXMA 1F9EB 2VA3A 4J7CA 4G9BA 2PFUA 1VQ8N 3AO4A 3BGRB 3WQUA 1BLUA 4F4YA 1HWJA 5BYRA 1DGSA 2UUAJ 4BR7A 1BPYA 4EMDA 1C0UA 1DTQA 3L2WA 4MJKA 4JI3K 2D7SA 1TKZB 5KTQA 4B3MF 1WG4A 3GJSB 3TQ1A 1HBMB 2MEWA 3RH5A 1SUQB 3I55N 4OIXA 2DHSA 5FLXO 3CFOA 3RB0A 1OUQA 2XMMA 3HVWA 5BR8F 3CCTA 1LXJA 4PG8A 4F67A 2NZ4A 1YUWA 3QEWA 4M63C 1BXNA 1OPIA 2LP4A 3ID6A 1BO5O 3LP2B 4NL9A 4FYXB 1D0EA 3LW5C 5RUBA 1UA1A 4LRDA 3EYZA 3CJKA 2KHOA 2Z4PA 1TYQB 4NZ7A 2B6GA 2K4EA 4A4JA 4ZA1A 1N34F 9ICWA 2VPWB 1SJQA 4RQ3A 4A47A 3ZNJ1 5TZVA 3CG7A 2CPJA 1RBOB 1ZQNA 3E8OA 5IOLA 1ZQZA 1D3WA 4ZCMA 4OJLA 1VJQA 1XK8A 4QPXA 4NMLA 4FK2A 2V5HG 4KHQA 4ECZA 1OKJA 3CD6S 3D6TB 1XNQF 3JPOA 2JVOA 3DU6A 1WC0A 4EO6A 3EKUA 1L7PA 1KQFB 3C6UA 4DN9A 1VC0A 4Q43A 1RQLA 2GO7A 3JQJA 2E1FA 1ZQLA 1TR0A 3A5MC 3AO3A 1QD1A 4R66A 1K9MO 3OHAA 3ZDEA 5IT9U 4IG3B 3B6PA 2GNKA 1HBUB 2BE2B 3KUHA 5BR9A 3ZTSA 3GR1A 1KD1T 5GMEA 3W9IA 2KSOA 4GVBB 3MGHA 4ENOA 2RRDA 1VGYA 4ZMMA 2MYFA 1ECWA 2KZMA 3AVLA 2W1BA 5EVZA 3FVYA 1XBWA 4TLQA 3DXSX 3OBIA 1X9MA 4LF6K 3UN3A 1W25A 3VCDA 3D6RA 1BUPA 4AHRA 1UJ6A 3EJMA 2EC2A 9ICBA 3IRWP 3QU9A 2XGPA 4ICAA 2PFPA 5DK5A 4KHNA 2MQOA 3TFSA 3QMQA 1SQFA 4R8UB 4BJQA 3MXIA 2Q3PA 2I5JB 3EVMA 2IOFA 4PCQA 4F5NA 3GYGA 5EUHA 1N32K 9ICKA 1I3OB 4HUGA 1X4CA 4EIAA 1RTJB 4OFZA 2E1EA 3JPNA 2ZJPQ 4JNEA 4FYWB 1TTHB 1GOAA 2M9KA 3UB5A 3OPKA 2E1CA 3DM2A 3BGLA 4Z0UA 5KFJA 1Z19A 3DOLB 4K2JA 2ZWHA 2OO4A 4B9VA 3CCQS 4CHNA 4JYAK 1RKJA 4PXDA 4K8XA 2VIXA 4C7QA 4DV6J 3P5BP 3H46O 3QGGA 2LDIA 3C95A 3PSFA 3UKRB 2X6NA 1U45A 1GMWA 3WK8A 3HP6A 4FBUA 3HKZF 4R5PA 2BJ9A 3TWHA 1YHQN 4B3OA 4LFCF 2PMWA 2MKSA 2CKWA 5M2UA 3I96A 4CVNE 3K8VA 2WAQD 4HEA9 2ACYA 1VQLS 4MKAA 3KWMA 1UL3A 1RBVA 4CF1A 3QUCA 4JRQA 3UCGA 2WB1F 5CD4A 3NE6A 3MPDA 4QYZJ 4YR3A 5C42A 3A1YG 4ZVPB 4H5NA 4Y2XA 4WFAQ 4GW6A 5CZ2A 2PYJA 4NLZA 4BRLA 2G8WA 4OI6A 3RJMB 5AZIB 4FWPA 4I2GA 3PRBA 2HAIA 8ICRA 3MBYA 3VQDA 4E7HA 1W7WA 5ADZA 2NYIA 1BPBA 3DXMA 5EWEA 5GAHU 3KK2B 1HNWK 4QIEA 4QIWD 1FESA 3UPFA 1IH7A 3PTWA 3F2CA 4NYPA 4FF4A 2EDUA 3BQ0A 1VC5A 1NM2A 5ETLA 1SB6A 3OS0A 3CCQN 3W8PA 1HD1A 2GQQA 1H2TZ 2QRRA 3K5OA 3QX7A 2YX7A 1U0SA 1WC6A 1U1OA 4DTRA 1ZH5A 2RU3A 2WF9A 2YNHA 4H8KA 4QJVA 3DRSB 3OXLA 3ZC4A 3R5GA 2CXYA 4KGMA 1N8RT 4HI2A 2OHFA 1N61A 4DPOA 3SAHA 2J9DE 2FGOA 2ASDA 1RK8A 1VS3A 4AT1B 1N33F 4AF1A 4WXWA 1Z2ZA 2H5XA 3M8RA 3ENHA 1RBSA 2FJVA 3RRGA 4KI4A 5C2CA 1LAWA 2F3NA 8ICUA 2MQMA 2UUAF 1HKAA 3UXOA 1VCTA 1CJKA 5C2GA 2W7OA 2ZUGA 3CXCM 4NLYA 2G2YA 2HMPA 3NMUA 4GVLA 1RLCL 2CWKA 3ZZTA 2E7VA 4PGXA 2FMSA 1KD1O 1O8BA 3E9OA 4JKHA 4B8AB 1ZYQA 4NPOA 4ID5A 5F0UA 1HKCA 5F8IA 2G5IB 4LH5A 8ICKA 1EAYC 3QAEA 1GH8A 5DLGA 3IDHA 4EAHD 4GIBA 3FEYB 4J9KA 4YN3B 2EFGA 2HFNA 4CDGA 4ZOHC 3HSTB 3HVAA 4CJSA 4DUTA 3LGHA 1KVKA 2DGWA 2Y9UA 3ZZPA 5KI6A 2VC1A 4CNZA 5IIJA 1FCAA 3GE9A 4JKCA 1CPZA 3HHNB 2CPHA 1FDDA 3C15A 4IOCQ 4OX9K 3C2KA 2NLXA 4BC5A 1TL7B 3EWAA 4EENA 4W5NA 1S5ZA 4DV4J 5J2JA 2LEAA 1HRHA 2KZZA 2A10A 2RE2A 4DTUA 4QU7A 5F9NA 1FK9B 1QAXA 5KNIA 2WBNA 1Y10A 4AP9A 4NLOA 3G82B 4LF8F 3SCLE 4LY7A 4C0OC 3M6KA 5DM7Q 1JLQB 1M6YA 4P74A 3MEEB 4OKEA 3CCLS 4Z4EA 3K1RB 3L9ZA 3RYLA 4CZKA 1TV6A 3UO0A 4M7YA 2ZDPA 4KB0A 5AQUA 5IFMA 2V67A 1KTQA 3G96A 4RPZA 3U9ZA 2VWBA 1MDUB 3THTA 3MDQA 5ALFA 4YP3A 1MN9A 1VJWA 2P51A 1X0PA 3RSEB 4WP3A 9ICNA 2DHAA 4OHZA 4IBNA 2J6UA 5ALHA 3D6HB 3KHGA 3ISND 1A5VA 3HFZB 4JKBA 1AT1B 1DLOA 4JBCA 1L7MA 2RQKA 3ZFVA 4RKUC 1RADB 4XH5A 1G7CB 3WXJA 3H0MB 3KUEA 2ZGZA 1C0GA 3LDLA 2KJ8A 2GVZA 1QZ6A 2F65A 3AA8A 3OVNA 3CCZA 1YJ9S 2PDAA 3SEOA 2G8VA 2P9LA 4LFAK 3OVAA 2OD6A 5AR0A 1IR1A 5KFMA 1FRXA 5B0BA 2ERRA 9ICMA 1WOPA 1SV0A 5HR6A 1RUSA 1W9HA 2CA9A 2E1RA 2BOAA 4M8LA 1FJEB 4JKGA 1KN6A 4DG1A 4DV6F 3SBMA 2BGGA 2JWKA 4M7XA 1QQ5A 3KOOA 3GZFA 3NS6A 3C14B 4UQTA 2HFZA 3VESA 1JL2A 3FE1A 2X3GA 3ISDA 1PJ7A 1FEEA 1FJGJ 3GFKB 2N7CA 4ATNA 2P9PA 1X3MA 2BRLA 4EBEA 3AAWB 4H4KA 2DUYA 4PL1A 4LSLB 4DF4A 3KLGA 1YJNS 1RXOB 3E2EA 1YBAA 1VIOA 7FDRA 2HIYA 1WG1A 1DOQA 2ZEJA 2MZRA 1NGGA 2DNHA 1YVNA 1TK0A 4K4SA 1JK9B 3CPEA 2RT3A 1IV8A 3T69A 2RIJA 4F5RA 2WONB 5KT7A 1YG0A 5HJYA 4BR5A 5H1SV 3D0GE 4JI8J 2J4RA 2YX1A 3VQQA 2KV2A 4YEAA 4DSEA 4BREA 1RWOB 3JQMA 3H8YA 3RJHA 2C2MB 3ZZOA 3GG4A 1IWGA 4OJRA 3VZHA 1GLCG 4XH4A 1BVSA 5ALSA 4FLVA 1SI9A 2PXIA 2HNDA 4CE9A 2O8FB 3THWA 3MXHP 4JI7J 4ZVTB 3MUTP 5I3PA 1QUVA 4YMEA 1XIQA 1SV0C 1HUXA 3R1HA 3HPGA 1NM1A 2ZHAA 3LP0A 4L76A 3NS5A 4M5KA 3BGOP 3D1OA 4M3ZA 3MTJA 1I94K 2FY1A 3HXMA 2BCRA 5J2KA 1FVQA 2VICA 3VF0B 1ZTTA 4N76A 4ECSA 1XJWB 5J1PA 4ED2A 5CCLA 3ATUA 2MQQA 2N3OA 3SPZA 3D2SA 1SJ1A 1VK8A 3D28A 4F92B 3TP2A 2G8HA 1EWRA 2C28A 1ZAWA 1YJNN 4J9RA 4H4KC 3SBTA 4WYWA 4PWDB 5M1KA 1UFWA 4NXNF 3KD1E 2RU9A 3IAYA 1IJEB 4L3KA 3W2VB 3SV3A 1RB0A 4O23A 5CD4H 4KGVB 2MY8A 3N79A 4FKXA 4UB2A 2PN6A 3OXFA 1L3UA 1T03A 3MPYA 4FO6A 4C48A 4IO9Q 4IS7A 3HF5A 4WJ3B 1CJUB 2PFNA 1WUDA 3R6GB 2ZZMA 3KZXA 4CI6A 1VRUB 4P73A 4CLFA 2LQBA 4CNQA 2BKNA 2RS2A 2MLZA 4C11A 1HQEB 1BQNB 2YMMA 2KO1A 4HTJA 3P8BB 2ZOFA 4O4GB 4NLPA 2VD3A 2XO6A 5AQHA 2MGZB 4EHTA 1SL2A 2OP5A 1TQLA 1HNXJ 2ZUBA 3FEZA 1A6LA 2DNYA 4YDXA 2CJBA 3H4BA 2C2DA 3KLHB 2ZH2A 3KUGA 2QLJB 4ECYA 1WJ9A 5LJWA 4KBOA 1H98A 2DR6A 4NRUA 2EK1A 2WF5A 3ETMA 4Y1DA 4U67Q 3CJ5A 3NGUA 1XERA 4RR5A 5F8LA 4RX6A 4DV7J 4NXMJ 4X65K 3D7SB 4C80A 4FZNA 2M52A 1N36J 1IXRA 2HIQA 2O5DA 4I2EA 2MKHA 2NZTA 5AQWA 5ALWA 4YN4A 4FN5A 1HYSB 3CE8A 3AD7C 2UXCJ 1FNMA 4FP9A 9ICAA 1VOMA 5EXWA 2Q1LA 1ASWA 3H1QA 4BGAA 1X8DA 3BQTA 1U1KA 2P8IA 4KH4A 4A8QA 1QVGM 3WNGA 3UVJA 2FLPA 3ZX2A 2W8LA 2Q0UA 2W2OP 3J7Z5 1UFLA 2WHEA 2Y1JA 2V4RA 2H3QA 1VQ9S 1PJ6A 4RQ0A 2UVWA 5AXKA 2AGQA 4O3NA 3QNOA 9ICVA 2OAUA 3V6DB 5K4LA 5HRSA 3O4QA 3Q8MA 4DSFA 1JRPA 5KT5A 2FPLA 2OGUA 3OQ2A 4I6AA 3CD0A 5HHIA 2MMYA 2V63A 1V85A 3M1VA 3FK4A 4YY3F 2DGQA 3OBWA 4ZHRB 4ECUA 3PO4A 3V4IB 1XMOK 1IBLK 3M8PB 1KQSM 4YOYA 5CHIA 3AGRA 3B4DA 4ILRA 1RBTA 1HIYA 3OUYA 2AQ4A 5DG7A 2H54B 1YWXA 3VAJA 4JI0K 1TU0B 4ID1A 2DT9A 5ALDA 3LDAA 3ETOA 3HRDD 1Y5NB 1VHFA 1IJFB 2ILYA 2VDIA 3TTCA 3VQCA 3HT3A 3IWLA 5G4DA 1GLAG 3OS2A 3D67A 2EFVA 3CULA 3OYNA 2K3KA 4NYFA 3PSTA 2ZBRA 1HNVB 5AM4A 4RPXA 1X31C 4GY2B 1WOSA 2IBKA 2MAXA 3N4QA 1BIUA 3OJUA 4M3WA 4BDYA 3GV8B 1WELA 5ALQA 4P7TA 3WK7A 4CYUB 1X4AA 1IKWB 3W66A 4CTAA 4RNHA 1F21A 2HK3A 1OQ3A 1LWFA 1S6UA 4H4MA 2YCHA 4CF9A 4OPKA 2RQCA 4F0HA 1TKTA 1TL4A 1C7YA 4IH5A 3A8JA 5EX5A 2C22A 2Z57B 5IQQA 3SQ2A 4NCGA 4LR9A 5CJ7A 2HI0A 1KC8T 3VQTA 3MECB 3D2NA 1SJRA 1B70B 3VTIA 1Y4ZB 1Q9YA 2B9EA 4DQ8A 4O3RA 5L9NA 5KT3A 1BG3A 1DT9A 3N0VA 2IJRA 2XLJA 4JI5K 4ZPDA 4BRHA 3NNHA 3G4SS 4BRMA 1K73O 1BY9A 1WHXA 3CCWA 5C25B 1U48A 4HTLA 2O8DB 3JAMU 2P5GA 1JX4A 1NK6A 4OJ3A 4YDUA 2BQ3A 3WEEA 3HD2A 4S0MA 5H9EK 2LU1A 4NXNK 4KPCA 4CF2A 5TISU 5AKIA 5EY4A 1PIEA 2CG4A 4DXLA 2HMIA 4J2AA 4MK9A 2Q66A 2P9NA 2B51A 4P10A 2EI5A 2OPRB 2WSFC 2E20A 4ELTA 3Q89A 4QZVB 1RZTA 4FPIA 3PW4A 3FRYA 1VMBA 3ENQA 2BBEA 5JVHL 4LUBA 3VQ4A 3IBCB 2HWIA 2QMWA 3PSPA 4DN0A 3GQCA 2PY5A 2DFLA 1HBNA 1TMJA 4I2QA 3BUZB 5D46A 2VL1A 1HLWA 5A8RA 3UW1A 2AJFE 3TAMA 2IOFK 3C65A 2DBBA 4PKHA 3C23A 4Q5VA 2P1JA 4CCHA 2MUTA 5HMZA 3TKAA 2WHOA 4ZPWR 1WLJA 4J2BA 3OTEA 4DX6A 4F72A 3H7HB 3H3NO 4C3LA 5ELZA 4DPTA 2KHQA 1B7FA 1S9FA 4CH1A 3UQSA 1LWEB 1WDDA 1VQYA 4G1QB 1SC6A 1Q3VA 3PIOQ 3NH2A 1SZHA 5AK6A 1XHXA 2HDOA 1S72N 4C4RA 1RYUA 4JP8A 4BR0A 3I0SA 1S5LU 4PAAA 4KIAA 4ZP6A 1M5PC 5DM6Q 3SR6A 1CULB 2XMJA 2MZSA 3O1WA 1NDCA 1RHQB 3ZSWA 2CFXA 2F4VF 2F1HA 4J90A 4F8RA 3EEQA 2DH9A 3CGIA 1PBUA 4FYYB 2LCWA 1Q46A 1T9TA 1RTIB 1VSLA 3EKSA 2VBZA 2UUTA 1CJVB 1UHUA 4YDUC 2DR5A 2XBPA 5AZJA 3Q8UA 4QZHA 1DFDA 4E8UA 2LQJA 4DR3K 4PA1A 4YFUA 2DGSA 4DV7F 2HHHK 4UARA 1BC6A 2DGXA 2KN4A 4USHA 1QQ6A 5LSRA 1HWKA 2MQPA 4WYLA 2R18A 1RU2A 1Y5LB 2Y1RI 4DUZJ 4A5AA 2C3MA 2F8HA 2CQ0A 3M3ZA 4PWWA 5CR4A 4B1ZA 1N5YA 2O6KA 1YX2A 1QZ5A 3D2QA 4P9SA 4FFDA 4M5HA 2XCAA 1MLAA 3QERA 4CZHA 1Y9OA 1LK5A 4JV0A 2QO3A 3VEWA 3V4MA 1LWXA 4ETXA 3BKFA 3KKAA 4ECVA 4DV1K 2QW9A 3VF2A 2Y8WA 1F0XA 3M8QA 1ITPA 5KFAA 3U8XA 2ZTEA 3VPZA 4UY85 1VSDA 2FHJD 3PSIA 1GX6A 3EMTA 3N9UC 1RE1B 2I6WA 5KG3A 5AKKA 4WFNQ 2PKEA 1UJ5A 4B1XB 2BCQA 3POTB 2AJ0A 1S8OA 3I32A 3JSRA 3MM9A 3ONNA 4BLGA 3H8JA 1I39A 2H3ZA 4MDBA 5B8HA 2F9JA 4KHUA 4P2HA 3E9LA 3I31A 4U7BA 4I2DA 4CJ4A 2FJXA 4TQSA 3LANA 4KJIA 2P6TA 3PIPL 4P2MA 3MXJA 2IVPA 2B6AB 2VPZB 1VI7A 4DR5K 5CZVA 2MPUA 1UVMA 4RW7B 3J80U 4FLTA 1ZXOA 4I2IA 2A40A 3A8YA 1T44A 2QV6A 2JRZA 3C21A 1YRUA 3EWGA 3QNNA 5ALEA 1FDNA 3LDNA 3MR2A 4U9RA 5AQLA 4LR8A 1DHMA 4J5OA 1EKRA 4ZPBA 2LVWA 2PAVA 1X42A 4ZIVA 4YB5A 4MAKA 2JEGA 4RPYA 3I0RA 4J9MA 4BE2A 7ICJA 1LW0B 4TURA 1UT8A 1ZQIA 4X62J 1KLMA 2UU9K 2R7VA 3KKAC 1ASUA 1LFWA 1PYSB 3RH6A 2R7WA 5KFEA 8ICHA 4OYWA 4GKJK 4O3OA 4Y2YA 2CJXB 4LZGA 1Y5IB 4UAWA 4GO7X 2Q97A 1UPPA 3FFIA 3HSZA 5LM7E 1PZNA 1S0NA 2E3TA 5J0UA 1ZBHA 1S49A 4ES2A 2OFGX 1JJ2M 4ZP8A 4FOIA 1ZQFA 5HROB 1HARA 1CEZA 5T7LB 3NGIA 4N7TA 4U6PA 2OA8A 2FPKA 5HVFA 3PY8A 2IJNA 3DI6B 4OHVA 3IWXA 3WXIA 3K5MA 5AIBA 2OSQA 2NXUA 3H08A 4MT1A 3K5NA 1SKSA 6FDRA 2VODA 1JCFA 2I8EA 2B9XA 3RTVA 1RJJA 5KPZA 5ETKA 3KWIA 3K0SA 3CP8A 1C1CB 3B0YA 1QQ7A 2R7UA 4M9NA 3D5MA 3FMBA 3FAHA 1QQCA 3J7YP 3SQ4A 2VJUA 2QIFA 1WTFA 1ZAVA 4OJPA 4FK4A 8ICZA 3IM9A 1G4CA 5CYQA 2YNGB 4NLVA 3CC7N 5IIKA 4C0ZA 1YJUA 4KQZA 1HJPA 4K4TA 3RAQA 1TK5A 1BDGA 4K5RA 3MEGA 2BPCA 1JNZB 2EX3A 4X4TA 4YXMA 2KT5A 5J0PA 2IHR1 4YFKA 3AD8C 2ZM6K 2YWHA 1Q1KA 3TJAA 1RT6A 1R0BG 4ISFA 2QC3A 4RNMA 3PMLA 4Z6CA 2BGWA 3O9RA 3T1HJ 5MAOA 3UE2A 1HPZA 2F2AB 4KLOA 4WYBA 1RT4B 3ZSVA 5IWAJ 2J7UA 4PG4A 2LYAA 3RRKA 2UXBJ 3TANA 2NYVA 3LWLA 1O03A 3T6BA 4CBWA 5GVQA 5IM0A 1AQ6A 3FNNA 2X1FA 1BOTO 2Z1IA 4OD0A 4AHSA 4FJJA 3MWBA 2FVSA 2KG0A 1FFWB 1U6ZA 2J6SA 3E0FA 1Y0HA 1RAAB 3GV5B 3S7RA 3B0XA 3UR3C 1UWBA 1HHSA 2HZAA 3M5RA 4MLHA 3V9ZA 3FZKA 4Z7YA 3QIPB 8ICIA 4KHPJ 2EAMA 2GWJA 1S9EB 2UUCK 4WE1A 5D15A 2BABA 4ZKAA 2DISA 2Q1NA 3HI0A 2ADCA 3ZSXA 1YIJN 1IG6A 3BREA 3IM8A 3V5RA 5F8JA 2ATQA 2JC0A 1VQPN 1YK9A 2IA6A 2E5LK 3AAQA 3TAQA 5JUMA 1N60A 2EAOA 1DGJA 1P1TA 2OTLS 3K57A 1R27B 1WC5A 3TACB 3I4HX 4MKBA 1ZQTA 2BV3A 1TL1B 3OTOJ 4WK3A 1M1GA 3IGVA 4CLYA 5GIOA 1UVIA 5EU7A 2FC8A 1Z1VA 1FTRA 3PX6A 1VK0A 2X3DA 3PV8A 2NR0A 4JK8A 4E98A 1T05A 2FMPA 3FGVA 5AQTA 4MH8A 4KITB 4OJGA 1N5XA 1K1QA 3C28A 1Y88A 3RJJA 1F1BB 1NOYA 1LQ9A 3QLHB 4FYDA 2W2MP 2NSCA 1JKHA 3AV9A 2X1BA 5J2FA 4F4KA 5FRMA 3OGUA 4JI1J 2CJ9A 1K47A 3CEDA 5LOQA 4FJ9A 2FF3B 1M5SA 2JJ4D 2XTJP 2P9EA 4RW4A 1HWIA 4HACB 2FVCA 3RBDA 1SXLA 1L5UA 2FZCB 2QL5B 1XNRJ 2IIHA 2JV3A 3JXUA 2L41A 3PCOB 4DL4A 2RE1A 4KFBA 3FC4A 2JXJA 4IRCA 3EICA 1KHVA 4DUYJ 4NLBA 1WCLA 2KKHA 2QMUB 1ZQYA 2PO4A 2V50A 5KT2A 3OTDA 4ZN3A 3OFGA 1AB8A 4OZLA 1SZ2A 1ZD5A 5HQ8A 3KKRA 3IDWA 4BRIA 2MJNA 2VFRA 4EBCA 3LAKA 4I0WA 2BM1A 2NUUG 7ICIA 2IRUA 2NRHA 2E6LA 5DB6A 3D68A 3OTBA 1YXQA 2OTLN 1WSIA 3HJFA 2YKOA 2FI1A 4DQRA 1WYGA 1J5OB 3TZXA 3HZEA 1ZQWA 1M1HA 1HQUA 1ZQKA 5GTHU 1NU4A 2VOOA 1BHLA 2PFFB 2ZHOA 3GFZA 4NXZA 3H0LB 3JPQA 2YQ1A 3GU0A 2W9BA 2XY5A 1KTVA 1SH3A 5ALYA 1GAOA 4JB3A 1UKUA 4AXJA 3A3NB 3QU7A 3EUB2 2OWOA 4OQJA 1RHMB 1DXSA 1C1AA 4J9SA 3DGPA 2KVQE 2WF8A 1MW7A 4NI2B 4L8RB 3TTDA 1VQ5S 1ZQHA 5HLFA 1UJ4A 3BB5A 2Y8YA 4DI6A 4F26A 5CABA 4TUQA 2JDJA 4X64F 4PUOB 4W92B 1X4EA 1OYEA 1KBRA 4FPAA 4R5PB 2F9WA 4ZP9A 8ICOA 4LF9J 3TUZC 4IUFA 4DR1F 5ALRA 3MEDB 4AHVA 3GIMA 5EE3A 3CMES 4M1KA 2L9NA 2D0CA 4WCEQ 1FXDA 1D1UA 4EZ9A 3L4PA 4K4IA 1OH8A 5EWFA 3L3CA 3KJNB 3WC0A 5CA5A 4OMFG 2HBRB 1K8AO 1NJZA 2QLXA 1F5CA 5CH7B 3ZEUB 2LLZA 3H4DA 1GMVA 1RCXB 4K41A 4J9QA 4YB6A 1CUKA 1WEYA 3CCES 2HYIB 1KVJA 1YBTA 3VQ6A 1KFSA 5D0HA 2ASLA 4NLQA 2IMOA 3DXMB 3OR2B 2H65B 2OPQA 3LQVA 2Z1HA 4FK0A 1LB2B 2M0GB 1SXDA 4B08A 3RMCA 3EGVA 3F44A 3IUCA 3FBEA 3K2PA 3FBCA 2FSNA 2E9RX 3G25A 1NJIT 4FWLA 3P49B 2JL9A 3GP9A 4JS4A 3ONQA 3AGKA 4DTSA 2G9OA 3AU6A 2H5JB 4R0EA 5FJ4A 1KONA 1DKGD 5K14A 2DO0A 3QFHA 5IWAF 2W9CA 3ED5A 2BXJA 4KTWA 4C8NA 5BPCA 3ZO7A 2HRUA 2UXBF 1NI3A 1KW4A 5E3RA 4FS2A 3VGVA 1JJ4A 5HATA 3QFUA 1IKXB 3BGRA 4ITSA 1NEEA 2WB4A 4O0JA 2CQIA 2OJ3A 3M6ZA 3TAEA 1LW2A 4Q2LA 3KJQB 2GFFA 1HKBA 3CMEN 5DRKA 4KMUA 4OGEA 1TKZA 2KN7A 1S97A 3DJCA 4TKTA 3W5XA 1HBMA 4OI3A 1SUQA 2ROGA 4KHPF 3VGMA 2WAQC 2KJ9A 2OSRA 4NLUA 3KK1B 5L9XA 1TZ0A 4FW1A 4KHYA 4Y34A 3LP2A 2YMQA 4KT0C 3HM9A 3CFPA 2AEJA 4UUWA 3VA3A 2O1PA 1RQ0A 4CT8A 1TYQA 3CCEN 2R7RA 1PVRA 4DPXA 3A5OC 4RL1A 1FNXH 3OYCA 3OYDA 3RH4A 2H5EA 3VAMA 3EE3A 1G1XA 7ICEA 1BPZA 4F5OA 4UF4A 4RPFA 3CDAA 2JEIA 2LSNA 4UAVA 9ICLA 3DDHA 1RKIA 4KH0B 5HO4A 1L3KA 3E51A 5KG0A 1T9VA 5F8HA 4QIWC 2E9TA 4A5BA 1CS4B 3H0PA 3DXKB 2RDIA 3D0IE 4X84A 2KW4A 2CDRB 4E0DA 4RUHA 3C15B 4QR1A 3AA4A 5A2QO 4FNHA 2IMWP 5KFRA 2E1AA 2Z2MA 1Q5YA 5KFSA 2G06A 2RAQA 2KU7A 2ZJ5A 2QT7A 4GV3A 2LU2A 1R8CA 1HBUA 2BE2A 2BACA 4E1NA 3HJEA 3V1OA 4GVBA 4IYQA 3HRGA 1XNRF 3MX2A 2AU0A 1V3SA 2QI2A 3IKMA 4DUYF 2B8QA 4IH7A 3H25A 4DU3A 4QIGA 2CQBA 5J2PB 3P4IA 1TKXB 4AQYK 4PHEA 5LMUJ 2F7TA 4R8UA 9ICEA 4CLKA 2CH5A 2JEJA 1RBRA 2I5JA 1NH8A 2BKEA 2D3ZA 4PZVA 1UW9A 4F91B 1A7GE 2V4JA 4WIIA 3C29A 1RTJA 3A5NC 4H0TB 3KLIB 3UNGC 4EU0A 3AM9A 1F3VA 8ICLA 3O6QA 4EBDA 1WWHA 4RQMA 2YKNB 3JSMB 1JN3A 5KFOA 4WU3A 3OR1A 1ASVA 1SB3C 3DOLA 3OS1A 4O5KA 1DQ9A 2HQCA 5C12A 5L1LA 3OSNA 2VONA 3QAUA 4EELA 4C7YA 1KQKA 1QAYA 1D5AA 1T94A 1GMWD 2B4PA 4OZJA 3RU0A 4DTXA 4PGYA 5HAOA 4CZFA 3UKRA 4Y2VA 1RDDA 1RTHB 1V4TA 3CCVN 4JV5F 3O5TB 1NJIO 1T95A 5I4MA 3T3FA 4DR2J 2XS5A 1A5XA 2YKQA 4JB8B 1ZPVA 3NKYA 4FJMA 5EE9A 1Q0NA 2KRRA 4LD0A 2FDNA 3M8WA 1X9XA 3CYMA 2UXDF 1EHWA 4NLKA 3D3CJ 2GC8A 5IILA 2KRBA 3SCIE 3K5LA 2NRTA 2A6OA 4PGQA 2IPOB 3TA1A 4CHZA 5BOLA 3M1YA 4RNOA 4FXVA 3KLGB 5F8GA 3BDPA 5L1KA 2DNMA 4I64A 1VQKS 4B3RJ 2O4IA 4IFVA 1MWZA 1PK1B 3H40A 4IFYB 3IRUA 5AZIA 3IA0A 3TU5A 4LF2A 3K59A 2F76X 4Y2QA 2DH7A 3S3OA 3ZD9A 2WOMB 4A8WA 1T11A 2LDYA 2M0NA 4ZVFA 3QT6A 2AZ3A 3MTKA 3KK2A 1AFJA 4P0PB 1RFQA 3P1GA 1J2NA 2KOBA 2XQCA 2EZYA 4FPBA 5IT9O 5E79U 3ISNC 3IG8A 3AVMA 2XS2A 3JYTB 3AUOA 1NSKL 5K5MA 2FYXA 2V34A 4OPAA 3MMJA 1ZQOA 3QWPA 3PX4A 4UOHA 4DCOB 3QMLA 5JTIA 2XMTA 4CT9A 2D4WA 4FWKA 1NOZA 5FPEA 3DRSA 2XB2D 3NGKA 4LQ3A 3IV6A 5DDQC 3MM8B 3LP0B 3G9CA 4DL5A 4USAA 1A6SA 1RISA 2GWSA 3KG1A 2FSJA 4Y28C 3M2RB 3NAHA 1WC4A 3KG0A 2PEBA 4GMJB 1Z4NA 2ESEA 4Y2MA 1XQSC 1YQHA 4CZLA 1D8YA 5HMLA 1BNPA 3NH0A 4C4WA 3LP1A 2RQ4A 3BN7A 4A8KA 3ZDAA 1U1NA 1NB7A 3OL9A 2LMIA 2N4DA 2YI1A 3JSBA 3TEGA 4A59A 4CJRA 3IG1B 3ZTPA 4YHHK 4W5RA 4LF7F 3MCOA 1E4GT 3PJXA 4ZLPA 3QEAZ 2LYHA 3I8BA 2GIFA 3ISZA 1EQMA 3RB6A 2HWHA 2KHCA 1FA0A 3CD7A 1YJWS 1VQ7N 4OLPA 5J2QB 2N3LA 1HBOB 3MXMA 3CWJA 2O8EA 2RS8A 2VC0A 3LYSA 3GIKA 2BA9A 4QYZK 3VQPA 1VRTB 4FE3A 4Z4CA 3BKTA 4IDHA 1F5SA 2C2OB 5F3ZA 1FFVA 1UAXA 2W40A 3OT9A 5DQHA 1L3VA 4XPCA 3SQOP 1KVIA 4OZ3A 1TL7A 5ALVA 1X66A 2LKZA 1P6TA 1P8ZA 2M5YA 1B9FA 2XG8A 2GJIA 4EUVA 4DLEA 1EWQA 4Z6DA 4ED6A 3RR8A 4LRAA 1FK9A 4CH7A 4XIUA 1GLBG 9ICCA 1H0HB 1T9XA 3KMSA 4M0AA 2ZNZA 2G5HB 4I29A 2F63A 3G82A 4ED7A 4OYPA 3MWPA 3E3XA 3J81O 1F3FA 1JLQA 1GOCA 3MEEA 2NV3A 1UMJA 4FF3A 2B8PA 4ES3A 3U3YA 1CXUA 1OO0B 4BY9C 4K59A 1X6IA 4YNQA 4IG0B 2D6FC 3MABA 1HNZJ 3KVGA 4DU1A 3TYTA 1KVAA 1T9YA 1RABB 3SEIA 3MCNA 4DTPA 4EO8A 4PG6A 3RSEA 1PYOB 2JGUA 2WAQF 4MYTA 1U2FA 3CC2S 3MM5B 1FFSB 1WN7A 5CY4A 3GJTB 4QPTA 4LBPA 3AO2A 3NNAA 1RT5B 3SYZA 5GTIU 1IUJA 1Q7YO 5DDRC 1VBYA 1BQMA 3E66A 4UOGA 4E7IA 5J0QA 2JFDA 1N62A 1BISA 2P6SA 2R7SA 3V2UC 3IO1A 4QWBA 8ICVA 1ZBIA 4Y2KA 4NYZA 4YCXA 2LYBA 3OTQA 3AJ1A 3DDIA 4URGA 5EOYA 4FSVA 1WSVA 3D54A 3HW8A 4JV5K 3VVUA 1ZBSA 1ZBLA 1U9LA 3QIOA 4F0MA 2KIVA 1PAUB 2NXJA 1RDWX 3H8MA 4JKAA 1HD0A 5AKXA 4CGZA 4QIWF 2DGTA 2BR0A 1UWAA 2U2FA 1XQIA 2IM3A 3T19A 3C14A 4L75A 4O0IA 1VQNS 1BUXA 4RBVA 4FJNA 3ALRA 1NZPA 1WWVA 4DR2F 2XZWA 4DWIA 2VFSA 3SI8A 1OVQA 3J7YU 1VQ4N 5A0YB 1JUDA 1AZSA 4DV4K 4GVMA 4LSLA 3QU4A 3BS5B 1X7VA 2NS1B 1U24A 4AUKA 1YGYA 3ZETB 1NH7A 3QATA 1U1PA 4WQ4A 1FHTA 9ICSA 1J54A 2NQPA 3H8SA 4B3RF 3QUBA 3CC2N 3L6QA 2XNRA 2NO5A 1ZQEA 3TRGA 2WONA 2EH9A 4Q2MA 1XSPA 5AM1A 1KLNA 1L8LA 3ILLA 5K8PA 2HHQA 3N4WA 1OVYA 1XTZA 2R8GA 2D9OA 2ZWOA 2F8SA 2V2VA 1PGZA 2E88A 3CMAS 2K60A 1NCLA 2APOA 2E4LA 2RHSB 3SMSA 1Q86T 1EO1A 3B78A 2XMWA 3NY0A 2O8FA 4I2AA 4MIAA 3NGYA 4C8OA 5A6WA 3VQAA 3N5BA 2MLYA 4DQIA 1D09B 4USUA 2XWXA 2B56A 1KL9A 1JROA 1HR0J 1Q79A 3RAXA 4DL6A 1VQNN 1U2VB 2KXHA 5E3CA 2R8KA 4KH6A 3A4TA 2P9NB 1JI7A 4DDFA 4K0KF 2Y3YA 3VEYA 2HHXA 4HHUA 3M8ZA 4ANEA 5KAKA 2WW8A 3MMVA 3JPSA 4DV2J 3LM9A 2XYPB 3HDSA 5GAEI 3W2VA 4I2QB 2VBXA 5EGYA 5A8RB 2W42A 1OY8A 1CC8A 4WQ4C 2VBYA 4F36A 1FE4A 4U8VA 3ZSRA 1HL6A 9ICOA 1FJGK 2B0GA 3VGUA 5F41A 1RLDA 5HQMA 1CJUA 2BQRA 3OV7A 1W97L 4FVMA 1CXQA 2R4FA 4TXSA 2YPZA 1VRUA 4USVA 4ZVOB 4HCBA 4M3XA 4M5JA 4ISGA 4WJBA 1BQNA 3CMAN 4LIWA 5EHHA 4PXEA 3KFWX 2FE9A 4O4GA 2AEMA 1Z25A 2MGZA 4TYBA 3KLEA 4GLXA 5ALOA 1LK7A 1QTMA 3I9ZA 4M6WB 3I0SB 2P35A 2VQEK 5BN9A 4URSA 3NHGA 1R8HA 3NF6A 4F7VA 3KLHA 1XHZA 1Q18A 3MK6A 3EX7B 4JI8K 2P5OA 4HKQA 1M5KC 2M70A 2VFTA 3CIMA 2IDEA 2QFIA 3G8SA 5AQIA 4F0KA 4RUAA 4DOCA 4M5MA 4UTGA 4MFFA 1M5HA 2K1RB 2WBRA 3AJ2A 4UOCA 5ALLA 4F02A 3NF7A 4IOAL 1ZBFA 1P7DA 1HHQA 2ZVIA 2GZOA 3J7ZO 2W2QP 1HYSA 1ATSA 3THPA 4E1MA 4JI3J 3CJTA 3LALA 2HBZB 2IRYA 1HJOA 5B0FA 2DNRA 3KKSA 4Q8EA 2G0JA 4NLWA 4USWA 1TAQA 2HHTA 2ZHBA 3NGSA 3ZTOA 5F3XB 4KV8B 2EVZA 2DQNB 4LF5F 1R89A 2CZ9A 3M2VB 5D4BA 3EGNA 1WNEA 1SWWA 3EZUA 2HF3A 2CPZA 3UD4P 3AVFA 4P2FA 3UM9A 1YJRA 3SSSA 2P9IB 5D4LA 2VPYB 5ITHA 1ZM3A 4OI1A 2YX4A 3L2QA 1XMQF 4YQWA 3V6DA 3ZSZA 1Q5VA 1VQSA 3R5JB 2W25A 2GEMA 3ENWA 4W5QA 1M1KT 3E9PA 4WQ5C 4M3RA 1YVUA 1J2MA 4DCHA 3VZIA 1ZRNA 2CN1A 2JNJA 1SC4B 4BC9A 3R6LB 5D0RA 4H0YB 4DQPA 3J81j 3K7RA 3V4IA 4ED5A 3M8PA 2HRTA 4B9QA 3X3UA 3W5ZA 4WWSA 1N52B 3MUVP 2PIIA 1G99A 1EP4B 2FXUA 5J1EB 1JLGB 2I9GA 4B9MA 4P75A 4H5TA 3O8WA 4R65A 1ZQCA 1UA0A 1CC7A 2BH1A 5KG1A 1PG5B 1NGAA 4M5IA 2QB0B 3EO3A 1SIJA 2ZC3A 3DLJA 1XWLA 3NH1A 1HNXK 1M90T 4TY8B 3CQYA 1Y7PA 2VFUA 5HMMA 2DPJA 3H42A 4CIOA 4JI4J 4LR7A 3L3UA 1UEKA 2HFSA 4JV2A 3RBXA 3GU3A 1HNVA 2GUPA 2NREA 3H5XA 4F5QA 4X66K 2HOQA 2I1RA 2LKYA 4C23A 4NXMK 4CYUA 1NNLA 9ICPA 2XI9A 1N36K 3CJ0A 4M3UA 1QHTA 4P2XA 4BC3A 3I28A 4OKKA 1FFUA 2PD1A 4Z4IA 4DEZA 2WZ1A 1UPHA 3UNYA 1F60B 4GV9A 2UXCK 3A8IA 3HULA 1T9UA 4C2MA 2CRXA 3F0NA 5AE1A 3WDOA 2W3SA 5J2IA 3MECA 4AH9A 1WD6A 3KHYA 4CEAA 1YLXA 4OV1A 4RCHA 4CK1A 5DG9A 3DU5A 3W62A 3LWMA 3FCHA 4CGHA 2CYYA 3O3FA 3PFEA 5B7WA 2B9YA 1L7NA 2P2CB 1WF2A 2DXDA 3C8YA 3U1LA 2HWTA 2JWLA 4AXIA 4A62A 2NUBA 3TPQA 5C25A 2O8DA 5C0YA 2I2YA 2RILA 2F8EX 1X4FA 2AH5A 1ZJNA 3CFRA 3GJRB 3KD3A 4CZCA 4KHMA 2RSQA 2VKZG 4NLDA 4YB1P 1B22A 1NKEA 2GCFA 3KLFB 3ZSOA 2G2ZA 8ICXA 2FY8A 3LO3A 1KKHA 1HR0F 3TUPA 3T5HA 2OPRA 2BKOA 1BA1A 4ISEA 2E44A 4YXJA 1RP5A 4GNIA 4H54A 3WIVA 1PVPA 1RHRB 4Y00A 2PA8D 1COKA 1XS9D 1Q81O 3M8YA 3BF1A 5F1XA 1RT2B 3EXYA 1X5PA 2IOHA 3GILA 4CQ1A 1UPMB 3NBPB 2DHHA 1LXNA 1RT7B 3TTFA 2B0CA 2FZKB 4PG5A 5LXRA 5KFHA 3DMJB 1K8KB 3JTOA 2V8GA 4AFFA 3FEXB 5E41A 2VCPA 4A8OA 1ULRA 2NO4A 1U6BA 1RT6B 4A57A 3MOZA 4OX6A 4CWBA 4QNLA 4I2PB 4K8ZA 2V68A 2MKIA 3UD3P 3AU2A 1MA7A 2Z1JA 4TU8A 1HNWJ 2QXFA 3NP5A 3LPEA 1O51A 4RWXA 2WFAA 1LWEA 3L09A 3HX9A 1A0PA 2V51B 3VQEA 1S4FA 4MF8A 1NK8A 2HS3A 4G1QA 1RAIB 1KVBA 1HNIB 2XLKA 4AHCA 4YMOA 5KGXA 1ZC6A 3C16B 3SLCA 1CULA 4E19A 8RUCA 2XNQA 4F04B 1Q82T 3FMWA 5D3GB 5D4OA 1M1KO 4TUSA 4ANDA 4LVOP 2J8SA 4ELVA 1V3RA 2XSFA 4WBFA 1EXQA 1RTIA 3V9UA 3LDSA 2GHPA 1CJVA 1U8WA 1S7HA 2VJ5A 3I6PA 1VIXA 3F41A 3L3VA 2KK0A 1KAXA 1K5OA 5BR8J 3GONA 2D0AA 1ILYA 4K4ZA 4HTUA 2MZQA 5F2RA 1BA0A 1DRZA 2P6UA 1BWEA 2ISPA 2VG5B 4JI3F 5I42B 3AB4B 1I3AA 3Q8YA 2NRWA 2PFOA 4P4OA 1M90O 5G0RB 2M2BA 4M41A 1NJYA 4XRHA 2COLA 1FX4A 3ZSYA 2E5GA 4L73A 5HI7A 3U4LA 1T3OA 2BCUA 2MSTA 3L7OA 3PG9A 5IV3A 2DL0A 5JMVA 2BQUA 3W63A 4WF9L 5EDWA 3MM6B 2HBYB 3R1LA 1HW8A 3PFOA 1JKHB 3DDNA 1NDLA 4FLYA 3MFHA 3POTA 4LRCA 4DOAA 4CLUA 4LQ9A 1GLFO 2QSFA 4RW8B 4BVPA 2MHEA 3CM6A 3Q8RB 1MSWD 3TEHB 9ICRA 3NTUA 2QG9B 4KFBB 2B6AA 2KFZA 4X4NA 1VDVA 4O5FA 2KM8B 2Z2ZA 4RW7A 3ICXA 9ICTA 2Q3SA 3M9NB 3OFHA 3GB0A 4DOZA 4IL6U 5D4PA 3EE9A 3DYAB 2I9SA 3HCXA 3V81B 3E1YA 3MCAB 3DLBA 3Q0AA 3NVWA 2HMXA 4KN7A 3QFWA 1MWQA 4KHSA 2IVFB 2HS4A 3TUJC 4B3SF 2A3JA 3Q7CA 2YX8A 4LF6F 3VEVA 2DGVA 5AK5A 3UDCA 1RACB 1LW0A 4GKKK 2CPRA 4UAYA 4EP4A 2CQHA 1HQUB 4I27A 3T79A 3UKUB 5JJBA 2EKNA 3ILJA 3NCPA 4QOTA 2W9BB 4DUZK 3O6WA 4CGIA 2HQIA 2ZD1B 4IOXA 2ZH4A 2WVBA 5KG5A 1N32F 3DAWA 1N0UA 3VOVA 3L4BC 5DZ7A 2LYVA 1XSLA 1Z00B 3BKUA 4F50A 2RRNA 4BGBA 5A8WB 5KFLA 5HROA 5HLFB 3SQ0A 2F5GA 2M9NA 1RG6A 5T7LA 3GL1A 3BEGB 3D0HE 4DL2A 2ZVSA 1S6QB 2QB1A 4CLLA 1NUEA 1IR2A 1JIHA 1VQ6N 4FKYA 1RDUA 2AA4A 3DI6A 2ZQBA 2BDPA 4RTFD 1TK8A 4JYAF 1VQ8S 2EW9A 1UOCA 4NLCA 2RP5A 2GWKA 4CIEA 2HQFA 5D8HB 5K9FA 4ZITA 1C1CA 3HHDA 2YHYA 4NLRA 2GQ2A 2CAJA 1A5WA 1NU0A 5JLFA 3G71S 2D1KA 4CHPA 4HYKA 2ISOA 1UTAA 3PRVA 3VR1A 1Q82O 3R2DJ 3I55S 1YJVA 3QPIA 1WBBA 3KKFA 2YNGA 3UCZP 2AGPA 3L2RA 4X4VA 3O08A 3MFIA 1IXKA 1SPBP 1ATNA 5J2GA 3LP3A 5IIOA 2XHWA 2AZ1A 3HLUA 2W43A 4WXOA 5J2CA 5JXSA 4FJHA 3DRXA 1WG8A 1A9NB 2NPIA 3ZSQA 1HI8A 3WT0A 5KAFU 2F44A 3LPYA 1O5JA 4K42A 4M5LA 2DHGA 1KDNA 3Q8KA 2ASMA 4ZTFA 2QK9A 3S3MA 2YMPA 2QLBB 3JPTA 1WAFA 4K50A 4KYZA 1KEKA 4L3QA 1RT4A 3J80O 2WK4A 2WVDA 2HBQB 3HP9A 4FM1A 1HNWF 4WP9A 2E2OA 5J0RA 3AQFA 1R31A 3VEZA 4X62K 3S41A 3BO4A 4FJKA 2PMHA 1W7AA 4J9LA 3OFFA 3PRDA 2ZBPA 1N33J 2RRAA 3KJVB 5AJ3K 2LA6A 4C9DA 3E58A 4QR2A 4JUZA 3AVJA 3BZCA 4F2SA 4A8XA 2NNWA 2HFVA 2VZ9A 5I9EB 1RCOB 8ICWA 2YJFA 4F4AA 2XZTB 1OQ6A 4KTQA 3EPIA 1LW2B 1ZOTA 3NRZA 3QIPA 1GK8A 4QS9A 3G71N 3SMVA 4U95A 1I94J 4EHUA 5KG4A 1S9EA 1N5SA 3AEVA 4K4XA 3FC9A 1MWKA 4FM0A 4N8NA 3TW0A 8AT1B 4PL2A 2ZF5O 1S76D 2DITA 2QEXN 5J0YA 5ALKA 5HHHA 3UQ2A 1SH2A 4ZPTR 2FHKA 1B64A 2BZFA 3NVVA 5M1PA 5FD1A 2ZGYA 3CDWA 3AVNA 2XEXA 2B9WA 2GAHC 2RH3A 4OZ2A 4TUPA 4K7QA 4FNIA 2CPFA 3NWRA 1SC3B 8ICNA 1TL1A 1ZTWA 4LZDA 3BF3A 2LHTA 3FYHA 3JTNA 1NK0A 2YWFA 2QA4G 4KE5A 1QVGR 3QEBZ 3R5CA 4H03B 2CJQA 4BGDA 1VSKA 3G6VA 1EZZB 1NSPA 2K8GA 2CGLA 3HOSA 2HBMA 5AM5A 5JVHQ 3CJCA 2NXEA 2HHUA 1DK3A 2M7SA 4YR0A 1W2BM 3QLHA 2ZOGA 4CHOA 1ICEB 1OIAA 3AY9A 4DPUA 2B21A 4QR0A 2X7IA 3ZDDA 1S59A 3J8AA 1KFDA 1VYAA 4DQQA 1KEJA 4HACA 3NS7B 4NLNA 1Z1BA 2DVIA 5DM6L 2LQ9A 4KX5A 2WVFA 1ZBUA 2ZIVB 1KQSR 4LF8J 5M2PA 3T1HK 3W64A 3I4PA 4MKVA 1YRXA 4BDPA 4OX9F 1YHQS 1NHKL 5GADP 2C42A 3SV4A 4CJTA 4B3SK 3VCBA 2L5YA 4IXCA 2BHNA 2BPFA 3FCVA 2JGAA 1OY9A 2Z56B 2A1RA 1F5BA 3DEEA 2LQ5A 2F1IA 2LFVA 1NO8A 3SMPA 3M2UA 3B8AX 2HPUA 3CJBA 7ICMA 2YN4A 4DSKA 2XHCA 3PKYA 4KX3A 4NL9C 3CCSS 2CDQA 2MKJA 4I67A 1J5OA 3DOKA 1UETA 4QBUA 2V4JB 3EL2A 4M3TA 1VC6A 4HHJA 3GOIA 2KVSA 1QUPA 1WACA 2UZAA 4ZLLA 3WK6A 2DD8S 1ZM2A 4DR6K 2MRLA 5HMXA 3WXLA 4F4WA 4PABA 2MB0B 1GXUA 3OR1B 2V2QA 2W01A 4OYOA 4CK2A 4PKDB 3PYGA 2BYCA 3R5DA 4NI2A 1XO1A 3OTOK 4KGKA 1B0VA 3QEIA 3NNCA 2PBDA 2H4YB 4BRFA 5ETNA 4PEOA 8ICAA 2Q0ZX 4B1YB 4OZ1A 8ICGA 4PUOA 4JAXA 4LFAF 1G15A 5G5HA 4FXWA 1XI1A 4DFKA 5ALNA 5K8NA 4P6QA 2JWNA 3HYFA 5LMNK 3MDAA 3OFEA 2GHWA 3R1XA 2DRDA 4M04A 1QCKA 2DGUA 3ATVA 3MEDA 1L3SA 4JI6K 1GXTA 4CM2A 5D6GA 2VGNA 5DS7A 1R6VA 1JNRB 4JI1K 2CXEA 2OMOA 3H59A 1VK3A 3PEHA 3FLCO 3SQGB 1HMVB 1JLEB 1PCAA 4JMUA 3GR0A 1N6QB 1Z1ZA 3PIPQ 3VQ7A 4UB1A 4IFVB 3CCSN 4MFCA 4DPYA 3ZEUA 3H3OB 4RQ1A 4OZNA 4O8KA 3T5JA 2DXEA 3G2XA 3GPAA 3MCSA 4K5SA 4Q0BB 2VANA 3FR0A 4FLWA 2DNQA 4BACA 1NHVA 2IVYA 4BWJA 3WHIA 1XR5A 4US9A 2AYGA