3HT3A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus v713p mutant bound to g:dctp
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase I, large fragment
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
total genus 208
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ht3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ht3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ht3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ht3A01
4DTMA 4CEBA 3OJUA 4XIUA 7ICRA 4DF8A 2BHNA 4OLAA 3NDKA 3IM1A 2UVVA 5DGAA 1RT1A 4PPXA 4QZ8A 3G0ZA 1UT5A 4HUEA 1SL2A 5KFTA 2AGOA 1ASVA 8ICSA 1TKDA 4LD0A 2RF2A 2FLNA 2ASLA 3QZ8A 1N48A 1XU4A 3SNNA 1BQNA 3EPGA 3LAMA 4I2JA 2ATQA 2R8JA 4ECTA 2V9WA 4KPYA 3N97B 2P66A 4L8RB 4FJ9A 1JLFA 3CFOA 4IG0A 4FK0A 4MEYA 5D3GA 5IIJA 4JRPA 4F91B 2DTUA 4KB0A 4CIGA 1S1TA 4H4MA 1TAUA 1RT5A 4B9TA 1WSIA 4DFJA 4KFBA 8ICBA 5EOZA 1KVAA 4TQRA 1NK0A 4CEAA 1KCFA 5CYQA 4RW9A 1RBSA 5KFEA 1U45A 4FJMA 3KLGA 5KFBA 1Q8IA 1TAQA 4GXJA 4I2HA 4CESA 3OHBA 5IINA 4E89A 2MUTB 4C8NA 1VSKA 1L3SA 4DL7A 5KG5A 5DDYA 3BQ2A 5L1JA 1TL1A 2Q3SA 2GBZA 2X6NA 5DMRA 1U48A 2BPFA 4DTPA 8ICOA 3QEIA 4FCYA 1SUQA 1B43A 4J2DA 3VQ5A 4OKKA 4M42A 3FDSA 4N5SA 1UA1A 4FLXA 4HCCA 2FPLA 5J0UA 4G3IA 1MQ3A 2OA8A 4UAWA 2B5JA 3SYZA 4DTNA 2XGPA 1JLQA 3K58A 1X1PA 3WNGA 4M9GA 4KLHA 3V6JA 5HP4A 1IKWA 5KG1A 2XY6A 4UAZA 3RAQA 4P2HA 3OYAA 1QHTA 2M9NA 4O4GA 3U3YA 2PY5A 3OS1A 4DS4A 3AVBA 2VG7A 2IGIA 3ISBA 4Q8FA 5CJ7A 3RAXA 4JRQA 5CP2A 4JWNA 1DTTA 4DWIA 4J2BA 4GLXA 4PWDA 2YNFA 4O0JA 4ED7A 4MFAA 3RMDA 2W8LA 1XHZA 5KGWA 4J9PA 1TK5A 1ZBIA 4ICLA 3L2QA 4ZTJA 4IQTA 1QSSA 4PHPA 7ICLA 3EY1A 3ZCMA 1S9EA 2DFLA 4CFCA 4P4PA 4F4YA 4ED8A 4B9NA 2PFOA 4RQ4A 2VG6A 1ZJMA 3SUOA 5KG0A 2PFNA 3SI8A 4I2IA 4RW7A 3NF7A 3ZT0A 2KFNA 1HUZA 4CEZA 1COOA 8ICZA 3OYLA 3QIPA 1FK9A 4NCAA 1YT3A 3QIOA 1U49A 3QE9Y 3SQ4A 4YXJA 2IHNA 3ULDA 4CF8A 1CZ9A 1I39A 3GIMA 4PUOA 4NLKA 1EP4A 3EPIA 3PW0A 2VG5A 5JS1A 4I7FA 3TI0A 4CHOA 5DQIA 3B6OA 1O1WA 1ZQOA 1GOBA 3C23A 3PMLA 4DOBA 3K5LA 3L3UA 4M45A 4Z4FA 4YG2A 4FJIA 2NUBA 4K4IA 4B3OA 5C24A 1RXVA 2G8HA 2ZE2A 3E01A 1T8EA 4I2DA 5HHHA 4R64A 3LPTA 3RTVA 1CLQA 1N5YA 2OPRA 4F5NA 2BCRA 2Q0ZX 4AHRA 3Q8SB 4TUPA 1NJZA 2O4GA 4FLZA 5J2MA 3HX0A 2I9GA 3FFIA 4N47A 3DMJA 4DQQA 2ZJAA 5DK5A 3OS2A 4E3SA 3D45A 4IQVA 5L1KA 1JLAA 5DGBA 2XRIA 2UVUA 3M9MB 1U4BA 2JEIA 4LZDA 2X78A 3MBYA 2HVIA 3IHQB 5JS2A 1LAWA 4FM2A 4R66A 4R63A 3ISNC 1ZQWA 2NRZA 2RN2A 5HMMA 4ECRA 4M3ZA 2NRWA 8ICFA 1BCOA 4M3TA 4DG1A 4UBCA 4W5NA 3P1GA 3OYCA 4J9MA 2NRXA 3SQ0A 3NE6A 1QE1A 1QSLA 1CUKA 5DB8A 5I42A 3QETA 5KFUA 4CERA 1RT7A 3B0YA 5KT2A 3H40A 3G6YA 4B9MA 2R8GA 4ED0A 3VQDA 4CFDA 1IXRA 4QWDA 3MAQA 4QW9A 3DRRA 4KN4A 1BPZA 2X74A 3QEXA 1S76D 4M3YA 4FO6A 3RJIA 4QZCA 2JEFA 3NF8A 1EKEA 1FKOA 3V9ZA 4M9HA 4DU4A 4HTUA 1BPDA 2FPMA 2B4JA 4JUZA 3LZIA 4DTRA 1UA0A 1DOQA 1NKEA 4IR9A 8ICQA 3G10A 1RDCA 5J0PA 4B9LA 1S1VA 2Y1JA 4YR2A 3RBDA 1RILA 4TURA 3HYFA 1VSJA 5KFIA 1VSMA 3LWLA 1HPZA 2IAJA 4NYNA 3VQEA 4FS1A 2DPJA 3K5MA 1RTDA 3MFIA 4NM2A 3LAKA 2HHTA 9ICKA 1S1WA 2I1QA 4C8MA 1ZQEA 3V9XA 1S6QA 3AUOA 4KLUA 1L3VA 1NK6A 2YNGA 3NGYA 3HPHA 3LP0A 3O3FA 3ZSWA 3WNFA 1VSLA 3ZDEA 1JN3A 1ZQIA 3C6UA 4YP3A 5KFAA 1Z25A 4R8UA 2OZMA 5KG3A 2WONA 4CEDA 2BQUA 2YKMA 4Z6CA 3KD1E 4PGXA 3ZDBA 4JS4A 5L1IA 2J6UA 2HHWA 3ZSXA 2RKIA 4B08A 3L2RA 3EZ5A 4MF2A 2KFZA 3LPUA 4R5PA 3TABA 4CEEA 3G6XA 3S3MA 4DQIA 4Z4EA 4XA5A 2IBKA 4LVSA 1YTAA 1BPYA 3L2UA 2FMQA 2HMIA 1SV5A 4EBEA 1ZQYA 4K4HA 2I5JA 1EX4A 3ZSZA 2ZUDA 4KO0A 5DQHA 1NKCA 1RYRA 4FJ5A 2R8IA 2G8FA 3PY8A 3RB6A 1C1BA 4AILC 4JWMA 5IIOA 2G8KA 5DKWA 4OJRA 7ICTA 3OYIA 3ZSOA 3PNCA 4GVMA 3MGHA 4R65A 5KG2A 4CE9A 4YFUA 1S6PA 4CHPA 3Q8LA 4LSLA 3RBEA 4J2AA 4AHCA 5EWGA 4O5BA 3C95A 4KHYA 1IM4A 2RPIA 1K1SA 5KFSA 3L8BA 3KK3A 5DB9A 1S0VA 4FZZA 2YKNA 4FJJA 2V4RA 2PZSA 1S10A 3AA2A 8ICNA 1JLBA 3V7JA 5KG7A 1U9LA 3H8WA 1T3NA 2VANA 2BDPA 1NOMA 3H4BA 9ICMA 4JS5A 1XWLA 1D5AA 3V81A 5DBAA 4KLGA 4JV0A 4FW1A 2BCUA 3NH0A 4BGDA 3RMBA 2BGWA 4DFMA 3GV7B 3QEWA 3MGIA 2JZBA 4YFKA 4HUFA 9ICNA 5CZ2A 2XCAA 3V9UA 2NRVA 4KLTA 3OJSA 8ICWA 4RQ1A 3AVGA 3DRSA 4JLHA 2IDOA 2LYHA 4PHDA 3AA4A 3QERA 1TKTA 3LP3A 4GXIA 4FBTA 1MQ2A 1QQCA 5FDLA 1ZQUA 3VN5A 1UAXA 4ELUA 4CJUA 4FM0A 8ICUA 3RJHA 3HO1A 3MFHA 3KKSA 1T03A 4RZRA 5HHIA 4NLGA 4JV1A 4KHWA 3OVNA 1NK4A 3I8DA 5D49A 3LWMA 3RH5A 4YVZA 3WNHA 3SUQA 4UB3A 3V1RA 1DLOA 3JPSA 3SI6A 3MXJA 1X9SA 5CYMA 1JMSA 4CIEA 3OYMA 3HPGA 3VQCA 3ZT1A 3BQTA 4R8UB 2JEGA 4QZFA 9ICPA 4I2GA 2FC0A 4F4XA 5J2DA 4I29A 4HYKA 2F8SA 5J0XA 3RMCA 4M3WA 4DSLA 3ZD9A 3GDXA 3K59A 2ISPA 5EU7A 1LWFA 5KFDA 3KLIA 1VSEA 3G6VA 5D4BA 4UB4A 4EBCA 2UVWA 4J9QA 3KHHA 4DOAA 5JUMA 3ITHA 4YD1A 2OPSA 3RB0A 3VQQA 1AROP 4XUSA 1ZQDA 3TFSA 5IILA 3QLHA 1Q9YA 9ICSA 4Q5VA 2VWJA 1DTQA 4OGCA 4O9MA 3H8SA 4BE0A 4FJKA 2ASDA 1ZQQA 2IC3A 3N4MB 4Z6EA 3QINA 2P51A 2Z1HA 5J0WA 1ZBUA 3RJKA 3C2LA 3L3VA 3HWTA 4CFBA 3T5KA 4J9KA 2C2RA 2WTFA 4QOZB 4CK1A 1B9DA 5J0YA 1JXLA 4CJQA 4CEOA 3T19A 1S0MA 1WNSA 3LDAA 2R7YA 1GOCA 3V9WA 4E7HA 1TL3A 3H08A 1EXNA 1PZNA 4PGYA 1EETA 4I2QA 4M9NA 3JPPA 4FM1A 4IG3A 3K5OA 2PYLA 1T7PA 4NCGA 8ICYA 2F1IA 5HP1A 3TQ1A 4I2CA 4BDYA 1NK5A 3VQPA 1L5UA 4B8CA 8ICMA 3ZSYA 9ICVA 4F3OA 4ELVA 1K6YA 3UXOA 3AVAA 2F8TA 4EP5A 5F9LA 4YXMA 4DL6A 3TAQA 3TWHA 5KFWA 2HHQA 1NK9A 1JIHA 1HYVA 3ZDDA 2JZBB 1HQEA 1BPEA 3AVFA 4CF9A 2ETJA 4M3RA 3JYTA 1S1XA 9ICTA 4ED3A 4KLSA 2YNIA 2ZJ5A 4DSEA 4AH9A 3AVJA 1CXQA 9ICGA 1KVCA 4HHTA 4Z4CA 5KG4A 5J2AA 4F4ZA 4YMOA 4O0IA 3MR5A 4FLWA 1WAJA 3UXPA 1D8YA 4KB1A 5J2QA 4EEYA 3ZSVA 4KITB 1N6QA 4Z0UA 4CJKA 4NY8A 4CGDA 5J2PA 4F8RA 1RT2A 4RW6A 3JPNA 4YMNA 1ZQRA 2BCVA 1S9FA 2KZ3A 5J2KA 4DTSA 3HSTB 1VRUA 4PY5A 5E41A 3UIQA 1ZYQA 4K8XA 3U6FA 4WE1A 3K57A 2DY4A 2XC9A 4RW8A 3TAPA 2XGQA 2FPKA 2HB5A 2G8WA 1LWEA 4KREA 5J2CA 8ICXA 5CZ1A 1C1AA 1FXXA 5DLFA 4DTUA 3OYHA 7ICEA 3BJYA 2C28A 1B92A 2FBVA 5DLGA 4KMUA 4KTQA 4E7LA 4TUSA 3B0XA 1RTHA 3IS9A 3H4DA 2FBXA 1JX4A 1BPBA 4F4KA 1WSGA 1ZQCA 3GV8B 2V4QA 4KHSA 3HM9A 3ZSRA 3RJEA 3QEPA 5C5JA 1MSWD 1JKHA 4FBUA 1ZQHA 5HRSA 5KTQA 4K8ZA 4CEFA 4FLYA 4O3QA 3JPTA 3UPQA 4FZYA 1K1QA 3AV9A 4CJVA 3VQ4A 1RDDA 2XO7A 4F3TA 4CJ3A 4LY7A 1JLCA 1HMVA 5KFNA 5IIIA 4RPYA 2HHUA 4KTWA 5KG6A 1TGOA 1BVSA 3EWAA 4CCHA 4OPKA 1IKVA 3O3GA 2ZD1A 4QZ9A 4XQ8A 3PR5B 3KK1A 7ICKA 1NK8A 4I2FA 3FYHA 1UOCA 1ZBLA 3NBPA 5KFKA 1ITGA 3OYBA 4RUAA 3RR8A 3DLKA 1UT8A 4CECA 4CJ4A 3KJVA 4QZGA 9ICAA 4CF0A 4DTJA 4J9SA 5BOMA 8ICVA 1L3TA 3KHLA 4B9UA 2QKKA 7ICQA 1KFDA 4E7IA 3K2PA 5CHGA 1WSEA 3MR3A 3QZ7A 3PVXA 1NJWA 2IS3A 1NK7A 3H8JA 3HL8A 2LSNA 4BWJA 5KT3A 4RG8A 1BGXT 3AVHA 3NF9A 2KW4A 3OGUA 4DO9A 2AU0A 1S77D 7ICJA 1C6VA 4EYHB 1Z00A 4RQ7A 3SV4A 1TFRA 3PW5A 1HUOA 4TQSA 4RPXA 5J2GA 3HVRA 4N41A 3VA0A 4CEQA 3LP1A 5HROA 5J0OA 2OWOA 4QZBA 4BDPA 4DMNA 4FK4A 7ICNA 8ICKA 4IBNA 1KTQA 4Z6DA 1TK8A 4RUCA 1W9HA 5T7BA 2ISOA 4DQPA 3ASMA 3NF6A 1Y88A 3KLFA 1ASWA 2NRTA 4NLNA 3CFPA 4W5TA 2EX3A 4EBDA 5C42A 3TARA 3V6HA 1ZQLA 2W42A 4KLEA 3DLRA 1VSIA 4DSJA 2E6MA 3RWUA 1RTIA 3S9HA 3UXNA 2IA6A 3LDSA 1SL0A 4CHQA 5EWEA 5CA7A 3S3OA 4KLDA 3V9SA 4DL2A 4OVLA 3JPRA 1V9PA 1RXWA 2F96A 3MEDA 4W5RA 3SUNA 1QTMA 4DS5A 3HVTA 4ZHRA 2XY7A 4KTZA 4RQ0A 5KFVA 4CK3A 2E6LA 3AVIA 3ZT2A 3T5JA 3M8QA 4IQWA 9ICRA 8ICIA 4F93B 4YN4A 1TKXA 5KFLA 3DM2A 2AQ4A 3TAFA 2FBTA 5DDMA 2P6UA 1JXEA 5SZTA 3IAYA 2BKEA 4KAZA 2R8HA 5L1LA 5HNKA 3CM6A 1BIZA 4DTXA 3OSNA 4J9LA 3RH6A 3BDPA 3M8SA 3TAEA 2IOCA 4W5QA 3GIKA 3C2MA 4NCBA 4DL4A 2H5XA 3AA5X 4DSKA 1S0NA 2XY8A 4FJ8A 4I2PA 2YNHA 3C2KA 4MQ3A 5J0TA 2AJQA 4FJGA 5DBCA 4MFFA 8ICLA 2DFHA 3EYZA 3NGDA 4NYFA 1KLNA 1X9MA 2HNDA 4O5CA 4C8KA 2OPQA 4EZ9A 1XC9A 4OKEA 3OYKA 4CGGA 2BPCA 4YQWA 3V1QA 8ICEA 7ICGA 4NXZA 1BL3A 1IH7A 3ZT3A 4CJEA 4JK1A 9ICXA 9ICWA 3HK2A 2ITGA 2HNZA 4FLTA 4QAGA 3KHGA 3HJFA 5F9NA 3KLEA 2KZZA 4GC6A 4CK2A 3OYFA 3V4IA 4IFYA 3GV5B 1RNHA 2G8UA 5BPCA 4O44A 4E19A 3TFRA 4QW8A 4IRDA 3PW2A 4ECSA 1Z00B 4CJ5A 4ZH4A 1ZQZA 4IRCA 2DPIA 3SQ2A 4KLMA 1KFSA 1ZQAA 5HLFA 4RNMA 1BI4A 1CXUA 3SCXA 2ALZA 2WOMA 3PO5A 5FRNA 1HYSA 2RDIA 3OY9A 1SKRA 4CHYA 4P4MA 3RMAA 3KLHA 3DRPA 4BE1A 3UQ0A 4QZAA 5HMLA 4H8KA 1NOYA 5IIKA 1ZQMA 9ICFA 3SUPA 2XY5A 1WN7A 4CGIA 4M6WA 5HRNA 2Y1IA 7ICVA 3JPQA 1Z3EB 4ID5A 5KFJA 4I2AA 5J2EA 5KGXA 3LK9A 4NLZA 4FS2A 4I9QA 3QEAZ 1H38A 1ZQKA 3F9KA 2BCSA 1WCNA 1A5WA 1RT3A 1RBVA 1B22A 1X2IA 4P4OA 1ZQBA 3OYJA 3T5LA 4QZIA 5HRRA 3MDCA 4KLFA 4Q0BA 4RPZA 1YTUA 4M0AA 3ZSQA 3CM5A 5KFFA 5J2JA 1KSPA 2OPPA 3RRGA 3AVCA 4M9LA 2GUIA 5KT6A 4Y1DA 3KHRA 2GV9A 4IR1A 3AA3A 1MC8A 1ZQGA 4UB2A 2ZJ8A 1KEJA 3AO2A 5HRPA 2C2DA 2F1HA 3GFKB 1KDHA 3NGIA 2KTQA 1JL2A 2F1JA 4YMMA 3DOLA 8ICAA 4B9VA 4M3UA 5KRTA 3C1YA 2RDJA 3CYMA 5KT4A 4B9SA 1HNVA 3K5NA 3ISDA 2ZUBA 4M47A 1HNIA 3M8PA 5KRSA 4EP4A 3NAEA 3DOKA 4FK2A 4RQ8A 4DFKA 3Q8PB 3ISCA 5HBMA 1XSPA 5KT5A 3ZDAA 1S9GA 1JLEA 8ICPA 2BCQA 1U47A 5EWFA 2BE2A 3TAGA 3RJGA 3PW4A 2IMWP 2BQ3A 4BE2A 1HJPA 2W9MA 2BQRA 4CJSA 4DTOA 5J2BA 4DLGA 3DLGA 3GILA 1ZETA 4PHEA 1T05A 3AU2A 4HCBA 4PA1A 3O4NA 3AU6A 1REVA 3GIIA 1VSFA 4UB1A 3MEGA 4EZ6A 4UBBA 2ZUCA 4O3OA 4CGFA 2UVRA 3GIJA 5CY4A 3ALYA 3HW8A 4CF1A 4B8AB 8ICTA 1R0AA 2BR0A 7ICPA 2HW3A 2HHXA 1NOZA 4KLIA 3O4QA 4F2RA 4K4GA 4OPJA 3L2WA 4QWAA 4QWBA 3VQAA 1KLMA 1X9WA 4FVMA 1LV5A 1XHXA 4TUQA 1RYSA 1D8LA 4O5EA 1A77A 4YD2A 1RZTA 4FXDA 4RQ5A 2PXIA 1BI4B 1NJXA 3MECA 3NCIA 4RNNA 2P6RA 4TSXA 3OSPA 3PO4A 4J2EA 2VWKA 4FJXA 4MEXA 1JLGA 2C22A 1GOAA 3L2VA 2FMSA 3ORYA 3MR2A 4I2BA 3ETLA 2X6SA 3V72A 4BXOA 4O3RA 3OYNA 4NM1A 4DQRA 4M6WB 3B6PA 1J9AA 2A1RA 3PV8A 2B6AA 3Q8KA 1RPLA 1Y97A 7ICMA 4LH4A 3NGZA 1ZQNA 1ZBFA 5C25A 1LB2B 9ICJA 4MFBA 2PI4A 4LSNA 4ECWA 5J2HA 1KFTA 3E2EA 5DG8A 4IFVA 8ICRA 3H7IA 5DBBA 1BPXA 4RQ6A 1RT4A 2JGUA 3MABA 1G15A 4Z6FA 3RJJA 1UWBA 5J2NA 5J0RA 4CHNA 3T5HA 4PQUA 3QEBZ 3DLBA 1SKWA 4RQ2A 5DQGA 2ZQBA 4DL5A 2E4LA 3HXMA 5DB7A 4DL3A 4KLJA 1WSFA 2D0BA 1J5OA 2BPGA 3RJFA 5I3UA 4Z4IA 3GQCA 4KN7A 1VK0A 5KFHA 1IO2A 2FBYA 3MXMA 3AVLA 4CHZA 2HHVA 4RT3A 3NH1A 4C8LA 1A76A 3VQ9A 7ICUA 4FLVA 4Q44A 4Q45A 4FLUA 1ZQSA 3MXIA 3VQ8A 5KFOA 1N56A 3EW9A 2VA8A 1BHLA 3LZJA 2P5GA 3RR7A 3Q8QB 4KHUA 1ZQJA 4UB5A 2P1JA 4CJRA 9ICBA 2A1JA 3KTQA 1RBUA 2IHMA 2W9BA 1TV9A 2PFQA 1RBRA 2OYQA 2R8KA 1JXBA 3SJJA 5J0SA 1W0HA 4Z4HA 3MR6A 5CR0A 1HYZA 1WAFA 3SPZA 1ZQXA 3VQBA 3OS0A 4ECZA 3BQ0A 1BISA 4IQUA 2W8KA 1L3UA 1QLNA 4OGEA 1XSNA 4F50A 2D0CA 4HVJA 2D0AA 4YR0A 1SL1A 4ELTA 1C7YA 3KIOA 3V6DA 2VA2A 4F5PA 4E0DA 4ZTFA 2ASJA 1TVAA 4M41A 4KI6A 3MDAA 1U04A 2FMPA 4FJ7A 8ICJA 3SPYA 2QK9A 1JL1A 4EYIB 1ZQFA 4PHAA 4FW2A 4PGQA 3LP2A 3AVKA 4LH5A 4Q43A 3NFAA 1VSHA 4PH5A 4ECXA 4E1MA 2VA3A 5KFRA 3LALA 4QZHA 5KFZA 1Q9XA 1ZQTA 3BQ1A 9ICHA 2B21A 5FROA 2GWSA 3I0RA 4O3SA 4W5OA 7ICSA 1XI1A 5KFPA 4DOCA 4MFCA 3K4GA 3JPOA 1DGSA 4ID1A 4YCXA 3VA3A 1C0TA 3C21A 3PR4A 3RH4A 3CFRA 2FLLA 1T4GA 4F5QA 4BXOB 1TKZA 3CG7A 3PMNA 4CGHA 1B9FA 3M8RA 2W9CA 1BIUA 2DFFA 3D0PA 4KRFA 3MEEA 3M9NB 2ZTDA 1HQUA 3T3FA 4YNQA 3O3HA 4H4OA 4BWMA 2EHGA 3OYEA 3QEVA 3SQ1A 4CJTA 3C94A 3P83D 4IKFA 2ZTEA 2PYJA 5KFMA 1S97A 3SZ2A 4M04A 3HP9A 5KFQA 3RB4A 8ICHA 4ED1A 1NKBA 1EXQA 4E1NA 4F2SA 2G8IA 5BOLA 1RDBA 4CJWA 2QKBA 4CF2A 4AHSA 5FRMA 3Q8MA 4RQ3A 9ICOA 1MU2A 4DF4A 3HP6A 2BGGA 4DU1A 2AGQA 1BQMA 4BACA 4AHTA 4F5OA 1LW2A 4ECUA 3AO4A 3AO1A 1BCMA 2W9AA 3AVNA 4I9LA 1LW0A 4ECVA 4QZDA 4CFAA 2YHAA 2YV0X 1HJRA 1C0MA 4O3NA 2Z1IA 5CWRA 1ZJNA 4CIFA 5TZVA 4CJFA 3DYAA 1J54A 2ATLA 2A1JB 5SWMA 2HHSA 2W9BB 9ICQA 4GMJB 3C5FA 3WNEA 1KRPA 1Z26A 3KK2A 2JEJA 1RBTA 3ZDCA 3M9OB 2KQ2A 3OYDA 4ED6A 4F92B 4KLOA 4GC7A 4Z4GA 4KHQA 3IRXA 9ICLA 3AVMA 3RRHA 1WSHA 3QESA 1IKXA 1D9FA 4BDZA 3IG1A 4N76A 1A5VA 5DG7A 1VSDA 4GXKA 2BANA 3JSMA 5KFCA 4RU9A 1TV6A 4FJNA 1YVUA 3PX0A 2ZTCA 5J1EA 9ICIA 2MAXA 5CB1A 4DLEA 5DB6A 2KZMA 1ZQPA 3QNNA 3SV3A 2HNYA 3VQ7A 1TK0A 4OLBA 1XO1A 1TVRA 5J29A 4IRKA 4RNOA 7ICHA 1RCHA 4N56A 3OHAA 4G1QA 1RDAA 3QO9A 3DI6A 1XS9D 2PFPA 1XSLA 4IDKA 4C8OA 3TANA 1VRTA 4Y1CA 2W9CB 3HPOA 4ECQA 1NJYA 4AHUA 4KLLA 1FKPA 3C5GA 4KLQA 5KFXA 3V6KA 1C0UA 1KVBA 8ICGA 3BGRA 7ICFA 1ZQVA 2Z1JA 5K14A 3THVA 3C1ZA 1ZBHA 9ICUA 1S1UA 1IKYA 3A2FA 1WCLA 3DLHA 4AHVA 4CJLA 4UQGA 2DFEA 4J9NA 4DSIA 7ICOA 5KI6A 4KI4A 4RT2A 2J6TA 4DFPA 5J0QA 3T1AA 5L9XA 3HT3A 3PX4A 2AQ0A 4QWCA 4O3PA 4DQSA 4FZXC 2JLEA 4M2YA 4I28A 4ECYA 4J9RA 4O5KA 4RW4A 3K75D 2MUTA 4UAYA 3AO5A 1WLJA 3VQ6A 4E7KA 4FJLA 4MF8A 1C1CA 1J53A 3TAMA 2FLPA 1SZPA 2AGPA 4FYDA 4F5RA 4CJPA 3NH2A 1A5XA 4GW6A 3DLEA 9ICEA 2KN7A 2J6SA 3NTUA 4DU3A 5J2IA 4JV2A 4CGJA 2QXFA 4ED2A 3F73A 4M9JA 2YHBA 5KT7A 1HRHA 4J9OA 9ICCA 5IIMA 2XCPA 2A1SA 1S0OA 2HVHA 2P5OA 3RB3A 2XHBA 4LZGA 1I3AA 1LWCA 4YR3A 1F21A 3LANA 3PX6A 1RTJA 2Z1GA 1LAVA 4KV8A 4M3XA 3ZD8A 4QWEA 5DG9A 4E7JA 2C2EA 3C6TA 3NHGA 4XRHA 4HUGA 3U3GA 1QSYA 4KHNA 4QCLA 5KFGA 1D9DA 1IG9A 3UQ2A 2PI5A 4I2EA 3AO3A 4DSFA 3OYGA 5D46A 5KFYA 3S3NA 3V1OA 4DEZA 4X5VA 3V7LA 8ICCA 4Q8EA 3Q8RB 2D5RA 3ZT4A 1ASUA 2O4IA 2G8VA 4KKOA 1S5JA 1RT6A 3P5JA 3PW7A 3KD5E 3I0SA 3PUFA 2OZSA 1CZBA 4I27A 3TR8A 4FJHA 3V7KA 4F4WA 3KKRA 3QNOA 1WSJA 4OKJA 1SKSA 7ICIA 4O55A 3CQ8A 1QS4A 5J2FA 1CEZA 4QZEA
chains in the Genus database with same CATH superfamily
1F2HA 1X3NA 4UQTA 1OWXA 2BHNA 5E79U 1U26A 3QO9B 2DNQA 3M8YA 3T1HF 5EN1A 4X4QA 4QZ8A 3AD7C 4IDKB 4ZLPA 1UJ4A 2RQKA 4OI4A 1UT5A 1VRTB 2COLA 1SL2A 3ZTQA 5IWAF 2B8QA 3MPUB 5CHCB 4ZVGA 1OXJA 2CJYB 2ZNYA 4LD0A 4KH1B 3MM6B 5FPEA 3UN3A 1TMMA 4U8YA 3EGNA 1ZC6A 2K8CB 5K14B 3KDNA 1P7DA 1IKYB 2ASOA 1DKGD 4BGBA 4RBUA 3BKFA 4BS2A 3P4UB 5IIJA 1QHAA 2V4JA 3GONA 5AQFA 2A40A 1WSIA 5AR0A 4NLSA 3FSYA 2VBZA 3UW1A 1HBOB 4OV1A 4YS2A 2E2PA 1KCFA 3QYPA 4RW9A 3IBFB 4DPUA 2NCKL 4FJMA 3KLGA 5FPDA 4CESA 5BR8K 4KY3A 4QQBA 4FP9A 3AOAA 4E89A 5DDYA 5AE2A 2GBZA 5GAHU 2BPFA 3QEIA 4FCYA 2OLWA 1B43A 4WF9L 3VQ5A 2CPHA 4M42A 4IOBA 5D0GA 4M5DA 4HCCA 2OA8A 4UAWA 1WC3A 3CO0P 2Q6BA 2E1CA 2HRYA 4MKAA 2E66A 1UL3A 2XGPA 2OCEA 5HP4A 4J5OA 5KG1A 4UAZA 3KUGA 2DIVA 4DUTA 1HUXA 4DS4A 3D68A 5A2QO 2VG7A 3AA8A 3RAXA 1EX8A 4HDGA 2ZUGA 4WFBQ 4JWNA 1XMBA 4DR2K 4YDDB 4OZJA 4CLPA 2BRKA 3U27A 4O0JA 4ED7A 4MFAA 1FHTA 1XHZA 4A46A 4JI8K 4IOAL 1NGDA 5GIOA 2KIWA 4CBXA 1P9QC 4ICLA 2AP1A 1MROA 1DEJA 2ZGYA 1QSSA 4UASA 5AKGA 1Y7PA 2ASMA 5GADU 2ZXHA 2MLXA 2UUCJ 2F4VJ 4Q2LA 2UXCJ 2PFOA 2BJEA 4RW7A 2WVDA 3NF7A 4N7TA 2A42A 3CCRN 1COOA 2FVSA 4LFCF 3OYLA 3QIPA 1VQKS 4C3LA 2GWJA 2Z2LA 4BRNA 2XIDA 4L6V3 1TE2A 3DEEA 4OZ2A 1CZ9A 1I39A 3GIMA 3DXMA 3TA1A 1RT1B 1B0VA 2E5LK 1WC1A 4I7FA 4FWQA 5DQIA 1YJNN 3HKWA 2LDYA 4I6AA 3KXDA 1GOBA 4IZ9A 3PCOB 3K5LA 3L3UA 1Q78A 2QB0A 3VEOA 3CDBA 4FJIA 2RF2B 4K4IA 3V4MA 1KAYA 1B3TA 1HIWA 3CPWM 1RABB 5GMDA 1BQNB 1F2GA 3D66A 3PFOA 4JKBA 4NLDA 1ATNA 2ZVSA 3LPTA 3RTVA 4JKAA 3GYXB 1LK7A 4CZCA 3W5YA 4FNHA 4RBTA 5F8LA 3MPYA 4H4MB 3CD6S 3WC0A 4NYOA 2UUAF 4PEOA 4IUFA 4TUPA 3ZTPA 2OTJN 2E1MC 2SXLA 1RFQA 2RQCA 1S72S 1U6BA 4N47A 3DMJA 3BYPA 2ZJAA 1FDBA 3H2VE 5B0EA 5DK5A 1CULA 5E3AA 1A6SA 4DR6J 2KICA 5CRXA 2UVUA 2JEIA 1AYEA 2G13A 3IMQJ 2KT5A 1LAWA 1H74A 3N4PA 1NB7A 2ZIVB 2FB0A 2E8AA 3QJPA 1TFYA 4X4NA 3WK9A 1FVSA 1YDLA 2NRZA 3EKUA 2RN2A 2YNIB 4FO0A 4P9SA 5A2QU 1BCOA 2JWKA 4DPYA 1U7LA 4W5NA 3P1GA 3FZ2A 4ETXA 1K5OA 4J9MA 3SQ0A 3CWJA 1QSLA 1I51B 1CUKA 1IKWB 4UT4A 4O4GB 1NZBA 3QETA 2J7KA 1RT7A 4CERA 5KT2A 2O8EB 4K4SA 4BR0A 3NS5A 4ED0A 3KWGA 5E3RA 3VQDA 1IXRA 4QW9A 4FZLA 3DRRA 2C3PA 3TOQA 2A3ZA 1BPZA 4WCEL 3QEXA 1S76D 2P2CB 3KKAC 2JEFA 5EDWA 2V0NA 3O6WA 1FDAA 4Y2CA 3JAMY 4MLEA 2G5HB 4M9HA 2CG4A 1BPDA 3OTEA 4MDAA 5KPZA 2B4JA 3LZIA 2I1RA 1S9EB 1X42A 3I8BA 4DTRA 1NO8A 1FO4A 4E1JA 2VG6B 2R7WA 2QW9A 4JK9A 2WC9A 4ES3A 2K8BB 2AH5A 4BCAA 2X1GA 2Z4PA 2FJEB 2LLZA 4NYNA 3GZ7A 2WB4A 2R18A 1RTDA 4ZCLA 3D6RA 3MFIA 4UTGA 3LDPA 3H7HB 4K41A 1FK9B 1HNXK 1QQ5A 3ULHA 1PVRA 1MW7A 3LAKA 2FVPA 2HHTA 9ICKA 4CLLA 2FVCA 3H2LA 1I94F 1XN9A 4CO4A 1J97A 1O5JA 4PUOB 2HPUA 4WQ4C 1H2TZ 1RQ0A 1KN5A 3TJ9A 1HWJA 2AJ2A 2EK1A 4FPAA 2WB1F 4R8UA 2E8OA 3ZZPA 4XK8C 3NS7B 2YWWA 1KONA 5H9EJ 3KD1E 4UAUA 4C7ZA 3D1HA 1R27B 3Q23A 4B3OB 4ZVFA 2HHWA 2OI2A 2DK2A 5KNIA 3L3CA 4BRHA 3EZ5A 3P31A 5D0RA 2YKPA 4MF2A 3E01B 3LPUA 3N7RC 2YKOA 3E9OA 3TABA 4DCCA 1NRKA 1FX2A 1Q5VA 1NJIT 1KD1O 2E1RA 4XA5A 2IBKA 2DO0A 2Z56B 4HI2A 5IT9O 2Q0RA 1BPYA 1F1BB 3FZFA 2OPRB 3VVUA 1U6ZA 5JJBA 2PEHA 3HHNB 4A8OA 4LJMA 4B3MK 3ZSZA 5AQVA 1ZRNA 2FJVA 3R6MA 4KO0A 4NLPA 4F71A 1BD6A 1NKCA 3LGNA 1RYRA 2G8FA 3PY8A 5IIOA 2LYVA 2DNPA 7ICTA 3ENHA 5IXUA 3PNCA 1J27A 3DFEA 4L3NA 4MMOA 4GVMA 4I6MA 3MGHA 1OO0B 5AQYA 5KG2A 2W2MP 1QY7A 1K8AT 1XR7A 4LSLA 4USJC 3TUIC 1K1SA 2LBOA 2MZQA 4HL9A 2VFVA 4RBVA 1A0PA 2YKNA 4DUYF 2YX7A 2DXFA 1U1RA 3AA2A 2VPYB 1QE1B 2QZ8A 3VEYA 3THTA 3NEKA 4NEYA 1HBOA 3SSRA 3F41A 2AF6A 2LPEA 2HLUA 4R0EA 2BDPA 3JQMA 3F53A 1GMUA 2XYHB 1D5AA 2DNHA 5DBAA 2B4PA 3NH0A 4BGDA 5JLFA 4CNYA 2VQFK 4FKXA 1RQLA 4JMUA 1ZPVA 2GV1A 3QEWA 3MGIA 3VMFB 2I7NA 1FKOB 4LRAA 2QA4S 1G99A 2NRVA 4KLTA 8ICWA 3R2CJ 3DRSA 3AA4A 3T6BA 1GLCG 2QWOA 2HQIA 4FBTA 1BUXA 1CVJA 5FDLA 2IOFK 1ZQUA 1UVKA 2QLWA 4KHMA 4CJUA 4X4VA 3SJHA 3JXUA 2Y1RI 3HO1A 1G1XA 1XMOJ 3F2KA 4RZRA 1DFDA 5LMNJ 1VQ7S 4NLGA 4PRFA 4NB4A 2YNGB 1N5SA 2FLOA 4NLVA 3RH5A 4YVZA 3SUQA 4ZJLA 4JYAF 1WDDA 4KGXB 2GVZA 1X9SA 4GO7X 5CYMA 3OYMA 3VTIA 3BQTA 3FLCO 4KX5A 2WONB 1VQ5N 3VAKA 4LF6J 2YKMB 5B08A 4PQAA 4KAIA 5IT9U 3TJ8A 5J2DA 5GAHI 1U0HA 3ZD9A 2D3DA 3OW2R 1LWFA 3C15B 1VSEA 4UB4A 4URSA 2CQIA 4DOAA 4YD1A 2P35A 2OPSA 3VQQA 1AROP 3SIPB 4XUSA 2HMIB 4JKFA 2RQ5A 4LF9J 3TFSA 3PDNA 3D54A 3QLHA 2HZVA 1Q9YA 1BHNA 2I5JB 2E2QA 4Q5VA 4RLEA 2YJFA 3VGSA 1KW4A 2YHXA 1PC4A 5AM2A 2E1FA 3Q8YA 4OI0A 4BE0A 4OYIA 1KVJA 2R2UA 3BO3A 4CZLA 4HLBA 2DR5A 4KGKA 2P9KB 4LRBA 1X5OA 3L3VA 3SMZA 4FYVB 4CFBA 2F8HA 4KB7A 2X1AA 1J5EF 4KH6A 4CK1A 2E2OA 5JVGL 1FEHA 3T19A 4NZ7A 1KR4A 3MCPA 5GADI 4JI6F 4E7HA 1TL3A 2H3FA 1NDCA 3H08A 4PXBA 3PKMA 5THWA 4WYBA 4U7UD 2QL5B 3LGHA 4LREA 2MHNA 1EETA 3JPPA 3SQIA 2QEXN 4IG3A 2DCLA 2LU2A 3FRZA 3HKZD 3BGOP 1VHFA 1T7PA 3UDCA 2O8CB 1O8BA 2F1IA 5HP1A 3VQPA 3V81B 4EWTA 3GLJA 4KHPK 2UXBK 3M6XA 4ELVA 1VQ6S 3I4PA 1ZXOA 4JV5F 2YMQA 1EKRA 4EP5A 2W11A 5F9LA 4DL6A 5KFWA 3CCMN 3F5EA 1D3WA 2VFSA 3ZZZA 2JZBB 1FRHA 2CGKA 1BPEA 3QUQA 2PAVA 2QMUB 2YNIA 1U0SA 2IJNA 1PK3A 4F0HA 1VQMN 2OHDA 5LSRA 4AH9A 3AVJA 5L8RC 4HHTA 3CD0A 4ZS6A 5KG4A 3MCSA 3MR5A 2FHMA 3MTKA 1D8YA 2NV3A 4KB1A 5J2QA 3MMCA 3AMZA 3VPZA 3UPFA 3ZSVA 3BYRA 2O3DA 1E3MA 4YB6A 4ILGB 4RW6A 1KQFB 3JPNA 4NOHA 2KSOB 1WORA 1S9FA 1FJEB 2WSEC 4DTSA 3GFXA 1K0TA 2HKEA 1Y64A 3S01A 1P8GA 2B51A 3CUNA 3EZUA 1JRPA 1CS4A 1ZYQA 2FI1A 1ECWA 3VENA 4FVCA 2DY4A 2XC9A 4CRXA 2ZHOA 4H0YB 2HB5A 2G8WA 4JI3J 4DX7A 1YJVA 2I6XA 4YY3F 3KWIA 1S6UA 3R7SB 1HKAA 1U2VA 7ICEA 4WYWA 5DZ6A 1Q7YO 2WAQD 1B92A 5C15A 4EHTA 1RCXB 2EXUA 4TUSA 4AXIA 4KGVB 2ZOGA 2ZVIA 3IS9A 4DR5K 3C14A 1FCAA 1TUWA 1JX4A 2ZZNA 3HI0A 4DV4K 1UVIA 4MN4C 3QT5A 2F3JA 4F4KA 5GADP 4MT1A 4JI1J 4LFAK 4FZNA 1TL7B 5D0EA 3WDOA 1M1GA 2UUAK 2JGAA 2V4QA 2HS0A 3NUQA 3G8QA 3RJEA 2H4WB 4ZP7A 1GK8A 5C5JA 1NNEA 3TUZC 2RLTA 4K8ZA 2EWSA 4FLYA 2QSFA 3MM8B 3ID8A 2Q1LA 1SC4B 4F3TA 1E6YB 4RPYA 1TGOA 1KLMB 3W7BA 4C0HA 4OPKA 1IKVA 2BUPA 2P9SA 1X4HA 4XQ8A 4CNQA 2IIHA 1NK8A 2M70A 1ZBLA 4WZMA 3OYBA 3H20A 2H1YA 4RUAA 3RR8A 3DLKA 3DXKA 4CJ4A 2CAJA 4FWRA 4X4OA 5B09A 4DTJA 4ZVSB 2QMWA 4J9SA 1CLFA 5BOMA 8ICVA 5BYSA 7ICQA 2BVZA 3M05A 2EAOA 4RUBA 1RSCA 1HQEB 2UU9J 2GJFA 1N2XA 2D41A 1DURA 4C97A 3HL8A 5KT3A 3DGPB 4RG8A 3KFWX 2MGZB 2RU9A 2J8AA 7ICJA 1HR0K 3PW5A 2HBLA 1HUOA 2X51A 4EX6A 3R5BA 4N41A 3MM9B 3VA0A 3I1YA 1HFEL 2Y9UA 1WB9A 5ALFA 3LP1A 2KJ9A 4DU8A 3G96A 3OD2A 3JS9A 3TR5A 1TK8A 4RUCA 3HSDA 5T7BA 5AXLA 4I68A 2V69A 4O3MA 2NRTA 5CZVA 3CFPA 1QVFM 3C7NB 4M5NA 1ZQLA 8AT1B 4KC5A 1VBKA 3J7YU 4WE1B 2E6MA 3RWUA 2ABYA 5C2CA 1L7OA 2F5GA 3DXSX 4KX3A 1SL0A 4NI2A 1A9NB 3VAMA 5EWEA 3MM5B 1HEKA 3S3OA 2HZAA 3FCHA 4KLDA 2DQNB 4P0PB 3MOJB 1KAZA 2W3RA 3JPRA 1V9PA 2JVOA 2O66A 3MEDA 4U6PA 2W4CA 2DXEA 4DS5A 4KTZA 3ZC4A 1Z2ZA 4CK3A 4BR2A 3ZT2A 1S7IA 3WBZA 3T1YJ 9ICRA 8ICIA 2H4YB 2UUBJ 1IR1A 1UPPA 4LSZB 3CXCM 4EX7A 4US9A 2XS2A 4PYAA 4DR3F 2GTDA 1WUDA 3O1LA 5ETSA 2QRRA 2BBEA 5SZTA 4OX9F 2F1FA 1F9EB 2MKSA 4Y65A 2KXNB 3V6DB 1HW9A 3EDRB 1NGBA 4DTXA 1RLDA 4DMZA 4BVPA 4Z7CA 3O9RA 1X0FA 4GKKJ 1LWXA 1K73O 3BDPA 1HKBA 3SMSA 3GIKA 1KWMA 2HFUA 1JLCB 3O4WA 3PFEA 4H0XB 5ALDA 2OIHA 2H5XA 3AA5X 2XY8A 5JICA 1IV0A 1VI7A 4C4SA 4FJ8A 4CO1A 4MQ3A 3WQUA 1UTAA 1Z1BA 2AJQA 2ZD1B 3IG8A 3NVYA 3HZ6A 4CLSA 4MFFA 3TEGA 3NRWA 2DFHA 4NYFA 4USKA 2CKWA 5BR8J 2C2KB 3IXQA 4LR7A 1CJKB 3JTOA 2OTLS 3KBBA 1IWAA 2OPQA 2PC6A 4YQWA 1DT9A 4NE9C 4M7YA 1BL3A 5B7WA 1O51A 2VPXB 4GVLA 4QYRA 2ITGA 1FRKA 1RK8A 3HJFA 1QZ6A 1N5WA 5ALLA 2ES6A 4E19A 5ALMA 2F8KA 2Z7JA 4IRDA 3EL2A 1URRA 1YZ6A 2AXTU 4ECSA 1JJ2R 1Z00B 1X5PA 4CJ5A 4ZH4A 2QN6B 2MLYA 1GT8A 5LSLA 5BJRA 5AKJA 1BI4A 1CXUA 2LU1A 2KHVA 3CDEA 3VAHA 2H9ZA 2Y9TA 4HHHA 3POTA 3M2UA 2VZ9A 4JN4A 1HBMA 1N8RT 1MLAA 4QZAA 3I31A 3W9HA 3UVJA 4X66K 4OI6A 5EUHA 2XY5A 4IQMA 5HRNA 2Y1IA 7ICVA 3LDLA 2X1BA 5IOLA 5JXSA 4DV1F 3M2VA 5K4LA 3GPAA 3LK9A 3H5YA 2Z2MA 1H38A 1RCOB 5E0OA 2W4DA 2N3OA 5DS7A 5KPRA 1HHTP 3RSEB 3BZKA 1ZQBA 4LF4F 3J7ZO 4ZCKA 5HRRA 3MDCA 4PKIA 3U8XA 1K8AO 3TX0A 4KLFA 3HVTB 2AX1A 4XPCA 2YX8A 1YTUA 2HGLA 1V3ZA 1G7CB 4NRUA 4CGZA 3CM5A 4TY8B 5KFFA 1HHSA 1KSPA 4OJ1A 4CLZA 3AVCA 4TNOA 1EKSA 4L72B 1IBKK 3DDHA 3CJ8A 5LMUK 3O80A 2E5SA 3DM2B 1C4CA 5E3QA 4CZKA 5HRPA 2F1HA 3MK6A 2LQJA 3DOMB 5AQSA 3BF4A 2DCUB 3EICA 4OL8A 4J7CA 2V2QA 2KTQA 1JL2A 4PKDB 3SAGA 1R8PA 1N0VC 1VQOS 4B9SA 3K5NA 2ZUBA 3S41A 1HNIA 2Y0SC 5KRSA 4EP4A 2OYYA 1QD1A 4RQ8A 2ZEJA 2K8AA 5EX3A 3ISCA 2L9NA 5HBMA 2XSFA 1S9GA 2WZ1A 1MA9B 3MWTA 1JLEA 2GQCA 4I2PB 2BCQA 3DXBA 3SCLE 1K8KB 2VJUA 2GIQA 3RJGA 3QWUA 1RWXB 2BQ3A 1HJPA 2BQRA 4QIWD 4B3SF 4DTOA 3CNQP 2NYVA 5AQRA 3IGNA 5C7PA 2XHCA 3H25A 5CXTA 1ZETA 1T9TA 1T05A 1XNRF 3KJFB 2HOIA 3GIIA 3IRUA 3Q7BA 4I6YA 4UBBA 4O3OA 3NMUA 3GIJA 3HJEA 4DR1J 5LOQA 4CF1A 3ZNUA 8ICTA 1OW5A 2G08A 2HNZB 4X4RA 2CQGA 1N34K 3U9ZA 2J9DE 1BDGA 2HHXA 1MN9A 1NOZA 2XICA 1N36J 3I9V9 4QIFA 2ADCA 3O4QA 2ASPA 4F2RA 4O44B 1PAUB 2G2ZA 3MC1A 4NLOA 4O5FA 2MLZA 1M5HA 1MN7A 4QWBA 1KLMA 1X9WA 4OZ3A 2QFIA 4TUQA 1RYSA 3OXFA 4K0KK 1DK3A 4O5EA 2DKXA 1BLUA 2MPUA 3L9ZA 1RZTA 2B4UA 3FZBA 6AT1B 4A5AA 4H5WA 1COKA 3UNGC 5HLFB 4WWSA 3C3LA 3MM7B 4XH4A 2DH7A 3OV7A 3OSPA 5AK5A 2A10A 1UCVA 2VICA 4FJXA 1JLGA 2FMSA 5EE1A 4IJNA 4G65A 4USTA 4M7XA 2X6SA 2QJ3A 2ZOFA 5AZIB 4KSEB 3OYNA 3WKCA 4RJVA 2HCFA 3B6PA 5GAGP 2A1RA 3OFEA 2B6AA 3IR6B 2GO7A 2MQNA 4RTFD 4A8YA 5BRDA 3IA0A 1G4CA 3A8EA 3Q89A 2R2TA 4AE5A 4FN5A 3A0BU 1RT3B 2KKPA 2GWKA 4Y2TA 1H98A 4FE3A 4IFVA 1HNXJ 2EZYA 3QRPA 2HGNA 4JHDB 3FVYA 1BPXA 3BN4A 4Z6FA 3EM1A 5HMZA 5J0RA 4DOZA 1KQQA 9ATCB 5ETKA 3A5MC 3K2YA 2XNRA 4JI4F 4ZVTB 3UKUA 2OPPB 1SKWA 3RU0A 4H54A 4L73A 3WXMB 3OBYA 2DEIA 2Y3YA 2RHQB 4GV9A 1VK0A 4MKYA 5D4PA 3AVLA 1VIOA 2GO9A 2CPRA 2ZF5O 2PO4A 2EG1A 5AJ3J 2GLEA 4FLUA 1VQKN 1ZQSA 2O8BA 4A48A 1N4LA 3MXIA 3M8PB 4GVBB 2VKZG 3HX9A 3H1VX 2QC3A 4GNIA 1WC4A 4IOCQ 1BHLA 4DR7K 3DJCA 2G5IB 2QLFB 4CLYA 4U96A 3GJSB 3Q8QB 3JB9k 4ZVRB 4B3MJ 1VQLS 1ZQJA 2MZSA 9ICBA 4P6QA 1QH9A 2XZTB 2IHMA 1H2UX 2W9BA 1GO3F 2WUSA 2PFQA 2KU7A 1RBRA 3GP9A 4CZFA 5J0SA 1W0HA 4Z4HA 1UETA 1WAFA 5JRTA 1Q3VA 3W3DA 4WK1A 3VQBA 3OS0A 3BQ0A 1L7PA 2DNYA 4ER8A 3QFPA 1K0VA 2D0CA 4HVJA 1T94A 2IVNA 2RSQA 2D0AA 1KHVA 1KKXA 2MMYA 3TNVA 5M2PA 4ELTA 3V6DA 2VA2A 1NHUA 3HTVA 4GKJF 4ZTFA 1TVAA 4B02A 3MDAA 1X4BA 3W9JA 5AICA 4Y2MA 3DAWA 3HT0A 3CD6N 2QK9A 1JL1A 1ZQFA 2C3UA 4FW2A 4F26A 4O23A 3NFAA 1BA1A 2FF3B 1S72N 1NGJA 2VA3A 1YK9A 1IG8A 5KFRA 2JL9A 4B3RK 4FWLA 2VQEJ 1RAEB 3I0RA 3EZOA 1RE1B 1RT5B 4NLYA 4DOCA 4OYPA 4MLHA 3JPOA 4LF8F 2PMZC 3VA3A 1C0TA 3C21A 5AI6A 3PR4A 4GIBA 3MCAB 2DTJA 3P49B 4BXOB 1TKZA 3PMNA 2IOFA 4CGHA 4DUZK 1B9FA 3C28A 2FF6A 3EWGA 5D78A 2OGUA 1KS2A 2CNOB 2HQFA 1FXRA 3D0PA 4KRFA 1HI1A 1HQUA 3G4SS 1M1KT 4F02A 2DR6A 4YNQA 4J9VA 3O3HA 4H4OA 3TA2A 2EHGA 1AFIA 2VPWB 3IKMA 1M5PC 4RCHA 4CJTA 4Z37A 2HBZB 2OM6A 2J0SD 3P83D 2ZTEA 2PYJA 5J2NB 2HAIA 3HP9A 3MWPA 4FWNA 3CJSA 4ED1A 1U24A 1NKBA 1YRUA 5I3QA 4F2SA 3TTDA 2YWGA 2G8IA 1IBMJ 2HVEA 3MXHP 1GEHA 4EU0A 1UVJA 1M0SA 1J5OB 5ALPA 3P96A 5M2UA 2BZ2A 4GV6A 2BGGA 3KUEA 3T1HJ 4BACA 2EEYA 3RJMB 3PEHA 3WXJA 4HHUA 3WIVA 5IWAJ 1HW8A 3AVNA 4BRIA 2F9JA 1LW0A 1KBRA 4ECVA 4FPIA 3PJXA 2YHAA 4DV3F 2BA9A 1HJRA 5K9FA 2Z1IA 5CWRA 2A6MA 4DCJB 2XSJB 1J54A 2G1DA 3FE1A 2ATLA 4OX7A 2HHSA 3VQTA 5HI7A 1KRPA 5AQMA 3MN6A 3IBWA 3CXCR 3BKTA 2JEJA 3PJ9A 4TY9A 2KQ2A 4DL0C 4Y0FA 1WI6A 4Y00A 1W2BM 3ZEUB 3H8YA 5EVZA 1FRXA 4DQ8A 4GC7A 9ICLA 1T0TV 3RRHA 3BV8A 4JP8A 4G9ZA 3HFKA 3SBTA 2FTRA 3ZXWA 4UB8U 5FP0A 3FKBA 4BC5A 4GXKA 1T9WA 3JSMA 1RACB 2YMLA 3LP2B 2KG1A 2FJBB 2NUHA 5TISU 4IL6U 3EJMA 9ICIA 2MAXA 2W40A 2PN6A 1ZQPA 1JB0C 1R8HA 1N5YB 1DHMA 2KHDA 1WSVA 2Y9HA 3TVYA 2Q4TA 3MX5A 4IRKA 4FWOA 4FXVA 1XNQF 4N56A 5A76A 3IO1A 3AXKA 4NLRA 4TN2A 4G1QA 1N33K 4K7QA 1XS9D 4LQ9A 4PHTX 4KH4A 2W7AA 1FA0A 3M1FA 4F67A 4Y1CA 2W9CB 3RYLA 1HWKA 1FKPA 1S8OA 4A8MP 1KVBA 1UFLA 3BGRA 1YTYA 3NOCA 2RDDA 5T7LA 3KOOA 4AL7A 3IC1A 1ZQVA 3THVA 1NLVA 2FJ6A 9ICUA 1S1UA 3W62A 1WCLA 4AHVA 1I1GA 2DFEA 3C66A 4DSIA 1BC6A 5KI6A 2AX0A 3OTOF 3NGSA 1SXLA 1OMSA 4KI4A 3IDWA 5BYRA 2L3MA 4EHUA 4LFCJ 3LDQA 3T1AA 5L9XA 4K8RA 4MKBA 2QA4N 3HT3A 3CPEA 1K47A 2D3ZA 2XWYA 4CD3A 1B4SA 4FZXC 2JLEA 2LI6A 2R7SA 1MU2B 2K4IA 4RW4A 4PL8A 5BYQA 5EE9A 3HHKA 4YHHK 1W97L 4E7KA 2P9CA 1LW2B 2VBYA 3BKUA 4MF8A 2MQPA 1C1CA 3TAMA 2P9IA 2FLPA 2OHFA 1HD0A 4FYDA 3I9ZA 4F5RA 4C7QA 4CJPA 4GW6A 5MAOA 1OY6A 2KN7A 2J6SA 3NTUA 4DU3A 5J2IA 3PKYA 1ZS6A 4MK7A 4CGJA 1OKJA 3NNCA 1VQ7N 1IG6A 3UMGA 2BOAA 2IBOA 2YHBA 1HRHA 2YN4A 2JDJA 5D8HB 2LA4A 3SFUA 2ZH8A 1S1VB 2LFVA 3QU2A 3DYAB 1IJFB 1WHVA 1P8ZA 2EPIA 4US8A 4LZGA 1R8CA 1MWZA 1LWCA 3OUYA 2HBKA 4OD0A 1QAYA 4KV8A 1IIPA 4BRAA 2JJ4D 3B78A 2UUAJ 4U7BA 1FESA 2LYBA 1FDDA 2C2EA 4C11B 3C6TA 1SIJA 4F3QA 1RWKB 4B3SK 4R25A 3AB4B 4HUGA 1M5SA 1OPZA 2YBVA 2E9ZA 2ZJPQ 2DHAA 2F40A 2HHPA 2B56A 4PZOA 5F1XA 2G0JA 1XNRK 4NEZA 3VGTA 5C10A 4JI2K 1IKXB 1RYUA 4I2EA 2P9LB 1TZ0A 2E1AA 3S3NA 3V1OA 4DEZA 5ALTA 1P6TA 1BU6O 2KVSA 2R9LA 4KKOA 5LXYA 3P5JA 1TV6B 3PW7A 1U25A 1IBLJ 4YB7A 1NNDA 3VGLA 4RWXA 2ZHBA 4FL9A 1YSJA 1SKSA 4IS7A 5J2FA 1CEZA 3TVZA 4RNHA 4DTMA 2M8HA 5ALKA 7ICRA 5DZ7A 2VL1A 3H0MB 3NDKA 2UVVA 1VQ4S 4ZOSA 2CWXA 4PPXA 3J81Y 2E5JA 4LIRA 1N61A 3NAHA 3G0ZA 2DPNA 2AYMA 4CH7A 2JR5A 1C1BB 3PRDA 4Y2RA 5D15A 3LW5C 3NLCA 1WELA 1C0UB 3D28A 2ASLA 3QZ8A 2PE8A 3ZETA 1XU4A 3SNNA 3LAMA 4I2JA 2ATQA 2R8JA 1FI4A 4ECTA 3SCJE 1MWMA 4H0TB 4AL6A 2ZBRA 4L8RB 1JLFA 1UPHA 4HWIA 3CFOA 4FJ9A 5D3GA 4KB0A 2XS7A 4CIGA 4DV2F 1RDFA 1TAUA 1RT5A 2IPOB 4DFJA 4KFBA 8ICBA 4TQRA 1NK0A 2YPZA 4CEAA 2F8EX 2NXJA 3K89A 4NZ0A 1QVGR 3QATA 1I94J 3MN5A 5AIBA 3M30B 3AT1B 1Q8IA 4GXJA 4I2HA 5IINA 2ZNZA 4OFZA 2WB1D 4DL7A 1A0OB 3HHLA 5IM0A 2F3NA 1BMQB 3FBFA 1U48A 3J7A1 3A3NB 1D8BA 2DHXA 2CZ4A 3HHLD 1SUQA 4ZMMA 4J2DA 1KHWA 1FFGB 2GOLA 4IQXA 3C19A 2B5JA 3THYB 4P0QB 4DTNA 1TKTB 3K58A 3WNGA 3JXOA 1YWXA 3CJKB 4WQ5A 5GAEP 4KLHA 3SSQA 2Q31A 2K3IA 2KH9A 1U2RA 2DB1A 2YKAA 3OYAA 1VQNN 1QHTA 2M9NA 1RTJB 4LF1A 1NMNA 3WXKA 3G9CA 3PIOL 2GGPB 3R3LA 1T03B 5CP2A 2VDIA 4DWIA 1WHYA 4GLXA 1T9UA 4KR0B 2R7XA 3QMLA 1LNQA 4C23A 5KGWA 4PL2A 4P7VA 3M4XA 4WFAL 4JI0F 5AXNA 2CNNB 5H9FJ 4PHPA 2FDNA 1CJTA 3BS5B 4URQU 3BEGB 1E6VB 3CCSN 2O8FB 1Y10A 4RQ4A 1Y0HA 1EIYB 3H3OB 5KG0A 4YORA 3I0SB 3KLIB 3NCQA 3R27A 3ZT0A 2QB1A 2KFNA 3KKFA 1YJ7A 3D2EB 4DUYJ 4NLBA 5LSOA 3RBXA 4NCAA 2EAMA 4H5NA 3LPYA 3QIOA 2KVQE 3VESA 2IHNA 1BNOA 2F77X 4CF8A 3VAIA 4R79A 3ZEUA 2DGOA 1SV0A 3EPIA 3PW0A 4WP9A 4AF1A 2D3OR 3TI0A 3B6OA 1KAXA 4LF8K 3W66A 4DOBA 3ZTSA 4EELA 4Z4FA 5HVHA 1SH2A 3K8WA 1NM2A 3O8WA 5GVQA 3CI5A 2F7VA 4NXMF 2K4HA 5CCLA 3BEXA 1T8EA 1M5KC 4I2DA 3HD1A 4RNFA 4R64A 3SLCA 2YX1A 4IG0B 5A8KB 1N5YA 5F8NA 3THWA 2Q79A 5ETRA 2RU3A 1PYTA 3SCKE 2GHPA 2A1BA 1HLUA 1S6OA 1S3XA 4AHRA 4A57A 4C3KA 3KZBA 3V2UC 2NO5A 4YDXA 3UDVA 3Q8SB 1X60A 2V67A 5B66U 4BX9C 1I5OB 5CYQB 5J2MA 2I9GA 1UMJA 4HT7A 4CM2A 3FFIA 1JJCB 3QRQA 3OS2A 3EVMA 3CETA 4ILMA 3UQSA 2XRIA 4GO5X 4JYAJ 3M9MB 3GYGA 3MBYA 1TL1B 2FJAB 1HNZK 3U26A 3ONNA 2KVIA 2YH1A 3ISNC 3I96A 4MYUA 5J1NA 4FOIA 4DV7F 4M3ZA 3WKBA 4DG1A 3MPVA 1YZ7A 1WSRA 4GMKA 3TTFA 2CRLA 4LUBA 5C2DA 2IVMA 3ZX0A 3OYCA 1JLQB 2NRXA 2GNKA 4LBIA 1RU1A 5DB8A 3LPEA 2DY1A 4CTAA 3A8IA 4DV3K 4X4UA 5I42A 3MX2A 4B3TF 4KH5A 1N32F 3G6YA 4B9MA 1JNZB 2R8GA 3VAGA 1DY3A 1PC5A 4YOVA 1DTTB 2BXJA 3JSRA 4PWDB 2YNFB 4FO6A 1D8ZA 3RJIA 4QZCA 3NF8A 3VEXA 3PNIA 3FCVA 3V9ZA 2PD1A 4UOHA 4WKRA 1GNKA 3MAHA 4HTUA 2VV5A 1J5EJ 1UZDA 4NV0A 3WT0A 4IR9A 3G10A 2IRYA 4UY8O 4B9LA 1S1VA 3L09A 1X9JA 4YR2A 3RBDA 1URNA 4AD6A 4TURA 4JI6J 1VSJA 3FQKA 1HPZA 2IAJA 4ZN3A 1VSMA 3VQEA 2DPJA 3K5MA 1MWYA 2ROPA 2VC1A 3SD7A 2VF3A 3A8YA 4DR4F 2HGMA 3QT7A 1S1WA 3SMVA 1S6QA 4Y2KA 4IO9L 4WU2A 3AUOA 5DM6L 1NK6A 3HKZF 2XNQA 4CRJA 1MMLA 2IA0A 2BJ3A 3HPHA 3QU9A 3LP0A 3AEVA 1MWQA 2WSFC 3WNFA 5LJ5Y 2VG5B 1W2BR 1WC5A 1B7FA 3OFGA 1ZQIA 4GV3A 4YP3A 4JV5J 1Z25A 2OZMA 4XH5A 4DPOA 2BQUA 4ZVPB 3MPWA 4LBHA 4JS4A 1CSJA 2J6UA 2AYGA 1VGYA 3ZSXA 5C24B 2ZE2B 1TL5A 4DQIA 3P5BP 4LVSA 2E1YA 2FMQA 1SV5A 4K4HA 3SDEB 3CF5Q 4K25A 1QQ6A 3M1YA 1TUYA 1Z19A 3TW0A 4CYUB 1SS6A 3M7VA 1JALA 3NBPB 4BVOA 2UUWA 3KG4A 4DCPB 3RB6A 1JLAB 3BSOA 1C1BA 1OY9A 4AILC 1FNOA 4OJRA 2NXCA 4NPOA 2C2NA 2DNOA 2E1EA 4R65A 2VOPA 1X4DA 4ILHA 2Z0GA 4CHPA 4CLFA 3QQCD 2LKYA 4AHCA 3C95A 1IM4A 3L5KA 1Q4RA 2KYXA 1UQVA 5F0UA 3ZZYA 4ZJQA 3A13A 4IKAA 2V4RA 1S10A 2BJ1A 1GH8A 4I1TA 2Z2ZA 2HWTA 3H8WA 4OJ3A 4YY3J 5D4LA 3NVWA 2ZIWB 1T3NA 2F44A 4NMXA 3GB0A 2YTUA 3DHXA 2J0QD 1NOMA 2WAQF 4JS5A 1XWLA 1WDTA 1R6VA 3HSZA 1HHQA 4QIEA 2B9WA 4LFBJ 4DFMA 3W0LA 2ZWHA 5IQ6A 2OAUA 3ATUA 2AEJA 1NDKA 2EC2A 4YFKA 4CI6A 5CZ2A 2QARB 5A2QY 1IWGA 1F5AA 4DV6F 2F7TA 3BF1A 4FF4A 5AI8A 2AKWB 2D74B 4JLHA 2AWZA 2IDOA 2LYHA 4DV5J 4KBIA 5L46A 2HFVA 2YVSA 5ALHA 3T9ZA 1TKTA 2D3UA 2F2AB 2W04A 1QQCA 2EDUA 4AYBD 2BYCA 3VN5A 2DVIA 2EC0A 1KOHA 1UAXA 4JI7F 2BE9B 1IUJA 2DR9A 3MFHA 1VR6A 3KKSA 1T03A 1VQON 4JV1A 2GEMA 2WVEA 2CDRB 4BBYA 2HVZA 4KHWA 3I8DA 5D49A 1ZZNA 3TO8A 4UB3A 4NL9C 1L7MA 2GZOA 5G5GA 3SI6A 3C6UB 3CJ0A 2MZ1A 3MXJA 4CIEA 4JKGB 3E58A 3HPGA 1HARA 3ZT1A 2WHOA 4OHZA 3W2VB 1S79A 2FC0A 2G09A 4F4XA 1VDVA 3R1XA 2F8SA 5ALNA 1YVFA 2ZH3A 2DNZA 5EU7A 5F0XA 2B0CA 5KFDA 3KLIA 3H5SA 3G6VA 4R5PB 2O67A 1K44A 3GFZA 2UVWA 3KHHA 3J81j 2HF4A 3D2EA 4MK9A 3LOUA 1NPPA 3OR1A 3M2RB 1LKZA 5IILA 2J76E 4ZPCA 1N5TA 2HK2A 2LQ8A 3MN9A 3SR6A 4JI5K 1DTQA 1M90T 3MMJA 2RMLA 2ZJRL 2LP4A 4DV2K 2GAHC 4B1YB 2P51A 4OHYA 3TTCA 1ZBUA 1F3VA 3E9LA 3IR7B 4TLQA 2WTFA 4QOZB 1B9DA 1JXLA 4DHYA 3FZLA 5CZXA 1S6PB 1S0MA 1WNSA 2R7YA 2DGVA 3V9WA 2BJ8A 4B1WB 4OZ0A 3KK3B 2ZC4A 4PGYA 4ICAA 3CCTA 2AEFA 4YOUA 4M9NA 3NRBA 1JLBB 3LYSA 2PYLA 1U8WA 2DGQA 8ICYA 4LRDA 4I2CA 4BDYA 2DBYA 4U67Q 3ENOA 1NK5A 1WJ9A 8ICMA 3CC7N 1D1UA 2ROEA 4DR3J 2CJKA 5A8WB 2HHQA 1NK9A 1JIHA 1BWEA 4CWBA 2KO1A 5HO4A 1VJWA 3IWXA 4CF9A 2ETJA 4IH6A 2CQCA 5ALIA 4ED3A 4OX9J 2QIFA 1JK9B 5AQTA 2ZJ5A 3U9DA 5AQJA 4DSEA 1KVCA 5B0AA 1VC0A 2W01A 2YHYA 4M5KA 1AZSB 5AQGA 2XWXA 2FYXA 4FLWA 3ZI4A 1GLFO 1Y4ZB 3DLLL 1WAJA 1X7VA 1OVYA 1A6LA 2A5XA 3IFRA 3A0HU 2OMOA 4CE6A 2AZ1A 2DBBA 5DDRC 4CJKA 4PR6A 4BQLA 2BM1A 1RT2A 2ZH5A 2R7RA 4YMNA 2LDIA 4WFBL 1NPKA 2CN1A 1DLOB 3CP8A 1LEOA 3B8AX 2X3GA 3HZGA 2KZ3A 2QSWA 2V63A 1Y3JA 1VRUA 2KYZA 4PY5A 4ZA1A 3UIQA 4K8XA 1NSAA 1VQLN 1JQGA 2EK6A 4WIIA 1ILYA 4IEEA 3AOCA 1VLOA 4ETZA 1Q16B 2B6GA 5BN9A 4KREA 5AK4A 5J2CA 4HDHA 1LQ9A 8ICXA 3ITHB 1FXXA 9RUBA 5DLFA 3BJYA 4OI2A 2OUGA 4E7LA 5DDQC 3C16A 4DR2F 1SQEA 5FPMA 2FBXA 4BG8A 2BX6A 2GIFA 3IAS9 3ZLJA 5EHHA 2FY1A 2IC3B 4JI8F 3UD5A 1WSGA 1IR0A 3GV8B 3W8PA 5IT9Y 3N7PD 3HM9A 2VFUA 2VIXA 3L7UA 3C6AA 2LA6A 3QEPA 1WC6A 2RRNA 2CA9A 4FBUA 1XBWA 4NMLA 1ZQHA 4CEFA 2KL8A 4O3QA 3RAMA 2H3EB 4DV1J 1K1QA 2AT1B 3AV9A 3VGKA 5A0YB 2XO7A 4LY7A 1DRGA 2H65B 1T11A 3EE9A 1Y5LB 4I2QB 3HFVA 3EWAA 4CCHA 4OYAA 4LF4J 2ZH9A 1NCLA 3M32B 2BW2A 3KK1A 4DV7K 4NCGB 1UOCA 3NBPA 5KFKA 1UT8A 3UCZP 1XNSA 4U9RA 2E5LF 4QZGA 1WEYA 4HTIA 2IJRA 5GINA 4CF0A 3A8JA 2NZ4A 2DWQA 2WTUA 2IVFB 1K9MT 1N32K 1B0TA 2C3YA 4X62J 2EZZA 4Y2XA 3MR3A 3JYTB 5L1MA 2YQEA 1S1XB 5KOWA 3MMAA 4BWJA 1ZM4A 5HVFA 3BPDA 2GMHA 2AU0A 1C6VA 4EYHB 3VHQA 1N0UA 3SV4A 1AUDA 1TFRA 7FD1A 4TQSA 3QT8A 3AM9A 1BO5O 2W1BA 1XEZA 3D0GE 4CEQA 1T9VA 5AQKA 1EJ7L 5HROA 2OWOA 4Y2YA 3TQEA 4QZBA 8ICKA 2P6SA 1KTQA 4A61A 1N6QB 4B3SJ 4Z6DA 3H45C 3O2IA 1RDUA 5J2PB 1FF2A 3ASMA 1ZZFA 2A3VA 3AB2B 3NF6A 1Y88A 4NLTA 4NLNA 2QLJB 1XNRJ 2EX3A 1F3FA 5C42A 2RUSA 2W42A 3DLRA 1S22A 4G1IA 1VSIA 1XK8A 4WXWA 2XS5A 3UXNA 3LDSA 2RS8A 4RW8B 1BWFO 1LWEB 4DL2A 4EGLA 4OVLA 2F96A 2R2SA 3SUNA 2FPHX 2BJ9A 5F41A 3AL0B 4LF7K 2FZGB 4ZHRA 4UW9A 5KFVA 3D6FB 1LFPA 2E6LA 2C42A 3ZFVA 3RZAA 3T5JA 4L76A 3M8QA 3L95X 3NG8A 1RTHB 2D1CA 3H0PA 4F93B 4KYZA 2QG9B 2DH9A 3CVKA 4YN4A 1TKXA 3TAFA 1AUSL 1SJ4P 3UO0A 2OKQA 3WQTA 1JXEA 3BSAA 1JKHB 2CPYA 2BKEA 3E1YA 4ZPVR 2R8HA 3IRWP 2QXLA 4EMDA 4ZVOB 5ALVA 4W5QA 3W1YC 5HR6A 2G9OA 4Y6IA 3C2MA 4ZLLA 1HMVB 3CDWA 1PILA 1Q82T 4WXOA 1S0NA 4Y28C 3HRGA 1LKYA 3CCJS 5BPNA 2HSZA 2KKZA 8ICLA 3QMQA 3D4JA 1C20A 2JVRA 4JI4J 5AKIA 1KLNA 1DXSA 1X9MA 4O5CA 4C8KA 3C0BA 2ROGA 2KN4A 2P9UA 4B17A 4EZ9A 1DAXA 3DRXA 1OPIA 4UUWA 3P39A 1RZMA 3BDEA 4IWVA 1UCNA 1FJGK 1FRJA 1WHWA 3CD7A 3KHGA 4QAGA 4GC6A 1YLXA 1N62A 4P2MA 1UJ6A 2HOFA 2HHHK 2YMPA 2IOHA 2HBYB 3JQJA 3VGMA 4C8ZA 4Y2JA 2HWIA 3V4IA 3P45B 3GV5B 2FDRA 3MEEB 5BPCA 4NRTA 3TFRA 4QW8A 2NSCA 3ULEB 1F5CA 2O8DA 3G82A 3GFYA 4IRCA 4I4BA 1KFSA 1ZQAA 4RNMA 2N4CA 4BRPA 2ALZA 2WOMA 1PYSB 5FRNA 1HYSA 3WIUA 1KQKA 1P1LA 4F72A 4C0OC 4OHXA 3DRPA 3UQ0A 3KLFB 2HFSA 4JI7K 5HMLA 4AL5A 1G3OA 3G71S 2EFGA 5IIKA 2L5YA 1ZQMA 9ICFA 3SUPA 4CGIA 3KDOA 2P9PB 1NUEA 1WG1A 5AXMA 4WK3A 5CAAA 2HFZA 1RTIB 5KFJA 4I2AA 4C6AA 3CC4S 4GKJJ 5J2EA 5K20B 3QEAZ 2QA1A 3F9KA 3DNCA 1IBCB 1RBVA 2CH5A 2K60A 3CDAA 4M94A 1X2IA 4P4OA 2CZVC 2Y8YA 3OYJA 2E20A 4QZIA 1PK1B 1CJVB 3CC2N 4PG7A 3LVWA 5H1SV 3ZSQA 3TADC 2HRUA 4TVAB 3NNHA 4G1PA 1KEKA 5J2JA 1R0BG 2VCPA 3W60A 4NLWA 2G0CA 3RRGA 5TKYA 5LL6Z 1SV4A 3KHRA 2GV9A 3AA3A 1MC8A 2VQFF 2O6KA 1KEJA 3HFZB 3BUZB 2C2DA 3CHWA 3H98A 3TSUA 1FW6A 4JB3A 2F1JA 3TYTA 8ICAA 2JH7A 1A7GE 1S49A 5EOYA 3CYMA 1LFWA 1PJ5A 3KD3A 3ISDA 3CMAS 3IRXB 4H0PA 3CCLN 1NGFA 4M47A 3P6YC 2BZFA 3UD4P 1NLKL 4DFKA 2GHWA 3J7Z5 3OW2M 5KT5A 3ZDAA 2ZM6K 2GAGC 3OR2B 8ICPA 2ZH4A 2YNHB 3GG0A 1U47A 3W5ZA 5LJ3Y 2BE2A 2MKCA 3PW4A 2IMWP 3S1TA 2VDHA 3CCES 4CJSA 4ANCA 5J2BA 3O9TA 5AKYA 2HNDB 4U7CA 1UW4A 4FWKA 2KLAA 2UUTA 3M6UA 3AJDA 3AU6A 2CADA 4ERDA 4WJ3B 3IMXA 4UB1A 2JV3A 4EZ6A 3MEGA 5IS2A 4CGFA 3EVOA 3W2WA 3HRDD 3HW8A 1R0AA 2MQLA 3MD3A 7ICPA 3KLEB 2HW3A 4PZNA 2I0XA 3MI7X 2LECA 3CMEN 1X8DA 1SXDA 3CJ9A 2Y0BB 4QWAA 5JVHQ 1FD8A 4LQ3A 3VQAA 4FVMA 4NL5A 3AAWB 3B82A 3VGVA 1XHXA 4NO7A 1XMQK 1I3OB 4DV3J 4ENOA 3AY9A 5AQUA 1HPMA 3F2CA 3GL1A 4RQ5A 1CJUA 2WF6A 3CCVN 3VEWA 1MG7A 3ZZ0A 3UKRA 1B4FA 5GTHU 4RNNA 2JC0A 3PO4A 4NA3A 3H0RB 1M6YA 2JWNA 2VD3A 3FRYA 4NLCA 1T9XA 3Q8UA 3KLHB 3QAUA 4MEXA 4CBUA 2C22A 1GOAA 4QPXA 5ADXH 3ORYA 3NVZA 1M90O 4I2BA 3HULA 3ETLA 2AIRB 4NM1A 2V2VA 3M7DA 4M6WB 4HT5A 3ONQA 3Q8KA 1TUUA 4LC9B 1Y97A 3N7SC 1WTFA 4ID5B 1DK2A 3L7OA 5AQIA 2ZIUA 3NGZA 3D7EO 4H5TA 5ETQA 5C25A 3ZZTA 1LB2B 9ICJA 3MAAA 1X3MA 2K1RA 4LSNA 2BJDA 5J2HA 5DG8A 3FQLA 1WKJA 1NB2A 3H7IA 1ZBSA 2MSSA 1YUWA 2JGUA 3L4IA 1G15A 3EUNA 3E0FA 3H5UA 1UWBA 2KP7A 4Q0BB 4PQUA 3EEQA 4M5GA 4KHPF 1RAAB 2V68A 3L7PA 2UXBF 3QFWA 3EGWB 1SZHA 2QWMA 5AQXA 3GMGA 2GJIA 4H4KA 4DL5A 3HXMA 4QS9A 1V97A 1LXNA 4KLJA 1XNQJ 4Z4IA 4QU7A 3WK8A 3IV6A 3F9MA 2DXDA 1HBUA 4C1NI 3DOLB 2F4FA 2E44A 5CCMA 1HNWK 1VHIA 3MMBA 3NH1A 3DDNA 4C8LA 1P27B 1HNVB 3VQ9A 1KOOA 2ASYA 4Q44A 4IDHA 3VF6A 4ZPDA 3VQ8A 3SAFA 3FR0A 2W4PA 3DOKB 3EW9A 2HMPA 1FTRA 3ICLA 4X4SA 3GWCA 4BQZA 2P9NA 4F36A 1UPMB 3RR7A 1RT6B 2M0GB 1Q18A 1VRQC 2P1JA 3HMJG 1Y5IB 4CJRA 1RGIA 3N5FA 3KTQA 3I87A 3PM9A 3OTOJ 4OLOA 2OYQA 1FIQA 3R8YA 1NU4A 3DLGB 3CCRS 1M1HA 1ZQXA 5ALEA 2H3VA 4IQUA 1REVB 1XSNA 3OFHA 1Z6RA 4M63A 1X4CA 4X65J 1Z05A 4ZOHC 3THXB 4ILLA 2VKRA 1NWKA 4UOFA 3CTRA 4M41A 4KI6A 1C0FA 2FMPA 4FJ7A 8ICJA 4M8LA 4ZLJA 3LUYA 1RWWB 1WOPA 3M6GA 1RHQB 4XAKA 1XTZA 1VSHA 4PH5A 3X1LB 3NNAA 4QZHA 3TSQA 3BQ1A 3OL7A 4DR5F 3BSCA 1IVZA 2B21A 5FROA 4PL7A 4DV4F 4O3SA 2JH3A 3MECB 4USWA 4BR7A 3A3OB 4CP5A 4LFAF 4DU7A 1XI1A 4CDIA 3K0JA 1SAZA 3FMWA 1DGSA 2PMWA 4P2XA 2L48A 5DDOC 2YKQA 3HJVA 2XMUA 4M5LA 1T4GA 3IWNC 2H3GX 4V19S 1X5TA 4BRGA 3MEEA 4FPBA 4CD1A 1QUPA 3ULEA 2V34A 4F3MA 2JH1A 4MFBB 2WF7A 4BWMA 1NGGA 2KJWA 4HACB 3TZZA 1PJ6A 2DITA 3D2FB 2YQ3A 2ZKTA 5G0RA 3SQ1A 1Q81T 2AA4A 2KNJA 2I8EA 5KAKA 5B0BA 4C0BA 1RT4B 4K4ZA 1Y00A 5KFMA 1VMBA 3W8GA 4E1NA 1WG5A 3SQGB 2CH6A 2M9KA 4RKUC 4CF2A 3C65A 2PFFB 4U8VA 5I3UB 1S57A 3I32A 2CJ9A 4DU1A 5LM7E 4C1NK 1RAOA 4AHTA 4F5OA 1S48A 3AO4A 3AO1A 2WFAA 1UW9A 1HR0F 2HG4A 2HSTA 4Y2VA 3AFGA 4CFAA 1NNLA 3ZO7A 5AI5A 3UMBA 1C0MA 4O3NA 3I5AA 1X0PA 3G6ES 5CHIA 2QYCA 2CDQA 3T79A 5ETOA 5L9NA 1U2CA 2A1JB 3CJ1A 3LM9A 5SWMA 1RTZA 2J0WA 4CF5A 3C5FA 1LCUA 3WNEA 2H54B 3D7SB 1Z26A 4JD2B 2CZ9A 2NRHA 4C2MA 3GOIA 1DARA 4RR5A 2OELA 5HL7Q 2HEKA 3QT6A 1RBTA 1HBNB 1QZ5A 4K4VA 4ED6A 4RL1A 4EENA 4AXJA 1WEZA 4OJHA 1GLBG 3NVVA 4KHQA 2A18A 3IRXA 2DNMA 3QESA 3FK4A 1R3NA 2YY3A 4PG4A 3OPXA 2QLXA 4ZP8A 3IG1A 2ZBCA 2KXFA 2J5AA 1A5VA 2BANA 4PYDA 1HWIA 3H2UB 2UUCK 1JCFA 2F4VK 3A5LC 5CABA 4H5VA 4FJNA 1QQOA 1YVUA 5AZJA 3PX0A 2ZTCA 5J1EA 5HATA 2NRRA 2RILA 3VAJA 2WSCC 5CB1A 4K43A 2AZ3A 3VQ7A 3F56A 4X2BA 1U8SA 4C4TA 2CNLB 4QIGA 1TVRA 7ICHA 2GX8A 1RCHA 3H1QA 2W6LA 1RDAA 3QO9A 1NZPA 1XSLA 3TUJC 4IDKA 4C8OA 5CD4H 3DC2A 4Q7AA 4EK2A 1O13A 3H5XA 1VRTA 1RWVB 3D1OA 3PSFA 1NJYA 2XMJA 3GR0A 3GR1A 1WBBA 3C5GA 3H46O 1NEEA 1VQPN 4KLQA 5KFXA 3V6KA 3MM6A 4JI0J 4QNLA 1RB0A 2M4MA 3MWBA 3G87A 2MY8A 1TFWA 4YDUA 1KKHA 5K14A 3NKYA 3C1ZA 3GSDA 5CA5A 1IKYA 5BPLA 3WEEB 2KOBA 4CJLA 4A8WA 4CVNE 4J9NA 7ICOA 2AYBA 2RB7A 1JJ2M 2QM1A 3VAFA 3TX8A 1VLYA 4RT2A 4DFPA 1Q82O 5J0QA 4IFEA 2AQ0A 2ZDOA 4O3PA 1FE4A 4DQSA 4C80A 3C8YA 4M2YA 1CI4A 1B7YB 2W7OA 5AQNA 1BQMB 4OJ5A 4H0VB 1RQNA 2F63A 4FJLA 4QIVA 4KGMA 3BH7B 1J53A 1SZPA 1B0XA 4BHQA 4W90B 2WBNA 3NH2A 2F9DA 9ICEA 2LEAA 5ALXA 2CPEA 4OHWA 4NXMJ 4F04B 4J9OA 2CNKB 9ICCA 2I5HA 3VVTA 2A1SA 4QYZJ 1RHUB 1TMJA 2XHBA 3GU0A 4PG6A 2Z1GA 3N4WA 4IO8A 1LAVA 1HWLA 4M3XA 4X66F 3HSGA 4PABA 4QWEA 4OJPA 2CQ1A 3WKDA 5J8YA 2GVDB 2VFTA 3NHGA 2XMAA 3Q2SC 2YWFA 1R8AA 2YX6A 3U3GA 2MHEA 4KHRA 2CQ4A 2P9GA 4QCLA 2L9DA 5CE3A 1UKUA 3D67A 3GYNA 3VEZA 3VZIA 3AO3A 3OYGA 4WFXA 5D46A 5KFYA 5ELZA 1YKWA 3ZT4A 3X3UA 1VQ5S 1ASUA 2GW8A 2BTFA 4PJ0U 2HZCA 4I0WA 1RT6A 2JSXA 4DV7J 2D1KA 1YJWS 1KQSR 2XYGB 1IBKF 5C2GA 3UE2A 2Y0SF 4DI6A 5LMUF 4OKJA 1EWRA 2R42A 4CEBA 4B3TJ 4DF8A 2JZ5A 3M1VB 1OH8A 1N32J 1SI9A 3DI6B 3MUMP 5FIIA 5DGAA 1RT1A 3WXIA 4B1UB 2M52A 2PA8D 2AGOA 8ICSA 1TKDA 1FDNA 2OEMA 3QRRA 2RF2A 2LXIA 1JMTA 2FLNA 5AI0A 1N48A 2XLIA 1BQNA 4A5BA 3EPGA 4XO0A 2O5DA 1S4FA 2I6WA 1JNRB 2EVZA 4MO5A 2RRBA 4FK0A 1ZAWA 4JRPA 4F91B 2DTUA 5ETMA 4H4MA 3WKEA 3KZIU 4B9TA 2QLTA 1KVAA 5F8HA 4CDGA 4DR4J 1ZBTA 5HQLA 2QEXS 2CPIA 4A59A 4FNIA 4F25A 3PIPQ 1U45A 3HLUA 3VF4A 2QWRA 2ZBQA 1HJOA 1N34F 3OHBA 1D0EA 1QM9A 1RAJA 2MUTB 1VSKA 3EX7B 3BQ2A 4QOTA 5L1JA 2KRRA 1Y11A 2ZIVA 5DMRA 4DTPA 5AKZA 5AQWA 8ICOA 2ACYA 3HF5A 3GG4A 3FC4A 3GTYX 1WNEA 3DLEB 3CCMS 3FDSA 3GSIA 4K0KF 3NGTA 2FPLA 2WHEA 2CQBA 1EQYA 4MJKA 4K2XA 3SYZA 2NLXA 5B0DA 2WW4A 4IJAA 4O4RA 4DBQA 3V6JA 1IKWA 3R8EA 2XY6A 2QKQA 4P2HA 4O4GA 2VFRA 2PY5A 1VQYA 4OZ5A 1TTHB 2D69A 2O8EA 2H3QA 2KB2A 3MDFA 1ZPWX 3ISBA 3AODA 4I64A 4JRQA 2PMHA 1MA7A 5GAHP 2E5GA 1B70B 3R6LB 3U7JA 3RMDA 2OANA 3MGJA 1TK5A 1SH3A 2Q3PA 1UEVA 3L4QA 1S9EA 5A8RB 4CFCA 4ED8A 2P8IA 2VG6A 2QWLA 3SUOA 2PFNA 4IOCL 3SI8A 2W41A 3PHTA 2XB2D 1RXOB 2OMLA 3BB5A 2BMBA 3R1LA 8ICZA 4O8UA 1FK9A 3FM9A 1GMVA 1YT3A 3NOGA 5AK3A 1YBAA 2NO4A 1GQEA 2PGCA 2RAQA 4BRCA 3SQ4A 3TACB 1XMOK 2ADBA 4CIOA 2HOEA 4QU6A 2ZC3A 5B0FA 2FE9A 4PUOA 4X4TA 4NLKA 3EKSA 3NGRA 3J80O 4BREA 5C0YA 4CHOA 2P5VA 1O1WA 3LA0A 2H5IB 3O9QA 3PMLA 4M45A 2K3KA 4YG2A 4LF6K 1ELOA 4DR7F 5AI9A 4B3OA 1ACMB 2EKNA 1RXVA 4DV6J 5KQDA 2G8HA 3E01A 3H59A 3MURP 4C98A 5HHHA 4G9BA 1H7WA 3OT9A 1ZQ1C 2BJ7A 5D6GA 1GX5A 2OPRA 4F5NA 2V4JB 2BCRA 3OFFA 2Q0ZX 4LF9K 3DDKA 4AYBF 3QBCA 4N77A 3EDQB 4JI7J 1PVQA 2EG2A 1NJZA 2O4GA 4FLZA 4RW9B 2DGSA 2FJXA 1W25A 3HX0A 1OYEA 4QBUA 2KRBA 3MUTP 5AIAA 3KLGB 2B43A 2IVPA 4DQQA 4USAA 1V38A 5L1KA 2KT2A 3QXGA 2N82B 1S59A 4V19J 2X78A 3RW6A 4OIXA 3QBXA 3IHQB 4FM2A 2IRUA 4R63A 3O1BA 2PMZF 1ZAVA 2E8MA 1ZQWA 3QWPA 4M5DB 1S12A 4B3RF 2IYGA 4UBCA 1XR5A 1NGCA 2QWNA 4DV0F 3BGFA 3NE6A 1QE1A 4Y34A 3DCAA 4BR9A 3Q24A 4CZGA 2MTLA 3LDNA 2VG7B 2A3JA 3H40A 4MKVA 1ESVA 3FZHA 4QWDA 4I56A 4DUZF 2WCXA 1N5XA 1WWVA 4KN4A 4LR8A 1U1NA 4P10A 4NASA 2HQDA 4BRMA 1EKEA