3HT3A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus v713p mutant bound to g:dctp
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I, large fragment
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 208
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ht3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ht3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ht3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ht3A01
1RT5A 3C2KA 4M9HA 4DWIA 3GFKB 4LSNA 3M8SA 4FJGA 1RILA 1JXLA 3H4DA 8ICGA 4FLZA 4ICLA 4CE9A 1ZQAA 1C0MA 3MECA 8ICVA 1ZQJA 5K14A 4ED3A 5KFMA 4G1QA 2HVIA 4EP4A 4J2EA 3RTVA 3MFHA 3AO5A 4CEZA 9ICPA 3CFOA 4FJ7A 2E6MA 3Q8RB 1S77D 4FXDA 1S1WA 7ICQA 3CM6A 4FLUA 4K8ZA 2IBKA 2LYHA 3V9XA 1HYZA 3P1GA 5HRSA 4NXZA 1ZQKA 4DTOA 3H8SA 3OGUA 5IIJA 1R0AA 2YNFA 9ICIA 5DG9A 1VSMA 2R8KA 4ECSA 3IAYA 1GOAA 2QK9A 4M9GA 1S6PA 1WSGA 4M9JA 3VQPA 5CY4A 3SQ0A 4KLJA 5IIKA 4FYDA 3PO4A 2R8IA 3RH5A 5D46A 2A1JA 1A5WA 4W5RA 5DGAA 4KLLA 1ZQPA 5C24A 3RB0A 3NF6A 3K2PA 5HP1A 3OS2A 5HHIA 1KLNA 5J2KA 9ICCA 4CF2A 3GIKA 4YFUA 5KT4A 4I2AA 4DTSA 4XUSA 1BVSA 9ICVA 3K57A 2AGQA 4JV2A 2R7YA 4FW1A 3ZSXA 3TI0A 4I29A 1RPLA 3C94A 3T5JA 1B9FA 2OPQA 4YD1A 1RBRA 2FBVA 3UXOA 1CZ9A 4ZH4A 4YR3A 4C8OA 3V9WA 4CCHA 4I2DA 1CXQA 1KSPA 4OVLA 4MF8A 3H7IA 5J0TA 2VA3A 2Z1GA 8ICOA 3TAMA 3KLFA 4CJRA 1TKTA 3HL8A 3DM2A 5CHGA 1ZBLA 3C21A 2Y1JA 3AUOA 4DU3A 1XWLA 3EZ5A 4CHYA 3OYHA 4K4GA 4FJ5A 1PZNA 4EP5A 4DMNA 1D8YA 1WNSA 1MQ3A 1EXQA 1ZYQA 4KV8A 2F1IA 5EOZA 4F8RA 3ORYA 2O4GA 3LPUA 5FDLA 1T03A 4E19A 3KLIA 2PFQA 3ALYA 1UOCA 3SJJA 1VK0A 5HRPA 3ZDBA 3T19A 3AVLA 4QZGA 1BQNA 1ZQTA 4C8NA 2BPCA 1QTMA 3Q8KA 1QHTA 3M8PA 2W9AA 4E1MA 5HRNA 8ICNA 1ASWA 3HPGA 1ZQUA 7ICMA 3S3OA 2J6TA 4O3QA 2P5OA 4J9RA 2ZD1A 3CM5A 4CF0A 3SUOA 1IKXA 4IFVA 3VQDA 3V6DA 3CFPA 3PW2A 1C7YA 1ZQVA 2DTUA 5KFOA 3H08A 3AVIA 1S10A 2DPIA 2HHQA 4B3OA 5DBAA 3NTUA 3SPYA 5L1LA 9ICQA 4P4OA 5HP4A 4IR1A 4Q8FA 3E2EA 3RMAA 4FBUA 4DU1A 1HJRA 1ZQQA 2W9BA 5KFAA 4CHNA 7ICHA 5BPCA 3LP0A 3LWLA 2BQUA 9ICMA 4RZRA 5KFNA 1RT3A 4ED6A 3K5OA 1RT2A 5DQIA 4GXJA 2XY6A 4DQPA 5HMLA 3PV8A 2WOMA 1JXBA 1BPXA 4KLHA 4HHTA 1Q9XA 1Y97A 3ZT1A 4ELTA 2V4RA 3OYKA 1ZQXA 4Z4IA 7ICKA 5HLFA 4CF1A 4RW9A 4KLOA 2JEGA 4XIUA 4RW7A 1B92A 1MC8A 3ZT3A 1LW0A 3O3HA 4E89A 5J0YA 2HB5A 1DTTA 3SYZA 5DLGA 4KAZA 3K5LA 3VA0A 5KFEA 1Z25A 2KFZA 1TL1A 1CEZA 4M3UA 3MXMA 4HUFA 3OSPA 2HHWA 3S3NA 1ZQWA 4RPYA 2BCRA 4BACA 5C5JA 3C2LA 4I7FA 4DTXA 1BCMA 4LVSA 8ICWA 4QWEA 1VSIA 3U3GA 4I28A 1SL0A 3E01A 1TK5A 3KLGA 3V9SA 3NDKA 3V6KA 4EYIB 5L1JA 4W5NA 3SQ4A 3KIOA 1VSLA 2JEIA 3IRXA 4AHRA 5KRTA 3RJFA 1TVRA 3M8RA 4M47A 5KFBA 3AA2A 4ZHRA 4DL2A 4CHPA 2FPMA 3B0XA 1NJWA 1RTHA 2P51A 4CJ5A 2R8GA 3RMCA 2BGGA 1XSPA 3RH4A 1Z00B 3OY9A 2C2EA 4LZDA 2Y1IA 4DTPA 4KLGA 1EP4A 3AU2A 1IM4A 2KFNA 5J0UA 4M45A 3HO1A 1X9WA 3JPQA 4PWDA 2C2RA 3QEPA 1ZBHA 1T7PA 4DL7A 4F4WA 3Q8LA 4CESA 3QEWA 4M04A 5DMRA 4FVMA 3NGYA 2VG6A 2PYJA 1RT6A 3QO9A 3SI6A 5KFVA 3V6HA 2ZUCA 2I9GA 4F91B 1SL1A 3V9UA 1XSNA 2F8SA 7ICOA 1U48A 3MABA 3ZDDA 1IH7A 1TKXA 4JK1A 4QZ9A 1YTUA 3RWUA 3MDAA 1TAQA 1KVBA 3K58A 4QZAA 1QE1A 3ITHA 4CJVA 8ICYA 3QEXA 3AV9A 4KLFA 2G8VA 2RDJA 5KT2A 3GIJA 3NF7A 7ICEA 3DRRA 2NRTA 4FLXA 2NRVA 2FC0A 4E7IA 1NJYA 1ZQEA 4OGEA 4Z4CA 2D5RA 4AHVA 5J2EA 3C2MA 4FJXA 4DQSA 3C23A 1IKWA 1VRUA 3QETA 4UAZA 1HQEA 5J2DA 3Q8PB 4CEQA 4ECXA 4OKJA 4PA1A 4ZTFA 5KT3A 3DLRA 2OA8A 4RU9A 3D0PA 3WNGA 5JS1A 1NOZA 3L3VA 1LWEA 3LZIA 3CYMA 3MR5A 5DKWA 4EBEA 2W8KA 3IG1A 2FMQA 3H40A 2A1RA 5DB9A 1ZETA 4FBTA 1NK8A 3EWAA 1RDDA 4I2QA 4HYKA 3KKRA 3ZSWA 3KLEA 2AJQA 3MAQA 4NCAA 9ICXA 4NLGA 1JLCA 4CF8A 4KN4A 4I9QA 1U9LA 4PQUA 2ZTEA 4OPJA 4CEFA 2HMIA 3OS0A 3OYGA 3VA3A 5KFIA 4RQ8A 2GUIA 1QLNA 3BDPA 4Z4HA 3KD5E 2VWKA 1V9PA 2XCPA 4FLTA 1QQCA 2JGUA 4JS5A 1TKZA 4AHSA 3T3FA 3QZ7A 4KHNA 3VQAA 1Q9YA 5KFDA 9ICGA 3NH2A 1FXXA 2FPLA 5JUMA 2G8WA 4KLQA 2B6AA 2MUTA 4ECQA 1J9AA 4B9LA 1S0MA 4Z0UA 3BQ1A 2HNZA 1KRPA 1JL2A 3VQ9A 4FLYA 4C8MA 4FS2A 4NCBA 4B9NA 1UA1A 3ZT2A 3KHLA 2AGOA 4I2HA 2B4JA 9ICHA 4YP3A 4TQRA 3ISBA 3UQ2A 3EPGA 5DLFA 4QCLA 7ICRA 4I2CA 2X74A 3LP3A 4M3YA 3GV5B 3UIQA 2BQRA 4Q44A 4QWAA 3GV7B 3RAQA 3AVJA 5HBMA 3MEGA 4JV0A 3RB4A 2IDOA 1ZQZA 7ICLA 4IRKA 3F73A 4GVMA 2OPSA 1MSWD 4F5QA 4CIGA 4FO6A 4CFBA 1ZQBA 4DSIA 2HNDA 4IFYA 4J9LA 4CGJA 1RYRA 2WONA 4CJFA 4F50A 3FYHA 4E7LA 2EHGA 2DFEA 4KLDA 4ED8A 4QZEA 4CECA 4BXOB 3OYJA 8ICPA 4ED7A 3MEDA 5EWGA 4OPKA 4RUAA 3C5GA 3JPPA 3NGIA 2D0BA 4QZDA 2BGWA 4O3NA 4TURA 5DBBA 4R8UB 1D9FA 3ZCMA 4X5VA 3MDCA 2BE2A 3K5MA 3QEIA 3G0ZA 1KTQA 2W9CB 4UB2A 1BPDA 5KFHA 4Z6DA 1NK6A 5BOMA 4MEYA 2OYQA 1XS9D 4R65A 1RDBA 2PY5A 3GIIA 3PX0A 3LWMA 3NF9A 4UB3A 4GC7A 3ISNC 4DSKA 3SCXA 1CZBA 1X2IA 1KFDA 3SZ2A 4CJQA 4ECVA 1RBUA 2AQ4A 4B8AB 5CYMA 4CEOA 4FZXC 2OZMA 4J2DA 1X1PA 2VG5A 4AHTA 4BDYA 1IO2A 4DTRA 4LZGA 1JKHA 3LPTA 3C95A 3ZT4A 2P6UA 3NH0A 5KT7A 2IGIA 4K4HA 8ICHA 1G15A 4MF2A 3PX4A 4RQ7A 5KFQA 1L3SA 1TVAA 4M3ZA 1ZQGA 2UVWA 3ISCA 5KFPA 3MR2A 1CUKA 4XQ8A 3RJEA 2G8IA 4DEZA 3HK2A 2KZZA 4KHSA 1RBVA 1NOMA 4BWMA 1FKOA 8ICTA 4EZ6A 3RJGA 1VSDA 4Q8EA 4R64A 4RUCA 5KFSA 2UVRA 2OZSA 4B08A 4RW4A 2XCAA 2UVUA 4EBDA 5KG6A 1BI4B 2JZBB 4NLKA 9ICTA 5CP2A 5J2IA 3SQ1A 3GDXA 4QWCA 1NK7A 3KHGA 1XSLA 4ED0A 1RT4A 4WE1A 4R5PA 2ASJA 7ICNA 3I8DA 4Z4EA 4F92B 1S9FA 9ICSA 5DDYA 4KTWA 3S9HA 5J0OA 2HHVA 1HNIA 4DL6A 4I2GA 4DG1A 4PY5A 1VSEA 3BQTA 5KFLA 5J0SA 1C1BA 3OVNA 5KFWA 2FBXA 3NHGA 3KJVA 3C6TA 4E7KA 5HROA 5CR0A 5E41A 3TARA 4QZCA 4TUQA 5D49A 4DOBA 4UBCA 3Q8SB 1D9DA 2VA2A 1I39A 3DMJA 5J0PA 1Z3EB 4RT3A 3DLKA 4YQWA 3RRHA 3MFIA 4O55A 3AVHA 7ICIA 3GQCA 1YT3A 5KFFA 4EZ9A 1SKWA 2VA8A 2ISPA 2O4IA 2ZE2A 3I0RA 4ELUA 4J2BA 1U45A 5KFJA 3M9NB 3MBYA 2HHSA 3BGRA 4J9NA 3KTQA 2BCUA 4QZBA 3V1QA 3RR7A 7ICVA 3L2WA 4Y1DA 5TZVA 1Q8IA 3U3YA 1REVA 2PXIA 3QE9Y 9ICUA 3Q8MA 3ZDEA 5DG7A 1A5VA 4QWDA 5J2MA 4B9TA 3CQ8A 2QXFA 5J2JA 3T5KA 2G8HA 4FJJA 5EWEA 1RT1A 3VQEA 4OKKA 4ED2A 4CEEA 3PW0A 2NRZA 3SPZA 1J53A 1NJXA 4E7JA 2F96A 4LSLA 5CB1A 3L3UA 4DOAA 4FJKA 2FBYA 5CA7A 1XI1A 2PYLA 2DFLA 4N56A 3IS9A 3EYZA 2R8HA 4J9MA 3KHHA 1ZQHA 3TAPA 1RT7A 3JPSA 3PVXA 2IC3A 4HCCA 2QKBA 1J5OA 4DL4A 3V4IA 1LWFA 2YHBA 3ZSYA 5KRSA 2YV0X 5DB8A 1U49A 2C22A 2P6RA 4CFCA 3OYEA 4H4MA 3RJKA 1KVAA 3NGDA 1S9EA 2YHAA 4DSLA 2FBTA 1FK9A 4QWBA 2XY7A 1WSIA 3V1OA 4DQIA 3L2VA 2XGQA 1B22A 3JPNA 1IKYA 4RW8A 4YN4A 1HYSA 2NRWA 2F1HA 3H4BA 5D4BA 3AVBA 1T05A 5CWRA 1LV5A 4O3PA 4JWNA 1HUZA 1B43A 3TABA 4MFBA 3O3GA 2DY4A 4F2SA 4O5KA 1XHXA 2HW3A 4DS5A 2W9MA 3PMLA 4YCXA 4JWMA 4IG3A 3OYBA 2BQ3A 3PO5A 3LK9A 3VQ6A 5J2BA 4FJNA 4E0DA 4IQTA 1WAJA 4YD2A 4YVZA 5CJ7A 3LP2A 4KTQA 5KG0A 4M3RA 1HRHA 3CG7A 4FK2A 1TGOA 2GBZA 4W5QA 4GXIA 3ZD8A 4M3TA 3V81A 4PGXA 4B9MA 1Y88A 4M2YA 4UAWA 4DOCA 4RQ6A 1S0OA 5I3UA 2BHNA 5KFKA 3OYIA 2ATQA 2YNIA 5J2CA 4YG2A 4Z6EA 4DTMA 1X9SA 1COOA 4RQ5A 4I2PA 3UPQA 2PI5A 4UQGA 2ZQBA 4UB4A 1L3UA 1RXWA 1EX4A 4CK3A 3ISDA 1S0VA 2C2DA 1EETA 1BISA 5FRNA 2PFPA 5D3GA 3TFSA 3TAFA 2X78A 3O3FA 1B9DA 5J2NA 3ZD9A 4O0IA 1BIUA 1JX4A 1NJZA 4OLBA 1JLBA 4OGCA 3AVFA 3HP6A 4NCGA 3NH1A 4Q0BA 3AVCA 1ZQFA 1QSYA 4F5RA 2OPPA 2I5JA 2MAXA 1BL3A 4F4XA 1RXVA 8ICSA 2ASDA 1NKBA 4DF8A 4QZHA 4DTNA 4B9VA 4EEYA 1W9HA 4DLGA 2ZUDA 4M3WA 1S0NA 4HCBA 1BHLA 4J2AA 5SWMA 1VRTA 3DI6A 2KN7A 1EXNA 2QKKA 3HM9A 8ICIA 2FMSA 3VQQA 3WNHA 3HPHA 5L9XA 1ZBFA 2NRXA 4DL5A 4J9OA 1S6QA 5DGBA 3NFAA 4YXMA 4PHPA 4O5CA 3SNNA 2P66A 5DB7A 4FJIA 3LAMA 3HXMA 2H5XA 4FJLA 4ECYA 4KHUA 4GLXA 5KFYA 1BCOA 2RN2A 3QEVA 4GXKA 2LSNA 2XY5A 5HNKA 3OYAA 3DLGA 4KRFA 3QESA 3RJHA 3RMBA 4DSFA 3KD1E 1RZTA 1F21A 2AQ0A 9ICAA 1DLOA 3AVNA 8ICQA 4C8LA 4F4KA 4FZZA 1VSJA 4IQUA 1HQUA 4LH4A 2ZUBA 4OJRA 4KI4A 4GW6A 1NK5A 2GWSA 3PW5A 2BCVA 4H4OA 4MFCA 1LAWA 4Z4GA 1IKVA 3AVKA 1ZQCA 3RB3A 2RKIA 4N41A 5J29A 5EWFA 4CJSA 2C28A 2IHNA 4E1NA 1L3VA 2KQ2A 2Q3SA 4RQ1A 4O0JA 3VQ8A 4F4YA 1RTDA 1H38A 1T3NA 4DLEA 3OHBA 3NBPA 1RBTA 1RDCA 3I0SA 2ALZA 8ICAA 8ICBA 1N56A 3QIOA 4FLWA 3LALA 4PHDA 2KZ3A 4IQVA 2D0CA 1TV9A 1ZQOA 7ICSA 7ICTA 2V4QA 3QERA 5DK5A 4BXOA 4NY8A 3RR8A 2EX3A 4PGYA 4PPXA 3PW7A 5DBCA 2HNYA 5J0XA 2IMWP 3JYTA 2NUBA 4F5OA 2BANA 4P4PA 1QSSA 1DGSA 4XA5A 5T7BA 3EY1A 4R8UA 1S5JA 4W5OA 3UQ0A 1DOQA 5KTQA 2HHTA 4JRQA 3ZSQA 1S9GA 1JXEA 4M9NA 2W9CA 4I27A 9ICEA 5KFXA 3MR6A 2FPKA 4UAYA 1EKEA 4BE1A 3K5NA 1WSJA 4P2HA 4CJLA 1N48A 4KTZA 5KFTA 1GOCA 3ZDCA 3AA3A 3FFIA 1TKDA 3TANA 4B8CA 4FJHA 3QEBZ 3TWHA 7ICGA 5F9LA 4CJ4A 4KFBA 1SV5A 4IRCA 3LZJA 1BGXT 3NCIA 3T1AA 4ID1A 4M41A 4BE2A 5F9NA 3TAQA 1ASUA 2M9NA 3OJUA 3SI8A 3OS1A 2XGPA 1S1VA 4FS1A 1SUQA 3S3MA 4BE0A 3QEAZ 4YMOA 4I2FA 4CK1A 3KKSA 4O3OA 1LAVA 4CGHA 3SQ2A 4N5SA 5CZ1A 5I42A 4CEAA 2Z1JA 4JUZA 8ICJA 4CEDA 3UXNA 1S76D 3O4NA 1BPZA 3OYDA 4FLVA 2E6LA 4DSJA 1IG9A 1BPEA 4CHZA 4F4ZA 4YR0A 5J0WA 3OYLA 1HMVA 1XO1A 3M8QA 2HVHA 2BPFA 1KFSA 1SL2A 3GV8B 2ZJ8A 5KG3A 2P5GA 1UT5A 1KLMA 5J0RA 1TAUA 1CLQA 1ITGA 4QZFA 5KG7A 4PGQA 3G6YA 1GOBA 5FRMA 4DFKA 5HHHA 1TK8A 4QOZB 1BI4A 2JZBA 2JLEA 1U04A 3IM1A 5KFRA 4N76A 2XHBA 5EU7A 3AU6A 4MFFA 4NYNA 4IKFA 4YMNA 3WNFA 3BJYA 5HRRA 3Q8QB 4CHQA 1BIZA 2KZMA 1SZPA 4ECUA 3V7JA 4KLEA 4IQWA 3MEEA 1U4BA 3K59A 3VQ7A 2W42A 4NLZA 4ECTA 2J6UA 2DFFA 3AO1A 3ZSOA 1WSFA 3SUQA 1NK4A 3V7LA 1JLGA 3TFRA 9ICNA 4G3IA 2VG7A 3MGHA 3PMNA 4KMUA 1HUOA 1VSKA 5KGWA 2D0AA 3L8BA 4GMJB 2B5JA 4J9KA 1HYVA 1ZQRA 4M6WB 4O5BA 1NOYA 1JMSA 2IHMA 1I3AA 3T5HA 4Z4FA 1ZBIA 3HVRA 2YNGA 1D8LA 2A1SA 3OSNA 1WCNA 9ICJA 3AA5X 2YKMA 1N5YA 1WSEA 4LD0A 1YVUA 1TL3A 3ULDA 5L1KA 8ICCA 4OLAA 3FDSA 9ICFA 4UB5A 1T8EA 3OYMA 4DTJA 4RPZA 4FJ9A 3OYNA 2W8LA 3V1RA 1QS4A 3UXPA 3MR3A 5KG1A 4CJTA 4KPYA 4O5EA 1HNVA 3G6XA 2J6SA 3OHAA 4UB1A 4MFAA 1C1CA 3AA4A 4L8RB 3TQ1A 3WNEA 3V9ZA 4DO9A 1SKRA 3RJJA 5CYQA 2ZJAA 3GIMA 4DS4A 2Q0ZX 3PX6A 2FMPA 4ID5A 3PR4A 3N97B 1K6YA 4J9SA 4JS4A 4W5TA 3DRSA 5KFUA 2IA6A 2IS3A 4IBNA 3QZ8A 2ITGA 1ZQLA 1L5UA 1AROP 1MQ2A 1RNHA 3MXIA 3RH6A 4DSEA 3AO4A 3G6VA 4KLTA 2X6NA 1N6QA 5IIIA 5J0QA 2F1JA 4ZTJA 4B9UA 4I2JA 1UAXA 4AH9A 4F93B 1JL1A 1KCFA 1C6VA 3V7KA 1ZJMA 2VANA 1ZQYA 1HJPA 4J9PA 2A1JB 1WSHA 4UBBA 4CGDA 4AHCA 4RQ4A 4JRPA 4KLMA 4K4IA 4O4GA 3ZSRA 3TAEA 4OKEA 4KHQA 4XRHA 1UWBA 3RBEA 4JLHA 3DOLA 4YFKA 3PY8A 3OYFA 1UT8A 1RBSA 4CJEA 1TFRA 3C1YA 4P4MA 1X9MA 3QIPA 2BCQA 1S1UA 3PR5B 3VN5A 2RF2A 9ICRA 3VQ5A 3HWTA 4R63A 4AHUA 5L1IA 4YNQA 4DFJA 1IXRA 3BQ2A 8ICMA 2ZTCA 4CIEA 1ZQMA 3U6FA 3K75D 3OYCA 4BDPA 4CGGA 3PW4A 5IINA 3DOKA 1O1WA 3HVTA 3RMDA 1RCHA 3PUFA 8ICZA 4RQ0A 2DPJA 1NK0A 3B0YA 5IIMA 1C1AA 1ASVA 4J9QA 4I2EA 3VQBA 4O3RA 3DLEA 3K4GA 1XHZA 2PFOA 4IRDA 5KFCA 3NF8A 3ZDAA 4KREA 3TAGA 2RDIA 4KLUA 1JIHA 2HHXA 4ECZA 4KLIA 1LB2B 3M9MB 2ISOA 5KFGA 1CXUA 2AU0A 2X6SA 3SUPA 1WN7A 2DFHA 3V72A 4NM1A 4CFDA 3LANA 4RNNA 1KDHA 4Q45A 4TUSA 3MGIA 4TSXA 3DRPA 4FW2A 4ECWA 1Z00A 5KFZA 4JV1A 1NKCA 3AVGA 3NGZA 2ATLA 1UA0A 3P83D 3HSTB 4RQ3A 1MU2A 3HJFA 4IDKA 4I9LA 4AILC 3DYAA 8ICXA 4FCYA 1RTIA 4RPXA 3L2QA 5KG5A 1J54A 2KTQA 5FROA 3RBDA 2IOCA 1JLAA 4GC6A 1U47A 4LH5A 4CJ3A 4KITB 5J2AA 3LAKA 3JPRA 3ZSZA 4RQ2A 4PHEA 2OWOA 4KHWA 3T5LA 5KT5A 2R8JA 2FLLA 1BQMA 3VQCA 5IIOA 8ICFA 8ICKA 3A2FA 3KK3A 4BGDA 2W9BB 1W0HA 3ETLA 1WLJA 4QZIA 2F8TA 1DTQA 1VSHA 3HP9A 4HUEA 4YR2A 3RB6A 5KGXA 5J2QA 4DQQA 4DQRA 5HMMA 4Z6CA 4R66A 3QNNA 4KLSA 4RNOA 1A5XA 2G8KA 4KI6A 9ICOA 3B6OA 4I2IA 2WTFA 4YXJA 3G10A 1A77A 3RJIA 3JPTA 4E3SA 2BKEA 5C42A 4FK4A 2ASLA 4MEXA 4CK2A 4H8KA 1ZJNA 1LWCA 3HYFA 1RTJA 2Z1HA 3AO2A 2ZJ5A 3AO3A 1NKEA 4RW6A 4NM2A 1WAFA 4CF9A 4BWJA 3LP1A 4F2RA 4LY7A 3LDSA 8ICRA 2XY8A 4Q5VA 3MXJA 5JS2A 4FM0A 3CFRA 3B6PA 5KG2A 3HW8A 8ICLA 1JLEA 4M42A 4PHAA 4O44A 1ZBUA 1HPZA 5DQGA 5BOLA 1KFTA 1BPBA 3RAXA 4DF4A 4I2BA 1Z26A 8ICEA 2PFNA 4FJ8A 1RDAA 4MQ3A 3P5JA 3HT3A 5J2PA 3F9KA 2VWJA 1NK9A 4Q43A 3SV3A 4E7HA 4F5PA 4DL3A 3C5FA 1LW2A 4HTUA 4K8XA 3H8JA 1ZQSA 1JN3A 1FKPA 2IAJA 4FJMA 9ICLA 4PH5A 1ZQIA 4FM2A 3KHRA 3D45A 2BPGA 4C8KA 4QAGA 4O3SA 4KB0A 5J1EA 2FLNA 2E4LA 4FK0A 3DLBA 2UVVA 3BQ0A 2XC9A 4CJKA 7ICFA 2I1QA 3M9OB 4QW8A 1L3TA 3N4MB 5DG8A 4N47A 4ELVA 5J2FA 2HHUA 1TK0A 1C0TA 3ZSVA 3HX0A 2ETJA 2ZTDA 3DLHA 4F3OA 3H8WA 3ASMA 4BDZA 3KLHA 5J2GA 4CIFA 3OJSA 5DQHA 2YKNA 9ICBA 2RPIA 4EBCA 3VQ4A 2KW4A 4M0AA 1WCLA 2BCSA 4CFAA 5DDMA 2JEJA 1VSFA 4NYFA 3V6JA 3L2RA 1SKSA 2G8UA 4CGIA 3QINA 2PZSA 3THVA 1S1TA 4O9MA 4EYHB 3EPIA 2JEFA 4KKOA 3L2UA 1ZQNA 4CGFA 4QW9A 2P1JA 3SUNA 2G8FA 4DFPA 1ZQDA 2FLPA 2BDPA 4Y1CA 4B9SA 3KK1A 4IG0A 4KHYA 3JPOA 4CJUA 7ICUA 4KN7A 4RG8A 3C6UA 3EW9A 1S97A 5SZTA 9ICKA 3QLHA 4F5NA 3O4QA 2V9WA 1KVCA 4DFMA 1C0UA 2XO7A 4QZ8A 3NE6A 3JSMA 4RNMA 4ED1A 3TR8A 4M9LA 1XU4A 2BR0A 1JLFA 2XRIA 1RYSA 5KT6A 1K1SA 5C25A 3RRGA 3SV4A 1KEJA 3LDAA 4RT2A 3NAEA 5KI6A 4FZYA 7ICPA 1A76A 4HUGA 3GILA 5CZ2A 1YTAA 1S1XA 2YNHA 1K1QA 1XC9A 2PI4A 5IILA 1TV6A 2OPRA 2B21A 3AVMA 4DU4A 4CHOA 3ZT0A 1T4GA 4CJWA 4NLNA 3KK2A 3PNCA 9ICWA 4IR9A 2GV9A 8ICUA 3HPOA 3QNOA 4Z6FA 4FM1A 4TQSA 4KO0A 4F3TA 2MUTB 2AGPA 5DB6A 2Z1IA 4PUOA 4TUPA 3C1ZA 1JLQA 4CERA 4YMMA 1QSLA 4ECRA 5KG4A 4CJPA 3IHQB 4DTUA 4KB1A 1BPYA 4M6WA 3AVAA 4M3XA 1D5AA 4HVJA 7ICJA 5J2HA 4CEBA
chains in the Genus database with same CATH superfamily
3C2KA 2G0IA 3M8SA 7FD1A 4HT5A 4X65K 2RIJA 4YS2A 1BDGA 5HBMB 4OI1A 3MEGB 4HTJA 4PG4A 5AJ3J 3D3CJ 3MECA 1SKUB 1X0PA 5K14A 4M7XA 1YJRA 5KFMA 4EP4A 3THYB 4I6YA 4J91A 2P9PB 4IFYB 5JXSA 2OAUA 4BR2A 3TW0A 1S1WA 3NS5A 3O1LA 4O8UA 4ES3A 3IV6A 2QIFA 4Y2XA 1KKXA 1F44A 1DQAA 2UZAA 2HZVA 3JAMY 4PKIA 3V9XA 1HYZA 3AJDA 3P1GA 2M8HA 4NXZA 1B0TA 3H8SA 1T9YA 2DXEA 4Q2MA 4ZVGA 2QARB 2CQ2A 1R0AA 9ICIA 5DG9A 4DX6A 2P9CA 4M9GA 1S6PA 5AZIA 4JI8F 3D2FB 1WSGA 1GTEA 2ZOGA 4R0EA 3DN9A 3W7BA 2E7XA 3C7NB 3C46A 5AKHA 1RCXB 5AZJB 4OJOA 5IIKA 2EW9A 1HMVB 3DGPB 2V8VA 2ZZNA 2R8IA 3RH5A 1C0FA 5DGAA 3UKRA 2HK2A 3RB0A 3M32A 2EZXA 2V52B 3NF6A 5HP1A 3OS2A 1NG9A 4CF2A 3IWNC 5LL6Z 3GIKA 4X4QA 4ZP7A 1VQOS 3IR6B 2IJNA 4K4SA 3K57A 1FO4A 3OL9A 2AGQA 1M5SA 2ZOFA 4N7TA 2E29A 1VYAA 1YVFA 2E5LJ 2M70A 4PXEA 2OFHX 2XSFA 4WPAA 4I29A 2VG5B 3CCMN 4NRTA 5D78A 4QU6A 1KAYA 3T9ZA 5FJ4A 1ZBTA 4YD1A 2RVJA 3ZXWA 1R31A 2QA4N 3D1QA 5H9EK 2RE2A 3W66A 4C8OA 3V9WA 1CXQA 1ZOLA 3J80Y 2KKVA 1F6TA 4Y2PA 1WKKA 3LDOA 3D5MA 1FEEA 4NYPA 4CJRA 1TKTA 4JI8J 2HDOA 2CWXA 2G0JA 1Z4UA 2NYHA 3DM2A 4H4KC 3T1YJ 4ZVOB 2EG2A 3AUOA 4CHYA 3GE9A 3OYHA 5ALKA 1PZNA 1D8YA 4RW4B 2HBQB 1CC8A 2QA1A 1C2PA 1EXQA 1EWRA 5FDLA 5EOZA 1T03A 5IQQA 2QTDA 3WQUA 3SJJA 5AXLA 4IJAA 1BQNA 5U47A 2DGZA 1UQVA 2BPCA 1QTMA 1NHKL 1KEKA 2BJDA 2NQPA 1ASWA 2FDRA 1HNIB 2WSFC 3CJ5A 1ZQUA 7ICMA 2QB0B 5G5HA 1C1BB 2DH7A 3C6TB 1G7CB 3MGVA 2P5OA 3U1NA 1T95A 5T7LB 2ZD1A 1VC5A 4B3RK 3DKDA 4IFVA 3V6DA 3LDQA 3VQDA 4ZLPA 1RAGB 1C7YA 1V3ZA 1FA0A 1L8LA 4FDFA 2MKCA 2JZ5A 3MM8A 5KFOA 3MMVA 3PTWA 3H08A 2DPIA 3H2UB 4B3OA 3D0HE 4A8WA 2R7UA 4WQ5A 4C2MA 1N8RT 3SPYA 4KT0C 2O8CB 4P4OA 1HBMB 3M2RB 1ZC6A 2QWNA 4Q8FA 4FBUA 2ZE2B 3I0RB 3TUJC 3NGKA 2W9BA 2WK4A 5BPCA 4L3NA 3KG1A 4AYBD 4RPFA 2E1EA 4RTFD 3E3XA 3VVTA 2MJNA 3ZI4A 1JJHA 3ZT1A 1DKGD 3OYKA 1V38A 4BR9A 1SWVA 2DKZA 2ZJQL 2E8MA 4CF1A 1RG6A 4QIWF 1U8SA 4WIQA 3HLUA 2P9IA 1VQNN 4C4TA 3B4MA 1B92A 2MQPA 3C15B 1XNSA 2HB5A 3G82B 4LSLB 1CLFA 5KFEA 4CM2A 1OXJA 1GNKA 3R8EA 1CEZA 4DR4F 4JI0F 2ZH4A 3SMSA 3E8OA 3OSPA 1XK8A 2HHWA 1QVFR 4OI0A 1S4FA 4JBCA 4FFDA 2X1FA 3JSRA 3G87A 3OVAA 1FXRA 3UDVA 1J5OB 4BACA 4I7FA 1QCKA 1P6TA 4LVSA 2PBDA 5AQFA 3U3GA 3E01A 1TK5A 3KLGA 3GJSB 3V9SA 1R8PA 3V6KA 2DEJA 3SQ4A 3BYRA 3KNAA 2JMGA 4AHRA 3IWLA 3FEXB 4JOUA 3RFAA 4BC3A 5KRTA 4N8NA 4W4MA 2HPUA 4CHPA 1AUSL 4WFNQ 2FPMA 1YRXA 4Y2RA 2ZNYA 2MZJA 2HOQA 1HNWJ 2GX8A 4KLGA 3N79A 5ETKA 3HO1A 2FVRA 4ZA1A 2ZIWB 3CCLS 2VDIA 1A7GE 3LO3A 2PN6A 4BQLA 2DRDA 4M04A 3LP2B 5DMRA 5GIOA 3NGYA 3SMVA 4LJXA 2OTLS 1QAIA 3PIPL 1TUGB 3C16A 5KFVA 2ZUCA 4DR4J 2I9GA 1WSRA 1VQ5S 3V81B 4N77A 3NGUA 4YOEA 3IBCB 1RXOB 1YTUA 2QA2A 2O8BB 1PJ5A 3K58A 1QTNB 4TXSA 1ZRNA 1QE1A 3ITHA 3JXUA 2D41A 3O3LA 3ZZ0A 1UVMA 3IRUA 1KD1T 2RDJA 3R6GB 4TNOA 5KT2A 3W0LA 2ZC3A 1ATSA 7ICEA 5ALRA 3DRRA 3VMFB 2KH9A 2NRTA 1ZD5A 2CPIA 3UKUA 3FSXA 4FLXA 3MZIA 3B9JA 2MKYA 1ZQEA 1EETB 2WFBA 2APOA 5J2EA 3HKZF 3IA0A 4NXNJ 5BPLA 4UAZA 1HQEA 5J2DA 3VAHA 3Q8PB 3F5TA 4ZTFA 3CCZA 3I55S 2R7SA 5ETTA 4GKKF 3WNGA 2CZ9A 4BCAA 1RBAA 2CQ0A 5F8HA 3QFPA 3LP1B 5DKWA 3GP9A 4BRGA 2P9NA 1XN9A 1R6YA 2HYIB 1NK8A 3EWAA 3AHPA 1X4CA 3DDHA 1RDDA 4DCHA 4LFBK 2DGVA 3MN5A 1ZM9A 3DI6B 4MYUA 4NCAA 3OTOK 4NLGA 1JLCA 1RK8A 3AT1B 2FJWA 4CF8A 4BHQA 2FHKA 5FPDA 4PQUA 3MMBA 4BC4A 1SC4B 2ZTEA 4CZGA 1FTRA 1FXLA 4RQ8A 1QLNA 5B8HA 5ALLA 2CQ4A 1NGGA 4RLEA 1OYDA 4Z4HA 4AP9A 2IM3A 3GZ7A 2HFSA 4JS5A 1HIWA 2YXLA 1CJUB 2KHOA 1NNLA 3DLGB 3HZEA 4ECQA 4Z0UA 2HNZA 1JL2A 4FLYA 4C8MA 4IOCQ 1O08A 1Q46A 4CNYA 4CLWA 4H5VA 2E5IA 4TY8B 1YJ9S 3KHLA 3L7OA 4ED4A 2B4JA 3D6MB 2GWJA 4GKKJ 1HBOB 1RU1A 2GEMA 1K9MO 3UQ2A 3EPGA 5DLFA 3B82A 4H4OB 4KHPK 1RKJA 3PRDA 2XWXA 3GV5B 2YWWA 2A40A 1Y64A 2RP5A 2RU3A 1VAZA 4QWAA 4LFCJ 2FSJA 5HBMA 3MEGA 4G1IA 3R9PA 5AK6A 5GTIU 5LXYA 1F3VA 2KT5A 2LBOA 1RTDB 7ICLA 2RSQA 4DR3J 4GVMA 3RAMA 1WG8A 2KKPA 3THYA 4AXJA 1K8AO 1N4LA 2P9PA 4IFYA 2K60A 1RDRA 3I0SB 3D54A 2HFVA 4E7LA 4J9VA 2DFEA 4F4AA 1GH8A 3UCUP 2HBRB 4UOGA 4QZEA 1Z4OA 3IP0A 3BYPA 5D0GA 2XI2A 3OYJA 4ED7A 4OPKA 3BV8A 4FN5A 3CNHA 3NGIA 4NB4A 2XYHB 2BANB 1WYGA 2CXYA 1S72S 4QZDA 5B0FA 1QVGR 4JYAF 3EGNA 4JI6J 4O3NA 5DZ6A 3M1FA 3N28A 4TURA 2QARA 1N34F 4R8UB 3M7VA 4W90B 3D2FA 1M1GA 3K5MA 3QEIA 3TEHB 1KTQA 1WG5A 2WHOA 3FKBA 3C7NA 1UFLA 2W9CB 5BR8F 5AZJA 3DGPA 5DDRC 3CDUA 2OYQA 5GMKa 4NLOA 1XS9D 4R65A 3CDEA 2E9ZA 4CI6A 4JK9A 1UFKA 3Q0AA 3GIIA 4GC7A 4KFBB 4MN4C 5K4LA 3SCXA 3RG6A 5AR0A 2B9XA 4B8AB 4DR1F 5CYMA 3HI0A 2CDQA 2RAQA 4NWBA 1SS6A 3VAMA 5JRTA 4BJQA 1TV6B 1E6VB 2B4UA 2O8FB 4BGAA 4HEA9 5BYQA 2VG5A 1R59O 1AQ6A 3QBWA 1RB0A 5LJWA 3L4IA 2P2CB 4K4HA 8ICHA 1Q0NA 1K44A 1N33F 2KKZA 1DRZA 1EX8A 1ZQGA 2UVWA 2ZUAA 4DV6J 5KFPA 1FFSB 2FVPA 1KQGB 1BO5O 2IFXA 3CI5A 2H9ZA 2KZZA 2D7SA 3M8QB 4AUKA 1PK3A 4KQZA 4BWMA 4OHYA 5GVQA 5HANA 1F5SA 4JI7K 4FVUA 8ICTA 4UARA 5BR8J 3RJGA 1KLMB 1VR6A 4R64A 2MSTA 1ZBSA 2GHWA 2ADBA 4B08A 4RW4A 2KYXA 3CCRS 3O08A 4WFBL 3WK9A 2DR8A 3GDXA 2HGNA 1GLFO 3A5MC 3CERA 1XSLA 3O8WA 5IT9U 4ETXA 3HHKA 2JSXA 3I8DA 4Y2VA 3JQMA 4C0HA 4AF1A 3S9HA 1HNIA 2NV3A 1XNQF 3S6JA 4PZOA 4I2GA 1UCNA 4U67L 4PY5A 1JRPA 4UOHA 5J0SA 1C1BA 3PYFA 4L3KA 2FBXA 3C6TA 5HROA 2N4CA 1OSDA 4NLTA 4HR2A 1ESVA 4DOBA 2RRAA 4A8XA 1X9JA 4UBCA 4FPIA 2VFUA 4I6WA 5J0PA 2B5JB 3EVOA 2O8DB 4RT3A 1X4BA 1VMBA 4C0BA 3ID8A 1ZQ1C 2BW2A 4YDUA 2O8CA 1BUPA 1SKWA 2YNGB 2ISPA 1HBMA 2HQCA 4ILRA 2ZE2A 2YKMB 3I0RA 3SQIA 2BJ9A 2OJ3A 5C2DA 2J0QD 3BDEA 5CRXA 1U45A 5KFJA 4X65F 4LF6J 4USAA 3MBYA 1RWPB 1U09A 1YI2N 4PPZA 2BCUA 3GZFA 5GADI 4Y1DA 4MTPA 4DV3K 5TZVA 1Q8IA 4R0JA 3U3YA 4FXWA 3H8YA 1W26A 3GCWP 3H45C 4CIOA 3V4MA 1C1CB 3S01A 3TA1A 2WF8A 1KKHA 3BF4A 2QXFA 5KPTA 3JTOA 1QQMA 4YY3K 3T5KA 3WT0A 3MX2A 2G8HA 1XNQJ 1SJRA 1PG5B 3C15A 5AHXA 5BRHA 4OFZA 2O01C 2L41A 3G82A 4DUZK 4E7JA 4LSLA 3L3UA 1U1OA 2AJ0A 3TSQA 5CA7A 2PYLA 4LF9K 3AAPA 2R8HA 2WB1C 5LJ5Y 1N6QB 4CRXA 2PMWA 1F9EB 3W2WB 1RM6C 2CQCA 2ZNZA 1J5OA 4P10A 2WAQD 3I82A 2YV0X 3CC4N 5ALJA 4H03B 1VQPS 4H4MA 3NUQA 3D6JA 3C2PA 3MPVA 4G1PA 1V9OA 3O8MA 1UWBB 1U6ZA 1GXUA 1YBUA 3DOLB 4CWBA 5C15A 1YKWA 4DQIA 3L2VA 1UZDA 2W24A 3QIPB 2NRWA 1S1UB 3H4BA 3QJLA 2YQEA 3MWPA 5FLXU 3CMES 3EXYA 5AI4A 3HKWA 3O3GA 2DY4A 4O5KA 4EFAC 1OH7A 4F3MA 4JWMA 2CN1A 3Q7CA 2ZM6K 3GONA 1NU4A 3OYBA 2K1RB 4A8MP 4LQ3A 2ZIWA 3HZGA 1OPIA 2EAOA 1TL7B 4KTQA 3LP2A 1S99A 4O4RA 3DLEB 4ES1A 2QZ8A 4GXIA 3ZD8A 2DY9A 4UAVA 3V81A 4PZVA 2I2YA 3ZLJA 1WWVA 2BHNA 1G1XA 3WKBA 3CQXA 4OHZA 2JXJA 1OS5A 3GIRA 2O8BA 3HTVA 5ETRA 2FZKB 2LQBA 2XEXA 5E0OA 1U1KA 3LP0B 1HI8A 2CAJA 2ZHBA 3C19A 1D1UA 2PI5A 2ZH7A 2DT9A 4UB4A 2E2NA 2G06A 4PL8A 2MTLA 1RXWA 1IXKA 2GQQA 1EX4A 5I3PA 1D09B 4YOYA 3MN6A 2C2DA 1EETA 4JI2K 5D3GA 1FKAF 2X78A 3NVVA 2HZAA 5J2NA 1XBWA 4O0IA 2FHOB 4LJMA 3LM9A 3D9BA 4OGCA 3AVFA 2GO9A 4B3RF 2YVSA 1QAXA 4F5RA 5H9EJ 1KHWA 4CF5A 1NKBA 4DF8A 2H4WB 4QZHA 1IBKF 4B9VA 3CCTA 2CPEA 2ZUDA 3CD6N 1BHLA 4QJFB 4A2AA 4CO1A 2OH2A 5SWMA 4K4TA 3DI6A 2VGNA 3HM9A 8ICIA 1VLOA 1AUDA 4BY9C 2XNQA 3BF1A 2PMHA 3Q86A 4YXMA 2E8NA 4OHVA 3HRGA 1KBRA 2IBOA 3SNNA 2P66A 5LY3A 3A3NB 2DK2A 4FJIA 3HXMA 4WQ4A 3PSPA 3NCRA 4JNEA 1BCOA 5AFUA 3SQOP 5AQSA 1MN8A 3QEVA 2EH9A 3DLGA 4ISEA 4DSFA 5F3XB 3EGZA 1RZTA 3CTRA 2AQ0A 2DNYA 5M1PA 1PYTA 3W64A 4F4KA 1YITS 4B3RJ 1WDDA 3ZFVA 3QT8A 2ZUBA 2GQCA 4C11B 1HBOA 3KJNB 1NK5A 2GWSA 3PW5A 4H4OA 1YVNA 4YB6A 1LAWA 4Z4GA 1IKVA 3AVKA 1EARA 1JLEB 1FVQA 2XBPA 3PYGA 2C28A 4E1NA 2Q3SA 5JU5A 3MM7B 1N36J 1RTDA 4OYMA 2UUCK 4DLEA 1YGYA 3OHBA 2H3IA 1HQ2A 5AKKA 5HN0A 3I0SA 1SXDA 2ALZA 3FK4A 1UFWA 2FJXA 1K73O 3MDFA 2ILZA 4NOHA 4PR6A 5AQIA 4DPUA 2V4QA 3QNWB 2X3GA 5M1OA 5EUHA 4ZPBA 3RR8A 1YBAA 1B0XA 2H48B 3PW7A 2IMWP 2IAJB 4B9QA 4BRDA 2LHTA 4EELA 2HWHA 2BANA 2LXIA 4ZCKA 3QAUA 1DGSA 2QMWA 4JK7A 3GE1A 4R8UA 1BHNA 2UYTA 1P9QC 4QS8A 2D3O1 2CNOB 2AP6A 2B9WA 2VBZA 3ZYYX 1UW4A 4JRQA 3ZSQA 3TPQA 4M9NA 2W9CA 1KVIA 9ICEA 4AM6A 3EDRB 1R7IA 4UAYA 3SMZA 1NNEA 3H2LA 2ZWOA 3ZETB 2F65A 4K2XA 3F53A 2A2CA 2ZH9A 4KGKA 1GOCA 1QAJA 3K8VA 3TANA 4B8CA 4FE3A 5F0XA 4Y28C 4FWLA 2WMMA 2N4DA 4KFBA 4IRCA 3T1AA 1VK3A 1YTYA 3CCES 1DK3A 2WB1D 3LDLA 1MMDA 2ZIXB 3PXGa 5T14A 8AT1B 4CI0B 1FRMA 3SI8A 1ZRMA 2QG9B 3DCAA 3IAM9 2QEXS 4H0TB 3QEAZ 3MN7A 2FY8A 3AGRA 4I2FA 1E6VA 5HQMA 3HILA 4CK1A 3KKSA 2O8FA 1VQ7N 4DR7K 1W7WA 2PMZD 3SQ2A 4N5SA 3ZEUB 5CZ1A 4BGBA 3UD3P 2V7YA 2FYXA 4DJBA 3HSJA 4JUZA 4KBIA 1DQ9A 3O4NA 3C6UB 4AL5A 3VV2B 1IG9A 2BKNA 4CHZA 3KKAA 5J0WA 1HWIA 1FTCA 3M8QA 1XO1A 4J5OA 3CC2N 1SL2A 2ZJ8A 1VBKA 4ALZA 1UT5A 4LFBF 1KLMA 3BGFA 4QZFA 2FI1A 5FRMA 3MPUB 4DFKA 2O67A 3OTOF 5K8OA 5KFRA 4DV2K 4N76A 3EMTA 2DHXA 5EU7A 4BRNA 1FFGB 4YMNA 2D3ZA 3FAHA 5HRRA 2KZMA 4GY2B 2JV3A 1SZPA 2FJBB 3V7JA 1RDFA 2B6GA 3I87A 4IQWA 3A0BU 4JKGB 4NLZA 2MKJA 5A8WB 4ECTA 2J6UA 5JLHA 1OH6A 4C7ZA 2I38A 1C0GA 3HHLD 3PRVA 3TFRA 2H3QA 2Y0SC 1KVKA 4CVNE 4OQJA 4PUOB 4G3IA 1PVRA 1XQIA 5HSPA 2K4EA 4GFJA 1D8ZA 2D0AA 3G4SN 2B5JA 4QBUA 2O8DA 3H0LB 4O5BA 1NOYA 2C2ZB 4MKYA 1VQLS 1I3AA 4Z4FA 1SJQA 2YNGA 1RT5B 4KHPF 3OSNA 2YKMA 1FRIA 4LD0A 3PCOB 2Y1RI 4Y0FA 2DHGA 4HH0A 4LFBJ 5H9FK 4QOTA 1NDLA 2OO4A 5AKIA 5E79U 1T8EA 2Q2RA 4DTJA 2ASMA 3OTOJ 4IYQA 2B4PA 3ILJA 3V1RA 2UXCK 3UXPA 3MR3A 3TTFA 1V3RA 2M88A 4PKHA 4ILLA 4KGVB 4BS2A 1C1CA 4NLWA 4ACOA 1SH2A 1XUPO 1NHVA 3R5AA 1SKRA 2Y9UA 1SJ1A 3RRKA 2YH1A 2ZJAA 2DNOA 5A8RB 2IVMA 2W2MP 3L3FX 5KFUA 4ER8A 1JKHB 3D7SB 4CTAB 1H2VZ 4IBNA 1L7PA 1LEOA 4CZMA 4RR5A 3MGJA 3RH6A 2CA9A 1N6QA 5IIIA 3W2WA 4ZTJA 2E2QA 4BR0A 1WBBA 3M6ZA 4B1UB 3M30B 2FVSA 2A19A 1LFWA 2VANA 4USIA 2NRRA 1JQGA 1YJVA 4KHPJ 1WSHA 4UBBA 3OBIA 4XTTA 4ZCMA 4KLMA 3NGSA 4CF3A 3QU2A 4OKEA 1UWBA 1RTZA 3DOLA 2DKXA 1GX6A 3EDQB 9RUBA 3MWBA 2HWIA 3VAJA 3M6XA 3QYPA 1ZA2B 4WU2A 2EWHA 3NP5A 3QIPA 1S1UA 3R27A 1EIYB 3A3OB 2EFVA 3BSAA 5CEHA 1NZ8A 4AHUA 1S49A 2Q97A 2CQDA 2KJ5A 2JLGA 2HEKA 1VIOA 1PAEX 4BDPA 4CGGA 4EHTA 3MK6A 2K1RA 3Q24A 1B0PA 2HBLA 3PUFA 4Y65A 2NO4A 4KH4A 5IIMA 1TL7A 4CLYA 3VQBA 3CPWM 3DLEA 1XHZA 4C98A 5KFCA 3O4WA 2XMMA 5CA5A 5GAEI 1IR1A 3CB4A 4URGA 1Z4NA 3TAGA 1B7YB 2ASOA 4JI7F 4FWKA 4WP8A 1JIHA 2HHXA 2WW4A 4ECZA 3UR0A 1GLLO 1WF1A 3M9MB 4JKEA 5KFGA 2AU0A 5K8NA 2A1BA 4CP5A 3SUPA 3FBEA 1P90A 1WN7A 3WBZA 3V72A 5B09A 3BO4A 4LT6A 4KV8B 5ALNA 2KD1A 5DJBA 4RNNA 2YKPA 2XLIA 3TTDA 3GG1A 2YWFA 5ALFA 1HNXK 3G96A 3M8PB 1Z00A 5KFZA 2FC8A 1T6DA 1M5PC 2UUAK 2RQMA 2ATLA 4KH5A 3P83D 3NCPA 2RT3A 4RQ3A 4RKUC 2DH8A 2D3DA 1LKZA 3JQKA 2WBRA 3NMRA 1JCEA 1EQMA 3FSIA 3U8XA 2Y8YA 3VAKA 3DYAA 4RPXA 4PZNA 2HOEA 2XG8A 1FDBA 2IOCA 2UXBK 2MB0B 4C0OC 1U2FA 3KYLA 1T6CA 5J2AA 5K20B 2P9GA 4PHEA 5KT5A 2FLLA 4KMOB 8ICFA 2DR9A 2AD9A 2M9KA 4JI7J 4BGDA 2DGOA 2JFDA 2ZFHA 5AQTA 2NXEA 5CQGA 2F8TA 3HP9A 4HUEA 1J2NA 2F8KA 5KGXA 2QLBB 4DV3F 4DQRA 3NGRA 4WKRA 5J8YA 9ICOA 2BJEA 2V67A 3NY0A 3VTHA 3B6OA 3UMGA 3EX7B 2NRHA 3D6HB 2CDRB 5AQVA 1A77A 2HKEA 4FK4A 5HQLA 4YY3F 3DV9A 1ZM2A 4NZ0A 4AXIA 4CK2A 1YJNS 3QJJA 1ZJNA 5LM7E 4KBOA 2Z1HA 1LW0B 3N4WA 2DHAA 2FGCA 4DUZF 2ZJ5A 2WB4A 2KHQA 2VPWB 4NV0A 2MZTA 4F2RA 2NR0A 4LF9F 2CQIA 4ZPWR 3WIUA 8ICRA 3I8BA 4R79A 4C11A 3CCUS 4CM0A 3CWJA 1T44A 1JROA 3CFRA 3U4LA 2B4OA 1HI1A 4GKJK 3WK4A 2OELA 1JLEA 1B70B 1J6ZA 2Y0SD 1TAMA 4KYZA 3MM7A 2HRTA 2HVZA 5AKJA 4C3MA 2F9WA 4FJ8A 1V5VA 3SCKE 2GJ2A 1RDAA 4ZPTR 3ZZZA 1TYQB 4NLRA 4AT1B 5JVGQ 1RHQB 1CQNA 1FRHA 3M6VA 2LYVA 4DV3J 4MLHA 1S59A 4DL3A 3K7RA 4LRAA 4LF7J 4BR7A 2EQYA 4DPXA 1ZQSA 1TTHB 3BZQA 1RTHB 2IAJA 2EK1A 2DNKA 2WW8A 4YDDB 4Q2LA 2QXLA 2FJAB 3GL1A 1ZQIA 2HFNA 2DR6A 4C8KA 2QLJB 4QAGA 1EP4B 3W1YC 1QD1A 4OI4A 3MMJA 4K5SA 2FLNA 1P8ZA 2FVCA 2J4RA 4FK0A 1YUWA 1CSJA 1HIYA 4MKAA 1TUVA 1WB9A 3M9OB 4DUZJ 4QW8A 4Y6IA 4IO9L 3LL3A 3Q89A 1KNZA 1S8OA 2WUSA 5J2FA 2HHUA 2F7VA 1TUYA 4LF9J 3WEEB 3ZSVA 2I5JB 3C65A 1RT6B 3BR9A 2ETJA 2ZTDA 3ZETA 2V2VA 4M8LA 4EU0A 3H8WA 3ASMA 4HWIA 4BDZA 5J2GA 4CIFA 1TKXB 5CXTA 4Y2IA 5F0UA 1RBLA 3VQ4A 2E8PA 4JAXA 2EFOA 2JEJA 1VSFA 3L2RA 2H65B 5KAKA 2ZIXA 1FEHA 1DZ5A 1N60A 3QINA 4A57A 4X66J 2JX2A 1S1TA 3BREA 4I1TA 3NEKA 3EPIA 4DDFA 2FSNA 2EC0A 4QW9A 3UDCA 2K7JA 3IG5A 3KKFA 1K9MT 1N52B 4B1WB 4KR0B 2FVQA 3Q8VA 2H5IB 4JI2F 5LMNK 3ZEUA 2G8FA 1N0UA 2AMCB 3CDBA 1NGHA 1NBWA 5AQOA 5CHIA 3JPOA 4RG8A 3C6UA 4IXCA 3EW9A 2IA0A 3N0VA 5SZTA 2ZM6J 5EXWA 4C80A 4MAKA 9ICKA 2J0WA 1WSVA 5K9FA 1K8AT 1UPPA 3GCXP 3SCLE 2XO7A 1O8BA 2K4IA 4RNMA 1LWEB 3GYGA 1XU4A 3CCJS 3T7ZA 1TMMA 3ZX0A 4CO2A 3OBYA 3PJWA 1ZM4A 3RSEB 4IOAL 4B3TJ 4I2QB 1DFDA 3NAEA 4MIBA 2L9WA 2K3IA 2MLYA 1X5PA 4TU9A 1U25A 3D6TB 3IXQA 5A0LA 1K1QA 2PI4A 5IILA 4TN2A 3CPWR 1J97A 4CQ1A 1Q7LB 2CUYA 2Z0GA 1R27B 4NLNA 2I0XA 2XZWA 2GV9A 4JKGA 2ZJPL 5A8WA 2KMDA 3HPOA 2VPXB 3QNOA 5ALVA 2VJUA 4FPAA 3TA0A 2PKEA 1FFVA 1N32J 4PUOA 1RU2A 4IEEA 3ONNA 2QWPA 5KG4A 2XMAA 4DTUA 3HSGA 2CG8A 1BPYA 3VPZA 4JN4A 5J2HA 1PSDA 2GNKA 4KPCA 1RT5A 3FE1A 2K8AA 4M9HA 4DWIA 4J9UE 3D66A 4LSNA 1UCVA 3W5YA 3H59A 1RILA 4FJGA 3M8YA 1WOQA 8ICGA 2YB4A 4FLZA 2YX1A 3E1YA 2QA4G 2UUCF 4H0YB 2COLA 1ZQAA 1F9HA 4I0WA 3MPDA 2OPSB 2W4PA 4G1QA 4J2EA 2HVIA 4FL9A 4CEZA 4FJ7A 4NI2B 2E6MA 3Q8RB 1S77D 2WONB 3BF3A 3PM9A 2W7AA 4YDUC 4NEYA 3P49B 1DJ0A 4UOFA 4RNHA 4FLUA 3OUYB 2ROPA 3EVWA 2K8GA 5LSLA 3H5YA 4K8ZA 1FW6A 3MEDB 2E20A 1WF2A 3AGKA 4LF4J 5A8RA 3TZXA 3NMAA 2W6KA 4MLEA 4DTOA 4AYBF 4CTAA 3I9ZA 5GAGP 3F41A 1VSMA 3G6EN 4ECSA 3IAYA 3OQ2A 2I1RA 4ZLNA 1GOAA 3SD7A 4HLBA 2OMLA 5BN8A 4RL1A 3TUPA 4KLJA 3M30A 2ERRA 1B7FA 2C3UA 4OPHA 3PO4A 3SSRA 3CJBA 1A5WA 4NEZA 2A6OA 4M7YA 2BH1A 1T3OA 1ZQPA 1NXIA 1WOSA 4LUBA 2VFSA 4BC9A 1KLNA 2ZHOA 1FRLA 4I2AA 2M3DA 5FPEA 2VB6A 3G8SA 4XUSA 4GVBB 2J8SA 3UN5A 4I68A 2UXDK 4QYZK 5C0YA 4M63A 5IC4B 5L39A 4DR7F 2Q43A 2A6AA 4OZ2A 1TFWA 5DZ7A 4ANDA 5GAHP 3GU0A 4KX5A 1B9FA 1M5OC 4IQMA 3ZTPA 1VQ9N 1CZ9A 1IQZA 3O0FA 4F36A 4ZH4A 3N5FA 2F8EX 1M1KO 3D1HA 4FF4A 1Y5NB 4P9SA 3H7IA 4DX7A 3TEGA 5J0TA 4YDXA 1EQYA 1FJGK 4CZLA 5E7OB 3CJ9A 3HL8A 3D1OA 1GMVA 2CJBA 5HMZA 5E3QA 4FYVB 4OZ0A 5IWAJ 1ULRA 4DPYA 3VZHA 3VZIA 1NZAA 2I6WA 4K4GA 4WZQA 4DV2F 4KV8A 2F1IA 3SSQA 3D2EB 3GFZA 2GAHC 2EG1A 3J7A1 4QZGA 1WC0A 1VOMA 1ZQTA 4R5PB 3Q8KA 3M8PA 2XNRA 2BZ2A 4LF8J 4CDGA 6FD1A 3AJ2A 3KHYA 4DR7J 1ZXIA 4O3QA 5M1KA 4DPWA 2A2DA 2AYMA 3CPEA 4CT9A 2WSEC 4J9RA 3CM5A 4CF0A 2EFNA 5LXRA 3CFPA 2DHHA 2DTUA 1NBEB 1WI6A 2KOBA 1KVJA 4PCQA 1S10A 4URSA 1JALA 2BBEA 2OKQA 4IR1A 1HJRA 2ZUGA 7ICHA 2VCPA 4QS7A 4JV5K 2DEIA 3MCMA 2IHR1 4GVLA 2UXCF 4ED6A 3K5OA 4M1KA 5AM2A 4X64F 3U1MA 5DQIA 2VBWA 2XY6A 2R9LA 4PWUA 2GMHA 1HD0A 1JXBA 1Q9XA 4WK1A 3GLJA 4ELTA 3GB0A 1T11A 2IIHA 3CCMS 4OJPA 2Y9HA 4WXOA 4ZVHA 2R2SA 3LVVA 1B99A 2QA4S 3CJ8A 1MC8A 3ENVA 3ZT3A 1LW0A 2AXTU 4E89A 5J0YA 3P5TL 2WBNA 3HD2A 5IT9O 5EE1A 3WXJA 3DGVA 3SYZA 3OXLA 3VA0A 2YB1A 3M8ZA 3GJTB 4CLLA 3MXMA 1Y11A 2QO3A 1RT7B 4AD6A 2IC3B 2KG5A 3S3NA 1ZQWA 4RPYA 2BCRA 3F5AA 4UY8T 4QWEA 4X4TA 3UD5A 4K0KF 1VSIA 4I28A 1SL0A 1Q7YT 4DV1J 2KIWA 4EYIB 1OO0B 4CH1A 5HQ8A 2W2PP 1NMDA 3KIOA 3KOAA 5G5GA 2JEIA 1EHWA 2UXCJ 3CCSN 1I51B 2RNEA 3D2NA 3VF0B 3AH6A 3WC0A 1FFUA 1HYSB 3CGIA 1UTAA 2ZDOA 4DR2J 3M8RA 1I94J 5KFBA 3AA2A 4DL2A 1WEYA 1Y00A 4CJ5A 2BGGA 1NJWA 1RTHA 2R8GA 3EICA 1RABB 1T9TA 2PFDA 4MMOA 3RH4A 4PL1A 1HKGA 4DTPA 3QFWA 1VHIA 1EP4A 3AU2A 1VQSA 4DUYK 5J0UA 4M45A 4PABA 5E84A 3JPQA 1BC6A 4HH1A 2BVZA 1JNRB 3N9UC 4DV5J 4DL7A 3Q8LA 3VGTA 1MWMA 2E66A 1BA0A 3R97A 3S1TA 3JAMU 2VG6A 1RT6A 5CD4H 4ES2A 3SI6A 2YWGA 2EKNA 4F91B 1SL1A 3V9UA 7ICOA 1U48A 1FNOA 2CPJA 1QDUB 1TKXA 2XZTB 3UDEA 1FNXH 4QZ9A 3KG0A 1KVBA 4ANEA 4RCHA 3SXLA 2B7BB 2CPZA 5AQRA 2ZITA 5AQLA 4FF2A 3QEXA 2DYAA 2G8VA 3FJ2A 2ZGYA 3GIJA 3D2WA 3L7UA 4USJC 3DC2A 3FQKA 4RU2A 2RD5C 1NJYA 1Q3VA 1VQNS 2E1MC 4Z4CA 1XEZA 2J9DA 3VC8A 3P39A 3C23A 1IKWA 2PIIA 3QETA 4BRMA 4ECXA 4PA1A 4FYWB 4GRSA 1RQ0A 2LXUA 2VYPA 2OA8A 5AK4A 3D0PA 1UEUA 5JS1A 1NOZA 3L3VA 1LWEA 2UXBF 1KD1O 1HNZJ 2R42A 2UP1A 2HQIA 5FLXO 2W8KA 3OL7A 1KQQA 1JNZB 3K17A 3P6YC 3H40A 2A1RA 2MLZA 2Z58B 1ZETA 3HM8A 3RSEA 4I2QA 2PFUA 2CKWA 2AF6A 1GK8A 1O6XA 3ZSWA 4YB1P 1KC8T 1UPMB 2AJQA 3M1VB 2NUHA 4KN4A 1U9LA 4OYIA 3X3UA 2MEWA 4E8UA 3VA3A 3NRBA 5KFIA 3EJMA 3KXDA 3G71N 3I56N 1UPHA 4EMDA 4UQTA 2OD4A 1LOTB 2VWKA 1NUEA 4FLTA 4ZKAA 2EFGA 1QQCA 3J7YP 5G0RB 1HNXJ 5I4MA 3OTBA 2UUAJ 2XS5A 1J9AA 1IQTA 4M5HA 5ETVA 1XMQF 3O1BA 1ZD3A 3PYDA 2Q1NA 4NCBA 1U02A 4B6JA 4IH6A 1WHXA 3VEZA 4I2HA 1HQUB 1J5EK 3G8TA 2U1AA 4GKJF 2RKIB 3LP3A 1NSKL 1FERA 4OJGA 4N8OA 2V9KA 3UIQA 2BQRA 4Q44A 4OV6A 3RAQA 1A6SA 3VTIA 4JV0A 2DBYA 4HHJA 2IDOA 3F2KA 1HPMA 2W03A 2OPSA 1JWWA 4CIGA 3OBWA 1RCOB 4CFBA 2EZZA 4NI2A 2WONA 4QPXA 4CJFA 4F50A 1CVJA 4DB3A 3OVSA 3UNYA 4KLDA 4ED8A 2ZBIA 5B0BA 2QL7B 3OUYA 1S7HA 2I8EA 3MEDA 5EWGA 3JPPA 2XULA 3JYTB 5KL1B 5MLCQ 1L7NA 2ZJRL 2HQ3A 3LVWA 3MCAB 4KE5A 3KK1B 5DBBA 1FJEB 2ZJQQ 1M0SA 2WTUA 3FGUA 3OFFA 2ZH1A 3MDCA 2E2PA 1S9GB 3HOTA 3ATVA 3EXCX 2QYCA 5KFHA 1U2CA 1NK6A 4MEYA 2CYYA 4WJBA 1NJIO 5ALUA 1WUUA 3DOMB 3KUEA 1LFPA 3BEXA 3MC1A 3A8EA 2HMXA 1RHMB 1KQSM 3NF9A 4UB3A 4BRAA 3ISNC 4DSKA 3I33A 2BJ1A 1X2IA 4ZIVA 1MMLA 4GVBA 3SZ2A 4DV4J 1SH0A 3N7RC 4J2DA 2OPRB 2JLFA 4LSZB 3SCJE 5LMNF 1X1PA 2Z57B 3AY0A 4AHTA 1Z19A 4BDYA 2IOHA 1SQKA 2RB7A 4PG8A 2A3ZA 4NMXA 1GLAG 5EHHA 4JB3A 4M3ZA 2MYFA 4K41A 2FHJA 3QGGA 1V97A 4RUHA 3BSNA 1CUKA 5MLCV 1JUDA 4F04B 1WC4A 1ZTTA 2KI2A 3HK2A 2A1AA 4KHSA 2MKSA 1RBVA 4BC7A 3WUHA 2GIFA 3F2CA 1VSDA 4YOXA 3OHRA 4RUCA 3PIPQ 4EBDA 1NGAA 1B0VA 1UVLA 5F8IA 4JI3J 3D2EA 4QWCA 5HL7L 1Y5LB 1VJWA 2B9YA 3FC4A 3BZCA 4R5PA 2ASJA 4O8KA 2B0GA 4F92B 1S9FA 2MZSA 3MEEB 2K4HA 4WCEL 4WIIA 2N3LA 4CRJA 4QIWC 2GA7A 4CZKA 1NB7A 4DHYA 4KHRA 5E41A 3W9IA 2JWLA 4QZCA 4HTIA 3UFCX 2HHHJ 4EO6A 5E5NA 4FWOA 3CJ0A 1N54B 1OMSA 4FWMA 5AK5A 2F3JA 3KNGA 1N5VA 2HF4A 3KZBA 5F8GA 5AE1A 3T79A 2A10A 4CLZA 4US8A 3AVHA 7ICIA 5L1MA 3GQCA 1U6BA 4NXMK 2BUNA 2QWLA 1EKSA 2RUGA 2MDAA 5AM5A 1UAWA 3BKUA 2XQCA 4US9A 4X62K 2IVOA 4J9NA 3OR1A 5EY4A 4UZBA 2LQJA 1TP7A 3FRYA 2ESEA 4ILHA 3V1QA 3RR7A 1GQEA 4OJ3A 4K7QA 3L2WA 7AT1B 1FD2A 2CNLB 4XPCA 3BH6B 3JQJA 5F8NA 4DR5F 1UW9A 3CQ8A 4XAKA 1NZPA 5HJXA 4IS7A 2EWSA 1VDVA 2KNJA 4TU8A 5EWEA 2CRLA 1QQ5A 4KH1B 4ZVEA 3LUYA 1SB3C 4XPEA 1J53A 3UD4P 2KP7A 2F96A 2DXFA 2VONA 5CB1A 4FJKA 2FBYA 1RWWB 1XI1A 2DFLA 1IBMJ 1ZQHA 4G9BA 1RT7A 2YMMA 2IC3A 1X40A 2CVEA 2YX7A 4W92B 1WJ9A 1WG1A 2YHBA 5KRSA 1TKTB 2MQQA 3OYEA 1WELA 3A13A 4WF9L 4ILJA 4O4GB 4LBPA 4ZN1A 1UHUA 1Q81O 4FZLA 1WSIA 4P2FA 2FJ6A 4PRFA 3PLAA 1RAHB 1IKYA 3JPNA 4YN4A 2UXDF 1HYSA 1HARA 2D0OA 2F1HA 2ZKUA 4OLPA 2RF2B 5D4BA 1FT8A 1FE0A 2VD3A 4NLUA 5CWRA 3D0GE 1LV5A 4O3PA 2IRXA 1B43A 5JMNA 4F2SA 2HW3A 2G5HB 3PMLA 2W9MA 3PNIA 5LL6d 3VENA 1F9FA 2CXEA 3HVTB 3QQCD 1YHQN 4FJNA 5LJVA 2FHJD 2GO7A 2ZD1B 4YVZA 3JSYA 5KG0A 1FJGF 1HRHA 3CG7A 1TGOA 2GBZA 5I9EB 4JI4K 1F1BB 2KFYA 3DFEA 2VFVA 4Y3CA 4M3TA 3GR0A 1YAGA 4B9MA 2Q1LA 1Y88A 2LEAA 3TX0A 2GIQA 4RQ6A 4K5RA 1LCUA 4RX6A 1YI2S 3OYIA 3CJSA 5MAOA 5M2RA 1APSA 4ZP9A 3UNGC 4YG2A 2GVZB 1BU6O 4NL9A 4PAAA 3UPQA 4CJ7A 4ZVQB 4WBFA 1IBLK 3AN1A 4UQGA 4ATNA 2Q79A 2ZQBA 1W97L 5EE3A 2UXDJ 3RZAA 5ALGA 4QYZJ 1X3NA 4FWQA 5EX0A 1VJ5A 3ONQA 2C3YA 3TAFA 5KAIU 1KQSR 4HT7A 1SV0C 1BIUA 4JHDB 3AB2B 1MU2B 4DCJB 5EGYA 5EX3A 2D3UA 4KHMA 1Q4RA 3IR5B 4OLBA 3QU7A 1JLBA 3NH1A 2O3DA 1VDHA 2OEKA 4Q0BA 1ZQFA 3IFEA 3LF0A 4C7QA 1PGZA 4Y2AA 3N4QA 1X3MA 1BL3A 4BC2A 2HIYA 1AT1B 3A3PB 2KHCA 3ULHA 3ICLA 1JLAB 2OI2A 4A8SA 2LPEA 1S0NA 3CC4S 1MDUB 4NPOA 3OA9A 5BPMA 1BQMB 2PMZF 1N5XA 3WKEA 4DV7J 5K5MA 2RQ5A 3OVBA 3M1VA 2BJ8A 4HVZA 3SQGB 1KBUA 4JV5F 2CH6A 5ALDA 1ZBFA 2NRXA 2NPFA 4J9OA 2XHCA 1PJ6A 2J8AA 3E01B 5J2QB 2KIVA 1IR2A 1OVYA 4FOEA 5DB7A 1UEKA 2E44A 2V4JB 3I1YA 5TKWA 4WFBQ 5G0RA 5HATA 3H0RB 2AZ3A 5TKYA 1R43A 3MMAB 3QESA 2GJIA 2DJWA 2W7OA 4XK8C 5JICA 5E3CA 2P6TA 4B1VA 4ZLJA 1F21A 1X31C 3FGVA 3W3SA 2YMLA 4RW6B 2YPYA 2Z4PA 4U67Q 1F2GA 2H3GX 3AVNA 4C8LA 5ADXH 1VSJA 2VC1A 4M94A 1HQUA 4LH4A 1Q16B 4ILMA 2GW8A 3HVWA 2JWKA 2X51A 5HVFA 2OP5A 1ZQCA 2HURA 2RKIA 2OANA 5J29A 2P9KB 4O44B 3C16B 2BXJA 3IFRA 3WQTA 3MMCB 4O0JA 3M7DA 2DXDA 2GMJA 1VQ6N 1H38A 1N5QA 3H5SA 3NBPA 2KXNB 4JV5J 2WSCC 3LTOA 1T3QA 1RDCA 2BV3A 5J2PB 2I7PA 1CULA 8ICBA 1OYEA 4PHDA 4IQVA 2QWOA 3TSUA 1NH8A 7ICTA 3H46O 4PGYA 2HBZB 2VUGA 5DBCA 3JYTA 3NRWA 1XR6A 2E5JA 3M2VB 3HHNB 4P4PA 5I3QA 1QSSA 2EVZA 2H5EA 4DUYF 1H3DA 1UJ5A 2WVEA 4C4WA 1S5JA 4OJLA 3VALA 2AYEA 3UQ0A 4B1ZA 1N33K 1HQEB 3BO2A 4XH4A 3NS6A 3KWMA 2W04A 4CGZA 3MD1A 1S9GA 1JXEA 3CD6S 2HLTA 3C8YA 5KFXA 2P9LB 4BE1A 3LGMA 4KGZB 3IGVA 1NAQA 4P2HA 3CRXA 4KTZA 3DOMA 4F25A 3ZDCA 1N5SA 4UZCA 3FFIA 4X84A 5FLXY 1TKDA 3KLHB 5LMUJ 1T9UA 3TWHA 7ICGA 1PO6A 4DN9A 4BRPA 1BGXT 3RVCA 3NCIA 4ID1A 4BE2A 1LXJA 4K4UA 4B17A 4P7TA 4PQUB 3MMBB 3OJUA 4JP8A 2XGPA 1SUQA 2JC1A 4M5JA 2JVOA 2P8IA 4CGHA 3J7ZT 2ZH3A 1OH8A 1QVFM 4IG0B 3UXNA 1S76D 2BZFA 2G0AA 3IO1A 4DMZA 4UY85 4DUYJ 4OX8A 1BPEA 3QLHB 4F4ZA 2YH0A 4R25A 2VDHA 3KDOA 3JSMB 4Z7YA 1JLFB 3GV8B 3DAWA 3T1HK 2LMRA 1Z1BA 1LOUA 3HKZD 3FZKA 5C25B 3AL0B 3ZNUA 3IDHA 1CLQA 4CO0A 1GOBA 3H1QA 2RRBA 2YWHA 3KWGA 2V34A 3UN2A 3AXKA 1U04A 3IM1A 3GBTA 1P8GA 4ERDA 1E4FT 2F9TA 3PSTA 2GLEA 2XHBA 4MFFA 4LR8A 4M5DB 2PE8A 4NYNA 3I5AA 3H0PA 5AQNA 1GLJO 3BJYA 3Q8QB 1BIZA 1NGBA 4QR1A 1Q3UA 5CABA 1TUUA 1JK9B 3MEEA 3K59A 4OYBA 3VQ7A 2W42A 3AO1A 1RSCA 4B1XB 4JKBA 1BOTO 3ZSOA 1WSFA 3SUQA 5ALSA 3CDWA 2AEJA 3QSYB 5CZXA 4YB7A 5KGWA 2KJWA 3L8BA 3WK8A 4YOTA 4J9KA 1ZQRA 1NHUA 4RBUA 2Q0UA 1T0TV 3MCOA 1J5EF 3CC7N 1SV4A 1JCGA 1ZBIA 3HVRA 3BKTA 2DNPA 1D8LA 2A1SA 5IXUA 1WCNA 3TTCA 1P27B 4ZDNA 4K4YA 4Y2MA 1NGIA 4BRIA 1YVUA 3MI7X 8ICCA 4URQU 4J03A 4OLAA 3OFGA 4P7VA 2MQOA 2NUUG 9ICFA 2F3NA 4UB5A 1GEHA 4A46A 1WC1A 3PKYA 3OYNA 5IV3A 2HG4A 4HI1A 2AWZA 1M1KT 1QS4A 3EKUA 1VLBA 4O5EA 3TADA 2OTJN 1UZHA 4H5RA 1VQ7S 4UB1A 3UB5A 3AA4A 4L8RB 3KUGA 2NLXA 3V9ZA 5CYMB 2R7QA 1VK8A 2G2ZA 4WP9A 3R5BA 4NX9A 3IBPA 3BB5A 4DS4A 2Q0ZX 1DAXA 2FF6A 7FDRA 1XIQA 2KO1A 4V19J 4J9SA 3HULA 4CO5A 2IS3A 5B08A 2YNFB 2ITGA 1IV0A 3VWSA 3CIMA 3UMCA 1ZAWA 3CC2S 3AO4A 4A2BA 1LWXA 2JGAA 1ECWA 3A1YG 3UDLA 5AQGA 4F93B 3V7KA 1ZQYA 1RADB 3BEGB 2Z30B 5CHCB 2A1JB 1FXDA 4GV6A 4RQ4A 4DI6A 2X1AA 3HSZA 5C24B 3DDKA 3RW7A 2XLJA 2LM4A 4O4GA 3ZSRA 4XRHA 4PG6A 2LVWA 3PY8A 2ZBPA 5ETPA 3OYFA 1TFRA 1R89A 3E66A 3F56A 4OJ5A 4KIAA 4OIXA 2NNWA 4Y2KA 3H5XA 3PR5B 1WG4A 2XHWA 2RF2A 3OL6A 3JXOA 5HOOA 1W25A 5L1IA 4Y34A 4YNQA 4JMUA 2ZWHA 1DRGA 2JVRA 3EM1A 4CIEA 3U6FA 4YEAA 2V8DA 3IP4B 1V6HA 3HVTA 4NE9C 3G4SS 5HROB 4EGLA 1RCHA 4RQ0A 2DPJA 2CPXA 3SCIE 3PKMA 3J7AP 3B0YA 1C1AA 2PAVA 1OW5A 4IRDA 1IWGA 1LKYB 5AIBA 1NGCA 3KLFB 3SDEA 4QU7A 4KREA 3I28A 1FDNA 1KXPA 2RDIA 2CNNB 1IBKK 2G1DA 3TP2A 2XI9A 1KW4A 3N6MA 4ZITA 4KLIA 4KRWA 4Z37A 3CHWA 4A8QA 3PHTA 4NLCA 4HDGA 2X6SA 5KAFU 1CRXA 3CCQN 2E7WA 4OJ6A 2GVZA 4K59A 1H0HB 4IOXA 1R8BA 5A6WA 4PHTX 1FVSA 2L3MA 4Q45A 4TUSA 4NYOA 1QVGM 1AYEA 4PL2A 3MGIA 4ECWA 1BY9A 1HD1A 1X42A 2F4FA 5LOQA 3AVGA 3NGZA 4H4KA 5EVZA 3TUZC 2FHMA 2DNGA 3CD5A 1Y3JA 3R1XA 4JHDA 1MU2A 3NAHA 2RS2A 3R3TA 3HJFA 1YX2A 2ZIVA 1ITPA 4D3GA 1WBDA 4FCYA 1G2EA 1E4GT 2MQ8A 3L5KA 4H0XB 2FLOA 1IKXB 1Y0HA 5ETNA 3AA3A 2VJ5A 3RBDA 1M5VC 2W01A 1JLAA 4GC6A 4LH5A 4KITB 5ALZA 2MQMA 3W5XA 3N7PD 2DNLA 2OWOA 4NXMF 2EAMA 2LA4A 2R8JA 3QDKA 4UW9A 1BQMA 3VQCA 1RHJB 2H5JB 8RUCA 2VZ9A 3C66A 1EZZB 3M5RA 3SQGA 4U96A 3ETLA 4DN0A 1NGFA 2FJDB 4UATA 4X62F 1PUZA 1VSHA 4H4MB 5JMVA 4YR2A 1RT3B 2DIUA 5J2QA 4DQQA 3OTEA 4LIWA 2WF6A 4KLSA 2AX1A 3QNNA 1A5XA 4KI6A 2UU9K 1EWQA 3ATUA 4I2IA 2V4JA 3MHYA 3G10A 2J7UA 4ILGB 1NGEA 3CJ2A 2BKEA 5HLFB 3MMAA 4H8KA 3HYFA 1EB0A 2RJZA 1NSPA 1GTHA 3H98A 3AO3A 4YMEA 1QZ6A 1Y9OA 4RW6A 2AJ2A 1WAFA 4BWJA 4YUDA 4Q5VA 2XY8A 4FM0A 5JS2A 2KM8B 3A0HU 4OZLA 4A61A 4MIWA 5AE2A 1R3NA 2YKAA 4CDIA 5CYJA 3B6PA 5ALXA 2EKYA 2P9KA 4TVAB 4O44A 4FZMA 1X4AA 4JI0J 1BPBA 3MMCA 3VEWA 3RAXA 4FNIA 1FE4A 8ICEA 2VKZG 4MQ3A 3R9KA 4X62J 5J2PA 3CJKA 2QEXN 5H2FU 4NLQA 4Q43A 2ZIUB 1KTVA 4E7HA 3ED5A 3C5FA 2MZ1A 2F5GA 5L8RC 2R3VA 4ZHRB 1U1LA 4K8XA 1JN3A 1HEKA 2XI3A 2HFOA 1ZH5A 3M2VA 4OHXA 1NDPA 4CZEA 2GAGC 4U7UK 1D4XA 3P38A 3R6LB 1XTZA 4O3SA 5D3GB 3I76A 2GFFA 2MA1A 2Q4TA 1D3WA 4NA1A 5J2NB 5LSRA 3GJQB 3J8AA 2YQ3A 2C2KB 4IJNA 2I1QA 1N61A 3QJPA 3H1VX 1VJQA 3JSBA 5DG8A 2IOFA 2HQFA 3L6QA 1TK0A 2M52A 2HBKA 4I6MB 4WFXA 2P9LA 4PKGA 3HX0A 4JI4F 3BY5A 2WVBA 4HKQA 3OPXA 2MKKA 1FNMA 3KLHA 1WEZA 4LF1A 9ICBA 2RPIA 4EBCA 4GV3A 4MT1A 1PIEA 2KW4A 1WCLA 4CFAA 2UUBK 5DDMA 4QJVA 4NYFA 1SKSA 1Q8KA 1ZTWA 2E5LK 1HWUA 3E9PA 5AKZA 1IBLF 1U2RA 2LYBA 2JEFA 3K8WA 4KKOA 1Q86T 3L2UA 1ZQNA 4CGFA 1CJKB 5JVHL 3M6GA 4NLVA 3KMSA 1ATNA 4V1Ak 5ALMA 2R18A 2P1JA 2K8BB 3WK5A 3SUNA 1GAOA 1ZQDA 3Q7BA 3DNCA 5F41A 4C1NI 3GU3A 4B9SA 4IG0A 3D7EO 1S4EA 3FEYB 4CJUA 3W60A 4L75A 1HWJA 2KEYA 3HHLB 1S97A 4Y2QA 3QLHA 4F5NA 3MCPA 3O4QA 4HTLA 1HKAA 4IO1A 2Q31A 3T1YK 3JSMA 1FX2A 2BR0A 1JLFA 1H73A 2F44A 2RLTA 2CPYA 4ZVTB 5GAGU 1NRKA 2BE7D 1BUXA 5C25A 3SV4A 1KEJA 1GFWB 1WOOA 2UUTA 2CH5A 4DPTA 1IKVB 2CZVC 4L76A 5KI6A 2EK6A 7ICPA 3ILIA 3VOVA 5A2QY 3RF9A 5CZ2A 4M5DA 4KH0B 1YTAA 2AZ1A 4QNLA 1XC9A 1WHWA 3H2VE 2IDEA 2B21A 2FTRA 3BBFA 3AVMA 1NDKA 3ZT0A 1CG2A 1IBLJ 5HI7A 4IR9A 4F26A 4ZVFA 3UN3A 1TKZB 4Z6FA 4FM1A 4OD0A 1NJIT 4PG7A 4TQSA 1W2IA 2MUTB 3MUVP 3FLCO 4BRLA 5DB6A 2Z1IA 5BN9A 3OD2A 4XDCA 4TUPA 4GO5X 3C1ZA 4CERA 1PYOB 1G4CA 5GAHU 1OQ3A 2GH1A 1J2MA 4DCCA 3IHQB 1BLUA 3W61A 4OYPA 3OV7A 4YOVA 4HVJA 1NI3A 7ICJA 3NOGA 1XC3A 5EN1A 2MSSA 5L46A 4OYWA 1NLVA 1K47A 5KNIA 3H4DA 1RAJA 4ANCA 4CE9A 1OJ4A 1WWHA 1C0MA 8ICVA 1ZQJA 4FWNA 1MWQA 3MFHA 3AO5A 2HOIA 2YY6A 4FXDA 3H42A 2J5AA 2Y9TA 5M1QA 1ICEB 4MHVA 3PFOA 2LYHA 5LSOA 3BQ7A 2QLXA 2N3OA 2EEYA 4LFAK 1ZQKA 3OGUA 3GG4A 3HRDD 5IIJA 2YNFA 4EK2A 5BRFA 1DARA 2R8KA 1VQMN 1GMUA 3VEOA 1TQLA 3IG8A 1UL3A 4JYAJ 2BE2B 2D0PA 1N34J 3SQ0A 3BGOP 4EI2A 4H5TA 1EO1A 3HHEA 3VETA 2KHDA 5D46A 2A1JA 4RJVA 1W2BM 1ZZNA 4E2FB 5C24A 1K0TA 1FDDA 3K2PA 5AXNA 2KK0A 5HHIA 2NSCA 9ICCA 4F0MA 4YFUA 5KT4A 3MUTP 4DTSA 1ZXOA 1BVSA 3GR1A 9ICVA 2VU5A 4JV2A 1HNWK 2R7YA 3VEVA 2NSBA 1KDNA 1UVNA 3ZSXA 3GG0A 1NPPA 2AYBA 3O6WA 4MH8A 2U2FA 4FPBA 4BRCA 3TI0A 1FRXA 2RE1A 2OXOA 3GJRB 4ED5A 1YXQA 2BRLA 1GMWA 1RPLA 4DR1J 3T5JA 1KQKA 4X4VA 4QPTA 1AFJA 2V2KA 2EDUA 3D3BJ 4CCHA 3B6BA 1RAIB 3MURP 4FYXB 4OVLA 4QS9A 1E3MA 2BKPA 3L7PA 4A8YA 1NMEB 1O5JA 3UE5A 1N33J 4OI3A 2V2QA 4X4UA 1LKYA 4C4RA 4BG8A 1CJTB 2Z1GA 3KLFA 2ACYA 5EE9A 1B4FA 3T1HF 1UJ6A 3FZ2A 5CHGA 3C21A 1YJWN 2Y1JA 4WKYA 4IO9Q 4GNIA 1ZOTA 2YN4A 5IV4A 1XWLA 3EZ5A 3B8HA 4FJ5A 4DMNA 1WNSA 2ATCB 1ZYQA 4F8RA 3PIOL 3LPUA 1ELOA 1SVDA 3ALYA 3QICA 2LYAA 1VK0A 3VGMA 4IO8A 3AA8A 2UV8A 2QRRA 5ALHA 1N5TA 1D8BA 4CNQA 4RUBA 3A0IX 5HRNA 1S12A 3ZZUA 2WFAA 2YBVA 3HJEA 5AXMA 3S3OA 5E2QA 2NXCA 2J6TA 1KAZA 2ZBRA 3D2SA 1WUDA 2JJ4D 3WHIA 3G6ES 4ZJOA 4X2BA 1VQYA 1Q81T 2VFTA 3SUOA 1IKXA 4RWWA 5E3AA 5D77A 3FBFA 3PW2A 3VCBA 4H0VB 3Q2SC 4WYBA 4UB8U 2YJEA 3AVIA 4MYTA 3DLKB 2HHQA 1UETA 3I96A 4DBQA 1RYUA 2IJFA 2YTUA 5L1LA 3E2EA 1IM6A 3RMAA 4DU1A 2K89A 1X6IA 3IBFB 3UCZP 3E58A 2R2UA 3LWLA 3RYLA 4RZRA 2L48A 3GFHA 5ALQA 4G9ZA 3GSDA 2KVSA 5KFNA 1RT3A 1ZS6A 3J7Z5 2C2MB 3MM6B 2D3OR 5GMDA 4IOAQ 4GXJA 4DQPA 4X65J 5KPRA 2OMOA 4ZVRB 1REVB 1OVQA 1BPXA 4USHA 4HHTA 1Y97A 2KICA 5J2MB 3HF5A 4Z4IA 7ICKA 2O66A 3W63A 5HLFA 4J37A 2BM1A 2Q36A 2DR5A 1VQ9S 3BGUA 4RW9A 3AM9A 4KLOA 2JEGA 4XIUA 2HS4A 3EE3A 5AKEA 2CJXB 2WF5A 3KVGA 2BJ3A 3U26A 1RBOB 2ZJPQ 3JTNA 2R7OA 5DLGA 3FSYA 3K5LA 2CRXA 1Z25A 2KFZA 3A4TA 3IS9B 4M3UA 4A48A 2QFJA 4HUFA 4LFCK 3O44A 4ZCLA 3OR2B 3MPWA 4FO0A 1Q5VA 4ZOSA 5C5JA 6FDRA 4DR3K 1LWFB 1BCMA 4IL6U 1Z2ZA 3IAS9 2MSNA 2CJKA 3L3CA 1NDCA 2ZC4A 4OZ5A 3EE9A 4M5LA 4X4RA 1S9EB 2EXUA 3NDKA 4O3MA 2JR5A 5L1JA 2MMYA 4W5NA 1VSLA 1PAUB 3NVYA 4K50A 1VISA 3IRXA 2ZIUA 4RW8B 2JFKA 2XS7A 4M47A 2ITMA 4ZHRA 3FM9A 2X1BA 4JI6K 3TWZA 4IC9A 2CJAA 1T05B 2P51A 4QR2A 4CE6A 1XSPA 3H6EA 1Z00B