3HT3A

Crystal structure of fragment dna polymerase i from bacillus stearothermophilus v713p mutant bound to g:dctp
Total Genus 208
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
208
sequence length
579
structure length
579
Chain Sequence
KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a high fidelity DNA polymerase bound to a mismatched nucleotide reveals an "ajar" intermediate conformation in the nucleotide selection mechanism.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I, large fragment
total genus 208
structure length 579
sequence length 579
chains with identical sequence D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3ht3A04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3ht3A02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ht3A03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ht3A01
1HQEA 3C2LA 5IIKA 3HT3A 1A76A 2J6SA 4YFUA 3F9KA 4DEZA 3GIIA 2VA2A 5EWGA 1WSEA 3KJVA 3DOLA 5EU7A 2FC0A 5KI6A 4E3SA 4K4GA 4MFAA 3ZT1A 4HTUA 4C8NA 5KFRA 1D8LA 4K4IA 1JMSA 4TUPA 4KB0A 4IFVA 1D9FA 3PW7A 1J9AA 2W42A 1CXUA 3JPOA 4LSLA 4BE1A 2W9BA 1TVAA 4E1MA 4Z0UA 1C1BA 4CJSA 4KLMA 1EP4A 1JL2A 2G8VA 1UT8A 3AO2A 1FXXA 2PI5A 4Y1DA 5C5JA 1KVBA 4M3ZA 2YHAA 4GVMA 1NKEA 1ZQQA 3HJFA 3D0PA 1S1VA 1BI4B 2YNIA 1JLCA 4FW2A 1L5UA 4I2EA 1K6YA 1UWBA 4J9QA 3G6XA 3BQ2A 4UB5A 3C95A 3QERA 1DLOA 4EYHB 4E7JA 4BE0A 1UA1A 3I8DA 8ICGA 4B9LA 4H8KA 1KCFA 1V9PA 2P5OA 1C1AA 4XA5A 4DOBA 4FW1A 3HO1A 8ICWA 4DF8A 3JYTA 5KFTA 4YR3A 2UVUA 2I5JA 1LB2B 4KN7A 4QZIA 2V4RA 4DFPA 4UAYA 4QZAA 1T8EA 5JS1A 3ZT3A 4DTXA 3PVXA 3VQ9A 3OYMA 1CEZA 3AVJA 2ZQBA 3RRGA 9ICQA 5J29A 3NGDA 1SKSA 3OY9A 2OPSA 4CK3A 5T7BA 1SKWA 4M45A 4I28A 2HVHA 3HPGA 4RW4A 3KK2A 4F5OA 1ZQOA 2IAJA 1S9FA 1A5WA 3VQ8A 4KLOA 4Z6EA 4CIFA 5HRPA 4LH5A 3C94A 1YVUA 2HHUA 5IINA 1C0MA 5IIOA 2XY6A 5EOZA 9ICJA 3D45A 3FDSA 3KLIA 3C21A 3NH1A 7ICMA 1CXQA 4M9JA 3LANA 4R64A 4DLEA 8ICOA 1EXQA 1VSKA 1ZQIA 4N56A 4W5NA 4RPXA 3SNNA 1EXNA 3AUOA 4OVLA 2G8KA 1ASVA 4O0JA 3MBYA 4HHTA 1FKOA 3B0XA 2F1JA 1DTQA 3NHGA 1NJXA 3QESA 4QZ8A 4PHAA 2JLEA 3ZD9A 3MXIA 1ZQJA 2BCRA 3BQ0A 3M8SA 1IKVA 2DPJA 3PO5A 4AH9A 2FPKA 4CERA 1REVA 1RBUA 3RMDA 2YV0X 4Q8EA 1X1PA 3SQ1A 2IS3A 4KITB 4AHSA 3LAMA 4P4MA 3UXPA 4I29A 1Y88A 4FJNA 1NJZA 1F21A 3CM5A 3LALA 1TV9A 3PMNA 3TI0A 1A77A 1VRTA 2MUTA 3ZT4A 3NH2A 1EKEA 4CFBA 4KKOA 4O0IA 3LDSA 4B9SA 5J2PA 2WTFA 4DOCA 1S1XA 1RNHA 3AVIA 1QTMA 2PFPA 4PHEA 3E2EA 1KDHA 4Q0BA 3LZIA 4PGXA 2ZTDA 3OYLA 4DS4A 4FJ8A 4KFBA 1X2IA 1IXRA 2IBKA 5SWMA 4QZDA 3DYAA 2OWOA 1TKXA 1NK5A 1FK9A 2NRWA 1S1TA 3GIJA 3HK2A 3O4QA 1U49A 4MF8A 4FJ7A 4I2QA 1S0VA 2DFHA 2AGOA 3DLRA 4PHDA 3HWTA 4DF4A 9ICRA 3Q8KA 3OVNA 4CEAA 3PW4A 4ECQA 7ICIA 2AU0A 4KAZA 3QLHA 1WCNA 4Z4FA 2GBZA 3PW0A 1RPLA 3TANA 4CHPA 4BACA 1RT2A 2EX3A 3V4IA 4EBEA 3V6DA 1DTTA 4FO6A 4X5VA 5DBAA 4C8MA 4IG3A 3H08A 3NH0A 2Y1IA 4KLQA 3MR3A 3QINA 3CYMA 2NUBA 4EYIB 3HL8A 3OYJA 5J2AA 3B6PA 3HVTA 1Z26A 4RQ6A 3H4DA 5KFYA 5KFOA 4F5NA 2AGQA 3IRXA 4QCLA 5IIIA 4FS1A 2JGUA 5KFDA 2J6UA 4CF0A 3P83D 3WNGA 1LW2A 4KHYA 2IOCA 3L3UA 1QHTA 3OSPA 4PGQA 1RXVA 3FYHA 5J0RA 3BJYA 5HP1A 2V9WA 3H8JA 3P5JA 1T4GA 1XHXA 8ICYA 5DQIA 2E4LA 3TQ1A 2FLPA 1BPZA 4UAWA 4B9MA 4UB1A 4DSLA 2AGPA 1SKRA 3I0SA 1JXBA 3V1RA 2HHWA 4KO0A 4JS4A 3MFHA 4LH4A 2G8FA 2FLNA 2IGIA 3Q8QB 3JPSA 2HNZA 4AHCA 4EP4A 1NK9A 5DGBA 4UBBA 3EWAA 3TAGA 4W5TA 4NCAA 2W9BB 1C6VA 2OYQA 4NLZA 5KGXA 3SZ2A 5J0QA 1ZQGA 4DQPA 7ICHA 4PH5A 3KLHA 1S0NA 4EEYA 4FJMA 2BQUA 3C23A 4QZGA 1NK0A 1GOCA 4O5EA 1S6PA 1JX4A 1HYSA 1RDBA 1RT7A 4FJ9A 2IHNA 1HUOA 3PX4A 8ICAA 1TKTA 3NF9A 1VSMA 5KFJA 2ZTEA 4GLXA 9ICHA 2VA3A 1Z00B 4F5PA 3V6HA 2PI4A 3IS9A 5J2BA 3AA2A 7ICJA 5I3UA 2PYJA 5KTQA 5DDYA 3OYNA 4YD1A 1ZBHA 4ICLA 3AA4A 3VQAA 4CEBA 4FS2A 4KRFA 4PQUA 1NKCA 1ZQLA 4I2AA 5KFUA 1JLBA 3JPQA 2A1JB 1BCOA 4J2EA 2Z1IA 5HLFA 3S3OA 2ZUBA 4GW6A 4LY7A 3VN5A 4BXOA 2BPCA 3TAPA 3H8SA 4O3PA 4DL4A 4DTNA 1ZQRA 9ICTA 2FBTA 9ICCA 4DS5A 1ZQKA 4NM1A 4R65A 4HYKA 4M3YA 3DLEA 2JEGA 2NRTA 3OYFA 1TVRA 4KHWA 1ZQVA 5CY4A 1RBVA 3V9UA 3V1OA 4NCBA 3LK9A 3SI6A 4KLDA 4OPKA 1RDAA 1LWCA 4HCBA 2A1SA 2ASDA 4F4YA 5KT3A 2IA6A 2XO7A 4CGHA 3AVAA 1HYVA 5KRSA 2FBXA 3NF6A 3MDAA 2W9MA 1XSNA 2R8JA 1HYZA 3AO4A 4JUZA 1X9SA 3QEVA 5HROA 3K59A 3RAXA 5J2QA 4TURA 4DU4A 3KD1E 4KLTA 2A1JA 5J0PA 3AVLA 3LP1A 1S1WA 5J2CA 4YR0A 1WLJA 4RNNA 2R8KA 4JV0A 7ICGA 3DLGA 1PZNA 3KKSA 5KFWA 3L2RA 4YR2A 3SUOA 1BL3A 2D0CA 5D49A 3VA0A 1BIUA 1TK0A 3TAFA 4FZZA 4ECVA 2IHMA 7ICFA 4CGDA 5KFAA 4RU9A 1BQMA 8ICLA 3ZDCA 8ICVA 3GDXA 5KG6A 3B0YA 4W5QA 1BHLA 3G6YA 1XO1A 9ICPA 4CHZA 1T05A 2B4JA 1RT4A 1UT5A 3AU6A 4RT3A 2IC3A 4KHNA 3SV4A 3QNOA 4M6WA 4MF2A 3M9OB 4RUAA 4DTJA 4O5KA 4CK2A 1ZQZA 3T3FA 4JS5A 4YVZA 5KFKA 5FDLA 4R8UB 1ZQSA 3HXMA 2V4QA 2YKMA 2RKIA 3BQTA 2ETJA 2KZMA 1Y97A 4KLEA 4XQ8A 7ICTA 4ELVA 2ZJ8A 5DB7A 3OYBA 5J2MA 3ETLA 4Q5VA 2KTQA 3CM6A 3C5FA 1Z3EB 4B9UA 5IIMA 4DQQA 3V9SA 1JLGA 1YT3A 4ZTFA 2UVWA 4F5RA 4FCYA 3MFIA 1KLMA 4O3RA 1ZQTA 2F8TA 1CZ9A 4CF2A 4DFMA 4RQ5A 2R8GA 3RJHA 4Q44A 2YNGA 3QETA 3MDCA 3RJJA 4ECZA 3Q8SB 4HVJA 3LPUA 3Q8LA 1K1SA 3K75D 5EWEA 4BDPA 8ICRA 4KV8A 2GWSA 3V81A 4EBCA 4FYDA 1BCMA 2E6LA 5J0WA 1ASUA 1SUQA 1ZBIA 8ICXA 4IR9A 4Z6FA 4ED6A 4RZRA 7ICOA 4IQTA 2AQ4A 2GV9A 3K58A 3S3MA 3LAKA 5J2FA 1DOQA 2BDPA 3Q8MA 2Z1GA 2B6AA 3Q8RB 3LP2A 1S0MA 4KLSA 4ED2A 4M9LA 3NGIA 3S3NA 1NOZA 2VANA 4B8AB 3ITHA 1R0AA 3V6JA 3K4GA 2JZBB 2XCAA 4B08A 5J2JA 3CG7A 4FJKA 3RMAA 3CQ8A 4O5CA 2KFZA 3OS0A 3DRRA 4KMUA 4RW7A 4J9LA 3ISNC 4RUCA 1MQ2A 4F50A 2NRXA 4BDZA 4K8XA 4OLBA 4F4XA 4IKFA 4BGDA 4TUSA 8ICQA 9ICLA 2XY8A 4YNQA 4UQGA 2BANA 3KHHA 2P66A 4G1QA 2BCQA 4Y1CA 4CEZA 4BE2A 3PUFA 5CA7A 4TUQA 4YG2A 3L2QA 2RDIA 3OJSA 4CGGA 3L3VA 3SQ0A 5KFNA 3BQ1A 1BPBA 1S97A 4F92B 3T5LA 4DSFA 4QZHA 2LSNA 4M04A 3VA3A 3ZSQA 1JLFA 7ICKA 1WSGA 4RW6A 4LSNA 8ICEA 1VRUA 3QEPA 4DFJA 1L3VA 4M9HA 3ISBA 1S0OA 3WNHA 2F96A 2YNHA 3RRHA 4LD0A 4OGCA 3K57A 1ZBFA 1J5OA 4O3OA 4O3QA 4P4PA 2ISPA 2C2EA 4O4GA 1RTJA 4C8KA 1QE1A 3UPQA 1BPDA 5DBBA 3BDPA 4FM0A 5KFSA 2FBYA 9ICAA 2G8HA 1JIHA 4DTOA 4Z4EA 4M42A 5KT7A 1VSEA 1ZQBA 2VG5A 4C8OA 3TFRA 4ED0A 1RT3A 5J2NA 1S9GA 2DTUA 5KG7A 4YXJA 3NE6A 2FPLA 2R7YA 1NOYA 5F9NA 2ITGA 7ICPA 4BDYA 1X9WA 2HHQA 4KLFA 7ICNA 4F8RA 4KI6A 2PYLA 2D0BA 4OKJA 4DSJA 4NCGA 2ZE2A 3RB0A 4ID1A 3RB3A 1JXLA 3AV9A 2BHNA 2A1RA 3TABA 2LYHA 1NOMA 1VSJA 2MAXA 8ICNA 1NKBA 1VSDA 4EZ6A 2BKEA 4IQUA 1GOAA 3DMJA 1XHZA 1VK0A 1RTHA 3PNCA 4J9RA 4CHNA 9ICEA 4I2BA 4NYNA 2FPMA 3C1YA 1XSLA 3JPNA 1RZTA 4HUFA 2IDOA 4CJKA 4E0DA 1A5VA 4EBDA 3QO9A 1C1CA 4TQSA 3VQ7A 3QIPA 3C1ZA 4PY5A 4QW9A 3O3HA 4RNOA 1Z25A 7ICQA 1D9DA 3PW2A 5KFCA 9ICWA 4FBTA 5CR0A 3SJJA 5DB9A 2Q3SA 3CFRA 1HNVA 3PX0A 4RQ7A 1TK5A 3HVRA 2C2DA 4KLLA 4Q43A 5DG8A 1NJWA 4QZ9A 1TL3A 1D5AA 2BCVA 8ICTA 2ALZA 2RDJA 4NLNA 3AVGA 3O3FA 4DQRA 1HRHA 3NGYA 5HBMA 5BOMA 5KFZA 4RNMA 7ICSA 5KFGA 4JV1A 4FJ5A 1JKHA 3NTUA 3RJKA 3KLFA 3CFPA 4I2CA 1XU4A 4RQ4A 3V6KA 5J0UA 2PFOA 1ASWA 2YNFA 3HM9A 2B5JA 1WSIA 3SI8A 2Z1HA 3HPHA 4YD2A 2G8WA 5DG7A 1ZQHA 1CUKA 1T03A 4HCCA 3H7IA 1ZQWA 3K5LA 4DL2A 5CWRA 3T5JA 1BPYA 3PV8A 3HP9A 3DRSA 7ICVA 3NCIA 3UIQA 4F2RA 3RB4A 4KHQA 2F8SA 1NK7A 4DSIA 3ORYA 1LWFA 3C2MA 5KT4A 5L9XA 3OYKA 3RMCA 5HP4A 5DKWA 1NJYA 2JZBA 4K8ZA 5KFHA 3T1AA 3PX6A 4DL7A 1TAUA 1XC9A 1RILA 1ZQYA 1KLNA 4B9TA 4ID5A 4FJIA 5BPCA 4CEOA 1BISA 3KTQA 3O4NA 4AHVA 3ZDDA 4RT2A 1KEJA 4IRKA 3A2FA 4IQWA 3RH4A 1RT6A 1QQCA 3OS2A 4EZ9A 3RJEA 1VSIA 2HVIA 1ZQUA 5KRTA 3MABA 2X6SA 3AVCA 4M3UA 3HP6A 3MEDA 4F3TA 2Q0ZX 5J0TA 4GXJA 5L1KA 3M8PA 2ZUCA 1TFRA 5HHHA 1KTQA 1RT5A 1RTIA 2E6MA 1JL1A 4NY8A 4BWMA 4I2DA 5C24A 4CIEA 4DSKA 1JN3A 5EWFA 1LAWA 2P1JA 3B6OA 1W9HA 2BCSA 4DSEA 4OLAA 4QWCA 3ZDEA 3QZ7A 9ICIA 2VG7A 2ASLA 1TL1A 8ICIA 5DGAA 1QS4A 3ZSXA 3SPYA 4W5OA 3KLGA 3L2VA 4Z6DA 3V9ZA 3VQ6A 3AVBA 3CFOA 3RR7A 4ECXA 1KVAA 4CEEA 4LZGA 8ICPA 1ZETA 1QSLA 4ELTA 4DFKA 1MU2A 4DTMA 3QEBZ 4DQIA 4CF1A 4J2AA 3KIOA 4CJRA 7ICUA 4CESA 4ELUA 4E19A 2RN2A 4DTRA 1H38A 1Z00A 4RQ2A 2Y1JA 4IRDA 3GV8B 1VSHA 4O5BA 3VQBA 3ZSWA 4AHUA 4CFDA 1Q9YA 1WSHA 5CZ2A 2QKBA 1VSLA 2QK9A 4FJXA 3QNNA 3PW5A 1JXEA 1U9LA 5CYMA 3OYDA 4FM1A 3G0ZA 3NF7A 4ECWA 4KLGA 4F4ZA 4CJUA 3C6UA 4CJVA 1S1UA 3MEEA 4CGJA 1I3AA 4CEDA 2O4GA 3PR4A 1D8YA 3KK3A 1C0UA 4IRCA 1ZQFA 1YTUA 4OPJA 1YTAA 5F9LA 2UVVA 2PY5A 4J9KA 5KG5A 4BWJA 9ICVA 1WAJA 1TGOA 4KI4A 1G15A 3G10A 4I2HA 3RBDA 3UQ0A 1RBTA 4CE9A 1GOBA 1ZQPA 2KW4A 4DOAA 4KREA 4O44A 2KZ3A 1I39A 4RW8A 4CJ3A 3ZSRA 4FK0A 1ZQNA 4RQ3A 5DQGA 1RDCA 5KFEA 4N47A 3TARA 4KB1A 3KHLA 1QSYA 2ZD1A 3K5NA 3ASMA 3K5OA 5KG0A 2HB5A 5D46A 9ICOA 5J2KA 2KFNA 4TSXA 5KG4A 4CJ5A 1VSFA 3ZT0A 2JEJA 5J2DA 4FLUA 4E1NA 3V7KA 7ICEA 3IM1A 3AVMA 5KFVA 2C22A 4I2PA 5KFPA 3L8BA 3UXOA 2HHVA 9ICXA 4B9NA 4DL3A 1XI1A 5KT2A 3H40A 2QKKA 5FRMA 1RTDA 4F3OA 5KFMA 3RMBA 5KFBA 2OPPA 1SL0A 1LWEA 2XRIA 2P5GA 3VQPA 1WAFA 5DDMA 4Q8FA 2HHXA 3L2UA 4QZEA 1B92A 5KT5A 1B9DA 4GC7A 4IBNA 1NK8A 5K14A 3G6VA 4CHOA 1SL2A 4FJLA 1BGXT 2NRZA 1IH7A 1KFTA 4J2BA 3OSNA 4ECYA 3KHRA 5KG3A 1B22A 4Z4HA 4B8CA 4YMNA 2F1HA 1RBRA 4F93B 5HNKA 3AO5A 4R66A 3HYFA 2DFLA 3DLBA 3KKRA 3ZDBA 2DY4A 2XC9A 3P1GA 1ZJMA 2P6UA 4N5SA 1L3SA 4F2SA 3V9XA 2W8LA 1Q8IA 2IMWP 3OJUA 3GFKB 3ZSVA 5C42A 2YKNA 2GUIA 5J2GA 1WSFA 1B9FA 1LAVA 4M0AA 4M3TA 3U3GA 4JRQA 1U4BA 4FLYA 4MEYA 4JK1A 2VG6A 5J2IA 5DB6A 3HW8A 4JWMA 4F5QA 4DWIA 3VQ5A 3VQQA 3IG1A 3LWMA 4FZYA 4DL6A 2ATLA 2QXFA 1MSWD 4JWNA 3AO1A 2XCPA 3GILA 1ZQDA 4GMJB 4KLJA 3SV3A 5DK5A 4ED1A 1K1QA 3RJFA 1IKWA 4ED7A 4JV2A 2F1IA 3AA3A 2HHTA 4FLZA 8ICCA 3V7JA 3QEWA 3MR6A 3KK1A 4ZH4A 2ISOA 4O3NA 3DOKA 4FLTA 3MGIA 2XGPA 4YXMA 4ZTJA 3TAQA 4CFAA 3LWLA 2D5RA 5J0SA 2ZJAA 4GXKA 4CFCA 4UBCA 4J9MA 3T19A 4Z4GA 4I2FA 4IG0A 1ZBUA 3WNEA 3GQCA 2XY7A 2BQRA 7ICLA 4FVMA 1ZQEA 1UOCA 1ZQMA 3UQ2A 4QW8A 3ZD8A 1EX4A 1ZBLA 4R8UA 4YP3A 1T7PA 5DBCA 4NLGA 4PA1A 4RQ0A 4I7FA 8ICBA 4FXDA 3DI6A 3PY8A 4DG1A 1HUZA 3MR5A 3M9NB 4OJRA 3SPZA 4E7HA 5DB8A 4J9SA 4FLWA 4CCHA 1S5JA 1Q9XA 4M2YA 5IIJA 1XS9D 3EPIA 3JPPA 4Z4CA 4LZDA 3H8WA 4NYFA 2I1QA 5DLGA 1KVCA 3PMLA 4CEQA 3SCXA 1N5YA 3KD5E 2BQ3A 1ZQXA 2ZTCA 1XSPA 4H4OA 2D0AA 2MUTB 3TWHA 3EY1A 3QEAZ 5HMLA 1RYSA 4KLUA 1AROP 4IQVA 3HSTB 5L1JA 3LDAA 2FMPA 3I0RA 3SUPA 4UB3A 1LW0A 3SUNA 3OYGA 4JRPA 1COOA 3U6FA 4QWBA 3MAQA 3IAYA 4UB2A 1X9MA 5E41A 3V7LA 5CZ1A 8ICUA 2DFFA 4AILC 3SQ4A 3N4MB 4KLHA 3WNFA 3RH6A 3NF8A 4YFKA 1DGSA 4AHRA 4ED8A 4IR1A 1L3TA 3LP3A 1ZYQA 2BGGA 3DM2A 2ATQA 2X74A 5CHGA 1EETA 3BGRA 4CHQA 2G8UA 3V72A 3HPOA 3RWUA 2BCUA 4KTZA 5L1LA 1ZJNA 4J2DA 5DQHA 4KPYA 4F91B 4DTUA 4M41A 4E7LA 9ICBA 3DLHA 2FLLA 3OYIA 1BIZA 5HRNA 4Z4IA 2R8HA 3S9HA 9ICSA 2BR0A 5J0XA 4BXOB 1SZPA 3EZ5A 1LV5A 5J1EA 4ED3A 9ICFA 4OKKA 2VWKA 4R63A 5L1IA 3EYZA 3OHBA 8ICFA 1U04A 4RW9A 2W9CB 4CJWA 1S9EA 2FMSA 1HMVA 1WN7A 3L2WA 1T3NA 4OKEA 4CJLA 1RXWA 3MECA 3LPTA 1RYRA 1IG9A 4K4HA 3TAEA 1U45A 1N56A 2PXIA 4DTPA 4I2GA 2KZZA 4WE1A 5JUMA 2YHBA 4RPYA 2P6RA 4MFBA 5HRSA 4UAZA 4J9OA 3N97B 4I2IA 4XRHA 3DLKA 4KHSA 5CP2A 5KFFA 4DLGA 4MFFA 4H4MA 3UXNA 8ICSA 2EHGA 5DLFA 1HQUA 1WSJA 5J0OA 5HRRA 3ZDAA 2P51A 4RQ8A 2C28A 2OZSA 2OPQA 3TR8A 4CJPA 4DMNA 1NK6A 2XHBA 3THVA 3ZSZA 5C25A 3GIKA 1IKXA 3M8QA 1B43A 4FJGA 3VQ4A 1IO2A 1C0TA 4FLVA 5HHIA 4CEFA 3TFSA 2PFNA 4RPZA 4QZBA 3MEGA 2NRVA 3RH5A 4N76A 2XGQA 4KN4A 4GXIA 2X6NA 4F4WA 4N41A 3OHAA 4DTSA 1XWLA 2WOMA 4NLKA 4YCXA 1JLEA 3MGHA 1JLAA 4MFCA 9ICUA 1BQNA 2ZUDA 4CJTA 4FLXA 1BPEA 4KHUA 3LZJA 3QE9Y 2RPIA 3ISCA 4EP5A 2VA8A 3E01A 5KFLA 3O3GA 2HMIA 2DFEA 4W5RA 4FK2A 4FM2A 3AA5X 4E89A 3JPRA 3PR5B 2KQ2A 4MQ3A 2VWJA 1N48A 1IKYA 1A5XA 5CJ7A 3RJIA 4DQSA 4M47A 1TKDA 3EW9A 3ZSOA 4G3IA 4FJHA 4JLHA 3ZSYA 5BOLA 4DL5A 2OA8A 4O9MA 3T5KA 3T5HA 2X78A 1RDDA 3MXMA 3V9WA 4LVSA 1HPZA 1W0HA 1BVSA 4O3SA 4PPXA 2OPRA 5KGWA 1KSPA 3PO4A 2WONA 4DU1A 4P4OA 4QZFA 2RF2A 5D4BA 4FBUA 3AVKA 3NFAA 1N6QA 2PFQA 4RQ1A 1S10A 1J53A 3VQDA 4R5PA 4TQRA 2UVRA 3AVFA 8ICHA 4YN4A 1ITGA 1JLQA 4CIGA 3SQ2A 5KFXA 1ZQCA 4GC6A 3GIMA 4J9PA 4Q45A 3AU2A 4F4KA 1CZBA 2ASJA 2BPFA 2H5XA 5JS2A 5KT6A 4PWDA 4YMMA 1KFSA 4XUSA 4YQWA 4J9NA 3ALYA 5D3GA 3ZCMA 4FZXC 4PUOA 2HNYA 1U47A 4B9VA 3RAQA 3HX0A 1KFDA 1ZQAA 2G8IA 1WNSA 5KFIA 1QLNA 3U3YA 7ICRA 1UA0A 1WCLA 5TZVA 4PGYA 1J54A 1MC8A 3MXJA 4QWAA 3H4BA 4I9LA 3V1QA 3TAMA 3NAEA 1HNIA 2R8IA 4DO9A 1CLQA 4QZCA 4C8LA 1QSSA 3RB6A 2Z1JA 2C2RA 3QEIA 2I9GA 2M9NA 4E7IA 4AHTA 1TK8A 3FFIA 3Q8PB 4ZHRA 1C7YA 1O1WA 3RJGA 4CGIA 3KLEA 4B3OA 4ECTA 3C5GA 5FROA 4KLIA 5CYQA 5J2HA 5FRNA 2PZSA 4CF8A 2FMQA 3NBPA 4QWEA 3OYEA 4MEXA 4IDKA 2HW3A 4E7KA 3QZ8A 4ECSA 4ECUA 4YMOA 3F73A 5DMRA 4HUGA 3KHGA 5SZTA 1S6QA 2W8KA 1FKPA 4HUEA 8ICZA 5KFQA 3GV5B 3VQEA 1TKZA 3OGUA 5CB1A 3RTVA 5J0YA 3VQCA 3JPTA 3AVHA 3RBEA 1KRPA 9ICMA 1SV5A 3M9MB 2KN7A 4CGFA 2OZMA 3OS1A 2O4IA 4XIUA 3NGZA 3IHQB 1S77D 3MR2A 1RT1A 8ICMA 3RR8A 5IILA 1BPXA 2BGWA 9ICGA 4Z6CA 3AO3A 3SUQA 4CJFA 1HJPA 4M9GA 5J2EA 3ISDA 1S76D 1NK4A 2JEIA 4FJJA 2BPGA 2J6TA 3QEXA 2B21A 4NXZA 4UB4A 3M8RA 3EPGA 4KTQA 1HJRA 3OYCA 9ICNA 4CHYA 1L3UA 4FK4A 2ZJ5A 5DG9A 2BE2A 3GV7B 4CJ4A 4QAGA 4CF9A 5KG1A 2FBVA 4CJQA 2W9AA 1TAQA 1IM4A 5KG2A 1SL1A 3ZT2A 5HMMA 2XY5A 2AJQA 1TV6A 4CJEA 3K5MA 4DU3A 4L8RB 4NM2A 8ICKA 3ULDA 1RCHA 4QWDA 1U48A 2HNDA 3NDKA 4M3WA 4IFYA 4RG8A 4M3XA 3SYZA 1UAXA 3LP0A 9ICKA 2HHSA 4CK1A 3C2KA 2DPIA 3AVNA 4PHPA 3OYAA 4QOZB 8ICJA 1BI4A 1MQ3A 4I9QA 4P2HA 3JSMA 4O55A 3K2PA 4CECA 4M6WB 3QIOA 4I2JA 4ECRA 3C6TA 2JEFA 4I27A 4M9NA 5I42A 2AQ0A 3OYHA 4OGEA 1RBSA 4KTWA 2W9CA 3DRPA 4M3RA
chains in the Genus database with same CATH superfamily
2W1BA 3SK3A 3CJ8A 3WKCA 4DV7K 5IIKA 2YWHA 4XH5A 2FQQB 2OHDA 3ILLA 3CF5Q 3IAS9 3DEEA 2VA2A 2G9OA 3A3NB 5EU7A 1Q81O 1OIAA 4FWKA 1X4FA 2QW9A 3MOJB 5IT4A 1HHSA 1IKYB 4GFJA 1VR6A 3ZT1A 2Y0BB 4C8NA 4WKYA 1ZM2A 4HT5A 3T1HK 1CJKA 2W42A 3H8MA 1VIXA 4BE1A 2LQBA 1JLBB 1QQMA 3G82A 2ZBCA 1LWXA 1EP4A 1Q79A 4RL1A 2G8VA 4LUBA 1JI7A 1EQMA 1SIWB 1IJFB 4LF4K 5C5JA 3M2UB 4DV6F 4IG3B 4GVMA 1RT3B 4QPXA 3AD8C 2YNIB 4A8XA 5T7LA 4CI6A 3D0PA 1BI4B 2YNIA 4PXDA 4IOCL 4I2EA 2C2NA 1K6YA 1BUXA 1UHUA 3CJ2A 3QNWB 2Z2MA 3CP8A 1EP4B 2J9DE 3AXKA 4LQ3A 5LSRA 5FIIA 1UA1A 2CG8A 8ICGA 4B9LA 4H8KA 1KCFA 1VQSA 3KJVB 4FW1A 1WB9A 1UKUA 2NYHA 8ICWA 5DZ7A 5KFTA 1UFKA 4RKUC 2UVUA 4USUA 1LWEB 4FL9A 2KG5A 2V4RA 4UAYA 3D6FB 3WK8A 4QZAA 1Y5IB 3W2VA 1T8EA 4L72B 4K2XA 1S72N 2DH8A 4YDDB 3BGUA 1RBOB 4OHVA 1XMQJ 1FJGF 2H9ZA 4AQYJ 1T9YA 1SKWA 4IO9L 2BJEA 3ZX0A 2HVHA 4RW4A 3KK2A 4B3RJ 4DV0J 1S9FA 1A5WA 4CIFA 2YMQA 5HRPA 4QU6A 3UDVA 2HHUA 2ZM6J 2CNKB 1NAQA 1IG8A 3AODA 2XY6A 3D45A 3C21A 1CXQA 5AQOA 4M9JA 5BYSA 2HLTA 1B64A 3FNNA 5LJWA 1HNWJ 3SJHA 1JMTA 4NJ8A 4N56A 3SNNA 3AUOA 1GXTA 4OVLA 3U7JA 2EPIA 4O0JA 5D15A 4UF4A 1QQNA 3B0XA 1YWXA 3HTVA 2M4MA 1OVYA 2XNQA 3R7NB 1DAXA 3R27A 1R43A 4QZ8A 2JLEA 3L7OA 1VBXA 4BRNA 2BCRA 3BQ0A 4C80A 2YKOA 3KZXA 3E0FA 4CBWA 2HK2A 2RDDA 2E5GA 5A8KB 3OXGA 1WOQA 2XMVA 1DGKN 2A41A 4BGBA 3AOCA 1ZZNA 2IS3A 3FRZA 1T0TV 3HULA 1NJZA 1NGFA 2RH3A 2WSEC 2IAJB 1SIJA 2QZ8A 2E20A 1VLBA 2OYYA 4NYZA 3VOVA 5BREA 1XJWB 3VESA 4LF1A 4AF1A 3G6EN 3I5CA 1FJ7A 4U7CA 4O0IA 2GUPA 2I0XA 1E6VA 1JNZB 2WTFA 3HSJA 4MKVA 2LQ8A 3BBFA 2NXEA 1FRMA 1QTMA 2PFPA 2HHHJ 1VQ5S 2ZNYA 3AQOA 4P0QB 3E2EA 1LQ9A 4MJKA 3OYLA 4KX3A 4OJOA 3ZC4A 4QZDA 2DGTA 3DYAA 3H5SA 2OWOA 1TKXA 1FK9A 4OJ5A 1UPPA 1VDVA 2DF4B 1U49A 1UJ6A 4YDXA 5AFUH 3R1XA 3DLRA 2R2RA 1AFIA 3HWTA 2WB1F 2VQFF 3Q8KA 4M5JA 3MM8A 4MKYA 2IDLA 2ZXIA 4JI4K 4DI6A 1R27B 3D6TB 3HOSA 1GT8A 1MN8A 3DV9A 5ALGA 2CAJA 2N4DA 5M1KA 4Z4FA 2V5HG 1NM2A 2H1YA 3V4IA 3TX8A 4EBEA 4CJ7A 1BA0A 2BABA 3OTCA 5H9FJ 2UUAK 5F8HA 3PYFA 4WFAQ 3CYMA 3QINA 2I38A 2CXYA 1IR0A 2MKHA 1NGIA 4WBFA 2HMXA 5J2AA 4X65J 2RKIB 4GKKK 4FZNA 4A57A 1Z26A 1S5LU 3A4TA 2AGQA 1RQNA 5KFYA 5KFOA 3H4DA 4CLTA 4F0HA 4A8OA 5CYMB 3FJ2A 3I5AA 5KFDA 2O8BA 5T7LB 4AQYF 3A5OC 1YUWA 5AZJB 4LFBK 2OEJA 2IOCA 3CDAA 3IR7B 3Q24A 4OJPA 5DO2A 5J0RA 4QJVA 4QZVB 1A0PA 2QWLA 4NEYA 4XPCA 1JJ2M 3FBFA 8ICYA 5DQIA 1Y3JA 2YNGB 4EIAA 1R6VA 3M1VA 2QB0A 4CNZA 3TQ1A 1YRTA 4UAWA 4B9MA 4UB1A 3KFWX 3E8OA 1U09A 2HHWA 4KO0A 3WT0A 4JS4A 5M1PA 2C3OA 2PD1A 4W90B 2FLNA 2DNZA 3LDNA 2OPQB 2HNZA 4I6AA 2IHR1 4B17A 2UUAF 4AHCA 4P73A 5GAGU 2DB1A 4P72A 4P7VA 4DR1F 4BR2A 3O6WA 1HYSB 3FC4A 2Z8QA 4B9QA 4LF8J 2EWHA 1J27A 2FJBB 4OZNA 5KGXA 1GNKA 1L7OA 2H65B 2KVSA 3UDLA 4PH5A 4RPFA 2JH3A 2BQUA 3A3OB 2XULA 5B66U 1DRZA 2G1DA 1JX4A 3PSTA 4C1NI 2ZH6A 2IHNA 1HUOA 3PX4A 4MK8A 3NF9A 2P9LB 3QU9A 1VSMA 5KFJA 3VMFB 4Y0WA 3I9V9 3OBWA 4KPCA 1Z00B 3KLHB 1UWAA 3IS9A 3TKAA 1ED1A 1YSJA 5J2BA 1B7YB 7ICJA 2KHQA 2D69A 4IDHA 1F5CA 4ZP8A 4YD1A 4OYMA 4CEBA 3AA4A 1DHMA 1X5PA 4I2AA 5HMYA 1SBRA 1MWMA 2RP5A 5IWAK 1APSA 3TNVA 4ILRA 3VN5A 1ZS6A 2LQ9A 4Y2UA 4O3PA 5D4NA 4HI1A 4TLQA 2WBRA 2OD4A 2FBTA 3LDLA 2KI2A 2XLKA 4O23A 4HYKA 1KBUA 3DLEA 4BRQA 3K0JA 1WBBA 2JEGA 1UWBB 4IOAQ 5CY4A 1RWWB 4Y00A 4LRCA 1KONA 4KLDA 3GG1A 4JKGA 2OTLS 4CF5A 5ALTA 3CI5A 1LWCA 2A1SA 5K8PA 1PYSB 3BYPA 3LYSA 3VAGA 4BVOA 2XO7A 3X3UA 3AVAA 3MDAA 5GMDA 2R8JA 1QVFR 3A5MC 4IUFA 3O3LA 3QEVA 1RWOB 2W4PA 3K59A 1FXRA 2XMTA 2PMZF 4FXVA 2A1JA 5J0PA 1XNRF 3AVLA 3LP1A 4YR0A 3E9LA 5B0GA 4JKEA 4MDAA 4RNNA 1FNMA 2HFSA 3DLGA 2E1ZA 3LTOA 4EK2A 4L3NA 3IA0A 5E33A 1XTZA 4F7VA 5CR4A 1Y7PA 2A6OA 3CNHA 2YJEA 5D49A 3VA0A 1LOUA 1BIUA 2VU5A 2IHMA 5HATA 4CGDA 2HF3A 4FYWB 4D3GA 4ID8A 1BHLA 1Y11A 1KQSM 3CDWA 1OH5A 4CHZA 5FLXO 2XIDA 1RT4A 3AU6A 2IC3A 1S4FA 2GEMA 5BXIA 2I2YA 1UEKA 4MK7A 5D3GB 2OM6A 4I69A 3T3FA 4EU0A 2W54A 3TEHB 4MMOA 2L5YA 4JKFA 2IM1A 3BQTA 1MLAA 1Y97A 4XQ8A 1DZ5A 1EKSA 2CJBA 4ELVA 2DGOA 3KBBA 4OYOA 3CSKA 1C1CB 3AQEA 4CZEA 2VL1A 4Y65A 2VKZG 2F8LA 2FIUA 4PZVA 4DR5F 1SAZA 4BQZA 2YQEA 5IIMA 3VR1A 4BQLA 2QB1A 3V9SA 3QX7A 3ENQA 1W25A 4PXEA 1KLMA 2F8TA 2HHHK 1OS5A 4RQ5A 4ZPAA 3HFZB 1PBAA 3QETA 3RJJA 1S8OA 4ECZA 3P4UB 3UKUB 3FVYA 1IBKK 3SLCA 3G6ES 3K75D 1S6QB 1V5IB 3V81A 4EBCA 4OYAA 1B0XA 3MEKA 2G13A 1N8RT 3E1YA 1ASUA 5EE9A 2EK1A 3ZTSA 1R89A 2QLWA 1ZTTA 3UR3C 4Z6FA 1YAGA 2E5JA 2R18A 2QRRA 3AY9A 9ATCB 4NYPA 1KEKA 1CBKA 2D9OA 3R5BA 2NLXA 3Q8RB 4U7UD 4OJ6A 4AT1B 4BRCA 3B4DA 4M9LA 5AM4A 3TADC 4B8AB 2P5VA 5L38A 3D1OA 1H6KX 3R2CJ 1NI3A 4FPBA 4C8YA 3JQMA 3PM9A 2QJ3A 3BR8A 1MQ2A 1GEHA 1WJ9A 1XMOF 2MEWA 1WHXA 5CZXA 3NASA 4TUSA 3CIZA 5HO4A 2M88A 4EWTA 4JI0J 4FYYB 1N4LA 3P6YC 2BUPA 4YNQA 2BANA 4Y1CA 4YB1P 1BOTO 3R5GA 2N7YA 2WBNA 1DK3A 3POTA 5AQJA 4BC4A 4CGGA 1HWLA 3H0RB 3IBFB 1HBUA 3SQ0A 5E5NA 4M63C 4C6AA 1L7NA 2GQQA 3TUJC 2HS0A 1O03A 3T5LA 4M5LA 4M04A 3VA3A 3W9JA 2XVTA 4LSNA 3ILOA 4DFJA 2VQFK 2X3DA 2O8CB 3N5BA 2F9DA 3RG6A 2DO0A 2H3GX 3O9SA 3WNHA 2KJWA 2Z7JA 2HBLA 2PFUA 2K2PA 3CMEN 1P1LA 4K43A 3K57A 2ZZMA 3LO3A 1P6TA 4O3OA 3MD1A 1J5OA 5D8HB 1FFGB 5HSPA 1QE1A 1MNEA 4FM0A 3AAQA 2OTLN 1TZ0A 9ICAA 1BWVA 4Z4EA 3W1YC 2CGLA 5KT7A 4G9BA 5ALYA 3BGFA 2VG5A 1U1PA 3BGRB 5L8RC 4C8OA 3W64A 3W8GA 4YHHJ 1S9GA 2DTUA 4A8KA 5KG7A 4MH8A 3UD4P 4U96A 3GG0A 3NVVA 1NOYA 4YY3F 1H2UX 2OMOA 1FEEA 3K9JA 1RFQA 5A76A 4KLFA 3FQKA 3CCTA 2WOMB 1XNQK 4F8RA 2PYLA 2QL9B 2H3IA 4A8SA 2MQQA 1K0TA 1VSJA 3U4LA 2KJ5A 3I5BA 2CUYA 4EZ6A 2DGZA 2BKEA 3DMJA 2HOFA 2JRZA 4C3LA 2DXDA 1P8GA 3EE9A 4P52A 1RTHA 1NRKA 3PNCA 4CHNA 3OW2R 2EAPA 4NYNA 4BRGA 4A2BA 3EX7B 4N8NA 4H5NA 3C15B 3R2DJ 1C1CA 3ZTOA 2ZWHA 3UQSA 3QIPA 1RE1B 4QW9A 1VYAA 3JTPA 4RNOA 1Z25A 4OYXA 4KHPK 1WEZA 3PW2A 9ICWA 2CJYB 1BQMB 3J7AP 3SJJA 5DB9A 3H90A 1RACB 2YY6A 4AXJA 1PKUA 4KLLA 3HJEA 2E29A 3I96A 5DG8A 3T69A 4C7YA 1V3RA 4PQUB 4J91A 4NLDA 3E3XA 1M1GA 2BH1A 2V8HA 3AD7C 4C0HA 4USVA 4AL7A 3VEZA 1L7MA 3A12A 1JNRB 2G1HA 2HFUA 3VERA 4JKAA 4NXMF 3RJKA 1R8HA 4I2CA 2PFOA 1ASWA 1Y64A 2Z1HA 3M8YA 4RR5A 1ZQHA 2PN6A 1U1LA 5EVZA 1ZQWA 1X4GA 3MCOA 4URSA 4DQ8A 3T5JA 3W2WB 2QXLA 1MROA 4DX8H 3PV8A 2A6AA 1UMJA 7ICVA 4WU3A 3UIQA 3IRXB 3LH2S 3C2MA 4GV3A 3RMCA 3TUIC 1RT1B 5DKWA 2QC3A 4A8QA 2JZBA 4M63A 5KFHA 4F0KA 3H5XA 1XC9A 1RILA 1Y5LB 4ID5A 5BPCA 5M1FA 1J97A 4BVPA 1KEJA 3MURP 3A2FA 2FF3B 4DX5A 4IQWA 3OQ2A 4CZLA 1REGX 2HWIA 2EZXA 3O1WA 3B82A 4EZ9A 3RJEA 4WQ5C 4GIBA 1NMNA 3CJ1A 1F3FA 2B5JB 2IJRA 1OY6A 2X6SA 5HQ8A 4FF1A 3RYLA 4M3UA 2R7RA 2QL5B 4Z37A 2CZ4A 3WEEA 1HBUB 4YB6A 4EO6A 3KLGB 5J0TA 1Q7LB 3W9HA 3RZAA 2HKEA 4RNFA 1TFRA 1KTQA 1RT5A 2LBOA 2AMCB 2OJ3A 4BWMA 4P6QA 2KXHA 4V19S 1D9AA 5C24A 2YTCA 2ALYB 2P1JA 3B6OA 3OLAA 1W9HA 4NLPA 4KV8B 4OLAA 2VG7A 2FJEB 2FE9A 4JV5F 3QFPA 3U9DA 3ZSXA 4QIWC 1HBOA 3TACB 3AAWB 3IFRA 2VKRA 2KYXA 2E2OA 1G7CB 1F0MA 3BUZB 3THYB 1JJ2R 3HHLA 1U26A 2HPUA 2BOAA 1QSLA 4B3TK 3QEBZ 4CF1A 1WORA 1OY9A 3VGMA 2UUBF 7ICUA 4CESA 4ELUA 2RN2A 3GFYA 4RQ2A 2Y1JA 4DUYJ 4BS2A 3GV8B 4M5IA 2HBRB 3VQBA 3R5JB 3UD5A 3TTCA 1RQLA 4AHUA 5ETRA 4CO3A 1VSLA 4IEEA 4USAA 1JXEA 4CO5A 4MDBA 3G71S 4F4ZA 3AJ1A 4CJUA 4LF2A 1GX6A 4FP9A 4X66F 3UE5A 1I3AA 3PR4A 3KK3A 4JOUA 1C0UA 4IRCA 3FFKB 2DY1A 1YTUA 3BO2A 2G08A 3G4SS 3RSEB 3PRDA 1AZSA 4MKAA 5A0YB 1F44A 5KG5A 1WAJA 2UXCK 3RW7A 4CE9A 2A18A 3NS7B 3QWUA 1GOBA 3GG4A 3BN7A 5HMZA 2PA8D 4CDGA 4RCHA 2L3MA 4X65F 1V3SA 2VF3A 5KFEA 4N47A 1GFWB 4B02A 1C1BB 1Z1BA 1UVKA 1VQMN 4QS8A 3QUCA 2K1RA 4B1YB 1SCJB 3ASMA 2E1RA 2DY9A 2OD6A 4LBHA 3CJ9A 4A59A 2KP7A 3W2VB 2IOHA 5J2KA 4TSXA 3VCBA 5HQLA 2FLOA 4NLBA 3SDEA 3IM9A 4EFAC 2JEJA 1HBMB 2OPSB 4DR6K 2CYYA 4I2PA 1SPBP 4EX6A 3L8BA 4I2PB 1M1KO 3HRDD 1VQ9S 4UY8O 3B8HA 2XB2D 4DL3A 2K3IA 3H40A 4PG8A 4AE5A 5KFMA 1TL7B 2W2QP 3QT6A 1SL0A 2HCFA 2XRIA 2BEFA 5J1NA 4DZ6A 4OJ1A 4ILGB 5DDMA 4Q8FA 2HHXA 4ES1A 4QZEA 3CMQA 1SV4A 5KT5A 4JAXA 1B9DA 4GC7A 3M2UA 4KHMA 5DDRC 5K14A 3G6VA 1EZZB 1SL2A 2R7WA 4TNOA 2BM1A 2MZRA 3LF0A 2C1EB 2CNLB 2IVOA 2NRZA 2BM0A 2IFXA 2VG5B 4BUGA 1UZHA 4LFCF 2GC8A 4YY3K 4WFXA 1QAXA 3ONNA 2IYIA 3PNIA 1RQ0A 4WYBA 1D0EA 4ETXA 1GH8A 2FZKB 4A4JA 3HHLC 3QFHA 3D1QA 2VCPA 2DFLA 1Z1ZA 5M2UA 2Y1LB 3PDNA 4NMXA 2GELA 1NNEA 1YJWS 3C46A 3BSCA 1Q86T 5FPMA 5HQMA 4MIAA 4O8KA 2CPEA 1NEEA 1UL3A 1CVJA 3IP0A 4ZVTB 1Q8IA 3AY0A 3MEDB 1RBLA 4HTJA 2GUIA 2W03A 1NNDA 1R8BA 5J2GA 4LF9K 1T03B 1J6ZA 4CLKA 2VPZB 5LL6d 1RT4B 2YCHA 1FA0A 4JK1A 5J2IA 3PSIA 4JWMA 1RT5B 4DWIA 3IG1A 1LWFB 3GPAA 3MPUB 4FZYA 4DL6A 1XO0A 3GJRB 2V8GA 1WC0A 1RI7A 3GILA 4KLJA 3SV3A 3G96A 2LEBA 3U02A 2DH9A 4ED7A 1RABB 5DDPC 1ZM3A 4BRLA 3RGIA 2NYVA 3AA3A 2HHTA 1F6TA 1F9EB 2J5AA 1WDTA 3HSCA 2YX6A 5EDWA 4H0XB 4ZH4A 3SMVA 3LM9A 4ZMMA 2CPHA 2RHSB 2IM2A 4O3NA 2AHOB 1CJUB 4JD2A 3TAQA 1HPMA 3LWLA 1KDNA 4CFCA 4MYUA 1FK9B 3U1MA 3DDIA 3T19A 4I2FA 3IM8A 3FGUA 1OH6A 5L39A 3GQCA 3HHLB 4FVMA 1IG6A 1QD1A 3HKZD 1UOCA 1LEOA 4QW8A 4OQJA 2QO3A 1Q5VA 2KVCA 4R8UA 2GVDB 3CJSA 3NOGA 3AT1B 1T7PA 5DBCA 5HROB 4NLGA 4PA1A 2E1EA 8ICBA 4I7FA 3NVKA 1KN5A 4NA1A 5E0OA 3RFAA 3PY8A 4YOYA 4DG1A 4H54A 4OJRA 3RF9A 1ESVA 1T05B 1D1UA 2R2SA 3OPKA 2C2OB 1S1UB 2AEMA 2Z58B 4IFYB 4LZDA 4NYFA 5DLGA 1KVCA 3SCXA 4LF5F 4H4OA 3CCQS 2PA3A 3KLIB 2V2QA 3PEHA 3JQKA 4E98A 1RYSA 1KHWA 3F2KA 3HSTB 2Q0RA 3VV2B 3QU5A 1U1NA 2UU9F 4UB3A 1LW0A 1RTJB 1GLCG 3OYGA 3R9KA 3C14B 4QWBA 2MGZA 3IAYA 2ZH9A 4OHWA 2NYIA 2ZOMA 3QJPA 3V7LA 1P90A 1EWRA 4JI1K 3SQ4A 4AILC 2ASYA 1DGJA 1TFWA 3WNFA 3N4PA 4F3QA 4OI2A 1UVLA 4K41A 1BHNA 3CCLN 3V81B 5KQDA 4NI2A 4XH1A 3I87A 1IBLJ 4CO0A 3GZ7A 2QWNA 1S49A 1GLFO 4AHRA 5AKIA 4AYBF 4AXIA 3LP3A 3DM2A 3SQIA 3FEZA 3QGGA 3CCVS 3CDBA 1ZA2B 4K0KK 5ALVA 2B4OA 3RWUA 3QU7A 5AHXA 1ZJNA 4OZJA 4J2DA 5ITHA 4KPYA 4Y0FA 4H0OA 3FMBA 1IN0A 4H5VA 3DLHA 4KMOB 1XMBA 3OYIA 1TUYA 4Z4IA 4G65A 2BJ7A 4BXOB 4DR3J 1LV5A 4ED3A 1TELA 1KQFB 9ICFA 3CJ0A 4OKKA 4LF5K 1YIJN 1N5YB 2NZ4A 1HKBA 2F63A 4ZVEA 1YJVA 4OI6A 2O67A 2DH7A 4KT0C 2QYCA 1RK8A 1RYRA 3TO8A 3W65A 4BRMA 3BKUA 3U27A 4WP9A 4WFBQ 4I2IA 4J8FA 3DU5A 1GXUA 3G8SA 2HBKA 3QUBA 2DBBA 2QA1A 5CP2A 5KFFA 2FY8A 3G71N 2CRLA 1RWKB 3H7HB 1D8ZA 4USHA 1KAZA 3QPIA 2QEXN 2IJFA 2RQKA 2FHMA 2QYGA 1M90T 2H51B 1KVKA 3ZSZA 1P9QC 1IKXA 3M8QA 4OI0A 4JV5K 4D3HA 5EGYA 3ZZ0A 1HKAA 3M7DA 2DISA 4F71A 2EDUA 5KPZA 4RPZA 4QZBA 2MTLA 4KN4A 4URGA 2X6NA 2HQGA 2UXDF 4UATA 3CD7A 2JX2A 2WOMA 2IM0A 4HWIA 4YOXA 2CWXA 4CI0B 4M5DA 2CQCA 1JLAA 2QA4G 4GKJJ 1RTDB 1WUDA 4WCEL 5JJBA 4ES3A 4PXCA 1K73T 2QWMA 2VA8A 2NLWA 5KFLA 2WB1C 5EE3A 3O3GA 2HMIA 4W5RA 4FK2A 2KU7A 3JPRA 4ZKAA 2KQ2A 2B9WA 5B08A 4MQ3A 2VWJA 1UVMA 1ZM9A 2HZAA 1VQ9N 5CJ7A 7FD1A 1JUDA 3RJIA 2W7AA 2W2NP 3EW9A 1AUSL 2K8AA 1TUWA 4ZCMA 4KIAA 3ZSOA 4FJHA 1N32K 1CS4A 1FCAA 2HFNA 4DL5A 2WF5A 2KE7A 4JKGB 2DGXA 4O9MA 1RDDA 3IG1B 1HPZA 4P71A 2OPRA 4O3SA 2J7UA 4CBXA 2AYEA 3NCQA 4G1QB 3GTYX 1VC5A 2WF9A 3KLVA 1ULRA 3AVKA 5D4BA 1S10A 2A5XA 4F36A 1VJQA 3AVFA 1QZ6A 1OYEA 4I6MB 2LXIA 4U67L 1XK8A 5IM0B 3NUQA 2YKMB 1RP5A 2WAQC 5ALUA 5DETA 4F4KA 3WIVA 1IBKJ 2GS8A 4IH6A 3H45C 4YQWA 4LT6A 2D3UA 1Q8BA 3QBWA 2Q2RA 2DGUA 3UD3P 2HNYA 3SSQA 3NVMA 2RU3A 2JLGA 4JD2B 1KFDA 1U0HA 4TU7A 1OYDA 1WNSA 1UEUA 3U3YA 2CQGA 2DKZA 3JQJA 3GFHA 2ZIUB 5JMVA 1MC8A 3H4BA 1S1XB 1WTFA 3ISND 1HD1A 5H9EK 3AQFA 3MF5A 2CPYA 1Q82T 3UVJB 4Y2QA 1P1TA 1QSSA 3IG8A 3FZLA 3ENOA 4US9A 2LXUA 2GX9A 3QEIA 4AHTA 4KY3A 3FMWA 1ZBTA 2E5HA 2JVRA 1C7YA 3J7YP 3KLEA 1QDUB 5FROA 4IKAA 2FHJD 2GJ2A 3FCVA 5AQKA 5IT9O 2Z2ZA 4PG5A 3BS5A 3CCVN 1K8KA 2HW3A 2WHOA 2G5HB 4ECUA 4YMOA 3QYYA 3F73A 1S6QA 5SZTA 2KL8A 1S9EB 1FKPA 2CNOB 3O2IA 1Z05A 2KKHA 4B3MK 2EK6A 3OGUA 3DRSB 3VQCA 1T9TA 1YHQS 9ICMA 1UEVA 2LMIA 4KGXB 1FE4A 1F60B 3M9MB 3D2SA 3OS1A 3NGZA 1WC6A 3H0MB 3MR2A 4BRKA 3WBZA 3MHYA 1BPXA 2BGWA 2B0CA 9ICGA 2A3JA 1HW9A 5AQVA 2CPRA 2VGMA 2WSCC 2HOQA 4WCEQ 2JEIA 4HTLA 2RHQB 4H5TA 4CZIA 2DNLA 1LXNA 3I56S 3OYCA 1KQKA 3DGPB 2O8BB 1NHKL 1W2BM 4GVBB 4NL5A 2CH6A 1AW0A 1S7IA 3UE2A 5CQGA 5KG2A 1SL1A 4BR7A 1I94F 3WC0A 1PC5A 2XZTB 2V9KA 1U48A 4HDGA 4USMA 3CCMN 2VH7A 4IFYA 1NCLA 4RG8A 3LP0A 4MIWA 1N8RO 3MM8B 5L9NA 2W7PA 9ICKA 2HHSA 3C2KA 4A61A 5ALWA 2HI0A 2XS2A 1QTNB 4LFBF 2P9NB 4OCZA 1MQ3A 3VGVA 3CCEN 3W0LA 3T1HF 4C23A 1CJTB 1AUDA 2DPNA 4DV1K 2WTUA 1NO8A 4M6WB 3QIOA 3KOOA 1N52B 2HIYA 1MMDA 2KNJA 2AQ0A 1NU4A 3R9LA 2F8HA 2BJDA 1JLEB 4OGEA 1SV0C 2W9CA 1CJVA 3GMGA 4M3RA 3VHQA 1ZAVA 1NBWA 2DNHA 2I5JB 4JI2F 3WXKA 2HDOA 2LM1A 3F9KA 2RS2A 5EWGA 1R6YA 3DOLA 1FKAF 2LECA 3VAKA 2FC0A 4E3SA 2AH5A 2K7KA 3BBCA 1EJ7L 3RU0A 5LY3A 1ILYA 3BSOA 1FDBA 4Y2TA 1D8LA 4KB0A 4CLYA 4G1IA 2A0FB 1PJ7A 3AA8A 1CXUA 2Q4TA 4XTTA 4KGKA 4Z0UA 1ZXIA 4BJQA 1JL2A 4I6MA 1UT8A 4PKHA 4CZJA 3FBEA 2PI5A 1FXXA 2O01C 1KVBA 4M3ZA 5D4OA 3FZBA 2ACYA 3HJFA 4FZLA 2HRTA 4I6YA 2KVQE 3M6ZA 4A46A 1JLCA 2DQNB 4FW2A 4NXMK 1L5UA 1T9XA 2K4HA 2OO4A 4CNYA 4ZPDA 4B3TJ 1VQLN 3BQ2A 4UB5A 2QLFB 3SFUA 2KXFA 1A7GE 1DLOA 3C95A 1YJ9N 4EYHB 1IV0A 4BE0A 5AKLA 2ITMA 3BEGB 2XWYA 4OZ5A 2LA6A 3KZIU 3CPWR 4XA5A 1U6BA 1CSJA 1NPPA 4YR3A 1H73A 3TAMB 5LXYA 1HNZF 2PMZD 4PAAA 2I5JA 1KQGB 3MX5A 4JI8K 1N54B 1FWLA 3AAPA 2XZWA 5IWAF 5AK5A 4UW2A 3LDQA 3ZT3A 3K17A 2RUGA 4DTXA 3M2RA 1JCFA 3CCJS 1Q7YO 3BZCA 1CEZA 2ZQBA 3AVJA 9ICQA 1SKSA 4CK3A 3R5AA 2HNZB 2F4VK 4I28A 3HPGA 2CPJA 2WZ1A 5F8GA 4AD6A 1PK3A 3MN9A 3OHRA 2C3MA 3NMRA 3C94A 4UT4A 3H3OB 2IRYA 5IINA 3H6EA 4DCOB 1KNZA 9ICJA 2UXBK 2BMBA 3VGSA 4LFAF 1VRTB 3G25A 1WTBA 3WU2U 2CVIA 4LR7A 4DN9A 3HI0A 4ITSA 1FXLA 4GKKF 3ZI4A 3RAMA 1VSKA 2GX8A 2P9SB 4MK9A 4W5NA 4DV2J 4RPXA 3F41A 2DHXA 1EXNA 1M5PC 2RHFA 3CT9A 1ASVA 3CJ5A 1FKOA 4YOUA 2MZ1A 4FPAA 2F7VA 1LKZA 4PG6A 1NJXA 2GO9A 3CJBA 3BN4A 1XMQK 4PHAA 1SH2A 1Z2LA 2IVNA 4FSVA 2VG6B 3C66A 3Q0AA 3PO5A 1U0HB 2OGUA 1TKXB 1RTZA 3PIOQ 3S7RA 3KKAA 1RBUA 3RMDA 3PZPA 4BHQA 5G4DA 3SMSA 4P9SA 4Y2JA 1KAYA 4OZ3A 3S01A 1OH8A 1B0PA 4RO0A 3DOKB 2ZHBA 3UXPA 3V4IB 4RNHA 3NXZA 1NXIA 4XAKA 3IV6A 2NUHA 4PR6A 1FVSA 1JLQB 4M5HA 2JL9A 1QH9A 5D78A 2N1RA 4RWXA 4M7YA 3PLAA 1VRTA 3H0PA 3H0LB 2XM3A 1YJTA 2MUTA 2XSJB 3ZT4A 3NH2A 4MKBA 5C15A 4B3OB 3LP2B 4DOCA 1S1XA 2MZJA 1TL5A 2B4PA 3EO3A 2HBQB 3Q8UA 4KHPJ 4FYXB 4Q0BA 1A6SA 2M5YA 3LZIA 4PGXA 2F1FA 1ZD2P 3MTJA 2IMOA 4Y2YA 4KFBA 1X2IA 1P9YA 2A6MA 1NK5A 3PG9A 3N4QA 1KBRA 2NRWA 2X1BA 3HK2A 5GAHI 4ZP6A 2G0AA 5GADU 2DFHA 2VUGA 2AGOA 3CJQA 4RX6A 4V19J 1V6HA 5AI9A 4DF4A 9ICRA 4QNLA 3OVNA 3DYAB 5JICA 3PW4A 5ALKA 1XNQF 7ICIA 2DK2A 2AU0A 4CD1A 1BNPA 3LGNA 3BSNA 5KPTA 4KAZA 3NGRA 5ETKA 1WC3A 3IBPA 1UFLA 2GBZA 3TANA 1I94J 3V6DA 4PYAA 2KD1A 4GY2B 2W55A 1IBLF 4C8MA 2MKCA 3BF3A 3H08A 3VEYA 4JI3J 2XI9A 3QGIA 3GSDA 2G2YA 4C2MA 3B6PA 3AB2B 3O8WA 3UCGA 4RQ6A 4F5NA 4O0NA 2ZJRL 5IIIA 2EZZA 2LHTA 1RZMA 2BKOA 2J6UA 3OV7A 3WNGA 4IJNA 1F1BB 4KHYA 1QHTA 4QS9A 2HZVA 5AKGA 4PGQA 1RXVA 3THXB 1PVPA 1VQLS 3H98A 3FYHA 5HP1A 2V9WA 5ALLA 3CCMS 2FXUA 1RM6C 4ATNA 4RBVA 2GCFA 4M8LA 5F0XA 5F41A 3TA2A 1XHXA 2J0XA 4DDFA 1CJVB 2DL0A 3GCWP 4HH0A 1WG4A 4BRPA 4DSLA 3I82A 3CCES 4LH4A 2G8FA 1RWXB 2IGIA 1RDFA 8RUCA 3WK5A 1P27B 2DR9A 3N9UC 2GVZB 4EP4A 1NK9A 1NG9A 5HR7A 1JALA 4UBBA 2QB0B 2RS8A 3EWAA 3W7BA 4DCHA 1TUUA 5AJ3F 2B4VA 2DHHA 2FVRA 5IV3A 4ZJOA 2NQPA 5E2QA 3MAAB 1C6VA 2FVSA 3F5EA 3CHWA 5B0EA 3SQGA 5J0QA 1ZQGA 7ICHA 4DHYA 3DHWC 1S0NA 2MQOA 4EEYA 2F8EX 5A8WA 1W26A 4QZGA 1NK0A 3IWXA 3BO3A 4BG8A 3EZUA 4LRDA 4O5EA 1TMJA 1UZDA 1U0SA 2WVFA 4DUYK 4ED4A 3OD2A 3KVGA 5A6WA 4GLXA 9ICHA 2M0GB 1K9MO 3KMQA 2VA3A 1KC8T 2NZCA 1RG6A 4F5PA 3Q86A 2E1FA 2DRBA 2PI4A 4HT7A 1SJRA 5AQPA 2PFDA 3E9OA 2LKZA 1WSVA 2PYJA 5CH7B 5KTQA 3VALA 3OYNA 3C16A 2GZOA 3C16B 4KRFA 3E9PA 1FWPA 3D0IE 5C2GA 2CQBA 1IBMF 2CQDA 3CGIA 2A3VA 4Z94A 2G0JA 2DHSA 1PAUB 1BCOA 4ZLNA 2YX8A 3CEDA 3TUPA 3S3OA 4BXOA 2GO7A 3TAPA 4DHVA 3H8SA 4DL4A 4FZVA 2LYBA 3QJJA 2KHDA 5C7PA 4NA3A 3TJ9A 1D8BA 3BS5B 2F2AB 3OYFA 3CD5A 4KHWA 4WYWA 1RBVA 4WJBA 5ALMA 3L0QA 2ZOFA 1C0GA 2MJUA 3J80Y 2X51A 4EUVA 5F0WA 2KM8B 4XK8C 4JKBA 1A6LA 5KT3A 4OLPA 5KRSA 5HANA 5EE0A 3CTRA 4JI7F 2W9MA 2V6AA 1UJ4A 2P9SA 3UKRB 2ZG6A 4I64A 5J2NB 4JUZA 1B7FA 1FNOA 3RAXA 4YOVA 4TURA 5J2QB 4DU4A 2ZBIA 1Z4OA 4BRDA 1S1WA 2K4PA 1WLJA 3EJMA 4OI4A 5IWAJ 4QR0A 7ICGA 1FTCA 5AZIB 4BR9A 3KKSA 1X6IA 3R6LB 1FNXH 2VONA 2KT2A 1FO1A 5GAEP 1VQKN 3TAFA 4FZZA 4ECVA 1PVRA 7ICFA 4DPTA 1CULA 8ICLA 8ICVA 3B0YA 4W5QA 3H25A 4FN5A 4X64F 3G6YA 3DLGB 1GLJO 5H1SV 5GIPA 3IG5A 1WACA 3D54A 3QNOA 4CO2A 2VHGA 2SXLA 3MM9A 4O5KA 2NCKL 1BG3A 2HQ3A 4IH7A 3K7RA 4X4RA 2MGZB 3K9KA 1VJWA 5FDLA 4R8UB 1ZQSA 1XC3A 2POKA 4TY8B 2V4QA 3NGTA 1Y4ZB 1X4EA 2ETJA 1ZD5A 2MMYA 5KNIA 3GZFA 1TFYA 3G8TA 3OR1A 5HMXA 5ETMA 3T1YJ 1N0UA 1UTAA 1F5SA 3ETLA 4O3MA 2V0NA 3NAIA 2V8DA 4UARA 5IC4B 2KTQA 1CJUA 1Z3EB 3VEVA 4DQQA 5AE3A 1NWKA 2F40A 4O3RA 2DNQA 2KT3A 5AZIA 1CZ9A 1SV5B 3DLLL 1RHMB 4DR5J 5AQFA 4M94A 3WXIA 3EGVA 4NA2A 3CD6N 2WVCA 2AYBA 4HVJA 2FJDB 3Q8LA 1CRXA 3POTB 1SXDA 1YBTA 5E3PA 2FF6A 5ALPA 1DBDA 2E6LA 1EIYB 5J0WA 3EKUA 1A0OB 2FJ6A 1SUQA 1RDRA 3MMCA 5SUHA 2KJ8A 4IR9A 1O51A 4RZRA 3QYPA 5B8HA 3TP2A 4DPWA 2BOPA 4CNQA 1FX2A 4DR4F 3P8BB 2XI2A 3LAKA 2G5IB 1DOQA 2BDPA 2DJWA 3Q8MA 3PKMA 1KP6A 2RLTA 1L7PA 3LP2A 1S0MA 3S3NA 2DD8S 5GAGI 2VANA 2M8HA 5DJBA 4CQ1A 2IVPA 1HHQA 3ITHA 3UN3A 4MHVA 2JZBB 4LF6J 2P9NA 3RMAA 1IKVB 1JLGB 3CQ8A 5LMUJ 4M1KA 3DRRA 3NS6A 4KMUA 4RW7A 3F56A 2JJ4D 4QYRA 1BDGA 1T11A 2NRXA 4BDZA 2Z4PA 2Y8WA 2FVPA 4W92B 3BDEA 4PXBA 4OLBA 3MMJA 1YVNA 3MM5B 4IKFA 3G82B 3DGPA 4X66K 1ZD4A 2AYMA 4BGDA 9ICLA 2DTJA 1Y3KA 2V52B 1IKXB 2BCQA 3HBTA 3EUNA 3OT9A 4CYUA 2EVZA 3L2QA 2H5IB 3AN1A 2RDIA 3OJSA 2YWWA 3M7VA 1UVJA 3BQ1A 1BPBA 2P6TA 4FWSA 2R7OA 1VK3A 3D7SB 1ZOTA 3ZSQA 5BPMA 3D4JA 5G0RA 3S6EA 1WSGA 1L3VA 2O8EA 4M9HA 3JSBA 2YNHA 1WEYA 3RRHA 3N28A 2EKYA 4LD0A 4OGCA 2GA7A 1WOPA 2ZHAA 2MKJA 3VETA 1RTJA 5AXMA 2FHOB 2QEXS 1WUUA 1BPDA 2VQEK 5KFSA 1SB6A 1WC1A 3J80O 1NGAA 2UXCJ 1SVDA 5AI5A 2MJNA 3FC9A 4MAKA 5IV4A 3WKBA 4ED0A 2M8DB 4C8ZA 4CLFA 3PJXA 4YXJA 1DY3A 3NE6A 2JC1A 4GMKA 2R7YA 1QUPA 5F9NA 1S72S 3J8AA 2ITGA 3MPYA 1KQQA 7ICNA 1HR0J 3FBCA 2QI2A 4KI6A 4W98A 2D3O1 1U2FA 4UW9A 3J7YI 3RB0A 4ID1A 3RB3A 4DR7K 1TQLA 2BHNA 3GE1A 3TABA 3AEVA 5HL7Q 1JCGA 1PK1A 1S1VB 2GTDA 2LYHA 3M6GA 4JI4J 8ICNA 1Z4NA 1VSDA 4CF4A 1TKTB 4QJFB 3FSIA 2ZZNA 1GOAA 1FKOB 3HT0A 1VQ4S 2FZCB 2Q79A 4AQYK 1F5AA 3FAHA 1U6FA 4TY8A 4J9RA 2YBVA 4I2BA 2FPMA 2DHGA 3HVWA 2KV2A 2YXLA 1RZTA 2IDOA 2Y9HA 1YRUA 2PE8A 4TQSA 3VQ7A 3WZ0A 3OBYA 1SQEA 1FXDA 1OH7A 4ZLPA 4LF5J 4JI5K 1JJHA 1X40A 1VAZA 3DI6B 2Q3SA 2LQJA 3MPDA 3OR2B 2FPHX 3KWMA 3HCXA 2ADBA 1R0BG 2QA4S 4DV0F 1NJWA 4QZ9A 2BCVA 2ALZA 2BTFA 2E9ZA 1H2VZ 1NNLA 3O3FA 4DQRA 4NL9A 5HBMA 2HEKA 5BOMA 4DG1B 5KFZA 2CWKA 7ICSA 1HIWA 5FDLB 3NTUA 2RQ4A 2WFAA 5J2PB 1X5OA 2HBZB 4WK3A 3FKBA 3V6KA 5J0UA 2YNFA 3HM9A 4C3KA 2YKQA 1WSIA 3SI8A 2DNRA 3R5DA 4ZIWA 3HPHA 5DG7A 4CDIA 1DLOB 1T03A 1WNEA 2RAQA 4DL2A 1BPYA 1RHRB 3NCIA 1RDWX 3IXQA 4GO5X 5FJ4A 2CXEA 2VPWB 4F2RA 3RB4A 1OPIA 2YKAA 1MWYA 5L9XA 3SSSA 3WQPA 1SIZA 4DBQA 1VQKS 3T1AA 1N34F 5ALHA 4JI5F 4KQZA 4QYZJ 1ZQYA 1KLNA 4FJIA 2F3NA 1E4FT 3KTQA 5ALJA 5I3UB 4AHVA 3ZDDA 4KJIA 2FTRA 3CJ4A 1M5VC 1H0HB 1PILA 2E7XA 5JVHQ 3OS2A 4WP8A 2GFFA 4NLYA 2BE7D 2OSQA 1W97L 3LP0B 4GNIA 2KEYA 3VF0B 3NS1A 3WK7A 4A8FA 2BE9B 4A47A 1NGBA 3SENA 3MDFA 3MEDA 3VGLA 1ZXOA 1D4XA 2FC8A 4F3TA 3MD3A 1DT9A 3CJCA 5L1KA 3M8PA 3M32A 2ZUCA 3CMAN 1LKYB 5HHHA 2E1PA 2E5SA 4C97A 1RTIA 4ALZA 3D2FA 3O5TB 2LYAA 2E6MA 2J8AA 4CO1A 1JL1A 4NY8A 1VRUB 1WI8A 2C42A 4RW6B 4K7QA 5AQLA 4CIEA 1JN3A 5EWFA 3SXLA 2BCSA 4BX9C 3GR1A 4JHDA 2QGFB 1HNXF 3H2VE 2ASLA 8ICIA 1QS4A 4I4BA 1IKWB 2F77X 3AGKA 3EDQB 3M6KA 1PBUA 3NCRA 3OFEA 4LFAJ 3CO9A 3VQ6A 1TKZB 4FWNA 3PKYA 3CFOA 4HHHA 1LW0B 4LZGA 3BPSP 3ZTPA 1MU2B 5EX0A 4LF4F 4ELTA 4DTMA 2VOPA 3KYLA 1T9WA 3KIOA 4DKWA 5AICA 3CMES 2B51A 1YBUA 4E19A 3T79A 3UWTA 4B3SF 2X1GA 4JI8F 2BJ9A 4TU9A 2EFOA 5AKKA 2L9DA 3CIPA 1WF2A 1B0TA 3ZNUA 3MMBA 2AJ2A 1Q9YA 1L8OA 2B56A 2QK9A 2AIRB 2FGOA 4EENA 2UUBK 1U9LA 2FHJA 5LXRA 3OYDA 1QCKA 4LF7F 2R9LA 3AOBA 3TJAA 2UV8A 1WYGA 1NDPA 2ZH7A 3W66A 2RD5C 5AT1B 4CJVA 1V9OA 3TQEA 3QXGA 2O4GA 2HWHA 5GAEI 1V4TA 1D8YA 4P2XA 3O9RA 4Y2AA 1UVIA 2UVVA 3AJDA 4K25A 1S4EA 2JFDA 3ZNJ1 2X3GA 1RBTA 1SJ3P 4KREA 1SC4B 5CAAA 2I7NA 2EH9A 4O44A 2CJ9A 1C0FA 4RW8A 4LF8F 4RQ3A 2QFIA 2YHXA 3KZBA 2VJ4A 4YORA 2E1MC 3KHLA 1AZSB 1X42A 4AL6A 3H42A 4C11B 4X4QA 2UXCF 2Q36A 2E1CA 5ETSA 2EFNA 2HB5A 2AJ1A 5D46A 5LMNF 2EFVA 4CM0A 4JP8A 3G9CA 4FLUA 1VBKA 2CNNB 4E1NA 2KHCA 3IM1A 3L4IA 2C22A 1U24A 3DGVA 3CC2N 3P96A 2HHVA 4FWQA 2IM3A 1XI1A 1LCUA 2QA4N 4ZPCA 4JYAJ 2QKKA 1G6BA 5FRMA 3SCIE 2OPPB 1RAGB 1R8CA 3A5LC 2P5GA 1WAFA 1MA9B 4U7UK 3L2UA 4GV6A 2R7QA 1WWHA 1UFWA 4IBNA 2G2OA 3PYEA 2W6KA 2I9SA 1BGXT 3VAFA 3QATA 5H2FU 1TU0B 4PPDA 1KFTA 3V5RA 4Y2PA 3MM6B 1RHQB 1WOSA 2GMLA 2V68A 1Y5NB 2HMIB 3L5KA 1UPMB 2ZC4A 3A13A 1J2VA 4OV1A 2DIUA 4JNEA 4ID5B 4CH1A 2HGMA 2ZH2A 1RA7A 2E8NA 2HQCA 1EARA 3WIUA 4O5FA 5LJ5Y 1OXJA 2V67A 4ZP7A 1RGIA 3KKRA 1MMNA 1I3OB 5J8YA 3ZDBA 1S22A 2WBMA 5M1NA 2DY4A 2XC9A 3P1GA 4R79A 1ZJMA 5AKJA 3DJCA 2ZJPL 4N5SA 3RW6A 3QIDA 4OYPA 2IMWP 3HJVA 1U2RA 3U9ZA 3H2LA 4I0WA 1KWMA 3ID6A 2WSFC 4UASA 3LGHA 1B9FA 1SS6A 2XI3A 1U4BA 5ADXA 1URRA 2VG6A 1NH7A 3WKAA 4OJ3A 2E5LF 3VF6A 4OX9F 3MN5A 3MM7B 2QXFA 2O6KA 4JWNA 3AO1A 7AT1B 2XCPA 1NGEA 1ZQDA 2XSJA 4ED1A 2DGWA 1K1QA 1IKWA 3KWIA 1S6UA 3DRYA 2E7WA 3WKDA 4FLZA 8ICCA 3MR6A 4TYAA 1U2VA 1JLAB 2V94A 4CWBA 1KVIA 2U1AA 2YHWA 3NVWA 2D0OA 3DOKA 3MGIA 2XGPA 3BREA 2JWKA 2D5RA 5J0SA 2ZJAA 1B3TA 3W2WA 4FE3A 4JB3A 3J7YU 5IT9Y 1ZBUA 3OFFA 2XY7A 2BQRA 1RYUA 3C15A 2ZM6K 3UQ2A 3ZD8A 1EX4A 3C19A 3PJ9A 4IO1A 4RQ0A 3UKUA 4ERDA 4JI0F 4MLHA 4HHJA 1NHUA 3HFVA 1HUZA 3FSXA 3SPZA 3W62A 3GWCA 3CRXA 4FLWA 4USWA 2HFZA 2XMWA 3ZZPA 4M2YA 3EPIA 1WC5A 2CQ3A 4A8YA 1NJIT 4P2FA 3KLFB 5FP0A 1J5EJ 1N0VC 3NS5A 3PYDA 3C14A 2GWJA 2YPYA 3IRUA 4K4TA 1XSPA 2AT1B 3WX4A 1Q82O 2F65A 3F5AA 3TWHA 4H5RA 1JXVA 4HR2A 3QEAZ 4N8OA 3SQOP 4KLUA 1RAIB 1YZ6A 1AROP 4IQVA 1KTVA 1FRHA 2FMPA 1QAIA 3I0RA 2MHEA 1CI4A 4QU7A 3N7RC 4DV0K 4PZOA 2OTJS 3SUNA 1V38A 4NLTA 3H59A 1COOA 2M0NA 2Q1LA 6FD1A 4C3MA 2O8FA 2KOBA 2K89A 4X62J 4C4TA 4UOCA 3MAQA 1W7WA 5E41A 1XERA 1S6OA 5B0DA 2OAUA 8ICUA 5F8LA 2HVDA 3TZYA 1WKKA 4FWRA 3RH6A 4YFKA 3IDWA 1N32F 3CMAS 1MDUB 3L4QA 5CYQB 2B0GA 2A3ZA 2J8SA 4J03A 4ED8A 1R8AA 1L3TA 4FZMA 2ATQA 2W41A 2GVDA 5CHGA 1ATNA 4CHQA 4LFAK 2HWTA 3T7ZA 3V72A 2BCUA 4TXSA 4DTUA 4M41A 4E7LA 9ICBA 1NDKA 4LBIA 4K4UA 3PFOA 4DV1F 3S9HA 2BR0A 2XYHB 3QAUA 1SZPA 5J1EA 4CLZA 3CCRN 4R63A 5L1IA 1Q4RA 3EYZA 1X4CA 2CH5A 1U04A 2W9CB 2B9EA 3DDNA 2QWPA 4CJWA 2VG7B 3UDEA 1HMVA 4HACA 3TEGA 1WN7A 4WTYA 3MEGB 3KUEA 2J9CA 4C4WA 3L4BC 4IOCQ 2CN1A 5AM3A 2DEIA 1Y9OA 1NGGA 3KXDA 2WRMA 3VAIA 5G5HA 1IG9A 5D4LA 2A19A 3TAEA 1U45A 1QM9A 4DTPA 4I2GA 4NMLA 3IS9B 3MN6A 2ZBRA 4MFBA 1PYTA 5HRSA 4UAZA 3BSAA 1F9FA 3LDPA 4J9OA 3SFGA 1S12A 3VF2A 2V34A 2BKPA 2LLZA 4P10A 5E3QA 2ZKTA 4IEIA 4WYLA 4LF4J 1KOHA 3NRZA 4H4MA 2Q66A 4DZDA 2EHGA 4ILJA 4L74A 1WSJA 4MFBB 5HRRA 4RQ8A 2C28A 2OPQA 5AM2A 4CJPA 1RBAA 2V8PA 3KHYA 4KGMA 1KVJA 4FLVA 2ZWPA 3CJKB 3MEGA 4ZVRB 3RH5A 2ZH3A 2QTDA 1T6CA 5JVGL 3QUQA 4K4WA 1KOOA 4F4WA 1OPZA 3TYTA 2Y3YA 1GLBG 3G4SN 1NHVA 1U6ZA 2JFKA 2P9GA 4KH4A 5DDOC 1JLEA 4X64K 1IUJA 4CZCA 2MKYA 4MFCA 4FLXA 4EMDA 1FF2A 1W2IA 3QO9B 2XLIA 4DV5K 4KHUA 2ZWOA 4EP5A 3P49B 3AA5X 4PZNA 3VQTA 4QR2A 2CRXA 2HHPA 1A5XA 4J37A 3KUHA 1QZ5A 1TKDA 2NXJA 2GMJA 2M70A 4JLHA 1QQ7A 2AEFA 5AR0A 2EAOA 5BOLA 4IXCA 2OA8A 3T5KA 3T5HA 1PG5B 4Y2MA 2W11A 4GVEA 1GX5A 3MXMA 3IRWP 3V9WA 2UXBF 4LVSA 1BVSA 3ENVA 1WF1A 1KKHA 2WONA 3P5BP 3I55S 1OSCA 1VQPS 2DITA 2OHFA 4RBUA 5CA5A 4QZFA 2RF2A 1X7VA 1H7WA 2PFQA 1Q8LA 3W61A 4GKJF 3VQDA 4R5PA 5B0FA 2UVRA 1Q0NA 3UN2A 2WCXA 2KLAA 1Y00A 1ITGA 2QARA 5HLFB 2NR0A 4DR5K 3SQ2A 5AQXA 1FKPB 1Q81T 4B1UB 3P3DA 3ZTQA 2B9YA 3AU2A 1PSDA 5KAKA 1U2VB 5JS2A 1AT1B 4XUSA 4R5PB 4NLUA 3ALYA 2YX1A 3ZCMA 4OIXA 2D4WA 2AD9A 1U47A 1TYQB 4B9VA 1QUVA 2MQPA 1G2EA 1IBKF 5KFIA 2EZYA 1FFSB 7ICRA 5IM0A 1WCLA 3GYNA 5LL6Z 3HD1A 1U8WA 3MXJA 5HAOA 1UW9A 3V1QA 4LIRA 3NAEA 1RXOB 1IR2A 2DR6A 4DR1J 4ZVHA 4ZPBA 4DO9A 2HGLA 4BREA 4I7FB 1OJ4A 2C2RA 4HEA9 2I9GA 2M9NA 1TK8A 2IRUA 4FF2A 3Q8PB 2JV3A 4WQ4A 1HR0F 3MX2A 4DX6A 4JI4F 3RJGA 1UQVA 2EXUA 3OR2A 1EO1A 4NE9C 5G5GA 4KLIA 5CYQA 3L4PA 5ETNA 4MTPA 5FRNA 3AOAA 1RSCA 2R7SA 4I68A 1KQSR 2LVWA 2B6GA 2P9UA 1X60A 3FLCO 4YOTA 4E7KA 4LRFA 2BRKA 4HUGA 4WFAL 4X4PA 3J7A1 3CO0P 8ICZA 2OP5A 3ATVA 1COKA 4ZVQB 1UCNA 2CQIA 3W8PA 4ICAA 3R1HA 4DUYF 5J0YA 2YH0A 2VV5A 5BPLA 3EKSA 1IBMJ 3GSIA 5ETVA 2OZMA 4OPHA 2MU2A 4XIUA 5C24B 4DCJB 1RT1A 1XBWA 2U2FA 4P0QA 4JKCA 5I9EB 3SUQA 4PKDB 4Z7YA 1HJPA 5J2EA 3ISDA 3HVTB 1NK4A 2KN4A 1HNZK 2C2ZB 3ILIA 3WEEB 3QEXA 3EPGA 4KTQA 4P0PA 9ICNA 5HR6A 4FK4A 2ZJ5A 5DG9A 3GV7B 3JSYA 3C3LA 4QAGA 4CF9A 3MMBB 2ROEA 4H0VB 3H1VX 2ACMA 4FKYA 2CDQA 2W9AA 4CJEA 4L8RB 2XMUA 4PL1A 3GP9A 4LIWA 8ICKA 4RW9B 3S1TA 1VQOS 1RCHA 3MK6A 1FI4A 1W2BR 4KO0B 1VHXA 1YJNS 2DEJA 2N4CA 5AE1A 1UAXA 2K7JA 4NRTA 4IWVA 4CK1A 1DJ0A 4QR1A 1DRGA 2DPIA 5ALDA 4DV3J 4Y2XA 3OYAA 3IFEA 5ETLA 5D0HA 4H4KA 3JSMA 3ZZZA 3CE8A 3CJ7A 3K2PA 5F3ZA 4DN0A 4EGLA 4M5DB 1RBSA 4CIOA 1BWFO 5HOOA 4KTWA 4F3MA 5L1MA 2I1RA 1HQEA 2Z0GA 4XPEA 1EETB 4NASA 3C2LA 2JHEA 3HT3A 5F8JA 2LQ5A 5KOXA 1A76A 4LRAA 4A62A 3TTFA 1NDCA 3KJVA 1WSEA 2MZSA 4NPOA 5I42B 1HBMA 2BKNA 4UY8T 2YTUA 4K4GA 4MFAA 4MYTA 4HTUA 2YB4A 3HILA 3FZFA 4K4IA 4TUPA 4MN4C 4J9UE 5D77A 4OI3A 4IFVA 3DRXA 3PW7A 4ZPTR 1J9AA 3JPOA 5AM0A 3M2VB 4US8A 2DNGA 3CCWA 2KHOA 4E1MA 1DEJA 1C1BA 4CJSA 4KLMA 3IC1A 3B78A 2M9KA 1IR1A 4Y1DA 2FVQA 2JRSA 5LMNJ 4LVOP 2L9WA 1NKEA 3N7PD 3QNMA 2FY1A 4IFVB 2Q6BA 2L48A 2YNHB 2FSNA 5J1PA 2UU9K 4BRFA 4J9QA 2WUSA 1H2TZ 3G6XA 1IWGA 4GVLA 4E8UA 3O9UA 3L6QA 5F1XA 2DIVA 1V9PA 1C1AA 2GQCA 3IO1A 4UOFA 2Q43A 3HO1A 4DF8A 3JYTA 2OANA 5TKWA 1LB2B 2QLBB 2M52A 2P9IB 4DFPA 2QMXA 3BO4A 1PUZA 3ID8A 5C10A 2WW4A 2I6WA 2XHCA 5B7WA 4NXNK 2V2KA 3M2RB 2FJAB 3OTDA 3SCLE 5HBMB 5A8RA 1S3XA 1XNRJ 3VQ9A 4X64J 3OYMA 3RRGA 3O08A 3OY9A 4M45A 1KAXA 2KKVA 1MWQA 4QYZK 1ZQOA 1N60A 2IAJA 4KLOA 1GMWD 4Z6EA 1V85A 4LH5A 1YVUA 1LVHA 5ALZA 2YPZA 3P31A 5IIOA 2YWFA 3MMVA 5EOZA 1J2MA 3KLIA 4ANEA 1N63A 5D6GA 7ICMA 5LJVA 4LRBA 4K8RA 2DR7A 3HDSA 5LMUK 3R5CA 4R64A 4DLEA 1BE4A 2VBZA 1ZQIA 3SBTA 2G8KA 2DNKA 3MBYA 4HHTA 5KAFU 1O5JA 1ZOLA 1BNOA 3GJQB 2F1JA 2WAQF 3C29A 2EWSA 1ECWA 2KB2A 3NMUA 5AQTA 2CVEA 3BKFA 3U8XA 2MB0B 3FGVA 1FRKA 3MXIA 2MDAA 1X0PA 3M8SA 3KUGA 4AH9A 5DM6Q 3M05A 2FPKA 2DR8A 3IP4B 4Q8EA 1X1PA 3I55N 1Q95G 5ALSA 2V4JA 5K5MA 4DR2K 4PKGA 1JKHB 2KM8C 4KITB 4QIWF 4AHSA 4P75A 4V19X 2OCEA 4I29A 3I32A 1PC4A 3CM5A 4NLXA 1TV9A 4OV6A 3ZEUA 1DARA 3EVWA 1BQXA 1HQ2A 5AQGA 4Y2SA 3O5BA 3H5UA 4BR5A 1TE2A 1A77A 3CIMA 3B54A 4BCAA 4CFBA 4KKOA 1WKJA 4MIBA 2BX6A 3TOQA 4ZDNA 3LDSA 5J2PA 2GHPA 1WHVA 4JEPA 2JWLA 3L3CA 5J1EB 1PYOB 3TADA 2VJUA 1QQ5A 1WF0A 1WHWA 2P9UB 2G0IA 4OZ2A 1KDHA 1N5TA 3I31A 4WWSA 4DS4A 1WD6A 2IBKA 2KRRA 2ZGZA 4FYVB 4ZITA 5SWMA 4KFBB 4XH4A 1ACMB 2COLA 2PC6A 4OPAA 2DO4A 4WFBL 1S1TA 4KGVB 3GIJA 3O4QA 4FJ7A 1S0VA 2OIHA 4I2QB 4LR8A 4GKJK 4PQAA 2XICA 3HSGA 2A10A 3GR0A 2GAGC 2JWNA 3EUB2 2MQ8A 4YB5A 2KVIA 4A8MP 2E8OA 2ZXHA 1VRQC 1WCNA 2G2ZA 4CTAA 3WXJA 1RPLA 4CHPA 3GYXB 4BACA 2EX3A 2EG2A 1SH3A 3Q2SC 4H5WA 2AP6A 3D3BJ 2IVYA 5DBAA 4IG3A 2PMWA 1N32J 4FWLA 2Y1IA 4JHDB 2HS3A 4KLQA 3SEIA 3MR3A 2W24A 1F0XA 3TSUA 5CHIA 1NB7A 3UDCA 4DV7J 2NUBA 4EYIB 1WI6A 4KGZB 4IS7A 3ISZA 2P9PB 3CNQP 1NSQA 5AKZA 4H0YB 2CQHA 4QCLA 2XS7A 3FZKA 4FS1A 4FOEA 2RQ5A 3Q7BA 4NLRA 3RSEA 2ZD1B 3O80A 1TUGB 1LW2A 1YJUA 3LGMA 3L3UA 1NUEA 1SWWA 5B0BA 3L9ZA 4IG0B 3T9ZA 2IIHA 3BJYA 5AQSA 3SCJE 2DNYA 1XN9A 1T4GA 5LOQA 4ZOHC 4UUXA 1WC4A 1L6NA 3HM8A 1MG7A 1ZC6A 1Z6RA 2E4LA 1BPZA 4BC7A 3MPWA 1S9GB 4B3MJ 4CZHA 5C2CA 4USTA