3HT3A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus v713p mutant bound to g:dctp
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I, large fragment
total genus 208
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ht3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ht3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ht3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ht3A01
3NF8A 3PW2A 1DLOA 3VQQA 4Z4CA 5FRMA 5IIOA 4UAZA 3OYIA 3A2FA 1BIZA 1SKSA 4YR0A 1KVAA 1X2IA 2YNHA 4YXMA 5D4BA 3DMJA 4FM1A 4IFYA 4E0DA 4FZZA 5DMRA 3C5FA 3C95A 3V9WA 3V7KA 5D46A 4CHYA 4FLTA 4KHWA 8ICOA 3C23A 3DLEA 3BQ0A 1ZBIA 4QZGA 4CHZA 4OPJA 3L2QA 1WSJA 3ASMA 4BDYA 5HRNA 3OY9A 1LWFA 1S1UA 3KK1A 1RT2A 4Q8FA 1JLFA 3RWUA 2F8SA 1MQ2A 4RQ8A 1RNHA 3TR8A 5CWRA 3HT3A 2BCUA 5KFMA 8ICJA 3BQ1A 1KVCA 1T3NA 3ZT4A 4CFDA 3UPQA 4R66A 1XHXA 5J2IA 4FW1A 4CJQA 4C8NA 1J9AA 2Y1JA 4FJLA 1HPZA 1ZQQA 2ATLA 5BOMA 1HQEA 8ICTA 4PHEA 3CM5A 2FLLA 4ED0A 2HVHA 1QSLA 4F4XA 2ZTDA 2FC0A 3V1RA 1UA0A 3LAKA 3E2EA 5DG9A 4FS1A 5KT3A 2PXIA 3S3OA 1Z00A 1NJYA 3CQ8A 1ZQPA 3ITHA 4J2BA 2JZBA 4DQQA 4K4GA 4ED8A 3VA0A 3KLFA 3EPIA 2DFHA 2VWJA 1SL0A 2UVUA 3L2VA 1W9HA 3HX0A 4RQ3A 4DQPA 1NKCA 2VG6A 3QINA 4O9MA 3ZSZA 2ZJAA 3PUFA 4JLHA 3TAQA 3TWHA 4RQ2A 3SQ2A 4RT3A 1ZQIA 2ZQBA 3LP3A 3LWMA 3B6PA 3NE6A 3C94A 4ED1A 3MEEA 4TURA 5J0QA 4JS5A 3S3MA 4W5QA 5J2JA 3LP0A 1Q8IA 3V6DA 5JS2A 1U45A 4O3PA 3T5JA 4N41A 4O5KA 3KHLA 2MUTA 3RRGA 4YFKA 1RT4A 1KRPA 4RW6A 4NXZA 4GC7A 3SQ0A 3Q8KA 4ED3A 5CJ7A 1SL2A 3U3YA 3GV7B 4ECRA 1COOA 4QWAA 2BR0A 5KFVA 5KFKA 4DF8A 2R8IA 2AQ0A 1BVSA 2PYJA 8ICPA 1ASVA 4MFFA 4MFCA 3HPGA 3ZSVA 2C2RA 2BCVA 4R64A 4AHSA 2P6RA 2FLPA 3NF9A 2UVWA 1VSIA 8ICSA 3LZJA 3KKRA 5HRRA 4DU4A 1CUKA 3G10A 3RR8A 1N56A 3AVMA 4E7JA 5J0SA 2XHBA 2NUBA 1KEJA 1HRHA 4MFAA 4M04A 5CA7A 1LV5A 4CJKA 4BWMA 4Q0BA 5DLFA 4I2IA 1VSDA 2HNYA 1Q9YA 1ZQWA 1KFDA 4BE1A 3THVA 1TVRA 4J2DA 5KG7A 1SKWA 5FROA 1WSFA 1T7PA 4HUFA 4KLGA 1D5AA 3IS9A 4CK3A 1PZNA 4DSFA 1REVA 3KD5E 2OPSA 3L2WA 4F5NA 3RTVA 3P83D 3TAEA 1NK9A 2YV0X 1S77D 1VSHA 2HB5A 4CHQA 3C5GA 2HHXA 2HNDA 5DGBA 5IIIA 2AU0A 5CHGA 5DBAA 4IFVA 2ASDA 3K58A 5FRNA 5J2AA 4W5OA 1VSKA 3GIJA 2GUIA 4KRFA 1DTTA 1RILA 2BANA 1LB2B 4EP5A 2UVVA 5DDYA 3NH2A 5DG8A 3TAPA 3KD1E 3JPRA 4RQ7A 4DFJA 3N97B 5KT2A 1C0UA 3TI0A 3B0XA 1IKWA 4M9GA 4E7HA 4DSEA 5DBCA 2GWSA 4KLOA 7ICMA 3NDKA 2B5JA 4O3NA 4CERA 4ECVA 4F2RA 3UIQA 1C7YA 4NM1A 9ICNA 5KRSA 2IC3A 2ISPA 2Y1IA 2R8HA 3MDCA 1S1VA 1ZQDA 2J6TA 4O0IA 5DKWA 4Z6CA 3I0RA 4DL5A 3NTUA 1QLNA 1IG9A 4FJNA 9ICGA 9ICKA 3OYCA 1VSJA 3AVKA 3DLBA 4B9UA 3MBYA 3VQBA 1N48A 5KFPA 1WSHA 2GV9A 4G3IA 4KLTA 4I2JA 1CXUA 3QE9Y 2P5OA 1Z26A 1NOYA 3KKSA 4ED7A 3N4MB 1EETA 1L3VA 3NFAA 2C28A 2HHVA 5JUMA 4C8LA 4Z4IA 4CJ3A 3JPQA 3O3GA 3QERA 3KLHA 2IOCA 4O5BA 1RTJA 3MGHA 7ICFA 4DO9A 4NM2A 1J5OA 4HTUA 3ZD8A 1RYRA 4LVSA 4M0AA 4XUSA 4EBDA 2IA6A 3LAMA 2C2EA 5CB1A 1RYSA 9ICMA 3QNNA 4EEYA 4F93B 4O0JA 4CEDA 3EPGA 4QOZB 1VK0A 4FK4A 1H38A 4F92B 4FJ9A 1BISA 2PI5A 2OZSA 2D0AA 4G1QA 4CEOA 4N47A 3UXNA 3ISBA 8ICCA 5DB9A 1NKEA 4IRKA 1EXQA 3PY8A 2IS3A 3Q8LA 4JS4A 4RW8A 1ZBHA 5KFJA 1HJPA 1VSMA 1Y88A 3ZSWA 1C1CA 3RB3A 3I0SA 3AVFA 1MU2A 1RBRA 3T3FA 3ZDEA 1NJWA 5HMLA 3HVRA 3SPZA 1S0MA 4DL7A 5DDMA 4OGCA 4QWEA 4F4YA 4B8CA 2AGOA 8ICBA 4PA1A 4P4PA 2DPIA 1Z25A 3OYAA 1JLBA 2P66A 5HHHA 1B22A 1XSPA 1BI4B 1KFSA 4TUPA 9ICHA 3WNEA 4F3OA 7ICSA 1DOQA 1NJXA 4Z4GA 4KITB 1TKZA 4BXOB 1TKXA 1KTQA 1MC8A 5IINA 4DEZA 4ELVA 4M9HA 1UAXA 3Q8PB 3SNNA 3AO4A 1N6QA 1IKVA 4PGYA 4QZFA 4FLZA 4YD2A 1VSEA 3AA4A 1S9FA 2DFLA 9ICTA 1QHTA 1IH7A 3OYBA 1BCOA 4P4MA 3ZT0A 3RJIA 2HHSA 1ZQEA 4CJ4A 3ZSQA 5J2EA 4QZAA 2D0BA 7ICHA 4CEAA 4CF9A 5KGWA 3AA2A 7ICJA 4H4OA 8ICVA 3ZDDA 3AVJA 2FBVA 4RU9A 4CJUA 2FBYA 4PUOA 1ZJNA 1TAQA 1ZJMA 4B3OA 4YN4A 2BCQA 4TSXA 3FYHA 4DFMA 2IAJA 3M8RA 4I27A 4FJJA 3DRRA 1CXQA 4DL3A 5KFUA 5DK5A 2P1JA 3DOKA 3GIKA 3AO5A 3OS2A 1ZETA 4KI4A 2F1IA 3OJSA 2AGPA 4KB0A 2FPLA 3ZSYA 2RDJA 2PFNA 1A5XA 5KFFA 3V7LA 4FM2A 4BXOA 1S0NA 2BDPA 1FK9A 4ID1A 8ICMA 1UT5A 1KLNA 4CGFA 1I3AA 2DFEA 3ORYA 4KLMA 2XY8A 4QZ9A 4QZ8A 1GOBA 1S0OA 3WNHA 4FZXC 1B92A 1LW2A 2Z1JA 1YT3A 2IMWP 4Y1DA 4RPZA 5J2MA 3QIOA 3VQ7A 4FLUA 2HHQA 1ZQBA 3SV3A 1RCHA 1I39A 3RJEA 2FBXA 4YFUA 1TKTA 4N5SA 4ECSA 1NK8A 4YNQA 1RTDA 4UB4A 1TK8A 2ZUDA 4DQIA 5KG5A 2NRXA 4DSLA 8ICLA 4F91B 2PYLA 3OJUA 8ICRA 2DTUA 4LH5A 3OYEA 3VN5A 4M3TA 5C5JA 3AO2A 2ZUBA 5DGAA 4IG3A 4BE0A 3QLHA 1T03A 1DGSA 1U47A 5KG4A 3KK2A 3VQ9A 4OGEA 4E3SA 2W9MA 3LDAA 4PH5A 3MEDA 4E1MA 1JXLA 1WSGA 4MEXA 4FJ7A 3SYZA 1C0MA 1A76A 1JL2A 4DOCA 2ETJA 4CJWA 2KFZA 3LANA 4RPYA 1WN7A 8ICGA 3MGIA 1J53A 2ZJ8A 2EX3A 2KN7A 4GXIA 3PR5B 5J29A 4UB1A 4DWIA 4EBCA 4NLNA 4P2HA 3G6YA 1KFTA 3O3FA 4I2HA 1QE1A 1HMVA 4QZDA 4F4ZA 2G8VA 4GW6A 4DTMA 1S6QA 1Z3EB 3QETA 3VQPA 4R65A 3RJJA 4EZ9A 1C6VA 3KLGA 4E19A 2Z1GA 2MAXA 3MXJA 2M9NA 5KFRA 1YTAA 4H8KA 3TARA 3ZSRA 3MXMA 4J9RA 3SPYA 3L2UA 1XS9D 2Q3SA 1XI1A 4K8ZA 2FLNA 4LZGA 9ICLA 5J0TA 4DSIA 3H8JA 4B9MA 3SZ2A 4YR2A 1RTHA 4FLXA 4CGIA 3ISNC 3K5OA 3V9UA 3S9HA 1BQNA 1L3SA 5J0WA 4MQ3A 3L8BA 3DRPA 2VG7A 4JV2A 1IO2A 4DSKA 9ICUA 4ELTA 4J9SA 4FM0A 3MEGA 1UOCA 4DTUA 1QSSA 4CJPA 1LAVA 1WAFA 4O3RA 1JXBA 4IQTA 4RW7A 4FJKA 3AO1A 4Z4FA 3PR4A 3KHRA 8ICKA 4DL4A 4NCBA 3MECA 1BQMA 3AVBA 1KVBA 4AHCA 3TFRA 4KHSA 3ULDA 8ICNA 4CFCA 1B9FA 3C6UA 7ICTA 4OLBA 4F2SA 5KFDA 4IQWA 5J2KA 5J0YA 3H08A 4IQUA 4M9LA 4RNNA 4CJ5A 4JV1A 1ZBLA 1DTQA 3LP1A 3CFRA 1WNSA 3BDPA 3S3NA 1SUQA 1VSFA 1BIUA 4EP4A 4NLKA 4JRQA 1RT6A 1ITGA 4AHVA 2BGGA 4OJRA 3BGRA 1QSYA 3SUPA 7ICIA 4TUQA 8ICWA 4PHDA 1JIHA 1JX4A 4KFBA 3HL8A 4TQRA 3RAXA 1BPXA 5J0RA 3RAQA 4RZRA 2XCAA 1JKHA 5IIKA 3VQDA 4YCXA 4M9JA 4IDKA 4L8RB 1Y97A 4RW4A 1RXWA 1SV5A 5T7BA 1GOAA 5J1EA 5DQHA 4DTJA 5BOLA 2HW3A 3EYZA 1S1TA 1C1AA 4FCYA 4KN4A 2E6MA 4B08A 1NK0A 1RT7A 3SV4A 1ZQUA 5CY4A 4FLYA 4OKKA 3QEVA 5C42A 1D8LA 2R8GA 2X6NA 8ICIA 4UQGA 1ASWA 3H40A 1XSLA 4MEYA 4F4KA 4QW8A 3M8PA 2ZE2A 4F3TA 3JPPA 4RQ1A 1F21A 4O44A 2HHUA 4J2EA 1BPBA 4W5RA 4Z4HA 1K6YA 3K5NA 5J2NA 9ICQA 1YVUA 2YNFA 2VG5A 1TL3A 2Z1HA 3E01A 5KFHA 4KHQA 3UQ2A 4IR9A 1L3TA 8ICAA 3VQCA 4CF1A 4M47A 1WSEA 2HNZA 4CGHA 4QW9A 3QEBZ 4ECTA 4CJTA 1S76D 2IDOA 3Q8SB 1U4BA 4OPKA 1WSIA 5IIMA 2RKIA 4QZEA 4E1NA 4RG8A 1UWBA 4FJMA 5KFIA 2J6UA 3OYKA 4J9OA 4FLVA 4KI6A 4F5RA 2FMPA 4ZTFA 4Z6DA 2XY5A 2VA2A 1XHZA 3ALYA 4OVLA 5CZ2A 2PFQA 3QO9A 5KT4A 1RBTA 5L1JA 4DOAA 1HUOA 4KLJA 4CJSA 3TAGA 4F5QA 5CYMA 3D0PA 4LY7A 1TV6A 2E4LA 3V72A 3O3HA 3PW4A 2DY4A 1NKBA 1Z00B 5KFXA 4Z6FA 3K5LA 4RNMA 2OZMA 3L3UA 3VQ6A 3MR2A 4RQ0A 3AA5X 5KFBA 4B9LA 2QXFA 4BWJA 2H5XA 4FLWA 1ZQHA 4UB3A 4O55A 1A5VA 2WTFA 4J2AA 4CEZA 4XRHA 5KI6A 2X6SA 3PMLA 2DFFA 4NY8A 1D9FA 3EY1A 4WE1A 3OYFA 4GXKA 5CR0A 4E7LA 4GLXA 3PW0A 1T05A 1NK7A 3HVTA 3MXIA 2FBTA 1JMSA 1RBVA 3CYMA 4QCLA 3NH0A 4KO0A 9ICFA 3SUOA 1LAWA 7ICGA 3DLGA 3DLKA 2NRTA 2FMQA 4CJFA 3RMAA 5L1LA 3AA3A 3ZT3A 2BE2A 3PMNA 5KFEA 5DB7A 5HRPA 2ASLA 1EP4A 4M3XA 3KHGA 3HP6A 1NOMA 4N76A 2NRZA 3C21A 1HYSA 1ZQYA 5I42A 4AHUA 2LYHA 1RDAA 5J2FA 3MFHA 3V6KA 4W5NA 3RB0A 3KIOA 4ECQA 1IM4A 4FJGA 8ICEA 3I8DA 3IM1A 1S1WA 4ECUA 4CIGA 2A1SA 4B9TA 1TAUA 1RT5A 5J2CA 3TAMA 1CLQA 4YD1A 3PO5A 4O5EA 2XGPA 4YG2A 4JV0A 4O3SA 3DLRA 1NK4A 4YVZA 4DU1A 3RB4A 2BQRA 2BPFA 1HYVA 4MF8A 5JS1A 2PZSA 4QWDA 1JL1A 1ZQAA 4R63A 4KKOA 2VA8A 2DPJA 3Q8QB 5C24A 3MR5A 3KJVA 3GFKB 4FVMA 3P5JA 2VWKA 2A1JA 1S9EA 1R0AA 1BGXT 4CFBA 1EKEA 4GC6A 4IR1A 4CGGA 1ZQVA 2W9CB 5J0PA 9ICEA 8ICUA 1JLGA 5DQIA 5L9XA 5CYQA 1KCFA 2YKNA 4KLIA 3CFPA 1L5UA 4IKFA 3VQEA 5L1KA 4CHOA 4I2EA 4FW2A 4W5TA 3C2KA 4I2FA 4CHNA 3QEPA 2I5JA 9ICSA 4I2QA 2XRIA 3U3GA 3KLIA 2RF2A 4CFAA 3RMBA 3PNCA 2AGQA 9ICPA 3VQ8A 3V1OA 4FZYA 5DB6A 3RBDA 2W42A 1S9GA 1TVAA 3Q8RB 2OA8A 2QKKA 3T5LA 4KTZA 1U9LA 4I2BA 1BI4A 4UBCA 8ICXA 2V4RA 2KW4A 3O4QA 5KG2A 4R8UB 2B6AA 5DB8A 3LPTA 4B9VA 1T4GA 8ICYA 3OSNA 3SCXA 2OWOA 4DTNA 5F9LA 3TABA 2HHWA 4K4HA 3RH6A 7ICRA 1WCLA 4JK1A 1A5WA 4DTRA 3CFOA 3MR6A 4QWBA 3TAFA 1CEZA 5KFNA 4F5OA 4OKEA 3V9SA 2I1QA 4J9QA 3GQCA 4Z6EA 3K5MA 4Q5VA 4DMNA 2XC9A 1D8YA 2O4GA 2OPPA 3QZ7A 1X9WA 3ZDBA 9ICVA 1KLMA 4DLGA 3PX0A 3JSMA 2ZJ5A 5KG0A 4M42A 4RT2A 3NF6A 2G8WA 5BPCA 3UXOA 2YNGA 3LALA 3P1GA 4B9NA 4FJ5A 2PI4A 3K59A 4NCAA 1X9SA 4GMJB 8ICQA 3GV8B 1G15A 4QWCA 4CEFA 4M3YA 3OYDA 5HP4A 4ECWA 4YMNA 4IQVA 3QEWA 3V81A 3PO4A 4CEEA 3PX4A 3M9MB 3B6OA 4DSJA 1VRTA 3DLHA 1EX4A 5J2QA 3HPHA 1S1XA 4YMOA 4YR3A 2F1JA 5EWGA 3BQ2A 3AO3A 1S97A 2W9AA 1B43A 1NOZA 2HMIA 1QS4A 2JGUA 2F1HA 3QEXA 1HYZA 2V9WA 3WNFA 5KFZA 3U6FA 5KGXA 1HNVA 5KFTA 4IBNA 3KHHA 2PFPA 5HLFA 1ZQMA 3AVCA 3AVIA 5KRTA 5J2GA 3OHBA 4KTQA 2XO7A 4KLUA 3K75D 4C8KA 2EHGA 4EYHB 4GXJA 2XCPA 3NGYA 3K57A 2G8UA 4Q44A 4PHAA 3TQ1A 2P51A 3SQ4A 4Q8EA 4RPXA 4Z4EA 4I2DA 2X74A 5I3UA 5DBBA 4O3QA 4NLZA 4J9PA 2Q0ZX 5CP2A 3ISCA 4DF4A 3NHGA 4HCBA 4DS4A 3EWAA 4FXDA 3ZSXA 4PGXA 5HHIA 5KG6A 2KZMA 4CIEA 2ZD1A 2F8TA 4O5CA 3C1ZA 1NK5A 3HSTB 2ISOA 5J0UA 5SZTA 4HUGA 1SKRA 3SUNA 4ID5A 1RZTA 3HK2A 3HJFA 4E7IA 2OPQA 3NF7A 4UAWA 4KLDA 3OYMA 2XGQA 4FJHA 3OYNA 4HUEA 4YP3A 7ICEA 1CZ9A 4CEBA 2V4QA 3WNGA 5D3GA 1ZBUA 2ATQA 3ZT1A 4FJ8A 1XO1A 4LZDA 2WOMA 4PY5A 4YXJA 3VA3A 9ICAA 1ZQKA 5L1IA 1TKDA 4I2CA 3TFSA 4B8AB 3AVHA 2ALZA 1GOCA 4ZHRA 3AVLA 3AVGA 5J0OA 4IG0A 3LZIA 2ZTCA 1JLAA 4NLGA 4KLQA 3NGZA 4FJIA 2RN2A 1WAJA 2NRWA 3M9NB 4JWNA 3OYLA 3H4BA 4DU3A 1JLQA 3MDAA 1UA1A 3SI6A 1ZQCA 3L3VA 2O4IA 4RW9A 3O4NA 3LK9A 1ZQSA 4C8OA 2AJQA 2IGIA 3KLEA 4UB2A 2E6LA 1MQ3A 3RRHA 4NYNA 2OPRA 3NCIA 7ICLA 2ITGA 4M2YA 1KDHA 3GDXA 3HP9A 1ZBFA 2D0CA 3AVAA 3F73A 4I28A 3H8SA 3OYHA 5D49A 2W8KA 3TANA 4CK2A 4KLFA 3ZSOA 3ZD9A 3RB6A 3AU6A 4KLHA 2YKMA 3OGUA 3DOLA 1TV9A 5EOZA 3JPTA 3B0YA 2PFOA 4N56A 9ICRA 3DI6A 3GIMA 3G6VA 1FXXA 1N5YA 7ICUA 1ZQXA 4KLSA 3FFIA 3QESA 1XC9A 8ICHA 5C25A 3HPOA 1YTUA 2FMSA 1HUZA 3C2LA 3G6XA 4KREA 3BQTA 5KFAA 4YMMA 3OHAA 3K4GA 4ED2A 1BHLA 4DLEA 2I9GA 3JPNA 4LH4A 4UAYA 4TUSA 5KTQA 5IILA 4I9LA 2HHTA 3ETLA 3M8SA 2R7YA 1S0VA 9ICIA 4DTPA 5KFQA 2KZZA 3FDSA 5KFOA 4IRCA 4XIUA 1X9MA 3GIIA 4BDPA 4ECZA 4LD0A 2YHBA 4B9SA 2BCRA 7ICVA 4F5PA 1S6PA 4Y1CA 1ZQNA 3NGIA 4CE9A 1ZQFA 4J9LA 4M6WA 3V6HA 2W9BA 2JEJA 1B9DA 4CJVA 4JRPA 4HVJA 1LWCA 5KFWA 4NYFA 4CK1A 3SJJA 1BCMA 1JN3A 2KFNA 3JPOA 2J6SA 4F8RA 4PPXA 1RT1A 3HWTA 5K14A 4E7KA 1VRUA 3V1QA 1RTIA 4MF2A 2B4JA 3D45A 1ZQJA 8ICFA 4M45A 3RJHA 5HNKA 1BPZA 5CZ1A 5KG3A 5HROA 4ED6A 3V7JA 1JLCA 1K1QA 2FPMA 1A77A 4RQ4A 4CGJA 2GBZA 9ICWA 2BGWA 1T8EA 4KAZA 3IG1A 3PW5A 3KTQA 2G8HA 2NRVA 7ICNA 9ICOA 2WONA 4JWMA 4XQ8A 5IIJA 4KHUA 2UVRA 3H4DA 4FJXA 4QAGA 3LPUA 4EYIB 4O3OA 3OVNA 5KG1A 1U49A 3PX6A 3EZ5A 5DLGA 4CJLA 1V9PA 2G8KA 3SI8A 5DQGA 3QZ8A 4RQ6A 2BKEA 1W0HA 1X1PA 4DQSA 4R5PA 2A1RA 3L2RA 3M9OB 5EU7A 1JLEA 2R8JA 1HJRA 3V9XA 1TK5A 2OYQA 3HO1A 3OS0A 1TK0A 3CG7A 4FBTA 4DTXA 1BPDA 1ZQZA 2XY6A 7ICKA 5J2HA 3V4IA 4ZTJA 4NCGA 7ICPA 2QK9A 4Q45A 3RMDA 1U04A 4M3UA 2IHMA 4KLLA 1EXNA 4IRDA 2KTQA 2G8IA 2F96A 2G8FA 2IBKA 3LP2A 1ASUA 3DM2A 5J2BA 4HYKA 5DG7A 7ICOA 3T19A 4PHPA 2IHNA 2Z1IA 4DTOA 4QZIA 3ZDCA 5KFCA 4DQRA 4M3RA 4KPYA 4CF2A 5E41A 3VQ5A 3UXPA 1JXEA 4DFPA 3NAEA 4KHYA 3DRSA 2JEIA 4CF8A 4ECYA 1BPEA 5KT6A 4J9NA 3RR7A 5TZVA 5F9NA 4CJRA 5FDLA 4LSNA 2P5GA 4J9MA 4DL6A 2JZBB 4DL2A 4OLAA 3HW8A 2HVIA 2BQUA 4RQ5A 3ZDAA 1NK6A 5J0XA 1UT8A 4PQUA 2LSNA 1WCNA 3OYGA 4ECXA 1BPYA 4KB1A 1K1SA 4M3ZA 2JLEA 3C1YA 1MSWD 1KSPA 3NBPA 3QEAZ 5HP1A 4LSLA 2P6UA 2C2DA 3AV9A 3C6TA 2W9CA 1D9DA 8ICZA 3ISDA 3K2PA 2W8LA 3VQ4A 3ZCMA 1RBSA 3RH5A 1C1BA 5EWFA 2ASJA 4KMUA 4O4GA 4UBBA 1ZQGA 1IXRA 1TGOA 4BDZA 1XWLA 4FO6A 3AU2A 1ZQTA 1XU4A 3QEIA 3MABA 1HQUA 4XA5A 3BJYA 4CHPA 3RMCA 5KFSA 4DTSA 4QZHA 3V6JA 3RJGA 4X5VA 2AQ4A 4FBUA 3QIPA 4I2PA 1RDDA 3T1AA 4KV8A 4YQWA 4I2AA 4CGDA 3NGDA 4KTWA 3PV8A 1IKXA 1CZBA 3CM6A 3F9KA 1ZQLA 4I7FA 3ZT2A 3MAQA 4PWDA 3T5HA 5EWEA 5KFLA 4Q43A 1O1WA 5J2DA 3JYTA 4OKJA 1ZQOA 4FK2A 9ICBA 1SZPA 2W9BB 4BE2A 4RNOA 3H8WA 3Q8MA 4M6WB 4F50A 3RBEA 4FS2A 5KT5A 2RDIA 5HBMA 4MFBA 4J9KA 4CF0A 3QNOA 3SUQA 1FKOA 3M8QA 4JUZA 3JPSA 4DFKA 2YNIA 2BPGA 3HXMA 7ICQA 9ICCA 1U48A 3AVNA 3GILA 4K4IA 4I9QA 4AH9A 2VA3A 2BHNA 2B21A 2ZTEA 1S10A 4AILC 3H7IA 4Z0UA 5HMMA 3V9ZA 3C2MA 4E89A 4ICLA 9ICXA 3RH4A 1RBUA 1QQCA 1RPLA 1VSLA 1AROP 4QZCA 4GVMA 3PW7A 5KT7A 4CEQA 5J2PA 4C8MA 2KQ2A 3RJKA 2JEFA 3RJFA 4R8UA 3AUOA 3T5KA 2BPCA 1NJZA 1C0TA 2X78A 4FK0A 3HM9A 4CJEA 1LWEA 4EZ6A 3PVXA 4HHTA 3GV5B 3VQAA 3IRXA 4CIFA 4DG1A 2BCSA 5KFGA 4TQSA 1Q9XA 4BACA 1TFRA 4H4MA 4KN7A 3MR3A 4CECA 2QKBA 3DYAA 1LW0A 1L3UA 2JEGA 3UQ0A 1BL3A 3SQ1A 3LWLA 3OS1A 5KFYA 3LDSA 4PGQA 2FPKA 1RT3A 4FYDA 1RDCA 4ZH4A 4I2GA 3EW9A 4I29A 4AHRA 2R8KA 1SL1A 3KK3A 3OSPA 2BQ3A 4RUAA 1HNIA 4UB5A 2C22A 4M3WA 4M9NA 1J54A 1ZYQA 4F4WA 4QZBA 3IAYA 1TL1A 2A1JB 1S5JA 1ZQRA 4KHNA 2ZUCA 4HCCA 1XSNA 1FKPA 4M41A 3MFIA 2VANA 9ICJA 2KZ3A 4CESA 2RPIA 3IHQB 4DOBA 1WLJA 5HRSA 5SWMA 3OYJA 2MUTB 1RXVA 4BGDA 4P4OA 4K8XA 3HYFA 4AHTA 1IKYA 3G0ZA 4CCHA 2XY7A 4ELUA 1QTMA 4DS5A 4EBEA 2PY5A 2D5RA 3NH1A 4RUCA 4KLEA 2YHAA 1RDBA
chains in the Genus database with same CATH superfamily
2VOOA 2ZDPA 1OH8A 4PJ0U 4UAZA 3MOZA 5ETPA 2QE5A 3VEZA 4NRUA 4NLDA 4QU7A 3CJ7A 4YXMA 2RHQB 3DMJA 3MPYA 3M2UB 3SMVA 3V9WA 2JX2A 4FLTA 8ICOA 3C23A 2LU1A 3CJ3A 3MCAB 2MKKA 2LCWA 5DZ6A 3R7SB 2FVPA 3SEIA 4OPJA 1PK1B 1HPZB 3QIPB 2OH2A 1CJUB 1URNA 4Q8FA 4H0XB 1ZM2A 2QZ8A 3AOCA 5AQYA 3BGRB 2DHHA 3FLCO 3FM9A 2BCUA 2YH1A 1RDRA 3ULHA 4CYUA 2BEFA 3SQIA 5ITHA 1WHYA 4U67Q 5ALIA 5J2IA 1BA1A 4CJQA 2V94A 3HD2A 1J9AA 5FPEA 3LYSA 4FJLA 1T3OA 2DGXA 3BM7A 4FOIA 8ICTA 4PHEA 2ZNYA 2FLLA 4ED0A 3ADAC 1QSLA 2DRDA 4F4XA 1S59A 3F0NA 2OFGX 3O6WA 1UA0A 4ZVHA 3WXKA 4DR2K 5DG9A 4FS1A 1UVLA 5KT3A 4U6PA 1Q7LB 3CQ8A 4C9DA 2D9OA 4J2BA 3G87A 5BXIA 2JZBA 4DQQA 2W7PA 1U24A 4ILJA 4CZFA 2MZTA 3HSGA 3R7NB 3L2VA 1W9HA 3HX0A 3WEEB 2QLBB 2VG6A 3QINA 4O9MA 1MLAA 1NPRA 4JLHA 3F44A 2BH1A 3TWHA 2OD6A 4OIXA 3PZPA 4NA2A 2ZQBA 2YNGB 3NCPA 1VHIA 3NE6A 2KG0A 4TURA 3HFZB 4X2BA 2XS2A 4M1KA 4M5KA 1VIOA 3LP0A 2OPPB 3EO3A 4AYBC 5JS2A 1FNMA 4O3PA 4XH5A 3I5BA 2IM3A 3CE8A 2DQNB 2ZUAA 4AFFA 2MUTA 3LQVA 4JEPA 2MLXA 4RW6A 4UOFA 2K89A 3FE1A 1PC5A 3WKCA 4TU8A 1SL2A 2FD2A 3KLGB 3U8XA 4L76A 3KLHB 3U3YA 1SQEA 2NLXA 1COOA 1B0VA 1K73T 5KFVA 4ZLNA 2IOFA 4DF8A 2R8IA 1BVSA 2G2ZA 1H6KX 3RRKA 2XYGB 4MFFA 2F77X 4MFCA 5D0GA 3ZSVA 3ISZA 3KLEB 2NLWA 1VC6A 1GLBG 1P8ZA 4AHSA 2XMJA 2P6RA 1V38A 2FLPA 5D4LA 2MU2A 1VSIA 4X65K 4RQMA 1HD0A 2CQGA 4ZP9A 3JAMU 2AT1B 1VQNN 4Q2MA 4K2JA 4CD1A 2G4BA 3IR7B 2HFNA 2JVOA 4Y2PA 2XHBA 1HRHA 4BRCA 4NRTA 4ZHRB 5J1EB 4Q0BA 3GSDA 5AQFA 2VJVA 2J76E 1F9FA 5ALVA 3D4JA 2UUBJ 3R5CA 2RHFA 4Y3CA 4LVOP 2YMMA 4CLFA 1HJOA 3X1LB 1U8WA 1REVA 2LU2A 4MKVA 3KD5E 1KC8T 3CVKA 4CWBA 3RTVA 2V8PA 1LWEB 2OMOA 4UB6U 3TAEA 1PVQA 1SC3B 1BC6A 1S77D 2HHXA 4IC9A 2Y0SD 4CZHA 5IIIA 1I94F 4IFVA 2EZZA 2VU5A 4H5VA 5J2AA 1VSKA 1IBKK 5AXNA 1D9AA 1ZD2P 2YWWA 3UQSA 2BANA 4KRFA 4WFBQ 3BZQA 4EP5A 2UVVA 3HSCA 3A8KA 4YOWA 3D2QA 1FK9B 3TAPA 4DFJA 3E66A 3A8IA 3N97B 2ZBCA 1IKWA 1N36J 4E7HA 3CCJS 5DBCA 4TNOA 3R9KA 3DJCA 2EK6A 3MMVA 3EZUA 2B5JA 1PO6A 2VZ9A 3UN2A 1WF0A 4CERA 3M32B 4TY8A 1C7YA 9ICNA 1TVRB 1FEHA 2ZJRQ 2M8HA 2QTWA 2EAPA 4LQ9A 2R8HA 1LWXA 1DZ5A 3M05A 4EX6A 3T6JA 1WNEA 2J6TA 2HGMA 3MMCB 2L48A 2KB2A 4DL5A 1Q53A 2RUSA 4MAKA 1J6ZA 5M1FA 2FJVA 3MBYA 1OUQA 1WSHA 1EQ0A 2P9IA 2V68A 1XNQF 3QE9Y 3SCLE 1NOYA 1F3FA 4QR1A 4ED7A 2P6SA 4BS2A 1YJTA 1N5QA 2GX9A 3TZYA 3OUYB 3JPQA 2L9WA 2X3DA 3MEKA 3L4QA 2IOCA 4QYRA 5CCMA 4O5BA 2MQLA 4PZVA 7ICFA 4DO9A 4HTUA 1MWQA 3S41A 3HBTA 4KQZA 4XUSA 3FMWA 3LAMA 2YKPA 1RYSA 3Q7CA 2HBQB 3T1YJ 4O0JA 4CEDA 1ZZFA 5AQWA 2I6WA 4CO0A 3I5CA 4O5FA 4F92B 1GAOA 1C0FA 5DRKA 2ZEJA 3OFHA 3SDEB 1BISA 4PHTX 2XHWA 3A3OB 3ENQA 1VJ5A 4CEOA 3ELHA 3I6PA 1FRJA 1ILYA 3ISBA 8ICCA 2KEYA 5JMNA 4O3MA 2EKYA 4IRKA 3UDEA 1A6SA 4CDIA 2PFFB 3C7NB 1MW7A 2ROGA 1C1CA 3RB3A 3I0SA 2ASYA 5F3XB 3AVFA 1RBRA 3T3FA 1BNPA 2C2OB 3ITHB 1VQ6S 3U27A 4CH0S 1WJ9A 2AKWB 4F4YA 4B8CA 1NI3A 1QAXA 2GC8A 1N32K 1SBRA 3OPXA 4P73A 5KL1B 2NS1B 5HHHA 2EC0A 1F3VA 1FW6A 4DX5A 2GMJA 1NJXA 1WOPA 1GLLO 1TKZA 2K06A 4ELVA 3D0IE 4DEZA 4WCEL 3VOVA 3AO4A 4PGYA 4KGZB 2KVCA 3OYBA 4P4MA 5LMNK 2HHSA 2AHOB 3C15B 2V8HA 5J2EA 4QZAA 2V50A 2JRZA 3TSPA 3IBPA 4K42A 3Q86A 4HACB 4KY3A 7ICJA 1Q3VA 2XSJA 5AZIA 3AVJA 3L5KA 2P9UA 3BBFA 2AF6A 3SFUA 5J1PA 2FBYA 4OHXA 4A8KA 5L38A 2LQ5A 4YN4A 2AJ1A 1NNEA 3BEGB 3RVCA 4DFMA 4V19S 3H5SA 4NO7A 4DX6A 4DUYF 4MJKA 2F63A 1BO5O 1U1LA 1YKWA 2XSFA 5KFUA 2HVZA 2P1JA 3GIKA 5HROB 5IC4B 4X66J 4LF6F 3AO5A 3C8YA 1S72S 1EJ7L 4RJVA 4CD3A 1IKVB 2F1IA 3OJSA 2AGPA 1IKYB 3CQYA 1C0UB 4KB0A 2FLOA 2FPLA 3ZSYA 4OQJA 2JLGA 1QJHA 3CI5A 2HWTA 2O67A 2P5VA 1RT1B 3O9TA 3S01A 1JCFA 8ICMA 3FC9A 4USHA 2GJ2A 1LWCB 5HAOA 2V4JA 3ORYA 2PT0A 1FEEA 2FE9A 4QZ8A 3O9QA 4CF4A 4L6V3 1N5TA 5F8JA 3NMAA 4BQZA 4Y1DA 4X66K 4YY3K 4RBVA 4RPZA 4M5DA 5FLXU 3QFPA 2HHQA 3PACA 3SV3A 4HHHA 5U47A 1XO0A 4IOCL 4YORA 1E6VA 2ZHOA 2FB0A 3BZKA 1NK8A 3D9BA 1RTDA 2VJUA 5ALNA 3A3NB 3IFRA 1TK8A 2OELA 5BYQA 2IY5B 3IS9B 4DQIA 4NI2B 2BM1A 4LJXA 2Y3YA 1VC0A 2OTLN 3OJUA 1EKSA 2KL8A 1PAUB 2F40A 3QATA 3J7YI 2ZUBA 1CS4B 4Q7AA 2KICA 4BE0A 1T03A 1DK2A 2Z7JA 2G2OA 5KG4A 1F60B 4J5OA 4FF1A 4RTFD 2PMWA 4E3SA 4L3QA 3LDAA 4E1MA 1IJFB 4MEXA 1YJRA 5F3TA 3SYZA 2E5GA 1C20A 1ZD5A 1C0MA 1A76A 3HD1A 1JL2A 4H4MB 4DUTA 4CJWA 3BSOA 1J53A 2ZJ8A 3M2VB 1EX8A 1YAGA 2KN7A 4GXIA 4DWIA 4NLNA 1IVZA 5HMXA 3O3FA 1R3NA 3Q0AA 3PKMA 1R8HA 3MEDB 1HI0P 5AKHA 1CQNA 3VAGA 2R2RA 3BO3A 2PAVA 1I6JA 3QU5A 1C6VA 2CQBA 1YIJN 1YJWN 3SFGA 2Z1GA 1RBLA 4JAXA 4H8KA 1JLQB 3BN4A 2AV5A 2J9EA 3R5GA 2QFJA 2QYGA 2FLNA 2ZBIA 9ICLA 2E8PA 4C2MA 2P9EA 3MPDA 1RTHA 4G1IA 1XMQK 3NGKA 3G82A 3K5OA 4OX9F 3ZFVA 1L3SA 1UWBB 2DKZA 1MROA 3ATUA 4TYAA 3L8BA 2VG7A 1IO2A 3W2WA 3HTVA 3MEGA 3CC2S 4B3RK 1ZQ1C 2BE9B 4IQMA 2FI1A 1E4FT 1LAVA 1WAFA 3BGLA 1JXBA 1TKTB 4IQTA 2QTDA 1SH0A 3BEXA 4OMFG 1J27A 4NCBA 3MECA 4I4BA 4WF9L 1KVBA 4CRXA 2QB0B 3HZEA 2H48B 2KU7A 4LF5F 4IQWA 3T6BA 2J9DA 3H08A 4IQUA 4MMOA 2HBMA 4I64A 4IQXA 3BDPA 3S3NA 2HFVA 4WYBA 2MQMA 4EP4A 1PBUA 1RT6A 2VQEK 4ALZA 3GCWP 2WVCA 1T9XA 4NWBA 1HR0F 5AT1B 1QSYA 3TU5A 4P10A 7ICIA 5E26A 1U1KA 2ODGA 3QDKA 8ICWA 4PHDA 1NM2A 3BBBA 3A5OC 3HL8A 3RAXA 3RAQA 1KAYA 4DV0K 2KG1A 4RZRA 3DLKB 3VQDA 2RRBA 1I94J 4IDKA 4Z37A 4RNFA 1DQ8A 4K43A 3VALA 4V19J 4RW4A 3QU2A 1Y97A 1RXWA 2DXFA 1M5KC 4B3OB 5T7BA 5HOOA 1WC1A 1OYDA 4CBXA 4K4TA 2Y8WA 2W03A 5I3QA 4CLZA 1S1TA 4YHHF 5HL7Q 2ZJRL 4FCYA 2KT3A 4B08A 2A6AA 4CO1A 4YB7A 4HACA 3LPYA 1ZQUA 3K1RB 1HW9A 2WK4A 5CY4A 2PEBA 3MD1A 4FLYA 3JAMO 3QEVA 3CT9A 5D4PA 4DCPB 5F8GA 1D8LA 2VQFF 2X6NA 4UQGA 3CXCM 2GHPA 4H0YB 4F4KA 4QW8A 1F21A 4J2EA 1N6QB 1BPBA 4W5RA 3J80Y 4A5BA 1GX6A 3FCVA 3D3BJ 1UEUA 3MECB 2KFYA 9ICQA 4O8UA 1HWUA 1WWVA 1YLXA 3OTOF 1TL3A 5KFHA 4GKKJ 2CQCA 2HOIA 2Z8QA 4M47A 3VVTA 3CEDA 4CGHA 4QW9A 4ECTA 1JCEA 3CP8A 3Q8SB 1O5JA 1FFWB 3BDEA 5IIMA 4EFAC 4FJMA 5KFIA 2LA4A 4J9OA 2MSTA 2NREA 3HSZA 3HOTA 3HHLA 3NS6A 3H3NO 4ZTFA 2OUGA 2AYBA 2V52B 3T1HK 2O8CB 2ITMA 3MEEB 3GONA 3FCWA 3KJQB 4LFAF 1VI7A 3GFYA 2F8KA 5IFMA 1KQGB 1JWWA 1RBTA 1WF1A 4QJFB 4PXBA 3MPWA 2I5HA 3JTPA 1FFSB 4KH0B 3IXQA 4LY7A 5ALPA 2H51B 4OI4A 2YWKA 4ZVFA 4FWKA 2DY4A 1NKBA 1UFKA 2FJBB 2YNFB 3PJ9A 4XH4A 2BW7A 1R31A 3L3UA 5G5HA 3KOOA 2OHFA 4RQ0A 3AA5X 4ES1A 2H5XA 1ZQHA 1U2FA 4DUZK 1RWMB 1A5VA 5KPTA 1LXNA 4C1NK 4CEZA 4BHQA 2EAMA 3M5RA 1K9MO 4XRHA 3FZHA 3E8OA 5KI6A 2DFFA 2C2MB 4CDGA 3EY1A 1UP1A 2CPZA 5CR0A 3DOMA 4GLXA 1T05A 2O66A 5B0DA 2YHWA 4I2QB 5AM0A 4KX3A 3F5EA 4YHHJ 4C0HA 3CYMA 4P6QA 4IG3B 2RJZA 4RW4B 1FNXH 1S8OA 2IOHA 3R97A 1Q7YT 2MPUA 4KO0A 9ICFA 3D2FA 1JUDA 3OBYA 3EXCX 2KG5A 1BDGA 3ZT3A 2GHWA 1GLDG 2BE2A 4BRFA 3PMNA 4A8XA 5EX0A 5DB7A 4K41A 3EE9A 4CGZA 2QRRA 1PYTA 2GTDA 3CJBA 4C0BA 1NOMA 2MZRA 4W4MA 3M7VA 2OO4A 1ZQYA 1QTNB 1HBMA 1RU1A 1OVYA 4JKDA 2UUAJ 6AT1B 3KIOA 3BV8A 4DR7J 1RM6C 4G1PA 1T9UA 2D74B 4M8LA 4YDXA 1NJIO 1FJCA 1A6LA 3TNVA 1GLEG 4ISGA 1QQOA 4JV0A 5DDPC 5A8WA 3FRZA 1NK4A 2M2BA 3R6LB 4BRIA 2M5YA 3NNHA 3UE5A 4H0OA 4WP8A 1HYVA 4MF8A 3OTBA 3DOLB 4RBTA 1ZQAA 4QS9A 1A9NB 3DRPB 3NLCA 1IM6A 2UXDF 2BXJA 1VQPS 1JI7A 1T11A 3KYLA 4FVMA 3S8SA 2OM6A 4DV2K 2LYVA 4Z2XA 1S9EA 3F5TA 1BGXT 1MDUB 4IR1A 1ZQVA 3D1HA 4OJGA 9ICEA 8ICUA 1RWPB 1JLGA 3BREA 3K17A 5L9XA 3TOQA 3LDNA 2YKNA 5AK6A 1KCFA 3CFPA 4N7TA 1JJ4A 4Y2CA 3A12A 1GH8A 3SMSA 2BW2A 2HHPA 1DURA 3H25A 3K9JA 9ICSA 3BYPA 1NMEB 1NUEA 2FGOA 5F8NA 3PNCA 2OTJS 4M95A 3KZBA 4XH1A 2YMLA 4PKDB 2XS7A 3V1OA 3WKAA 2QLWA 2DEJA 3Q8RB 2ACMA 4ZLLA 1NPKA 2AZ3A 2HS3A 2WOMB 2RP5A 4NLXA 4KTZA 4FZNA 4I2BA 2YQ3A 4CZEA 2AA4A 8ICXA 3OLBA 3ETRA 4GNIA 1FIQA 2V4RA 1X9XA 1NZAA 2KIWA 1L6NA 2ZH6A 4LR9A 3KDOA 1U1RA 2B8QA 3Q89A 3PSPA 3VEWA 1N33J 3SAHA 2AYEA 3OSNA 3SCXA 4DTNA 4ED5A 3TJAA 1T03B 1CLFA 1A5WA 3CFOA 1C1CB 3MR6A 1X4GA 2OEMA 1B7YB 4OKEA 4NCGB 1GTEA 5T41A 4QZVB 1FERA 1MN7A 4WU2A 1V9OA 5F3ZA 3TA1A 3HKZF 4DMNA 2LBOA 1UVJA 2OPPA 4LFBK 3QZ7A 1KLMA 2V8GA 4DLGA 3TVYA 2GO9A 3TZZA 4QIWD 4R5PB 3NF6A 2G8WA 4NX9A 5ALJA 3P1GA 3G2XA 2O8BA 4FVCA 2FZGB 5AE3A 3ZEUA 3K59A 5H9EJ 1N36K 5F41A 2N3OA 3OYDA 2HNZB 1XNRK 2JR5A 1XUPO 3P38A 4MKYA 5ALUA 1RWKB 3IFEA 1A0OB 3VGUA 1PC4A 1OSCA 5ALDA 2YXLA 2UXCF 3B6OA 4JKFA 3EGWB 5ETQA 4YOUA 4JNEA 4YMOA 4YR3A 1FA0A 5EE0A 2F1JA 1C4AA 3AO3A 3OFFA 4KV8B 1QS4A 3OXFA 1HX1A 2PMZC 2JHEA 1M5OC 3CWJA 1RP5A 4OYWA 2HMIB 2OKQA 1V4TA 2IJNA 3O44A 3U6FA 2CQ4A 3I1YA 2I6XA 3B82A 3QSIA 1RTIB 2QSWA 4UUWA 3AVIA 2O8FA 5J2GA 3VAHA 1C1BB 3KKAA 1VLOA 5K8PA 3A0HU 3K75D 1HLWA 4X4VA 4PHAA 3L3FX 2W3RA 2P51A 4RPXA 4Z4EA 5IWAJ 3ZO7A 4BBYA 1QQ7A 3VZIA 3WQPA 2B5JB 3C15A 2Q0ZX 5FJ4A 3CD5A 2BMBA 2ASPA 3EWAA 4OV6A 4FXDA 3ULEB 5KG6A 1OPIA 3MWTA 4WXOA 3C1ZA 2D3OR 1U1NA 1XR7A 2ZZTA 1RDUA 1F5CA 1FVSA 5SZTA 3QRQA 4HUGA 1VCTA 2W4DA 5AK3A 4RWXA 2BJ9A 1OH7A 4E7IA 5LM7E 3VGKA 3R5AA 2FJDB 2IM2A 4DCCA 3FFIB 1GO3F 4H0PA 1ZD3A 1M5HA 3MM9A 1TFYA 3L6QA 4YP3A 2XWXA 1LKYB 4Y2TA 5K9FA 1CZ9A 1TP7A 1ZBUA 2B6GA 1L7NA 3MAHA 2HIYA 3LGHA 1VQ8N 1AXQA 2WF9A 1KQQA 4B8AB 1Z2ZA 2BJEA 2ALZA 1UPPA 3AVGA 4ZPTR 1K44A 2CPIA 3J8AA 3GU0A 1WG1A 2NSBA 4DX8H 1Z19A 4A5AA 3H4BA 1CC7A 2MGZB 1WWUA 2J0SD 3W2VB 2O4IA 3L3VA 3PFOA 1RAHB 3N4PA 5H2FU 3OT9A 2IGIA 1CQMA 3CCQS 3RRHA 1JNZB 2XZWA 4MN4C 2ITGA 2KIVA 1C0TB 1KDHA 2DO0A 4GO5X 3GDXA 1ZBFA 3F73A 2RLTA 1YG0A 1CZAN 3OYHA 5IT0A 2W8KA 3TANA 3QYYA 4KLFA 1TZ0A 3ZSOA 4DB3A 3IWNC 1Z1ZA 3LPEA 3NWRA 1TV9A 3I9ZA 4YB5A 4IOAQ 1YRUA 3JPTA 3QGIA 4ZIVA 1NHKL 4LRDA 1RFQA 3TACB 3GIMA 1PILA 3D2WA 3FFIA 5C25A 3HPOA 1YTUA 3TUIC 1FDBA 3C2LA 4RUHA 4URSA 4LF7J 4K4ZA 3BQTA 3OHAA 2Z30B 4OHYA 1ZA2B 1C4CA 2OTJN 3GJRB 2DF4B 1FRMA 4CLYA 2I9GA 2COLA 4MIBA 2E1ZA 5GIOA 4I9LA 3M8SA 4CW7B 1S0VA 3P5BP 5E3CA 1VQOS 2KZZA 1OMSA 2RILA 5KFOA 2DL0A 4IRCA 4CZJA 5D78A 3SAFA 3GIIA 3GDQA 1KP6A 2BCRA 1N36F 4F5PA 5DDOC 4QIGA 4CT9A 4M6WA 5GAHI 3NG8A 1ZTWA 2IVOA 2W9BA 1TL4A 2CPEA 3MTJA 4HVJA 4FPRA 4CK1A 3SJJA 1JN3A 3C16B 2KFNA 4F8RA 1RT1A 4LFCJ 5K14A 1HL6A 2CJAA 2HGNA 1NPPA 4AQYJ 2GUPA 3H7HB 4K2XA 2OHDA 3O80A 4M45A 5HNKA 1BPZA 4US8A 5E7OB 4HHUA 1JLCA 4JKGB 3VQSA 2VQEJ 4RQ4A 3DCAA 2WBRA 2F4VF 1HQUB 4G6VB 1T8EA 4DV2J 2ZITA 5E3AA 2K4PA 3LM9A 4LVNP 3E58A 4PQUB 3G71N 4BCAA 1NU0A 4OYOA 1T3VA 5KG1A 3OVNA 3Q2TC 1LFWA 2HK3A 4UY8O 1CJTB 1U49A 3FZFA 5KPZA 4J8FA 3QIDA 3BZCA 1UEKA 4XDCA 3PX6A 5DO2A 5DLGA 1J2MA 5DQGA 3QZ8A 4RQ6A 2BKEA 2E44A 2I2YA 1W0HA 3WK6A 3G8SA 4US9A 3HVWA 2RRDA 4EHTA 3BS9A 4I56A 1O51A 3CPEA 1S99A 3DM2B 5AJ3F 4H0VB 3L7UA 3HO1A 4FWSA 4PG8A 2M4MA 3W61A 2KKVA 3CG7A 1UCNA 2FHJA 5F8IA 1ZQZA 2RS8A 3V4IA 4NCGA 7ICPA 2QK9A 4DR6K 1R43A 4TN2A 1T6DA 4DV0F 1EXNA 4OYIA 3P8BB 3DRYA 4LFBJ 1VDHA 2BUPA 4DV1K 1X66A 1HPMA 2G8IA 1PUZA 2PSZA 2FYXA 3PIOQ 5J2BA 2W43A 4HYKA 5DG7A 3IBCB 4O44B 1SXEA 2HFOA 4PHPA 2W2NP 4NYOA 3N28A 3M8PB 3CC4S 1HIWA 4DTOA 4A8WA 3ZDCA 1Q18A 2XHCA 4CQ1A 1HNIB 4CF2A 1YGYA 2CPYA 1SKUB 4Y28C 2VWBA 3F2DA 3ZZOA 1RHMB 1JXEA 3NAEA 4P0QB 4PL8A 1VQ9N 5THWA 4KX5A 2JEIA 2JWNA 4ECYA 2HRYA 1BPEA 5KT6A 3RR7A 5TZVA 4QYZK 1DARA 1R89A 2ADCA 4OLAA 3J7Z5 2QLJB 1FJ7A 1NK6A 5IV3A 1UT8A 1WCNA 3LUYA 2POKA 1W7WA 4WFNQ 1IQZA 3RG6A 1RAGB 1Q86T 4OYBA 5I3UB 4F67A 1DK3A 3R9LA 4XDDA 4U7BA 3JSRA 4LT6A 3ATVA 2ASJA 3CSKA 3SSRA 3BF1A 4IH5A 1RBAA 2W54A 4QNLA 4NMXA 3VMFB 3QBXA 4KGMA 2QWNA 1NAQA 4BR4A 1JJHA 5KFSA 2G0IA 3CTRA 2CNOB 4QZHA 3V6JA 1FWKA 4X5VA 4FBUA 3UNYA 1UHUA 4KV8A 4YQWA 4I2AA 4CGDA 1NNLA 3PEJA 1VQ5S 4KTWA 2IPOB 2ASOA 2Q3PA 4I7FA 4QIEA 3MAQA 4JOUA 3ZZUA 2Q2RA 4IFYB 5B0EA 3CCRN 2BX6A 4JKCA 4JI2K 3Q8MA 1RWNB 5AQTA 5EUHA 1REGX 4WK3A 1MROB 4FS2A 1HYSB 1RHQB 2GZOA 3SUQA 3ILOA 4JUZA 3JPSA 2YNIA 2BPGA 3GB0A 3VCDA 3HXMA 7ICQA 4DPWA 3GILA 4C4TA 7FDRA 4XTTA 3KWGA 2JRSA 2P9PA 2IRUA 4Y0FA 2IOFK 2CZ9A 2VUGA 5I9EB 2H54B 4AILC 4Z0UA 1KL9A 1RAOA 2HBZB 1LCUA 1QQCA 3WK9A 2E8AA 4H5WA 3CXCR 1HLUA 2GVDB 2KM8B 1S6OA 4CEQA 2ZGYA 1UVIA 2JEFA 1A0PA 3FAHA 4HH1A 4YMEA 3AUOA 3WX4A 2CQ1A 2R7RA 4R25A 3HM9A 1D3WA 1EZZB 1LWEA 1WC5A 3BS5A 3AD7C 3ZNJ1 2E66A 4OYPA 5I3PA 4HHTA 3SMPA 2N3LA 2XO6A 3IRXA 4F7VA 4NLSA 2RB7A 2BCSA 2YKMB 5LMNF 4FPBA 2FF6A 2BJ3A 4AL7A 2K3IA 3KJFB 1N5WA 4KN7A 4CECA 2JEGA 1VQ7N 1BL3A 2FSJA 3GPAA 2F7TA 4AD6A 3ET6A 5KFYA 3LDSA 4IOBA 4PGQA 2FPKA 1DEJA 4UB8U 1RDCA 4I2GA 2IIRA 2F8HA 3W9IA 2R8KA 2LVWA 2HHHK 3NUQA 2RHKA 3CCMS 4BC3A 3JXOA 3G4SS 1T94A 5B0GA 3CD6N 2XTJP 4YB6A 2CFXA 4WQ5A 3WZ0A 3EKUA 1F2HA 5AQLA 2ZH4A 5FPMA 3GZ7A 2MY7A 2E2QA 1MWYA 3N01A 3WK4A 2A1JB 1WOOA 1WC0A 3H5UA 1FKPA 4NV0A 4DV7J 1FRIA 5ALYA 3RF9A 2E1RA 4JI0F 3D7EO 5ALMA 1ZBSA 5HI7A 4DV1F 3GR1A 3FBFA 5SWMA 2H3QA 1H2UX 3TVZA 3MM9B 3NCRA 4Y2VA 1RUSA 2XMAA 3I87A 4DV5J 3LDQA 1SQFA 1N54B 1RXOB 4AHTA 4CCHA 4OYXA 2WHEA 3WDOA 2WZ1A 2PY5A 4CVNE 4A59A 2ZIXA 1WF2A 2L5YA 1VHXA 1U6BA 1DLOA 2A2DA 3VQQA 5M2UA 4KSEB 1RWVB 2MZJA 1SKSA 2MQ8A 2E9ZA 5HL7L 3CCQN 1FTRA 1KVAA 1X2IA 3OTEA 1JJ2R 4IFYA 4DR3F 5DMRA 3C5FA 5CD4H 1VQMN 3V7KA 1SIWB 2BACA 1XMBA 2FUG9 3DLEA 3J80U 3N4QA 2XSJB 3BQ0A 1ZBIA 3GFHA 3GMGA 1TQLA 5AQQA 3WX8A 1WSJA 2QC3A 4BC5A 3P39A 4IEEA 2GHVC 3OY9A 2QWPA 1XN9A 1RABB 1Q0NA 3TA2A 3OV7A 5FLXO 2ZDOA 2BYCA 4RQ8A 5BR8J 2W4PA 3U7JA 1ELOA 3THXA 5CWRA 1T05B 1JJ2M 1NGDA 3NMRA 1GMWA 2GQQA 2O8FB 1KVCA 3MCPA 1T3NA 2ALYB 3ZT4A 4WE1B 2GELA 3OVSA 4R66A 5C2FA 2CXYA 2JWKA 3EE3A 1XHXA 2E88A 3RBZA 3GOIA 4C8NA 5LSOA 1AT1B 2Y1JA 2FC9A 4EFHA 2D6FC 2W25A 1HPZA 3AT1B 1X6JA 2ATLA 5BOMA 1ZRMA 4NLUA 5LMUK 2H3GX 1SV4A 1IWAA 1WUDA 1J97A 2D1KA 2FC0A 3DXMA 1SAZA 3V1RA 2Q6CA 1O08A 4OO1J 3E2EA 4BR2A 3BQ7A 3S3OA 2PXIA 5IWAK 1WHWA 3N5BA 4JI4K 5AKXA 3KLFA 4B17A 2F9JA 3EPIA 2DFHA 3SSQA 5HO4A 2J9CA 5JTIA 1EB0A 2H5JB 4RQ3A 1NKCA 4HT5A 3O2IA 2QEXS 4ZN1A 2ZBQA 4RT3A 1ZQIA 3LP3A 3LWMA 4ED1A 2GJIA 3HMJG 2LLZA 5J0QA 1OYEA 4LF9K 3CJSA 4JS5A 4MLEA 1Z4NA 3S3MA 2ZBRA 4B3TK 5H1SQ 1Q8IA 4AUKA 4DZDA 5GADP 4ZVGA 2GMLA 5GTHU 3DDHA 3W66A 1RLCL 3CJRA 3KHLA 3RRGA 1RG6A 2D0OA 1RT4A 1KRPA 3LH2S 3SQ0A 3CJ5A 2HI0A 5CJ7A 4ZPVR 1S9GB 3UPFA 4ECRA 1RHUB 4DUZJ 5J2NB 2UUBF 2AQ0A 3HKWA 4P0PB 8ICPA 1ASVA 1IBCB 3HPGA 1RU2A 3MWBA 2C2RA 1DRGA 5M1QA 4R64A 4EO6A 3CNHA 1VQ6N 2DH9A 4B1WB 3LZJA 5HRRA 3D67A 3DU5A 4I0WA 1N56A 1P1LA 5BR8F 2LHTA 1S1VB 2XS5A 2ROPA 2HFZA 1T6CA 3FBEA 3K5PA 4GY2B 4BE1A 2DNGA 4JI8F 1TVRA 3E9PA 4J2DA 1M6YA 1Q78A 3ENWA 4TY8B 4CZKA 4O8KA 1Y00A 4DX7A 5FROA 1WSFA 4HUFA 1D5AA 4PAAA 4CK3A 2OPSA 2MKCA 4DR3J 3L2WA 3VESA 3ENHA 2G13A 1NK9A 2BJ8A 2HB5A 4FKXA 2MQQA 5DGBA 2IVPA 5CHGA 1JRPA 3DHWC 2BANB 2LKZA 1TE2A 1XMQF 3EGVA 2YBVA 4IJAA 5ETRA 4FWMA 1PVRA 3R6MA 5A8WB 1O8BA 2EQYA 2PMZF 3W5XA 2WTUA 5A0LA 2ES6A 3KD1E 3JPRA 4RQ7A 1CJVA 2DHSA 1DBDA 5KT2A 1NDPA 3BR8A 5CD4A 3B0XA 4F3QA 4M9GA 2YWEA 2P9SA 3J80O 4WFXA 4WTOB 2GWSA 4ILHA 3W2WB 2GJFA 2G5HB 4F2RA 3UIQA 3MOJB 1YRXA 4NM1A 1VK3A 3DXKA 5JVGQ 2QFIA 2EG1A 2IC3A 3W60A 2Y1IA 1GLAG 3MDCA 1C2PA 3JQJA 1EP4B 5T7LA 3HZGA 2F7VA 4O0IA 2VC1A 1JJCB 4ZLJA 1LVHA 3NTUA 1QLNA 1IG9A 2D3O1 4B9UA 2DGVA 1RGVA 3VQBA 3ZXWA 4KLTA 4I2JA 4JI0K 1MNEA 2XVTA 2BUNA 2DNPA 2P5OA 5FD1A 4LFAK 1VQPN 3F2KA 3NFAA 1L3VA 3G8QA 2HHVA 5JUMA 1W7AA 1VRTB 4CJ3A 3GL1A 2E1YA 3ENVA 5IT9U 1X7VA 3CERA 3KLHA 3NS7B 2VL1A 4WXWA 2D4WA 1RTJA 3MGHA 4E8UA 2ZWHA 4NM2A 2EFOA 1J5OA 2CH6A 1RYRA 2PA3A 4M63C 1HHQA 3CPWM 1IBMK 4XPEA 5CB1A 2QYCA 2P35A 3GG0A 4EEYA 1WOQA 2GIRA 1N5SA 2VDHA 4FK4A 1H38A 1J5EK 2E1PA 1RAFB 3TVKA 2YTCA 4LRCA 3N9UC 4UARA 4N47A 2CVIA 1CS4A 4DV7K 2AJFE 2EZYA 4Y65A 5J8YC 1EXQA 2IS3A 4JS4A 1ZBHA 2YPZA 3DRSB 2LMIA 4LF9J 1PAEX 4ZVRB 2VGNA 4NYPA 4IO8A 5SUHA 3FZKA 3QJLA 1LNQA 2IFXA 3AA9A 2OJ3A 5AKEA 5E3QA 3HVRA 3SPZA 3WIUA 3LW5C 4EENA 4OGCA 4QWEA 2FVSA 2Z58B 2AGOA 8ICBA 2LPEA 4FWNA 4J37A 4OZ0A 2NXNA 3CCUS 2OMLA 3KMQA 4WKRA 3DKDA 2P66A 1NB2A 3H45C 1B22A 2W7AA 3WNEA 4BVOA 3CCMN 3UKUA 2IJFA 3BKUA 1K73O 5GAGP 1YXQA 1RDWX 5AM4A 4BXOB 5ETKA 2V7YA 3R8EA 3GLJA 1UAXA 1BMQB 3SNNA 4FDFA 3AA4A 1VSEA 1S9FA 1COKA 4LBHA 2GO8A 3CC7S 1BCOA 4LF7K 3ZT0A 3RJIA 3NMUA 1Q8BA 3ZSQA 3IAS9 2OEKA 3WT0A 5RUBA 4KT0C 5KGWA 4H4OA 3AA2A 3RSEB 2A19A 3L7OA 3ZDDA 5D6GA 3VAMA 2FBVA 2MZSA 3A8EA 3PYDA 5CRXA 1ZOTA 2YX6A 2VICA 3CJKB 4RU9A 3MMCA 2DR6A 3M2UA 1TAQA 1ZJMA 1MN9A 3IR5B 2QV6A 4Z7CA 4ILRA 4B3OA 4OYAA 3P5TL 2WONB 1BLUA 5LL6d 2BCQA 1YIJS 2P9UB 4C7YA 1S3XA 3F5AA 1AA1B 4L72B 5BREA 2IAJA 3M8RA 3RGIA 1KC8O 3QFUA 3DRRA 1CXQA 2RD5C 5ETMA 5AXMA 2IHR1 2M70A 4U9RA 5KAIU 4BGBA 4BJQA 3OS2A 4ISFA 2I0XA 3DGPB 1FJGF 4KI4A 1T95A 4QOTA 4EMDA 2DY1A 5AQVA 3VEOA 4HWIA 2PFNA 1BD6A 1A5XA 1RT5B 5KFFA 3V7LA 3KUEA 4FM2A 4PZOA 1S0NA 2BDPA 2CPXA 1YWXA 4ID1A 3OD2A 3FFKB 2E1EA 1HD1A 1KLNA 2WB1D 3FGUA 5DDQC 2DFEA 4KLMA 1OY9A 1IWGA 5F0XA 3WNHA 2PEHA 2VFSA 2OIHA 3IUCA 1X4FA 1YZ7A 3RW7A 2B3TB 5A0YA 1TELA 2AX0A 4OYMA 1Y3JA 4UOCA 2KRBA 4GVBB 3CO0P 4N5SA 5EOYA 3RJMB 4UB4A 4K7QA 4K0KJ 2R2SA 2ZUDA 5KG5A 2XMVA 2UU9F 1NGGA 2PYLA 1FWPA 4JI8K 2MB0B 4LH5A 3UCUP 5D15A 4LF5K 3OYEA 3VN5A 3M1FA 2W2OP 4M3TA 3UE2A 5DGAA 4IG3A 2MKJA 2PE8A 1IQTA 3ZX3A 4CZCA 3KK2A 4A61A 1WSGA 1SB6A 1V3ZA 3C6AA 2R7TA 1AFJA 4ETZA 1SZ2A 2ETJA 2KKHA 1H3DA 4NLQA 8ICGA 4KYZA 4FYVB 5ETVA 3PR5B 5J29A 2CQ0A 4DUZF 3OVAA 4P2HA 2D0PA 3G6YA 3K1ZA 4QS8A 5BRFA 5IT9Y 3E0FA 4TLRA 5FP0A 2RF2B 4ZCKA 1S6QA 3QETA 3H5YA 3KLGA 1UW4A 2JL9A 3IG5A 2XYHB 3MXJA 2HIQA 2M9NA 1ZAWA 5KFRA 3K8WA 1X4BA 4BC4A 3HHLC 2KN4A 4AQYF 3O6QA 4J9RA 3L2UA 1XS9D 7FD1A 3QWPA 3NOCA 3AQOA 2Q3SA 1XI1A 4DR4J 3KG0A 2NXUA 3LVWA 5J0TA 2ZIWB 4B9MA 3SZ2A 1BQXA 3QLHB 3M8QB 1IBLJ 1X42A 4USKA 5KNIA 3JTOA 1BQNA 3R6GB 4OX8A 1FNOA 2RKIB 3DXKB 3ZLJA 5J0WA 4JV2A 3D28A 3AN1A 1UOCA 5ETLA 3SQGA 5DM7Q 1QSSA 5F2RA 4I6MA 2I7PA 4E1JA 4O3RA 2JC1A 3PR4A 3KHRA 3OFGA 4DL4A 2IVYA 1KQSM 3AVBA 3O4WA 4AHCA 2CVEA 2OPQB 1B9FA 4QPXA 5M2RA 3HSJA 5J2KA 4Y2UA 3I4HX 2Y0SF 4RNNA 2AYGA 1RA7A 2Y1LB 2YB4A 3LP1A 1CC8A 1WNSA 4XO0A 4JI8J 4JYAJ 1RAIB 3MXHP 1VSFA 3ULEA 4AHVA 1FFGB 3BGRA 4NEZA 4TUQA 4P2XA 2EPIA 1J5EF 4MDBA 2G09A 3DOKB 4LBPA 1S1UB 1BPXA 2Q4TA 5J0RA 4NB4A 4CRJA 3IP4B 3FK4A 5IIKA 3D2FB 3UW1A 4M9JA 2A2CA 2VFTA 1DT9A 2HRTA 2U1AA 4L8RB 4EELA 4YY3J 1WHVA 1GOAA 3BYRA 5J1EA 1IBMJ 5DQHA 4DTJA 5BOLA 3JQMA 1IR1A 3F53A 1RWWB 3FKBA 5KQ8A 1S7HA 2HQFA 4DV3K 4OKKA 4DI6A 3JB9k 3CIMA 3NNCA 3PSIA 2R8GA 3EZWA 3RAMA 5HJXA 4WYWA 3M8PA 3HT0A 2ZE2A 2A3ZA 3CUNA 4RQ1A 5B09A 1S1XB 4O44A 2HHUA 2O8EB 1N8RT 3SEOA 4OI2A 3K5NA 2CWKA 3QJJA 3MUTP 2YNFA 1YVUA 2VG5A 5B0BA 1TKXB 2Z1HA 3IKMA 4ZPCA 4IR9A 4IZ9A 3HHLD 3VQCA 4CF1A 3I0SB 1ZM3A 4IH7A 3QEBZ 1S76D 2IDOA 2QM1A 1Q4RA 1AB8A 3N7PD 4I69A 1Y5LB 4E1NA 5GMEA 1BHNA 2I9SA 4FLVA 2MSSA 4KI6A 2OANA 5KAFU 4M5NA 4BRHA 2XY5A 1QUPA 2VA2A 1U1PA 3ALYA 2EH9A 3HHLB 3ILJA 2KLAA 5KT4A 3FR0A 1RK8A 5L1JA 1RAAB 1VQ7S 4CJSA 5IV4A 3LF0A 3TAGA 4F71A 2DXEA 1RTJB 5A8KA 2DHAA 1WDTA 4X65J 2E1AA 5AQHA 4N8OA 4FXWA 3BO2A 2RQKA 3MPVA 2HMXA 3WK5A 2B6AB 3T69A 2LYAA 1VISA 4DR2F 4Z6FA 2O8EA 3K5LA 3VQ6A 4MT1A 3OW2M 5AKJA 2D7SA 4BWJA 2HSEB 2F8LA 2CPJA 3J81O 1H72C 2OD4A 2X6SA 2L9DA 1D9FA 3FBBA 4WE1A 1YZ6A 3H0RB 3D68A 3H20A 3CJQA 2UUCF 4E7LA 3DV9A 2FBTA 3QMQA 1JMSA 1H1VA 1RBVA 2KDOA 2JC0A 1JNRB 4B3TF 3O8WA 4ICLB 1TFWA 4QPTA 2QWRA 4HTJA 3M32A 3W65A 3THWB 2KKPA 1NBWA 4JYAK 2FMQA 4CJFA 1JLGB 1VQNS 3AA3A 2PFDA 1BE4A 5KFEA 1AZSA 4JB8B 1EP4A 2W3SA 1AUDA 3TX8A 3HP6A 4N76A 3CDUA 1EARA 2E2OA 4BRAA 5B66U 2YJEA 3C21A 2UUBK 2PO4A 5E2QA 5AKIA 4DV4F 4AHUA 1GX5A 1OSDA 2VONA 1RDAA 1Z4OA 3MFHA 4W5NA 4DOZA 3GWCA 1D09B 2C3UA 1HW8A 1B70B 5GMDA 3PCOB 4PKIA 2ZBPA 2XQCA 1X5TA 4IFVB 3FZBA 4JI0J 4GKJK 4CIGA 3ZI4A 1IKWB 4B1YB 3KJNB 2A1SA 1TAUA 4JI5K 5AZJA 3M6XA 3GIRA 4OV1A 4G9BA 1QD1A 4BC2A 3TZWA 1Z6RA 1KN6A 3DLRA 3VF2A 4C3KA 2D41A 1XQIA 3RB4A 2BPFA 1HNXF 3MEGB 4B3TJ 1KVJA 4QWDA 1JL1A 3KBBA 1WI8A 2V8VA 1OY6A 4M7XA 2WAQD 2FHKA 2DPJA 5GAGU 3IV6A 3MR5A 1RADB 4WFYA 3P5JA 3EMTA 1F9EB 2EDUA 1R0AA 3HILA 1QH9A 3HJEA 1PKUA 4IO9Q 2D1CA 3KG4A 4IH6A 2K2PA 4CHOA 5H1SV 3ETOA 3BY5A 3C2KA 3TYTA 2KI2A 3QEPA 2NO4A 4B02A 4FWQA 1FXRA 4KR0B 4I2QA 1VGYA 3GE9A 1UWAA 3KLIA 2R7SA 4QR0A 3Q23A 3RMBA 3N6NA 2MEWA 2DR8A 4FZYA 2W42A 3RBDA 3H1VX 1TVAA 4LREA 2AEMA 3CJTA 1N32F 3WIVA 4ZMMA 2HF4A 4UBCA 8RUCA 2JFDA 3RBXA 3ONNA 4KBOA 2UYTA 3SBGA 5KG2A 4R8UB 4B9VA 3FSXA 4GV3A 3KK2B 1VS3A 5F9LA 2Y8YA 4K4HA 1PJ6A 5CZXA 4UF4A 1NEEA 4KH1B 4Y2KA 1CEZA 4HDHA 3V9SA 2KSOB 4J9QA 3GQCA 4Z6EA 2H5EA 3V4IB 2GVZA 3K5MA 1V3RA 4C4SA 1KS2A 3VAKA 3IM8A 2UZAA 3L9ZA 2WF7A 3UN5A 2ZJ5A 3UR3C 2YNGA 1UKUA 4B9NA 5LL6Z 4NZ0A 1KONA 2G2YA 5A2QO 2HPUA 2A42A 8ICQA 4LQ3A 2E9RX 1G15A 4CEFA 1M1GA 4M3YA 3OR1B 5HP4A 1UTAA 2AEFA 3V81A 3OXLA 3T79A 3PO4A 1HNZK 4CEEA 2Q97A 1U2CA 1EX4A 2AXTU 1FTCA 3TUJC 1GXLA 2ZOFA 3H2VE 3C65A 2W9AA 2PMZD 5JMVA 4TYBA 5M1OA 3G9CA 3UMCA 1LWFB 3QEXA 2RS2A 1WB9A 2EI5A 3M7DA 2PA8D 1X60A 3S6EA 1HNVA 4UOHA 1RQNA 5KFTA 1KXPA 3VGLA 3R7BB 3QRRA 3I0RB 4CYUB 1WEZA 5KRTA 4X64K 5AK4A 1HARA 2HOFA 4XK8C 2YI1A 2XO7A 1Q7YO 4C8KA 2MA1A 4EYHB 3NGYA 2G8UA 2NYIA 2IM0A 3TQ1A 4Q8EA 3NNAA 2C3OA 1FJEB 1B99A 5I3UA 5DBBA 1E6YA 3DN9A 2HFSA 3O9SA 3ISCA 3CD6S 2J8AA 2ZJPL 5AFUA 1VQ9S 4DDFA 4A2AA 4CIEA 3MCOA 2F8TA 1NCLA 3HSTB 3OL7A 3MWPA 4LJMA 1HWIA 4OYZA 1DTTB 4P0QA 3W3DA 4LFBF 2JOQA 4LF7F 3W9JA 3MGJA 4RPFA 1SB3C 3IGNA 4JI5F 4BRQA 3AAWB 3SUNA 5CZVA 1RZTA 3HK2A 3HJFA 2V8DA 4TVAB 2H9ZA 2IBOA 3NF7A 4BC7A 4AL6A 4UAWA 1V3SA 1FFUA 2FC8A 2HNDB 3UD4P 4Y2QA 3QX7A 4FJHA 3OYNA 1SC6A 3SMZA 5D77A 1MU2B 2HGLA 2UXBF 4CEBA 4IOAL 3H42A 2OEJA 5AM1A 1NMNA 1TUYA 1XO1A 4LZDA 3A0BU 4PY5A 9ICAA 1QAYA 2BJ1A 3PKYA 3TR5A 3FC4A 2WSFC 3G82B 4HKQA 3TFSA 3M1VB 4A2BA 2E1MC 2E2PA 1K8AT 1F2GA 3AVHA 3OTCA 3AVLA 3OXGA 4IG0A 3W8GA 1LW0B 4NLGA 4ZVUB 4KLQA 1NGJA 3NGZA 4B3SK 2J7KA 2RN2A 2VKRA 1KKHA 1JLQA 3MDAA 4A8MP 1UA1A 1S5ZA 1Q95G 1ZXOA 3LK9A 4C8OA 2W41A 3OHRA 4OJHA 1HKBA 3TO8A 3WBZA 4X64F 4UB2A 3I8BA 1MQ3A 5IM0B 2AD9A 4CH1A 2OPRA 2NYHA 3JS6A 8AT1B 4A57A 4KMOB 3H8SA 4CBUA 1O13A 1H7WA 4LF8K 1XJWB 2W2QP 4KKOB 3W63A 3IMXA 2YKMA 3BPDA 1QAJA 5D3GB 1V4SA 2CG4A 3Q7BA 2R7QA 5EOZA 4X4QA 3I4PA 1TU0B 3B0YA 1JXVA 1FXXA 1N5YA 4LF4K 4JI7J 7ICUA 3C2PA 3LP0B 2Y0SC 4KLSA 1XC9A 3KG1A 8ICHA 2FMSA 1HUZA 2VJ5A 4EK2A 2XLKA 2J4RA 4KREA 5KFAA 1ED1A 1DAXA 4YMMA 2BJDA 2F3NA 1H0HB 4DLEA 5DJBA 1RE1B 2HZAA 1R8AA 2XZDB 3Q8VA 3AAPA 5HVHA 4I68A 1BUXA 5F8HA 3HULA 3O0FA 1I3OB 2RQ4A 2A40A 4BDPA 1HEKA 4ECZA 3I56N 1R27B 2EVZA 3J81j 2EG2A 2YHBA 3CCJN 2PBDA 5J2MB 3NGIA 1ZQFA 2MMYA 4J9LA 3V6HA 1KVIA 1NGAA 2QWMA 2JEJA 4JKAA 1BXNA 4URGA 5GMKa 3CJ1A 2O3DA 1JQGA 1Y5IB 5ALRA 5AQJA 3MI7X 4C8YA 2L3MA 3HWTA 3TQEA 2VV5A 3NKYA 3THXB 1W26A 4MF2A 2B4JA 2VBZA 3D45A 5AE2A 4CZGA 2O8DA 4P7VA 4P74A 2JLFA 3DHXA 4ILLA 2E8MA 5HROA 2OPSB 5CZ1A 1REVB 5MLCV 4KIAA 2FPMA 3D2NA 2FSNA 3NWGA 2B0GA 4LR7A 1TUGB 2RRAA 3H2UB 9ICWA 1HI1A 2XI3A 2WC9A 2Z2YB 3KTQA 9ICOA 5H9FK 4IYQA 5IIJA 2UVRA 2YX1A 3H4DA 1HA1A 1SV0C 4FJXA 3BPSP 4PUOB 2V2KA 3PM9A 4QAGA 4O3OA 2HQGA 3C6TB 3DLJA 2MDAA 6FDRA 4BR5A 3J81U 2PC6A 2C2ZB 1G4CA 2E29A 2EK1A 3GG4A 1V9PA 3WXJA 2G8KA 3QWUA 3SK3A 3OL8A 4TKTA 4TU9A 5GAEU 1K0VA 4ZVQB 1X1PA 3TP2A 3ZX0A 1Y7PA 2A1RA 1HJRA 3V9XA 2RIJA 4N8NA 2BKOA 4K4UA 3NRZA 4PWUA 1TK0A 5C2CA 2XMMA 3CJ4A 4CO2A 3QGGA 1ZA1B 5J2HA 3R3LA 4ZTJA 4ZCMA 3NRBA 3NGRA 5AQPA 4KLLA 2VPYB 4IRDA 1QHAA 1I51B 2HURA 4KHRA 3LP2A 2F5GA 3EE8A 5CEHA 3IG8A 3L4PA 3DM2A 4OPAA 4OI6A 3IA0A 1KNZA 4DUYK 2IHNA 4P52A 4QZIA 3GE1A 2ZVIA 2ZC3A 2P9LB 3VQ5A 3BF4A 3UXPA 1T9WA 5E0OA 3J7ZO 4JI3K 2DIUA 1IG6A 1F9HA 4KHYA 2EANA 2XEXA 2E5LK 4J9NA 3G4SN 4DR2J 5IWAF 3RYLA 2H4YB 2AIRB 3E1YA 2P5GA 4J9MA 1UVMA 3EXYA 2HVIA 1XNRJ 2A0FB 3CJ2A 1IBKJ 3MM8A 1UFWA 2BE7D 2BQUA 5E84A 1DRZA 1SC4B 3MM6A 3EL2A 5AXKA 1Q81T 1MMNA 4DR5K 2AJ0A 2JLEA 3C1YA 2XMWA 4IDKB 2ZH3A 3NBPA 5HP1A 4QIWF 2DK2A 4LSLA 1N52B 4Y2SA 3AV9A 3C6TA 1GXUA 3ISDA 4CLPA 2NPIA 1KN5A 4JI3J 1RBSA 1C1BA 5EWFA 3OUYA 1TGOA 1NLVA 1XWLA 3AU2A 4Y2AA 1U2VA 1XU4A 1E4GT 2DRAA 1N34F 2OFHX 3RMCA 1KW4A 2JXJA 4WZQA 4A48A 2ESEA 4BLGA 3QIPA 2W2MP 2HK2A 3A8JA 4X4PA 3AD8C 4OLOA 1SXLA 4NXMJ 2GMHA 3SD7A 2WSEC 1IKXA 1CZBA 3CM6A 2JH3A 2GAHC 3QUQA 1RSCA 3ZT2A 4PWDA 3T5HA 1HWKA 4NWIA 1N63A 1OY8A 5AQNA 3MMBB 5EWEA 4WJBA 4Q43A 2D3ZA 3JYTA 1ZQOA 4KPCA 1SZPA 3VQTA 5L1MA 2QA4G 1TL7A 1OPZA 2WBMA 3WK7A 3D6FB 4ZA1A 4M6WB 2BVZA 2DGZA 4P2FA 4BREA 2IDLA 4MFBA 5AQRA 1QVFM 2MHEA 4CF0A 3IMQJ 3M8QA 4ES3A 5JVHL 1HWJA 1LEOA 5HQLA 4K4IA 1YITS 4I9QA 1B64A 5G5GA 4AH9A 2V2QA 2BHNA 1U7LA 2EFNA 1HKAA 2ZTEA 1VLYA 4ZVSB 3CRXA 4L73A 2HKEA 3TADC 1P7DA 1I5OB 1QAIA 3P4UB 3V9ZA 4ICLA 4I2PB 1K8KB 2DWQA 3RH4A 1RBUA 4ZCIA 1AROP 2O5DA 3PIPL 2EXUA 1FF2A 4QZCA 4GVMA 3PW7A 2WBNA 5KT7A 2O01C 2FHJD 3VHQA 4ANEA 2WVBA 1SWWA 4X62K 1N60A 3T5KA 3EM1A 1RWUA 2GEMA 2XMKA 3PVXA 1YJNN 3GZFA 1Q8KA 3GV5B 4JI6K 4CLTA 3W3SA 4DG1A 2RQ5A 5KFGA 1R0BG 3CCSS 1UW9A 4IL6U 4JV5F 1F0XA 4U95A 2QKBA 1NRKA 4KE5A 5JXSA 1RA6A 1ZH5A 4BR0A 2ZWOA 3IR6B 1QVGR 4RO0A 3LWLA 2YX7A 4OJ6A 2Q36A 4FYDA 5FDLB 5HMZA 4ZH4A 4DPYA 4ER8A 2F4FA 1S7IA 3KK3A 5CXTA 2UXBK 1RACB 4NJ8A 5LXYA 2ZOMA 4NI2A 1Q82O 2Y9UA 3NVVA 5CHCB 1YX2A 4RUAA 1HNIA 4I6WA 4UB5A 4M3WA 1RHRB 1RTDB 1B4FA 2N82B 1ZYQA 4MKAA 4BRNA 4DR4F 3IAM9 4NOHA 1YJNS 5C15A 4F4WA 5AIBA 3IAYA 2UUWA 3NVWA 1TL1A 1UL3A 3QUBA 2YMPA 5JRTA 4M5DB 3GYNA 1XSNA 3HI9A 4X4SA 2VANA 3D2EB 2KZ3A 4CESA 3FUYA 4P2MA 4JK9A 3CB4A 3CNQP 4X64J 3EDQB 3OYJA 2F3JA 1YRTA 1RXVA 4NLWA 4AM7A 4WKYA 1QTMA 1PSDA 4EO8A 4DS5A 2BDUA 3NH1A 4KLEA 1WHXA 1Z1BA 4ID5B 2CJYB 1IBMF 4MFBB 3NF8A 3ID6A 3PW2A 4F4AA 1HBNA 2CGLA 1L8OA 2VODA 4B3MK 1URRA 4Z4CA 2NCKL 5IIOA 5FRMA 3I33A 2BKNA 2QLTA 5F8MA 4BRDA 1S1TB 4PYDA 2ZJPQ 3KHYA 4E0DA 4FZZA 2GV1A 2DCUB 4CHYA 1WD6A 1FX4A 5HLFB 2DR9A 1L7MA 4LFCF 1X5SA 4QZGA 1XMOK 4CHZA 2FY8A 3ASMA 3MCSA 2W01A 2HBJA 5ALSA 1KEKA 1LWFA 1S1UA 4WP9A 4KFBB 3KK1A 1J2VA 1RT2A 3SCIE 3PJXA 1UFLA 1JLFA 3RWUA 2Y9HA 2QA4S 1RNHA 3HVTB 4O4RA 3HT3A 5KFMA 8ICJA 1GMVA 4CFDA 3SBMA 3UPQA 4K5RA 4FW1A 2MXYA 3EKSA 3W8PA 3L95X 4R0JA 4CF3A 4JP8A 3DNCA 2Q66A 1PK1A 4A8QA 2WFBA 1KTVA 3NBPB 4FO0A 1M90O 2HVHA 3B54A 3D6RA 2DRBA 2KMDA 2ZTDA 3CCVN 1S6PB 1NLKL 4ISEA 2WW4A 3LAKA 3UFCX 3QT7A 2ZZNA 1Z00A 1Y4ZB 1WWHA 4NPOA 1ZQPA 1WKKA 4DJBA 1WDDA 2AX1A 5EE3A 1BNOA 4GRSA 4K4GA 3LDOA 4ED8A 3IRUA 1YI2S 2VWJA 1SL0A 4TU7A 4JV5J 3T7ZA 2VG7B 3GBTA 4DQPA 4RW8B 3ZSZA 2ZJAA 4W90B 2HS0A 4RQ2A 4F26A 3SQ2A 3QO9B 3VEYA 3B6PA 2O1PA 4DV6F 2J0XA 3MEEA 1UJ6A 3B8AX 3D2SA 1WACA 1ZBTA 3M6ZA 1NDKA 2P9NB 3JSYA 4WIQA 5D4NA 2J5AA 1PK3A 1ROFA 4O5KA 2G08A 2B43A 1WELA 2WW8A 3KFWX 4PCQA 5JJBA 1SC1B 2NQPA 4GC7A 5GIPA 3HM8A 4WZMA 3CMAN 1KD1O 2ZH5A 5CYJA 1LK5A 1VQ4N 1FKPB 2OYYA 3GV7B 4V1Ak 4JKHA 4WFNL 4WWSA 5KFKA 5E79U 3VV2B 1T9TA 2PYJA 1RHKB 5IT9O 1N0UA 3GU3A 2IYGA 1IG8A 2HYIB 2I1RA 2K7KA 2P9IB 2DEIA 2F4VK 2BCVA 2MKYA 1IJEB 1BWVA 1KWMA 1DXSA 4UT4A 2RE2A 3K2YA 3NF9A 1IJJA 4PEOA 3G10A 4BRKA 4OD0A 1HQ2A 4E7JA 5J0SA 3MM7A 1KEJA 2H3EB 3H0PA 2KJVA 1MN8A 1Q9YA 1ZQWA 1A7GE 1B0PA 1DY3A 2FHMA 1H73A 4HHJA 4CT8A 1WSRA 2KK0A 4USMA 1G1XA 2XULA 3V4MA 2F65A 2Q31A 4KLGA 1JLCB 3IS9A 3IP0A 4DSFA 3VF0B 4F5NA 2X7IA 3P83D 1Y0HA 3LOUA 1L7OA 2YV0X 4CHQA 2QB1A 2G1HA 3CO9A 3C5GA 2HNDA 2JWLA 5BRDA 1KQSR 2WRMA 3R5DA 1LOUA 2H3VA 2CZVC 2AU0A 2JFKA 2M52A 5DBAA 4B1ZA 1HNWK 2ASDA 3L7PA 3K58A 2IJRA 4HL9A 3TUPA 4W5OA 4DR5F 2UP1A 3R3TA 4B9QA 3OA9A 4B1UB 4UQTA 1DTTA 1RILA 1LB2B 5HMYA 2VBYA 5DDYA 4AXJA 3Q22A 3NH2A 5DG8A 1VFJA 2E5LJ 4K59A 2OLWA 4HTLA 2P9PB 2DD8S 3RFAA 2D3UA 1ZOLA 1C0UA 3BB5A 3TI0A 4ZKAA 2AYMA 1S48A 4C11B 5K4LA 4E98A 4ZPBA 4DSEA 2Q0UA 5HR6A 2YVSA 4KLOA 4DPUA 2E5LF 3NDKA 4O3NA 3HLUA 4NA3A 3TJ8A 3NS1A 4ECVA 2D8CA 2ZH1A 3RUBL 3V5RA 2W11A 3P45B 3AL0B 4QJVA 5KRSA 3PJWA 4JD2A 1PJ7A 2MJUA 4M5MA 2ISPA 3OTOK 3JYTB 1LK7A 2XMUA 1S1VA 1ZQDA 4DV4K 3P31A 5ETTA 4XPCA 4ZVTB 5D8HB 2FPHX 4P7TA 4FJNA 9ICGA 9ICKA 5AQOA 3OYCA 4FL9A 2YPYA 3VENA 3PYEA 3CC7N 2K4HA 1N48A 2GV9A 2DKXA 2OXOA 4G3IA 3BN7A 4CLLA 1NU4A 4NLOA 4FN5A 5AKYA 1UETA 1Z26A 1LOTB 3OBWA 3N4MB 1EETA 2C28A 2CZ4A 2RQMA 1QE1B 4Z4IA 1HWLA 5AFUH 1CG2A 2V0NA