3HTSB

Heat shock transcription factor/dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
82
Chain Sequence
MARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQNNDSRWEFENER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A new use for the 'wing' of the 'winged' helix-turn-helix motif in the HSF-DNA cocrystal.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*GP*TP*TP*CP*TP*AP*GP*AP*AP*CP*C)-3'
total genus 22
structure length 82
sequence length 91
ec nomenclature
pdb deposition date 1998-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3htsB00
5DCMB 1XMKA 4LLLA 1U78A 2EFOA 2ZFWA 4FHTA 2DFIA 2UZKA 2A61A 3V8KA 4R79A 3VFZA 2KKOA 4HLYA 4EQQA 1USTA 3F72A 3J81K 4M6YA 1LJ9A 4G6QA 5E1XA 1LQ1A 3QPHA 1LB2A 4ZH4F 4S05A 2HQRA 1KYZA 2WWYA 3VB2A 3ZN0A 2PQ8A 1BOAA 2XAJA 5H6QA 2M8EA 5HLGA 1HKQA 1EH8A 5L3BA 1B9NA 1I1GA 4IXAA 3J7AO 5H6RA 2X4HA 1OPCA 2RC4A 1QPMA 4CDGA 1SD7A 1UFMA 2HTJA 3HOSA 2PG4A 3WGHA 5CVUA 3DEUA 1L3LA 2F5DA 2CFXA 2GZWA 4XBFA 3GVAA 2ZXJA 5DCMA 1S7OA 5LLQA 2W84A 4HW0A 4KMFA 2D45A 1T38A 2A68F 1W5SA 2GA1A 3GX4X 4BHPA 5E17F 3IWZA 5FGMA 3F8FA 5ILVA 4HX8A 3BZ6A 1Z9CA 1MGTA 4AIJA 1MDMB 2VBWA 2J5OA 1FLIA 6PAXA 3T8TA 3TOAA 4K2EA 4LMYA 3LA7A 1R1TA 4OINF 5IT9Z 1K6OA 2VBZA 3GO5A 3E3VA 2A3SA 3KZYA 4LB6B 5K5QA 4HF2A 3IHUA 2Y0MA 1ZN2A 4P5OA 3TQNA 2GXBA 2K7LA 3MCZA 1K7AA 3GZ6A 4NHJA 4RAYA 5FD5A 3JAMZ 4M9SA 5ILSA 1DP7P 5IT9K 1Y0UA 1XB4A 3HRSA 2DAOA 1ZLKA 3IKTA 5DDGA 4CO8A 4S04A 2HYFA 4H0EA 4JK1X 2RGVA 1R22A 4M74A 1R36A 2XGXA 5ED4A 4P9UA 4UVCA 4UUVA 2GA2A 4B09A 1KU9A 2FU4A 4HF0A 3DPTA 4L9VA 3BY6A 3K69A 1FYLA 1R7JA 3E6CC 2G7HA 1QBJA 1V4RA 4L18B 4ON0A 2E1NA 2V1UA 4RB0A 1P6RA 1JHHA 4ZZDA 2R3SA 3DF8A 2VOOA 2ESHA 3I0TA 4EJTA 1I27A 3DV8A 4ESBA 5KVRA 2LF7A 5D4SA 1AWCA 1J9IA 3IL2A 1SD6A 2PMHA 3L09A 1O3RA 1O3TA 2F2EA 2IVMA 4LG0A 4LG0B 1I5ZA 3U1DA 1ZGAA 1HXDA 5JFRA 4L5IA 4RB1A 1NHAA 5D5XB 4EJWA 4IF4A 4KN4X 2EV5A 2M87A 1ZRDA 4XSXF 4UHTA 2CWEA 1PUEE 1ZG3A 3RPUA 2Z3YA 1O3QA 2V1DA 4PGHA 4L0YB 2PFBA 2NNNA 3BROA 3FMRA 3SFZA 3NQOA 3N4MA 3NEUA 4HBLA 4F7ZA 2VE8A 3Q5FA 1ZARA 2XKOA 4FT8A 1YO5C 3MZHA 5CVVA 4G6DA 4OIQF 5LGTA 2B0LA 2WTEA 1H9TA 1LVAA 1U8RA 4MGRA 2DT5A 1KQ0A 4ZYDA 4I0BA 3V8LA 2EFQA 2IRFG 4PGGA 3HRUA 1XGMA 2W25A 4L9JA 1J0RA 4RB3C 2YX4A 3VODA 2JPBA 3BJOA 2ESNA 4EJUA 1FBSA 2XASA 3E6MA 2RQPA 3SQNA 1G3TA 3U9GA 1HSTA 4N0BA 4E70A 2A6EF 1F1ZA 1G3WA 5CVJA 4XLNF 3I54A 2MD5A 3HHGA 3QOPA 2H27A 1JXSA 1GXQA 2OZ6A 4EMSA 2R7DA 3FM5A 2YU3A 4I7HA 3DFGA 5BPIA 4AIHA 3WTSC 4HDVA 2KRFA 3QP5A 1HW2A 2EA2A 2H94A 3GFMA 3DPLC 4EJOA 5LGUA 3V7RA 4ZYGA 5FD6A 1R23A 3BJAA 3JSOA 2IW5A 2QLZA 1XDUA 4HX4A 1FWZA 1R5GA 2MH9A 1FNNA 3IWFA 3F6OA 3F8MA 3EQLF 5DEQA 1YS6A 4IPAA 4KA4A 2NS0A 3DP7A 3H3UA 4Q4ZF 1ZG1A 1U5TA 2O8XA 1HKTA 1ZAOA 3NRVA 3C1DA 2DQLA 5EEHA 1KQ9A 3WTWC 2ISYA 5TRDA 3P7NA 3CUQB 4U7BA 3LQQA 4Q5SF 4FX4A 4ENNA 2QUFA 1FZPB 3VEPA 1S6LA 3BP8A 5CLSA 2DQRA 2KJBA 4EVIA 2A69F 2VT2A 1YLFA 4L9TA 4AIKA 5CVRA 4KYWA 2XRNA 3GFIA 3HOTA 2YSRA 1K78A 3JTHA 2FMYA 1IUYA 4A5MA 2RNJA 1MZBA 2K4BA 4A0ZA 3WTVC 4A0YA 1HKSA 2HFHA 4OOIA 4MNUA 1HBXG 5LRSA 3ZP5A 3WG9A 4GYIA 2QQBA 5J8FA 3C18A 3CUQC 4L0ZB 1D8JA 4R8HA 2VN2A 3P9CA 2Q0OA 4ESFA 3M8EA 2FSWA 4MTDA 5FFXA 1W5TA 1ONVA 3BDDA 5D4RA 1J5YA 5ICGA 3KZZA 2HKOA 3DXJF 3KLOA 4RGRA 2MBFA 3RPQA 2WC2A 1K78B 2VONA 3TO9A 4O5VA 4QLCU 2V79A 3WTTC 4OMZA 1SD5A 5D5UB 4XSZF 1T2KA 1TNTA 2DW4A 3WU1B 2GWRA 1LEBA 2BYVE 4FX0A 4KN7X 1KGSA 1R1UA 4WF2A 2DU9A 1YIOA 4B8XA 3O3KA 5E8GA 2D2WA 4QWQA 3GFLA 3I58A 5CJ9A 1BI3A 4M72A 2ZMEB 3MEXA 5JI6A 4HYEA 5K5OA 2O0YA 1RNLA 5K5RA 4KT5C 1J75A 3HUGA 5DUIA 2DPUA 1BM9A 2FE3A 4A6DA 3V8JA 1FBUA 3F21A 1XSXA 1BN5A 3FZVA 2FMLA 3MZYA 2KIFA 2ZNZA 3SZTA 1BIBA 1IF1A 1KU2A 2GXGA 3M1EA 2DPDA 3ZN1A 2COMA 2NNYA 3OOPA 1GXPA 3TKYA 3RYPA 2FNPA 2IA2A 2IA1A 1HW5A 4M9XA 4PDKA 2ADUA 3V4GA 2XAFA 2L4MA 4LFUA 2W57A 4G7HF 4HF1A 1WKMA 1FSHA 1OKRA 4N9IA 3KLNA 3LFKA 4P96A 4Y17A 4MEXF 3GUDA 1G3YA 3ELKA 4YFKF 4U0VA 4KDPA 1YYVA 2LNBA 1Q1HA 1FSEA 4M6XA 2R7FA 2OA4A 5BPDA 2P7VB 1G3SA 5A2QK 3JW4A 3FX3A 3I64A 5TJJA 5ICEA 3K0LA 2O03A 1XCVA 3M9AA 1T6SA 4WCGA 2K4JA 4L5JA 2UWMA 3FF5A 3IRQA 4GYGA 2Q2EA 1IN7A 2QBYB 3PQJA 2FQ3A 2HEOA 1BI2A 2VC1A 4Z2YA 4GXOA 2PN6A 1U5TC 4WXHA 3I5UA 1GVJA 3HTUA 3LWFA 3FMQA 3LA2A 2LSOA 1TQPA 2BE5F 1SFUA 3F6VA 4WXDA 3L2CA 4Y13A 3LAPA 2HR3A 1WQ2A 4UXNA 2JTVA 4NB5A 2GQQA 3KP2A 4EM2A 1IN4A 3CO6C 1XGOA 1PP7U 4IJAA 3WGIA 2A5YB 1SAXA 1TTYA 5LHGA 4LLNA 2VXZA 4G9YA 1IXCA 2BBYA 2RN7A 3K1MA 2D1VA 2M5WA 2H09A 4MEYF 4A2UA 1T98A 2DO7A 2W85A 3EDPA 3G73A 5FFZA 1ZH5A 5E18F 2XVCA 2NAZA 2PJPA 4HQEA 3GLXA 4LD5A 2H6CA 2IA0A 2VOPA 4HAMA 2RV8A 3M8FA 4CICA 5J8CA 4JQFA 4Q47A 2UXXA 2BGCA 2DI3A 3F8BA 5HS7A 1PP8F 1Z7UA 2DK5A 5L3CA 2PEXA 3CUOA 5JR3A 2P5KA 4IHTA 1OYIA 3O6BB 3I71A 1DPRA 1J7KA 1T39A 1MDMA 1BC7C 1UHMA 1I6XA 2CW0F 2P6TA 1C0WA 1J2XA 3CTAA 3KP6A 4KUMA 3EYIA 5J6XA 3ERED 2FA5A 3E5UA 1L0OC 3ML6A 4BQAA 1RZ4A 4BHCA 1IW7F 3D0SA 4RGXA 3REOA 3FWEA 1D5VA 2DLLA 1B1BA 5H20A 1MKMA 2LF8A 3H92A 3PQKA 1YW9A 3P9KA 1FX7A 2QENA 2VBYA 3T0YA 5HDNA 2FBHA 1HSJA 3K1NA 3SZPA 1IAWA 4MTEA 1S7AA 2Z99A 1U6GA 3F22A 3U2RA 2D1HA 4GGGA 4O3MA 5A2QZ 2TDXA 2EFPA 2M1BA 4R1HA 1P4XA 2HTSA 3GZ5A 4ZYHA 4HLXA 1MJBA 1XGNA 2EFNA 4LLGF 1PDNC 1P4AA 2VBXA 1FYMA 4IVNA 2Z33A 1QQIA 3ZMZA 3LSTA 3GEZA 3KFWX 3WTYC 2GAUA 4ENJA 4UVAA 1RUOA 3ABUA 1D3YA 3RTRA 3PFIA 2E7XA 3WE2A 3I59B 3R0AA 2LKPA 5LHHA 1T0FA 4M9ZA 2OU2A 3OV8A 3Q9VA 2XIGA 4M71A 5D8LB 1MD0A 3E6DA 3QPTA 2P6SA 1EH7A 3G3ZA 1U2WA 2YR2A 3WTUC 4U0YA 2XAGA 1Z6RA 3QU3A 5AIPA 2M30A 4HV5A 5HDGA 3ECHA 2BV6A 4KIFA 4EM0B 1F4KA 4XRFA 3WE3A 4UVBA 3JAMK 2PLYA 2JZYA 4ZYEA 2OD5A 4KICA 3H3ZA 5DD4A 3HRMA 2FNAA 1TNSA 4U0WA 4KIBA 4CHUA 1R5HA 2QQ9A 2QWWA 1LDKB 3FXRA 3WODF 4A5NA 4G94A 3J80K 3F23A 1HW1A 4YFXF 1FP2A 1TBXA 4DNCA 3T1BA 3MQ0A 1F5TA 3E5QA 4HX7A 2M45A 4MQVA 3KP3A 5ICCA 1RUNA 2PI0A 1X3UA 5L3GA 2HQNA 3CJNA 3R6SA 2FRHA 1BJAA 2CO5A 4IHSA 2BEOA 2CQKA 4IRHA 1XD7A 1W7PB 2K02A 4CGZA 5F6FA 5LEJA 3MFKA 2CGPA 2JPCA 2RDPA 1SFXA 3ISPA 1KA8A 2W24A 5AONA 4BXUA 2IT0A 4LB5A 1O7LA 3BOQA 1QZZA 1H0MA 2WV0A 1REPC 4ZZLA 2HKXA 1LDDA 3GXOA 2VODA 4D0PA 3SHFA 4P55A 3S2WA 2EB7A 4P9FA 3ZMTA 4IRGA 2O3FA 4GCVA 1CF7A 4L9NA 4OIOF 1XSDA 3HSEA 2F5EA 3I59A 1ZREA 2MLGA 1USSA 1Z1DA 1B6AA 1FT9A 2ELHA 4KMUX 2OQRA 2ZKZA 2P7CB 1P2FA 5LRRA 3HRTA 1IRGA 1TW3A 1AOYA 2VC0A 5IT3A 1LDJA 3KP5A 1XSVA 3TGNA 3HYIA 5E20A 4G7ZF 3TO7A 1FY7A 4AD9A 1WRJA 3MWMA 2F5FA 2XUBA 1IRFA 1XN7A 3FM3A 3RYRA 4HQMA 1RIOH 3R61A 2VE9A 3VOEA 3F8CA 2KIMA 3K9TA 3GW2A 2XV4S 3EUHA 3MAJA 1K79A 1IN8A 4BAYA 2C6YA 1SFEA 4BNCA 3V7SA 3FXQA 1FP1D 1FC3A 4YFNF 1OMIA 3RDIA 3CDHA 1KYWA 3TDUC 4GO1A 1BI1A 5HVQC 1DPUA 2DK8A 2L4AA 1QGPA 4U7DA 3DKWA 2H6BA 2CYYA 2MH2A 2EA4A 4RS8A 3E6BA 5E1WA 3HSRA 3LAJA 5ERIA 4BH9A 3E97A 5DUKA 3ZPLA 2EV6A 3F3XA 1OYWA 1P4WA 3CUQA 3J80Z 2OBPA 1FYKA 3RIRA 4HZFA 4KFCA 4OIPF 3ZMDA 3GF2A 4A12A 2K27A 1CGPA 1I1SA 3FMSA 2HGCA 3L7WA 1SMTA 4MHGA 4LK0F 1O3SA 1SMYF 2V1XA 4I98B 5FB2A 2L3DA 2IPQX 2PBIA 2EWNA 2EJRA 5LEKA 4ETSA 4WWCA 3GFJA 2J5PA 2CSOA 1ULYA 4HDUA 4MQ9F 3T8RA 5HDKA 4EGYA 1BIAA 1ON1A 1Z6TA 1XDSA 2FEZA 1XGSA 2V9VA 1W7PD 4PZJA 3W6KB 3C7JA 2P4WA 1ZHFA 1ZG5A 2E1CA 5KK1A 2EK5A 1U5TB 2Y48A 1ZYRF 3KEOA 5L3FA 4CXFA 1MJAA 3KE2A 1TLHB 3T5XA 3HSFA 3ZMUA 5HS8A 3R60A 1FOKA 3E5XA 2ACJA 4ASNA 4WXCA 3BWGA 1KU3A 1ZLJA 4ESJA 1B9MA 1BI0A 4DQ2A 1TQIA 1Z91A 3ECOA 2ISZA 3V7CA 5K1YA 2ZNYA 4M73A 5HS9A 3FHZA 3WTZA 5LHIA 4RGSA 2GIVA 5LGNA 4ENMA 4HOBA 5ILUA 5FLXZ 1B4AA 1YQAA 4Q48A 2V6CA 2HOEA 4BYYA 3QP6A 1XMAA 1ZRCA 3EYYA 2F5CA 3KCCA 3D5LA 1RI7A 3QRFF 3ZMVA 2ZBKA 3ZQ7A 5L3EA 2O61A 4LJZF 3L00A 5AIQA 2MLKA 4UV8A 1S29A 1BC8C 2KJCA 4I0AA 1W4MA 2G9WA 2Z5UA 4G8XA 2P8TA 5JHUA 5L3DA 1B59A 3Q9SA 3N97A 2FBIA 2QVOA 1O57A 4O6JA 3HIFA 1KQ8A 4YIIA 3HHHA 5F64A 2OAZA 1BBYA 2STTA 2G7UA 5BQTA 5HLIA 2PMUA 1G6NA 3BPVA 5FLXK 2AXLA 1HQCA 5LBQA 3IC7A 3I4PA 4OIRF 3WTXC 1JE8A 3B02A 1IXRC 1ZGJA 2YPRA 3W6JB 1UB9A 5HLHA 1STZA 1Z05A 3WU0A 1G4DA 5BMZA 4U88A 3P9IA 3O2PE 3RI4A 1J59A 3L9FA 4G7OF 1SD4A 1IZ1A 2OQGA 3KETA 3QU6A 4KNYA 2QBYA 4OU0A 2HWVA 3R0JA 2L01A 5D5WB 2EV0A 2FOKA 4AWXB 2XKPA 1ZRFA 3K2ZA 2ZMEA 3RKWA 5BOXA 2ZO4A 5DV5A 1DUXC 3KEQA 4HV6A 4EGZA 3B73A 3GYHX 3F8NA 5EEGA 4RAZA 2AS5F 5E8IA 3CLOA 4UV9A 1UHWA 1V3FA 2K86A 2QQAA 3WGGA 3JTGA 4EM1A 2CG4A 1MJ9A 2A6HF 2XHKA 2HYGD 1OR7A 1YW8A 4AVPA 1EV7A 4I01A 4IRIA 3ABTA 2A07F 2IP2A 3RKXA 2XAQA 2XAHA 2DTRA 4LK1F 3M7GA 4PCQA 4LGWA 3RKYA 3CO7C 4ENKA 3DQVC 1DDNA 2X0LA 1EH6A 1YG2A 4WX9A 2L02A 5CYVA 2HDCA 4A6EA 2JSCA 2P5LC 1VTNC 1H9GA 3RJPA 3BJ6A 2UXNA 3J81Z 4HA8A 2QYOA 3TDZC 4XLPF 4UNOA 4A0XA 1QZYA 5F1RA 2NRAC 1FPQA 1ODDA 2IJLA 2FF4A 1QNTA 2OZUA 1GHCA 3JSPA 5D5VB 1LEAA 1YTYA 1R00A 4NQWA 1S8NA 3BPXA 1LNWA 4TV7A 3ULQB 4CYDA 1A04A 5CVIA 2JRTA 4EV0A 3EETA 1JGSA 1XCBA 4RGUA 5D6EA 2VT3A 1R58A 2Y75A 1KU7A 3R4KA 1QO0D 3K1PA 2Q8KA 4OMYA 2NYXA 3SXYA 2YX7A 3QAHA 2JT1A 3IRRA 1OYYA 5HOOA 1YS7A 3KP7A 2QZ8A 5D6FA 5DYMA 4EJVA 5DD8A 5DCFA 3LQRA 2MC3A 2FXAA 5FO5A 2FBKA 4BHBA 1U3EM 1IN5A 2XROA 1TQMA 4N9HA 5BS6A 1JHFA 2HS5A 4YIFA 2QM3A 2ETHA 3C3WA 4YG2F 1YFHA 4Y15A 2O6GE 1WWXA 2MA3A 3HTSB 4I09A 4CZZA 3LA3A 3ZMSA 3GWZA 2HZTA 2L54A 2P5VA 2Z9OA 3FXUA 1ON2A 2RKHA 4I2OA 1P92A 1TW2A 4KIGA 1WSUA 1UCRA 1IXSB 1E2XA 3KP4A 1W7PA 4I02A 5ICFA 1IN6A 2EFWA 1YW7A 1FBQA 2STWA 3I53A 1O7FA 2KIUA 3TOBA 3COAC 3ROUA 2RVCA 2LDUA 5E1ZB 3TO6A 4JBAA 1S3JA 1D8KA 1F9NA 4WK8F 2ZCWA 1E17A 4RB2C 1R1VA 2E7WA 3IKVA 2DBBA 5D8KB 1WI9A 5JVTA 1CF7B 3AAFA 2ZJ2A
chains in the Genus database with same CATH superfamily
4X6AJ 4JX5A 1XMKA 2DDAA 5DCMB 4ZYAA 4LLLA 2EFOA 1R71A 1U78A 1X2MA 2ZFWA 4FHTA 4XLHA 1DP3A 1ITYA 2JWTA 2DFIA 2UZKA 2A61A 2OJED 3V8KA 3EUHC 3JRAA 2M7BA 4MLOA 2MYSA 4R79A 3VFZA 2BZTA 2XPWA 2KKOA 2P0WA 4HLYA 4EQQA 2M9HA 4IO9F 1ETVA 1USTA 3LSPA 2JA8J 3F72A 4BJ5C 3J81K 1X19A 1LPQA 2IGNA 4M6YA 1WJEA 3PSIA 1FOYA 1LJ9A 3BCAA 4G6QA 4JX6A 5E1XA 1LQ1A 4XLAA 1Y8QB 3QPHA 1NH3A 3KYDB 2E1MC 1LB2A 4ZH4F 4S05A 2HU9A 2HQRA 1ETYA 1KYZA 2NS7A 2L5QA 3JREA 1NK3P 1W1WE 3MMYB 4IOCF 2WWYA 3VB2A 3ZN0A 2PQ8A 5IY5H 1BOAA 3GTGJ 2XAJA 5H6QA 2M8EA 5HLGA 1HKQA 2LBFB 1EH8A 5L3BA 3LNQA 1B9NA 5KAIC 2ZC2A 1I1GA 4CCLA 2DA3A 4IXAA 3J7AO 5H6RA 2M3AA 2X4HA 2W7NA 1OPCA 2BVMA 2RC4A 3DEEA 1PUFA 3HGYA 3DBRB 1FIPA 1NTCA 1QPMA 4E7LA 1HDPA 1PJRA 4CDGA 1SD7A 1UFMA 3I9V2 2HTJA 3C2HA 3HOSA 3OS0A 2PG4A 3H35A 1Z3XA 3WGHA 1FMWA 5CVUA 4ZDPA 2DMQA 3DEUA 2JUCA 4MO7A 1L3LA 2F5DA 1D1CA 2CFXA 2GZWA 4XBFA 3GVAA 2ZXJA 5DCMA 2E1MB 1S7OA 2F5VA 3C2BA 5LLQA 2W84A 5EGOA 3PJRA 5J47A 5EGOB 4HW0A 4KMFA 4GFBA 3SDGA 4II2A 2XRLA 1RPWA 2D45A 1T38A 3HEFA 2A68F 1W5SA 2GA1A 4D5FA 3GX4X 2GBYA 4BHPA 5E17F 3IWZA 1QHGA 5FGMA 3F8FA 5C4XJ 5ILVA 4HX8A 3BZ6A 4J00A 1Z9CA 1MGTA 4C30A 2OTJI 2EIJH 2DOEA 2JVGA 2VBWA 4AIJA 1MDMB 2J5OA 4FASD 2E19A 3U21A 3S2HJ 1XTAA 1FLIA 3QOEA 3ZOBA 1JTYA 1H89C 2KL4A 6PAXA 5EJCA 3T8TA 2W00A 3TOAA 4H4KC 3VYSB 4NC8A 1IDYA 3FXOA 3A01B 3OYMA 4XNFA 3A01A 4K2EA 2LKSA 3LA7A 4LMYA 5E3NA 1R1TA 1E3PA 4OINF 1MNDA 5IT9Z 3KYCB 1K6OA 4ZDOA 2VBZA 3GO5A 4XIDA 3E3VA 2A3SA 3SJMA 3KZYA 4YELA 4LB6B 5K5QA 4OAZA 4IHWA 4HF2A 4QIWN 3BG3A 3IHUA 2Y0MA 1ZN2A 2ME0A 1YIJI 4P5OA 2BY2A 4PSWA 3TQNA 1XG1A 2GXBA 4B4CA 2K7LA 5IP7J 3MCZA 1K7AA 3GZ6A 5FLVA 1TWFJ 1SEUA 2DA6A 4NHJA 4A69C 5IYBJ 4RAYA 5FD5A 3JAMZ 3H9QA 4M9SA 5ILSA 1DP7P 5IT9K 1Y0UA 3QYFA 1XB4A 3HRSA 2DAOA 1ZLKA 3DU6A 3IKTA 2IAIA 3CJTB 5DDGA 4PJ0C 4YEJA 4CUGA 4CO8A 4S04A 2HYFA 4H0EA 4JK1X 2RGVA 1ZGWA 4KT6A 1R22A 2BW3B 2F4OB 4M74A 1VQ4I 4FETA 1YJ9I 3OS1A 3J7YJ 1VQ9I 1R49A 3H5AA 2ZB9A 4E7SA 1R36A 2KFDA 2IGOA 2XGXA 5ED4A 1JGGA 2O5RA 2L0KA 1JUPA 1QU3A 3CF2A 3CDLA 4P9UA 4UVCA 4UUVA 2DDBA 3K4BA 3FXLA 2W4SA 2GA2A 4B09A 1KU9A 1Z3YA 2FU4A 4HF0A 3DPTA 4L9VA 2HOSA 1N75A 3BY6A 3BG5A 2QSFX 2X9DA 2R7SA 3K69A 1FYLA 5IP9J 3SZGA 1LFBA 2R92J 5F0FA 2LC2A 1MMSA 2VPRA 1R7JA 3E6CC 2G7HA 1MBKA 2MW8A 1QBJA 1U9OA 4A3MJ 4ANJA 1V4RA 4L18B 1Q1VA 1Y8RB 1ZQ3P 4A3DJ 3B6CA 4IHYA 3ONQA 2CQXA 3OYLA 4ON0A 2E1NA 2V1UA 4RB0A 5IOYA 1GVDA 1P6RA 1JHHA 4ZZDA 5M5XJ 1VZ0A 3ZR8X 2R3SA 1WJDA 3DF8A 2VOOA 2ESHA 1S7EA 3I0TA 4UY8I 4EJTA 1I27A 4E7HA 3DV8A 3GTPJ 1Y56A 4ESBA 2M2EA 5KVRA 2DODA 3G1LA 2LF7A 3SEZA 5D4SA 1AWCA 4KISA 1ZK8A 3CF5F 2G0EA 1J9IA 3IL2A 3O8GA 1SD6A 2PMHA 3L09A 2KLOA 1N77A 1O3RA 2B63J 1O3TA 4ABZA 2F2EA 1OCOH 4RMNA 4XRSG 1LE8A 4OAYA 2IVMA 4LG0A 4LG0B 1I5ZA 2DN0A 3CCSI 3U1DA 2R7RA 3TW7A 2CU7A 1ZGAA 1HXDA 3OL3A 5KCMA 5JFRA 1AU7A 4L5IA 4RB1A 1NHAA 5D5XB 3CCUI 4EJWA 1V55H 4IF4A 4KN4X 4MFDA 2EV5A 2M87A 1ZRDA 1RESA 2E1OA 3JR9A 4XSXF 4UHTA 2CWEA 5JLWA 1MNMC 1PUEE 1ZG3A 1D1AA 3RPUA 5F0CA 1LKXA 2Z3YA 2R0QC 2LY9A 1O3QA 2V1DA 4PGHA 2Y69H 4L0YB 2WY7Q 4CCKA 2PFBA 2NNNA 3TP0A 3BROA 4B3AA 3FBIB 1QVUA 3FMRA 3SFZA 3NQOA 3N4MA 3CJRB 3NEUA 2VKVA 2PMZA 5IYDJ 4HBLA 4F7ZA 1Y0NA 3I4MJ 2VE8A 2MC4A 3Q5FA 1JUMA 1VQMI 1ZARA 2XKOA 4FT8A 2Z16A 1YO5C 3MZHA 5CVVA 3M1CA 4G6DA 3ZQCA 2N8GA 5JLXA 2BW3A 5GP9A 2B7EA 4OIQF 2M8GX 5LGTA 2B0LA 2WTEA 1H9TA 1LVAA 3GCMA 2ZXHA 3VSKA 1U8RA 2Z1DA 3H36A 4MGRA 2DT5A 1KQ0A 4ZYDA 4I0BA 1V54H 3V8LA 2EFQA 4BGDA 4HRIA 4PJJA 2IRFG 1PYVA 2JN6A 3X2QH 2R7OA 4PGGA 1VQ5I 2VB6A 3HXLA 4NC7A 2B9SA 5HNFA 4GRIA 4V2GA 2NVUB 5FKNA 3HRUA 1M1EB 1XGMA 3M3YJ 1B8IA 2W25A 4L9JA 3J7AY 1J0RA 4F92B 4RB3C 3HBLA 5EF6A 2YX4A 3QPSA 3VODA 2VASA 2JPBA 3BLYA 3G1OA 3BJOA 2ESNA 1BR1A 3IAM2 4PFOA 4EJUA 4A3BJ 1FBSA 4XOPA 2XASA 3E6MA 2RQPA 3SQNA 1WJ5A 1G3TA 3U9GA 2YS9A 4RLQA 1HSTA 4N0BA 4E70A 2GOXB 3K2AA 2A6EF 1F1ZA 1G3WA 5F27A 5CVJA 1HC8A 2M4GA 4XLNF 4C2TA 4LIUA 3I54A 3HHGA 2MD5A 1ZELA 3QOPA 2H27A 1JXSA 4RLFA 2R7ZJ 4FISA 1G8XA 1GXQA 2OZ6A 4RAGA 4EMSA 1IUFA 2R7DA 3FM5A 3NAUA 3WG7H 2YU3A 2W1OA 4I7HA 1TZLA 5K7ZA 1MIJA 4B44A 3J7ZI 3DFGA 5BPIA 1RR7A 2QGUA 2YUSA 4AIHA 3WTSC 3HOXJ 4HDVA 2KRFA 3QP5A 5IP6A 1NK2P 1WPKA 1HW2A 1AA7A 1D0XA 2EA2A 2ZXWH 3OYGA 2LOOA 2H94A 3GFMA 3DPLC 2HPIA 2ZJPF 4EJOA 5GAHJ 5LGUA 3V7RA 4ZYGA 2LRDA 2F48A 1Z67A 2HYJA 5B3SH 2VKEA 3QODA 5FD6A 1T33A 3EUKL 1R23A 3BJAA 3JSOA 2OUMA 4PFPA 2IW5A 2QLZA 4A3FJ 3FK6A 1XDUA 2IS4A 4HX4A 4D7NA 2F4MB 1JT0A 2PMZN 1FWZA 3GBGA 1R5GA 2MH9A 1FNNA 4F55A 5M3MJ 3IWFA 1ETWA 3F6OA 1B8IB 3F8MA 1YOVB 4Y4RA 5FRNA 3EQLF 2JA6J 5DEQA 1YS6A 2XGCA 5KHDA 3H9JA 4IPAA 2W48A 4KA4A 2NS0A 3DP7A 3H3UA 4Q4ZF 1ZG1A 4GDFA 2XGDA 1U5TA 2O8XA 1UAAA 1HKTA 4CYCB 3JRIA 1ZAOA 5GTHC 1TP4A 3LL7A 3NRVA 3K4JA 2AO9A 3OYKA 1Y1WJ 3OYAA 3C1DA 2UUZA 2DQLA 5EEHA 1APLC 5C44J 1KQ9A 5GAGJ 3WTWC 2NVQJ 2ISYA 5TRDA 2CUFA 3P7NA 3CUQB 4U7BA 3LQQA 1YI2I 2R7VA 3M8JA 4Q5SF 2X1DA 4FX4A 4CCNA 3VDXA 1IV8A 3H3VK 3I55I 2DCEA 4ENNA 2VKHA 2QUFA 1FZPB 3Q3SA 1S5LC 1POGA 2EZKA 4B1RA 1FMVA 3VEPA 1S6LA 3BP8A 5CLSA 2QCOA 2DMUA 5HNHA 2DQRA 1P7IA 5B1BH 2KMUA 3PIOF 4JP0A 2KJBA 4EVIA 2A69F 2DFHA 2VT2A 3OS2A 1YLFA 5HODA 4C3IJ 1T95A 3HOYJ 2K40A 4L9TA 4AIKA 3RQIA 4Y7NJ 4XOTA 5CVRA 3M07A 4KYWA 2XRNA 2OCCH 3GFIA 3HC7A 3K4LA 1OCZH 3HOTA 2JQ7A 4IKFA 2YSRA 1K78A 3JTHA 2FMYA 1X4PA 1OISA 2LMDA 1YX5A 1IUYA 2VUMJ 1E0EA 3ASOH 4A5MA 1R4MB 2GOMA 1CQTA 3BT9A 2RNJA 1MZBA 3BQYA 2K4BA 2YU9J 4A0ZA 2CQQA 4C9YA 1RR8C 3WTVC 1MBJA 1ZR4A 4Y3OA 4E7JA 4A0YA 1HKSA 2HFHA 2EINH 3SEQA 2LTPA 3MKLA 4MNUA 4OOIA 1HBXG 3DWLE 5F0HA 5LRSA 3ZP5A 3WHBA 4A3CJ 3OIPA 3OYIA 4BL0B 1HOMA 3WG9A 4GYIA 2PJRB 2QQBA 1ZTRA 1OCCH 5J8FA 2RQQA 3C18A 1GUUA 2RAEA 4LG3A 1K83J 3CUQC 4QPOA 4NQWB 4L0ZB 2E2IJ 3ABLH 4R8HA 5DM6F 1D8JA 2VN2A 2DJIA 2I10A 3DEWA 3P9CA 4PJMA 3CCEI 1JJ8C 2Q0OA 4KJZA 3MVPA 4F91B 1A6QA 3KX2A 2E34A 2ZJQF 1QRYA 4ESFA 1X4OA 3M8EA 3W2AA 2FSWA 3K70C 4MTDA 3FK7A 5FFXA 1W5TA 3BZCA 1ONVA 3BDDA 5D4RA 3FBNB 1J5YA 1Z77A 2HVQA 2CJJA 3SFIA 5ICGA 3KZZA 4XKBA 3CQZJ 2HKOA 3DXJF 5C4JJ 1MH3A 3KLOA 3KPHA 4XM3A 2K3PA 2Y31A 3DPUA 1ORKA 4RGRA 2MBFA 3RPQA 2NOGA 2WC2A 1IJWC 4XONA 1A36A 2ELKA 4RDUA 3TO9A 4O5VA 1K78B 2VONA 4QLCU 2V79A 3WTTC 4A3JJ 4OMZA 1SD5A 1WJBA 5D5UB 3CP8A 4XSZF 1T2KA 2WY8Q 3BR6A 2LH9A 3CMEI 1TNTA 2WAQA 2XAUA 4P1WA 1W36C 4Y52J 2DW4A 3WU1B 2GWRA 3LSMA 5B5EC 1LEBA 3IP4B 4B3XA 4IX7A 2V6EA 1F36A 2BYVE 3BG9A 2IGMA 4FX0A 4KN7X 4EEFG 1KGSA 1R1UA 4WF2A 2DU9A 1X3WB 1YIOA 1OCPA 4NDLA 3BQZA 3BTIA 2WV1A 4B8XA 3O3KA 5E8GA 2D2WA 3OL4A 4LITA 2RNGA 3DTEA 4QWQA 2A05A 3W3CA 3DU5A 4U87A 1JJ6C 1TWCJ 4C2UA 2CRGA 3GFLA 1B72A 3I58A 3AG1H 4BBSJ 5CJ9A 1BI3A 4M72A 4XICA 2ZMEB 1B72B 4DBRA 1VF9A 3MEXA 4BDZA 5JI6A 1OCRH 4HYEA 4ZTJA 1U8BA 4F93B 3IH3A 3OYHA 5K5OA 2O0YA 1BW6A 3CDIA 1RNLA 5K5RA 2CV0A 1S9HA 4KT5C 1SANA 3OMYA 1J75A 4HNUA 2QQ8A 3HUGA 3VYTB 3PSFA 5DUIA 2DPUA 1BM9A 2COBA 3RZDJ 1X2NA 4RA2A 2FE3A 4A6DA 3V8JA 1FBUA 3F21A 2F6CA 1XSXA 1BN5A 5GPCA 3H9GA 3FZVA 2FMLA 3MZYA 2AQEA 3E7LA 2KIFA 3FIWA 2ZNZA 3SZTA 5GTIC 1BIBA 2GIZA 1X1CA 1BOBA 2K9NA 2PJRA 4DGWB 4XRMA 1WCMJ 3OYEA 1IF1A 1KU2A 2FD5A 2GXGA 3M1EA 3ZQHA 5EDNA 1ETOA 2DPDA 3ZN1A 2DA4A 2COMA 2NNYA 3OOPA 4BEHA 1GXPA 3TMOA 3TKYA 3RYPA 2EPFA 2FNPA 2IA2A 2IA1A 2E2HJ 1HW5A 3QWLA 2CS3A 2K3FA 4M9XA 4D1QA 2L7MP 4I76A 1VQ7I 2DXIA 4PDKA 2ADUA 3V4GA 2AHQA 4V19K 2XAFA 2L4MA 4LFUA 2TCTA 2W57A 4G7HF 4HF1A 1WKMA 1FSHA 2E36A 4FE7A 4BE2A 1OKRA 4N9IA 3RCOA 3UKGA 3KLNA 3LFKA 4P96A 4Y17A 1ACIA 1QA6A 4MEXF 1FOWA 1ERDA 3GUDA 5FKMA 1G3YA 3DTKA 3ELKA 2CQ7A 1D1BA 4YFKF 3JRFA 3K4CA 4U0VA 1YYVA 4KDPA 3FXJA 1HDDC 2EILH 2LNBA 1Q1HA 2IS6A 1FSEA 4M6XA 1TWHJ 2OA4A 2R7FA 5BPDA 1T0FC 3QQAA 2P7VB 1G3SA 5A2QK 1X1AA 4PJNA 3JW4A 3FX3A 3KZIC 1DGRM 2X51A 4ITVA 3I64A 5TJJA 5ICEA 3K0LA 1UZCA 1SVLA 2O03A 1XCVA 1WJFA 3M9AA 1ETKA 1T6SA 3HPGA 5E79C 2O7OA 4WCGA 2K4JA 4L5JA 2UWMA 1JI8A 1KONA 1WGXA 1W0TA 3FF5A 3IRQA 2Q2EB 3K4KA 4GYGA 1H88C 2Q2EA 1IN7A 4HSTA 2QBYB 3L2VA 3F0CA 3PQJA 4BJ6C 3PUFA 2FQ3A 3PNYA 3OYNA 4BE1A 3S8PA 2HEOA 3S16J 1BI2A 3LSKA 4CA0A 2OPTA 1O4XA 4AC0A 2E35A 2VC1A 4Z2YA 3S32A 4GXOA 2PN6A 2DYRH 1U5TC 4WXHA 5E3OA 3I5UA 1GVJA 1UELB 3HTUA 3LWFA 3GMEA 2VJJA 1K4SA 3FMQA 3LA2A 4Y33A 1VI0A 2LSOA 1BJZA 1TQPA 5IOZA 4JOMA 2BE5F 3AKZA 3DLLF 1D5YA 3W2VA 3OSFA 3HOZJ 2IGKA 2I8DA 1SFUA 2Z2SB 1MBHA 3F6VA 4WXDA 3L2CA 3S1QJ 4A93J 1RRJA 2EH3A 3H1CA 4Y13A 4ZJZA 4D5CA 3LAPA 2HR3A 1WQ2A 4UXNA 2JTVA 3OYFA 4NB5A 2GQQA 2R7XA 1KZHA 3DKYA 3KP2A 3PFYA 1IN4A 2KRCA 2EZIA 4EM2A 3CCRI 3CO6C 4IHXA 1XGOA 1PP7U 4IJAA 2R7TA 3MD2A 2A5WA 3WGIA 2A5YB 2LP0A 3FISA 1SAXA 1TTYA 5LHGA 3G71I 2D5VA 2R5ZA 1XC5A 4X0GA 3VPRA 2R5ZB 2JJ7A 3ZRGA 2VIXA 3V42A 2VXZA 4LLNA 4C2MJ 2CUJA 4G9YA 1IXCA 2BBYA 3S1RJ 1QPIA 2RN7A 3BCBA 3K1MA 2D1VA 4DYQA 2HDDA 1SFKA 2H09A 2M5WA 2IS2A 2BHZA 4MEYF 4A2UA 1MSEC 1U9NA 4UUSB 1HF0A 3K4MA 1T98A 2DO7A 2HNHA 3EDPA 2W85A 3BZKA 3FXKA 5FFZA 3G73A 2R5YA 3TEDA 1P9QC 1MBFA 2DOFA 1ZH5A 5E18F 2XVCA 2KDOA 3HZJA 2NAZA 1GV2A 2X6OA 3LSRA 2PJPA 2DA1A 1X1BA 4ZDLA 3MKYB 4HQEA 3GLXA 3HDDA 4LD5A 1GV5A 2KQRA 2VI6A 1FTZA 2H6CA 2IA0A 1WVRA 2VOPA 2MSYA 3CESA 2OV7A 3LSHA 4HAMA 2I5UA 2RV8A 5C3EJ 3M8FA 4CICA 5J8CA 2X6WA 4JQFA 4M3DA 4Q47A 2UXXA 2QA4I 2WAEA 2VJ4A 2CMPA 2BGCA 2DI3A 1RETA 3F8BA 5HS7A 1PP8F 1Z7UA 1BR4A 2DK5A 5L3CA 2PEXA 4HPQA 4BU2A 2LKXA 3CUOA 5JR3A 2P5KA 2E2JJ 4IHTA 1OYIA 3EPZA 3TW6A 2FOWA 3O6BB 3AFHA 3I71A 1SVOA 2DT6A 1DPRA 1J7KA 4B48A 1T39A 1MDMA 1BC7C 1UHMA 1I6XA 4A3LJ 2CW0F 1RKTA 1VQNI 4NUBA 3A1YA 2P6TA 2ICWG 3HB9A 1C0WA 5CQEA 2HQAA 1J2XA 2JA2A 3CTAA 3KP6A 3NARA 4KUMA 3ZGKA 2HPMA 4XKVA 3EYIA 3KEYA 5J6XA 3I4NJ 3ERED 2ECBA 2FA5A 1LFUP 4RBOA 1Z21A 3E5UA 2FX0A 2CW7A 4E7ZA 2O8KA 3JRBA 2O9LA 1L0OC 2K9QA 3ML6A 2ID3A 4BQAA 4NC6A 1RZ4A 4BJTA 2WA0A 3TL4X 4BBRJ 4BHCA 2GM4A 2HQ5A 1WH5A 3CZ6A 3M4OJ 1IW7F 4UUSA 2IS1A 4G6TB 3AG3H 3D0SA 4RGXA 3ZQQA 3REOA 2CQNA 3FWEA 1D5VA 2DLLA 1IGNA 2HXOA 1B1BA 5H20A 1G59A 2LD5A 1GT0C 1MKMA 2LF8A 2ID6A 3H92A 3CCYA 3PQKA 2XF7A 1YW9A 3P9KA 3CD6I 1FX7A 2QENA 2JUGA 2VBYA 3T0YA 5HDNA 2FBHA 3PNVA 5EZGA 1HSJA 3I3LA 3IH2A 1WJCA 3K1NA 3SZPA 1IAWA 2R7WA 1HLVA 4MTEA 1S7AA 2Z99A 1U6GA 3F22A 4A3GJ 3HOVJ 3U2RA 2D1HA 2L9NA 4GGGA 3OYJA 4O3MA 5A2QZ 2EZHA 1GLNA 4IL6C 5J3LA 3CCMI 2TDXA 2EFPA 5GAEJ 3A4CA 1DU0A 2H1KA 2M1BA 3S3OA 3JRCA 4R1HA 2K9LA 2LY1A 2NOJB 2M4KA 1P4XA 2HTSA 3GZ5A 4CCJA 4HLXA 4ZYHA 4PK4A 1MJBA 1XGNA 1MBGA 4IHVA 3LSGA 3OIQA 2EFNA 2Y0SN 4LLGF 1PDNC 1P4AA 2XC7A 2VBXA 3LSIA 2BXYA 3DKXA 1FYMA 4IVNA 1W36D 2Z33A 1QQIA 3ZMZA 1UJ8A 3LSTA 1VFCA 3GEZA 3KFWX 3WTYC 2GAUA 2HZDA 4ENJA 5GADJ 3N05A 4UVAA 1RUOA 1MBEA 3ABUA 3GTMJ 1D3YA 2BXZA 3RTRA 3PFIA 2E7XA 2DYSH 3WE2A 3S1NJ 4M6VA 3I59B 5BNGA 3R0AA 2LKPA 4EATA 5LHHA 1T0FA 1VQKI 4M9ZA 4G12A 1VNDA 2OU2A 3OV8A 3Q9VA 2XIGA 4M71A 1IRZA 5D8LB 1MD0A 5CKTA 3E6DA 3QPTA 3QYBA 2P6SA 1EH7A 3G3ZA 1U2WA 1ZKGA 2YR2A 3WTUC 1YE9A 4U0YA 2XAGA 1Z6RA 1IC8A 3QU3A 3GTQJ 5AIPA 1LFPA 2M30A 2XSJC 5FLMJ 4HV5A 3NWTA 4XKWA 5HDGA 3ECHA 2BV6A 4KIFA 4M3EA 4EM0B 1SC7A 1H8AC 1F4KA 4XRFA 5M5YJ 3A0HC 3WE3A 1PVEA 3BTCA 3A0BC 2X1CA 1A6IA 3VYUB 4UB8C 1S72I 4AIDA 3S15J 4UVBA 3JAMK 2XPUA 2PLYA 3OWTA 2JZYA 4ZYEA 3OYDA 3U1KA 2OD5A 4KICA 4AM3A 1TT0A 3H3ZA 3HRMA 5DD4A 2MFZA 1A31A 2HI3A 1WJAA 4S0HB 2FNAA 1TNSA 2ZJRF 4I99C 2DMNA 4DOZA 2LYCA 4U0WA 2WB1A 4KIBA 4CHUA 2KHMA 4FTHA 1R5HA 2QQ9A 4CSWA 2QWWA 2NVXJ 1LDKB 1V5GA 1PUFB 3KYLA 5HLTA 1TWGJ 1UHSA 3FXRA 3WODF 4A5NA 4G94A 4NBQA 3J80K 2ECCA 3SDBA 3F23A 1HW1A 4YFXF 1FP2A 1TBXA 4DNCA 3T1BA 3MQ0A 1F5TA 3E5QA 3BG6A 2M45A 4HX7A 4MQVA 5F08A 3WHCA 3OOUA 1V5FA 3KP3A 5E3LA 1LE8B 5ICCA 1RUNA 2PI0A 1X3UA 5L3GA 2HQNA 3CJNA 3R6SA 4AUXA 2HVRA 2FRHA 3FKJA 2KRHA 1BJAA 2E71A 2CO5A 4IHSA 2BEOA 2L9VA 3D1NI 2CQKA 3ZQLA 4IRHA 1XD7A 1W7PB 2LG4A 2FJ1A 2K02A 4CGZA 2XF5A 1A5JA 1IRXA 5F6FA 5LEJA 3MFKA 2CGPA 2JPCA 1T08B 2RDPA 3CP2A 1DU6A 1SFXA 2WAQN 4F3QA 4UB6C 3ISPA 3PO2J 1KA8A 2W24A 5AONA 4BXUA 4E6KG 2IT0A 4CZCA 4LB5A 1O7LA 3BOQA 1QZZA 2DT7B 2EQRA 2VQCA 3L1PA 1H0MA 2WV0A 1YX3A 1REPC 4ZZLA 1JKOC 2HKXA 1LDDA 3GXOA 2VODA 3G2BA 4D0PA 3SHFA 4P55A 3KIOA 2EB7A 4P9FA 3S2WA 3ZMTA 4IRGA 2O3FA 4YRVA 4GCVA 3L2QA 4ZC3A 1CF7A 4L9NA 4AVZA 4OIOF 3RKQA 1XSDA 3HSEA 2Y9ZA 5GPAA 3RSNA 4C3JJ 2F5EA 1IV6A 3I59A 4BY1J 1ZREA 2HOTA 2E60A 1VQPI 4HG2A 2MLGA 1EA3A 1USSA 1Z1DA 2VKDA 3HGGA 4B47A 4DIQA 5KAFC 4DYRA 2V9PA 1B6AA 1WI3A 1FT9A 2ELHA 4A3IJ 4KMUX 2OQRA 2ZKZA 3FDYA 4DJAA 3VYRB 2K5CA 3D5SC 2P7CB 2XPVA 1P2FA 3ZQGA 5LD2C 2EIKH 3AL0B 4X1EA 2XGEA 2P81A 1JTXA 4N4OB 5LRRA 5JHFA 4BE0A 4BXFA 2FUG2 1K6YA 1MMDA 2QKLB 3HRTA 1R9TJ 2VJ5A 1IRGA 5FROA 2KP6A 1TW3A 1AOYA 2M0MA 2VC0A 3S93A 5IT3A 1EF4A 1LDJA 4AU7A 1VQ6I 3KP5A 5JVGF 1XSVA 3TGNA 5J1UA 3HYIA 5E20A 1VQOI 3HL2A 4G7ZF 1IG7A 5DM7F 2R7UA 4M3FA 3TO7A 1FY7A 3OIOA 4BXXJ 4AD9A 1ETXA 2LR8A 3AG2H 3H0GJ 4AYBA 5IYCJ 2E5NA 3BR3A 1WRJA 3MWMA 2F5FA 2XUBA 1IRFA 1XN7A 3FM3A 4E7IA 4C3HJ 2X6YA 4HQMA 3RYRA 2M0CA 5EG0B 5FJ8J 1RIOH 2OF7A 3R61A 2WAFA 3G4SI 2VE9A 1AKHB 3VOEA 5E3MA 1T8IA 1AKHA 3F8CA 2KIMA 3K9TA 3HPHA 2F4IA 4IEJA 3GW2A 1E3OC 2XV4S 3CMMA 3EUHA 3MAJA 1YHQI 3PUBA 3L2RA 4CCMA 1K79A 1IN8A 3S17J 4BAYA 2C6YA 2V9KA 1SFEA 4BNCA 3V7SA 3BTJA 4M3GA 1TC3C 3FXQA 4XORA 2HXIA 4UUTA 1FP1D 2JRMA 5DTDA 1FC3A 2A6TA 4II3A 3LMMA 4YFNF 1OMIA 3MZ8A 2JA7J 4RM2A 1BR2A 5K7HA 3L2UA 3RDIA 3CDHA 5FKOA 1HCRA 1KYWA 3TDUC 4GO1A 1BI1A 5HVQC 2CW8A 3ABMH 1DPUA 2DK8A 2L4AA 4J01A 1QGPA 4NNJA 3WU2C 4U7DA 2JA5J 3DKWA 1X1PA 1QHHD 2H6BA 3UR3C 2CYYA 2DOAA 3PIPF 3Q0VA 2MH2A 1IDZA 3BR2A 2EA4A 4RS8A 4N4NB 3E6BA 1FIAA 4E4HA 5E1WA 3HSRA 3LAJA 5ERIA 4BH9A 1BL0A 2KIQA 3E97A 2WBMA 4XLEA 5DUKA 2NVTJ 3ZPLA 2EV6A 3H0DA 2VQHA 1LVKA 3AG4H 1I39A 3F3XA 2EIMH 3I56I 1OYWA 1P4WA 3E1SA 1HA8A 4XL9A 2DFFA 3CUQA 4MFEA 3J80Z 2OBPA 1FYKA 1WH7A 3RIRA 2BOLA 4HZFA 4KFCA 4OIPF 2Y9YA 3ZMDA 3GF2A 5M3FJ 2K27A 4A12A 3NWSA 2L9SA 1CGPA 1I1SA 3FMSA 2HGCA 2ZFUA 1WFXA 4L5EA 3ABKH 3CMAI 3ERMA 3L7WA 4OWRB 1SMTA 4MHGA 3S3MA 4LK0F 2XF6A 1O3SA 1SMYF 1BW5A 1QZEA 2V1XA 4I98B 2X1EA 4DBQA 1IO2A 5FB2A 4HSRA 1EJ9A 3MN2A 2L3DA 2IPQX 2PBIA 2EWNA 2BVLA 2TRTA 4AYBN 2EJRA 4D9JA 5LEKA 4ETSA 1I3AA 4BQNA 2WB1N 5TISC 4WWCA 3GFJA 1OFCX 2J5PA 4B43A 2DA7A 2QEXI 1FTTA 4D7MA 2CSOA 1ULYA 4HDUA 4MQ9F 2LVSA 3W2WA 3T8RA 5HDKA 1J09A 1RC9A 4EGYA 1BIAA 9ANTA 1MMAA 3L2WA 2NS8A 4XLFA 1A35A 1ON1A 1Z6TA 1XDSA 2FEZA 1XGSA 2MD0A 1MH4A 2V9VA 2XB5A 1W7PD 4PZJA 5TGTA 3W6KB 3C7JA 2P4WA 1ZHFA 1ZG5A 2E1CA 4DYCA 5KK1A 1UG2A 3A02A 2LLKA 2EK5A 5J4YA 3IV5A 3EUAA 5B1AH 2QKMB 3JRDA 1U5TB 2X85A 1Y39A 2Y48A 1ZYRF 3KEOA 1TL8A 5L3FA 2X6XA 2VQLA 4CXFA 1MJAA 3QPLA 1N25A 3KE2A 1T56A 1TLHB 4M3BA 3T5XA 2LFBA 3HSFA 4XRSA 2V4JC 3ZMUA 4ZTFA 5HS8A 3R60A 3OR2C 1FOKA 1R6RA 4V2FA 3E5XA 2ACJA 4ASNA 4WXCA 3BWGA 3PL8A 1KU3A 1ZLJA 4ESJA 3S2DJ 1B9MA 1BI0A 1Y6IA 3Q0WA 2H1LA 4DQ2A 2K9MA 3CC7I 2JVHA 1TQIA 1Z91A 3HG9A 3ECOA 2ISZA 3V7CA 1P7JA 5K1YA 2ZNYA 4M73A 3IH4A 1WZ2A 2BY3A 3IUOA 5HS9A 3FHZA 2JMWA 1V5EA 2FQ4A 3WTZA 5LHIA 2E5ZA 4RGSA 2RREA 2GIVA 5LGNA 3HOWJ 4BDYA 3HKZA 4LIVA 4ENMA 4HOBA 5ILUA 2CV1A 5FLXZ 5IPAA 1FEXA 1B4AA 1YQAA 2DMPA 4Q48A 4XN0A 2V6CA 3LSJA 2HOEA 4BYYA 3QP6A 1XMAA 4DZJA 1ZRCA 3JRHA 4HEA2 4KITB 2IXSA 5J4VA 1D0ZA 1OJLA 3EYYA 2F5CA 4MIMA 3RQ4A 2CFOA 3JRGA 2KZGA 5H2FC 3KCCA 3D5LA 1RI7A 3S14J 3QRFF 3ZMVA 2ZBKA 3ZQ7A 5L3EA 3A2KA 2O61A 5EG0A 3MKWB 4BKXA 4LJZF 5F04A 2BHYA 1SAUA 3L00A 3W6VA 5AIQA 2MLKA 1E3HA 4UV8A 1S29A 1BC8C 3K70D 2KJCA 2GXAA 2HVSA 2IEKA 4I0AA 1UMQA 1W4MA 2G9WA 3CCQI 1I6HJ 3MKZA 3FHNA 2Z5UA 4G8XA 2ZSHB 3HKZN 3H5NA 2L7FP 4XK4A 3BTLA 2P8TA 5JHUA 3RZOJ 5EYRA 5L3DA 1B59A 1X3ZB 3Q9SA 3N97A 2FBIA 4XQFA 2QVOA 3DLAA 2K85A 1O57A 2CUEA 2CUZA 3A03A 3OR1C 4O6JA 3HIFA 1KQ8A 2NXNB 2Y30A 4YIIA 1XS9A 3O8HA 4XN3A 4I6ZA 3HHHA 5F64A 2KDZA 3ZQIA 2OAZA 3HM5A 1BBYA 2STTA 1Y1VJ 1YITI 2G7UA 5BQTA 5HLIA 2MGQA 2PMUA 1G6NA 4PJLA 3BPVA 3FKIJ 4HNTA 5FLXK 1Z7LA 2AXLA 5FRMA 1HQCA 3AL0C 5LBQA 3IC7A 2JK3A 2OTLI 3I4PA 2ZMEC 4CYCA 3C2GA 4OIRF 2OC6A 3WTXC 1JE8A 3B02A 1IXRC 1ZGJA 2YPRA 3W6JB 1UB9A 5HLHA 1STZA 1U0JA 3FXMA 2VXDA 3CCJI 4RM3A 1QVTA 2ZXIA 1Z05A 3WU0A 1OQYA 1G4DA 3H5RA 5BMZA 1JKRC 2JSPA 2VQGA 4U88A 3P9IA 2UV1A 3O2PE 3RI4A 4JYKA 1VQ8I 1J59A 3L9FA 4G7OF 1SD4A 2DMTA 1NG7A 2XB0X 1VQLI 2R5YB 3DCFA 2QSGX 3PO3J 1IZ1A 1R4NB 2OQGA 2XSDC 3KETA 3QU6A 2QBYA 4KNYA 4OU0A 2HWVA 3RPUD 2PX9A 3IAS2 3R0JA 2L01A 5D5WB 2EV0A 2FOKA 2M34A 2QSHX 4AWXB 2XKPA 1D0YA 1ZRFA 3BR1A 3DBHB 3K2ZA 2ZMEA 3RKWA 3ZCOA 3OYBA 3CC4I 4Z6YA 1YRNB 3CMYA 5BOXA 2ZO4A 5DV5A 1DUXC 3KEQA 4HV6A 1UG0A 3CCLI 4EGZA 4QSHA 3B73A 3GYHX 1RKWA 3F8NA 4A3EJ 3PM1A 1ENHA 4JX4A 1DGWY 2DA5A 5J1YA 5LFAA 2R7QA 5EEGA 4RAZA 2MABA 3P5JA 2AS5F 2BY0A 5E8IA 2EBIA 2OCEA 3CLOA 4UV9A 1UHWA 1V3FA 2K86A 3GTJJ 2QQAA 3WGGA 5FKKA 3JTGA 1XMXA 4BY7J 4YIRX 4EM1A 2KPMA 2CG4A 2HOAA 2M7AA 1WHUA 5F1JA 1OR7C 4HNVA 1MJ9A 4W1UA 2A6HF 3ASNH 1W5CC 1XPXA 4BQQA 1JKPC 2XHKA 4BEHB 2HYGD 2KISA 1OR7A 1YW8A 4W97A 5J1RA 4J19A 1G2HA 4AVPA 1EV7A 5EZHA 1SFOJ 3E0JB 2L2OA 2Q1ZB 1JT6A 4I01A 3G1MA 3VSLA 3CCVI 2NVYJ 2MG4A 3UNGC 4FCYA 4IRIA 2DFEA 3ABTA 1I3QJ 2A07F 2BY1A 2V26A 2IP2A 3PNTA 2GLOA 1OLTA 3RKXA 1LUJB 2XAQA 2XAHA 2DTRA 4LK1F 3G6EI 2R93J 3M7GA 4PCQA 4LOCA 2CV2A 1TT5B 2IBDA 4LGWA 1N78A 2LK2A 3GTOJ 3RKYA 1XX5A 4PUSA 3CO7C 3OYCA 4ENKA 3DQVC 4DW6A 3S1MJ 3OSGA 1FOXA 1DDNA 2X0LA 1EH6A 1YG2A 4WX9A 5K7FA 1MMGA 2L02A 5CYVA 2KT0A 2HDCA 4A6EA 4RAFA 3HJEA 2JSCA 2H8RA 4XR6A 2ME6A 1MSFC 2L7ZA 2P5LC 1VTNC 1H9GA 3RJPA 4QPQA 3BJ6A 1F43A 2UXNA 3J81Z 1JKQC 4HA8A 2QYOA 1BA5A 4IQ4A 3TDZC 2QF7A 4XLPF 3GZNB 4UNOA 3D5RC 4A0XA 1K4TA 1QZYA 5F1RA 2NRAC 3QYEA 1FPQA 1ODDA 2KZVA 2H8WA 3F9KA 3K10A 2IJLA 2FF4A 1QNTA 5EEAA 1Z0XA 2VPLA 2OZUA 5M5WJ 1GHCA 4E7KA 3JSPA 5D5VB 2X48A 1LEAA 3JCUC 1YTYA 1R00A 4NQWA 4XMYA 1S8NA 2ELJA 3HOUJ 3BPXA 1LNWA 4TV7A 3ULQB 2ZSIB 1JUSA 4CH7A 1YRNA 1A04A 5CVIA 4CYDA 2JRTA 4EV0A 4XKCA 5FKLA 1AHDP 4BS9A 3TBIA 3EETA 1JGSA 1XCBA 4RGUA 5D6EA 1R5ID 2VT3A 1R58A 3HUGB 2LREA 1GDTA 2Y75A 2EZLA 4A3KJ 1KU7A 1X1DA 3R4KA 1K61A 4IOAF 1QO0D 3K1PA 2Q8KA 4OMYA 2NYXA 1FJLA 3SXYA 1TWAJ 2YX7A 4XLCA 3BC8A 3K6GA 2W82A 3QAHA 2JT1A 3IRRA 1OYYA 3DBLB 1YS7A 3K7AJ 5HOOA 3BR5A 4F52A 3KP7A 2QZ8A 5D6FA 5DYMA 2V7FA 4EJVA 3SYTA 3VWBA 3K4NA 4FE4A 5DD8A 2L7KA 3LQRA 5DCFA 2MC3A 2FXAA 5FO5A 2FBKA 4BHBA 1U3EM 2DJNA 3Q0UA 1IN5A 2XROA 3CJQB 1TQMA 4N9HA 1X58A 1DQUA 1MNEA 5BS6A 2VL8A 3GLLA 1JHFA 2HDWA 3ESWB 2HS5A 4YIFA 2QM3A 4IQJA 4IZZA 2ETHA 3C3WA 4YG2F 1YFHA 4Y15A 2O6GE 1WWXA 3CLQA 2MA3A 3HTSB 4I09A 5B66C 1I50J 2LY2A 4BUPA 4CZZA 3LA3A 3ZMSA 3GWZA 4PSXA 2HZTA 2L54A 3LOCA 3GTKJ 3OY9A 2P5VA 3ZQFA 2Z9OA 4DZPA 2L9RA 4BQOA 2AXTC 3FXUA 3ZXSA 1ZR2A 4FQGA 1SVMA 3B6AA 2R4GA 1ON2A 2Y0SA 2RKHA 2K9SA 4I2OA 1P92A 1TW2A 4QTRA 1W0UA 4KIGA 2DA2A 1WSUA 2CH0A 1UCRA 1IXSB 1E2XA 3KP4A 2VLAA 1W7PA 4I02A 3S3NA 4BACA 5ICFA 1IN6A 2EFWA 1YW7A 2LBFA 1FBQA 2Y2ZA 2STWA 3I53A 1O7FA 1YJNI 2KIUA 1ETQA 3TOBA 5CPRB 3COAC 1MMNA 5J40A 3ROUA 2V1NA 5KNLA 1OCTC 1YJWI 2RVCA 3BR0A 1EKEA 2LDUA 5CQGA 2WADA 5E1ZB 3TO6A 2AQFA 5DS9A 3GTLJ 2VJIA 4JBAA 1S3JA 3TP3A 1D8KA 1F9NA 4WK8F 1NG6A 2ZCWA 1E17A 4RB2C 1R1VA 2E7WA 3IKVA 2DBBA 4CCOA 3LFUA 2XDVA 5D8KB 2DTZA 1WI9A 3BG7A 1MW7A 3CC2I 3DTIA 5JVTA 1CF7B 3AAFA 2ZJ2A
chains in the Genus database with same CATH topology
5DCMB 1XMKA 4LLLA 1U78A 2EFOA 2ZFWA 4FHTA 2DFIA 2UZKA 2A61A 3V8KA 4R79A 3VFZA 2KKOA 4HLYA 4EQQA 1USTA 3F72A 3J81K 4M6YA 1LJ9A 4G6QA 5E1XA 1LQ1A 3QPHA 1LB2A 4ZH4F 4S05A 2HQRA 1KYZA 2WWYA 3VB2A 3ZN0A 2PQ8A 1BOAA 2XAJA 5H6QA 2M8EA 5HLGA 1HKQA 1EH8A 5L3BA 1B9NA 1I1GA 4IXAA 3J7AO 5H6RA 2X4HA 1OPCA 2RC4A 1QPMA 4CDGA 1SD7A 1UFMA 2HTJA 3HOSA 2PG4A 3WGHA 5CVUA 3DEUA 1L3LA 2F5DA 2CFXA 2GZWA 4XBFA 3GVAA 2ZXJA 5DCMA 1S7OA 5LLQA 2W84A 4HW0A 4KMFA 2D45A 1T38A 2A68F 1W5SA 2GA1A 3GX4X 4BHPA 5E17F 3IWZA 5FGMA 3F8FA 5ILVA 4HX8A 3BZ6A 1Z9CA 1MGTA 4AIJA 1MDMB 2VBWA 2J5OA 1FLIA 6PAXA 3T8TA 3TOAA 4K2EA 4LMYA 3LA7A 1R1TA 4OINF 5IT9Z 1K6OA 2VBZA 3GO5A 3E3VA 2A3SA 3KZYA 4LB6B 5K5QA 4HF2A 3IHUA 2Y0MA 1ZN2A 4P5OA 3TQNA 2GXBA 2K7LA 3MCZA 1K7AA 3GZ6A 4NHJA 4RAYA 5FD5A 3JAMZ 4M9SA 5ILSA 1DP7P 5IT9K 1Y0UA 1XB4A 3HRSA 2DAOA 1ZLKA 3IKTA 5DDGA 4CO8A 4S04A 2HYFA 4H0EA 4JK1X 2RGVA 1R22A 4M74A 1R36A 2XGXA 5ED4A 4P9UA 4UVCA 4UUVA 2GA2A 4B09A 1KU9A 2FU4A 4HF0A 3DPTA 4L9VA 3BY6A 3K69A 1FYLA 1R7JA 3E6CC 2G7HA 1QBJA 1V4RA 4L18B 4ON0A 2E1NA 2V1UA 4RB0A 1P6RA 1JHHA 4ZZDA 2R3SA 3DF8A 2VOOA 2ESHA 3I0TA 4EJTA 1I27A 3DV8A 4ESBA 5KVRA 2LF7A 5D4SA 1AWCA 1J9IA 3IL2A 1SD6A 2PMHA 3L09A 1O3RA 1O3TA 2F2EA 2IVMA 4LG0A 4LG0B 1I5ZA 3U1DA 1ZGAA 1HXDA 5JFRA 4L5IA 4RB1A 1NHAA 5D5XB 4EJWA 4IF4A 4KN4X 2EV5A 2M87A 1ZRDA 4XSXF 4UHTA 2CWEA 1PUEE 1ZG3A 3RPUA 2Z3YA 1O3QA 2V1DA 4PGHA 4L0YB 2PFBA 2NNNA 3BROA 3FMRA 3SFZA 3NQOA 3N4MA 3NEUA 4HBLA 4F7ZA 2VE8A 3Q5FA 1ZARA 2XKOA 4FT8A 1YO5C 3MZHA 5CVVA 4G6DA 4OIQF 5LGTA 2B0LA 2WTEA 1H9TA 1LVAA 1U8RA 4MGRA 2DT5A 1KQ0A 4ZYDA 4I0BA 3V8LA 2EFQA 2IRFG 4PGGA 3HRUA 1XGMA 2W25A 4L9JA 1J0RA 4RB3C 2YX4A 3VODA 2JPBA 3BJOA 2ESNA 4EJUA 1FBSA 2XASA 3E6MA 2RQPA 3SQNA 1G3TA 3U9GA 1HSTA 4N0BA 4E70A 2A6EF 1F1ZA 1G3WA 5CVJA 4XLNF 3I54A 2MD5A 3HHGA 3QOPA 2H27A 1JXSA 1GXQA 2OZ6A 4EMSA 2R7DA 3FM5A 2YU3A 4I7HA 3DFGA 5BPIA 4AIHA 3WTSC 4HDVA 2KRFA 3QP5A 1HW2A 2EA2A 2H94A 3GFMA 3DPLC 4EJOA 5LGUA 3V7RA 4ZYGA 5FD6A 1R23A 3BJAA 3JSOA 2IW5A 2QLZA 1XDUA 4HX4A 1FWZA 1R5GA 2MH9A 1FNNA 3IWFA 3F6OA 3F8MA 3EQLF 5DEQA 1YS6A 4IPAA 4KA4A 2NS0A 3DP7A 3H3UA 4Q4ZF 1ZG1A 1U5TA 2O8XA 1HKTA 1ZAOA 3NRVA 3C1DA 2DQLA 5EEHA 1KQ9A 3WTWC 2ISYA 5TRDA 3P7NA 3CUQB 4U7BA 3LQQA 4Q5SF 4FX4A 4ENNA 2QUFA 1FZPB 3VEPA 1S6LA 3BP8A 5CLSA 2DQRA 2KJBA 4EVIA 2A69F 2VT2A 1YLFA 4L9TA 4AIKA 5CVRA 4KYWA 2XRNA 3GFIA 3HOTA 2YSRA 1K78A 3JTHA 2FMYA 1IUYA 4A5MA 2RNJA 1MZBA 2K4BA 4A0ZA 3WTVC 4A0YA 1HKSA 2HFHA 4OOIA 4MNUA 1HBXG 5LRSA 3ZP5A 3WG9A 4GYIA 2QQBA 5J8FA 3C18A 3CUQC 4L0ZB 1D8JA 4R8HA 2VN2A 3P9CA 2Q0OA 4ESFA 3M8EA 2FSWA 4MTDA 5FFXA 1W5TA 1ONVA 3BDDA 5D4RA 1J5YA 5ICGA 3KZZA 2HKOA 3DXJF 3KLOA 4RGRA 2MBFA 3RPQA 2WC2A 1K78B 2VONA 3TO9A 4O5VA 4QLCU 2V79A 3WTTC 4OMZA 1SD5A 5D5UB 4XSZF 1T2KA 1TNTA 2DW4A 3WU1B 2GWRA 1LEBA 2BYVE 4FX0A 4KN7X 1KGSA 1R1UA 4WF2A 2DU9A 1YIOA 4B8XA 3O3KA 5E8GA 2D2WA 4QWQA 3GFLA 3I58A 5CJ9A 1BI3A 4M72A 2ZMEB 3MEXA 5JI6A 4HYEA 5K5OA 2O0YA 1RNLA 5K5RA 4KT5C 1J75A 3HUGA 5DUIA 2DPUA 1BM9A 2FE3A 4A6DA 3V8JA 1FBUA 3F21A 1XSXA 1BN5A 3FZVA 2FMLA 3MZYA 2KIFA 2ZNZA 3SZTA 1BIBA 1IF1A 1KU2A 2GXGA 3M1EA 2DPDA 3ZN1A 2COMA 2NNYA 3OOPA 1GXPA 3TKYA 3RYPA 2FNPA 2IA2A 2IA1A 1HW5A 4M9XA 4PDKA 2ADUA 3V4GA 2XAFA 2L4MA 4LFUA 2W57A 4G7HF 4HF1A 1WKMA 1FSHA 1OKRA 4N9IA 3KLNA 3LFKA 4P96A 4Y17A 4MEXF 3GUDA 1G3YA 3ELKA 4YFKF 4U0VA 4KDPA 1YYVA 2LNBA 1Q1HA 1FSEA 4M6XA 2R7FA 2OA4A 5BPDA 2P7VB 1G3SA 5A2QK 3JW4A 3FX3A 3I64A 5TJJA 5ICEA 3K0LA 2O03A 1XCVA 3M9AA 1T6SA 4WCGA 2K4JA 4L5JA 2UWMA 3FF5A 3IRQA 4GYGA 2Q2EA 1IN7A 2QBYB 3PQJA 2FQ3A 2HEOA 1BI2A 2VC1A 4Z2YA 4GXOA 2PN6A 1U5TC 4WXHA 3I5UA 1GVJA 3HTUA 3LWFA 3FMQA 3LA2A 2LSOA 1TQPA 2BE5F 1SFUA 3F6VA 4WXDA 3L2CA 4Y13A 3LAPA 2HR3A 1WQ2A 4UXNA 2JTVA 4NB5A 2GQQA 3KP2A 4EM2A 1IN4A 3CO6C 1XGOA 1PP7U 4IJAA 3WGIA 2A5YB 1SAXA 1TTYA 5LHGA 4LLNA 2VXZA 4G9YA 1IXCA 2BBYA 2RN7A 3K1MA 2D1VA 2M5WA 2H09A 4MEYF 4A2UA 1T98A 2DO7A 2W85A 3EDPA 3G73A 5FFZA 1ZH5A 5E18F 2XVCA 2NAZA 2PJPA 4HQEA 3GLXA 4LD5A 2H6CA 2IA0A 2VOPA 4HAMA 2RV8A 3M8FA 4CICA 5J8CA 4JQFA 4Q47A 2UXXA 2BGCA 2DI3A 3F8BA 5HS7A 1PP8F 1Z7UA 2DK5A 5L3CA 2PEXA 3CUOA 5JR3A 2P5KA 4IHTA 1OYIA 3O6BB 3I71A 1DPRA 1J7KA 1T39A 1MDMA 1BC7C 1UHMA 1I6XA 2CW0F 2P6TA 1C0WA 1J2XA 3CTAA 3KP6A 4KUMA 3EYIA 5J6XA 3ERED 2FA5A 3E5UA 1L0OC 3ML6A 4BQAA 1RZ4A 4BHCA 1IW7F 3D0SA 4RGXA 3REOA 3FWEA 1D5VA 2DLLA 1B1BA 5H20A 1MKMA 2LF8A 3H92A 3PQKA 1YW9A 3P9KA 1FX7A 2QENA 2VBYA 3T0YA 5HDNA 2FBHA 1HSJA 3K1NA 3SZPA 1IAWA 4MTEA 1S7AA 2Z99A 1U6GA 3F22A 3U2RA 2D1HA 4GGGA 4O3MA 5A2QZ 2TDXA 2EFPA 2M1BA 4R1HA 1P4XA 2HTSA 3GZ5A 4ZYHA 4HLXA 1MJBA 1XGNA 2EFNA 4LLGF 1PDNC 1P4AA 2VBXA 1FYMA 4IVNA 2Z33A 1QQIA 3ZMZA 3LSTA 3GEZA 3KFWX 3WTYC 2GAUA 4ENJA 4UVAA 1RUOA 3ABUA 1D3YA 3RTRA 3PFIA 2E7XA 3WE2A 3I59B 3R0AA 2LKPA 5LHHA 1T0FA 4M9ZA 2OU2A 3OV8A 3Q9VA 2XIGA 4M71A 5D8LB 1MD0A 3E6DA 3QPTA 2P6SA 1EH7A 3G3ZA 1U2WA 2YR2A 3WTUC 4U0YA 2XAGA 1Z6RA 3QU3A 5AIPA 2M30A 4HV5A 5HDGA 3ECHA 2BV6A 4KIFA 4EM0B 1F4KA 4XRFA 3WE3A 4UVBA 3JAMK 2PLYA 2JZYA 4ZYEA 2OD5A 4KICA 3H3ZA 5DD4A 3HRMA 2FNAA 1TNSA 4U0WA 4KIBA 4CHUA 1R5HA 2QQ9A 2QWWA 1LDKB 3FXRA 3WODF 4A5NA 4G94A 3J80K 3F23A 1HW1A 4YFXF 1FP2A 1TBXA 4DNCA 3T1BA 3MQ0A 1F5TA 3E5QA 4HX7A 2M45A 4MQVA 3KP3A 5ICCA 1RUNA 2PI0A 1X3UA 5L3GA 2HQNA 3CJNA 3R6SA 2FRHA 1BJAA 2CO5A 4IHSA 2BEOA 2CQKA 4IRHA 1XD7A 1W7PB 2K02A 4CGZA 5F6FA 5LEJA 3MFKA 2CGPA 2JPCA 2RDPA 1SFXA 3ISPA 1KA8A 2W24A 5AONA 4BXUA 2IT0A 4LB5A 1O7LA 3BOQA 1QZZA 1H0MA 2WV0A 1REPC 4ZZLA 2HKXA 1LDDA 3GXOA 2VODA 4D0PA 3SHFA 4P55A 3S2WA 2EB7A 4P9FA 3ZMTA 4IRGA 2O3FA 4GCVA 1CF7A 4L9NA 4OIOF 1XSDA 3HSEA 2F5EA 3I59A 1ZREA 2MLGA 1USSA 1Z1DA 1B6AA 1FT9A 2ELHA 4KMUX 2OQRA 2ZKZA 2P7CB 1P2FA 5LRRA 3HRTA 1IRGA 1TW3A 1AOYA 2VC0A 5IT3A 1LDJA 3KP5A 1XSVA 3TGNA 3HYIA 5E20A 4G7ZF 3TO7A 1FY7A 4AD9A 1WRJA 3MWMA 2F5FA 2XUBA 1IRFA 1XN7A 3FM3A 3RYRA 4HQMA 1RIOH 3R61A 2VE9A 3VOEA 3F8CA 2KIMA 3K9TA 3GW2A 2XV4S 3EUHA 3MAJA 1K79A 1IN8A 4BAYA 2C6YA 1SFEA 4BNCA 3V7SA 3FXQA 1FP1D 1FC3A 4YFNF 1OMIA 3RDIA 3CDHA 1KYWA 3TDUC 4GO1A 1BI1A 5HVQC 1DPUA 2DK8A 2L4AA 1QGPA 4U7DA 3DKWA 2H6BA 2CYYA 2MH2A 2EA4A 4RS8A 3E6BA 5E1WA 3HSRA 3LAJA 5ERIA 4BH9A 3E97A 5DUKA 3ZPLA 2EV6A 3F3XA 1OYWA 1P4WA 3CUQA 3J80Z 2OBPA 1FYKA 3RIRA 4HZFA 4KFCA 4OIPF 3ZMDA 3GF2A 4A12A 2K27A 1CGPA 1I1SA 3FMSA 2HGCA 3L7WA 1SMTA 4MHGA 4LK0F 1O3SA 1SMYF 2V1XA 4I98B 5FB2A 2L3DA 2IPQX 2PBIA 2EWNA 2EJRA 5LEKA 4ETSA 4WWCA 3GFJA 2J5PA 2CSOA 1ULYA 4HDUA 4MQ9F 3T8RA 5HDKA 4EGYA 1BIAA 1ON1A 1Z6TA 1XDSA 2FEZA 1XGSA 2V9VA 1W7PD 4PZJA 3W6KB 3C7JA 2P4WA 1ZHFA 1ZG5A 2E1CA 5KK1A 2EK5A 1U5TB 2Y48A 1ZYRF 3KEOA 5L3FA 4CXFA 1MJAA 3KE2A 1TLHB 3T5XA 3HSFA 3ZMUA 5HS8A 3R60A 1FOKA 3E5XA 2ACJA 4ASNA 4WXCA 3BWGA 1KU3A 1ZLJA 4ESJA 1B9MA 1BI0A 4DQ2A 1TQIA 1Z91A 3ECOA 2ISZA 3V7CA 5K1YA 2ZNYA 4M73A 5HS9A 3FHZA 3WTZA 5LHIA 4RGSA 2GIVA 5LGNA 4ENMA 4HOBA 5ILUA 5FLXZ 1B4AA 1YQAA 4Q48A 2V6CA 2HOEA 4BYYA 3QP6A 1XMAA 1ZRCA 3EYYA 2F5CA 3KCCA 3D5LA 1RI7A 3QRFF 3ZMVA 2ZBKA 3ZQ7A 5L3EA 2O61A 4LJZF 3L00A 5AIQA 2MLKA 4UV8A 1S29A 1BC8C 2KJCA 4I0AA 1W4MA 2G9WA 2Z5UA 4G8XA 2P8TA 5JHUA 5L3DA 1B59A 3Q9SA 3N97A 2FBIA 2QVOA 1O57A 4O6JA 3HIFA 1KQ8A 4YIIA 3HHHA 5F64A 2OAZA 1BBYA 2STTA 2G7UA 5BQTA 5HLIA 2PMUA 1G6NA 3BPVA 5FLXK 2AXLA 1HQCA 5LBQA 3IC7A 3I4PA 4OIRF 3WTXC 1JE8A 3B02A 1IXRC 1ZGJA 2YPRA 3W6JB 1UB9A 5HLHA 1STZA 1Z05A 3WU0A 1G4DA 5BMZA 4U88A 3P9IA 3O2PE 3RI4A 1J59A 3L9FA 4G7OF 1SD4A 1IZ1A 2OQGA 3KETA 3QU6A 4KNYA 2QBYA 4OU0A 2HWVA 3R0JA 2L01A 5D5WB 2EV0A 2FOKA 4AWXB 2XKPA 1ZRFA 3K2ZA 2ZMEA 3RKWA 5BOXA 2ZO4A 5DV5A 1DUXC 3KEQA 4HV6A 4EGZA 3B73A 3GYHX 3F8NA 5EEGA 4RAZA 2AS5F 5E8IA 3CLOA 4UV9A 1UHWA 1V3FA 2K86A 2QQAA 3WGGA 3JTGA 4EM1A 2CG4A 1MJ9A 2A6HF 2XHKA 2HYGD 1OR7A 1YW8A 4AVPA 1EV7A 4I01A 4IRIA 3ABTA 2A07F 2IP2A 3RKXA 2XAQA 2XAHA 2DTRA 4LK1F 3M7GA 4PCQA 4LGWA 3RKYA 3CO7C 4ENKA 3DQVC 1DDNA 2X0LA 1EH6A 1YG2A 4WX9A 2L02A 5CYVA 2HDCA 4A6EA 2JSCA 2P5LC 1VTNC 1H9GA 3RJPA 3BJ6A 2UXNA 3J81Z 4HA8A 2QYOA 3TDZC 4XLPF 4UNOA 4A0XA 1QZYA 5F1RA 2NRAC 1FPQA 1ODDA 2IJLA 2FF4A 1QNTA 2OZUA 1GHCA 3JSPA 5D5VB 1LEAA 1YTYA 1R00A 4NQWA 1S8NA 3BPXA 1LNWA 4TV7A 3ULQB 4CYDA 1A04A 5CVIA 2JRTA 4EV0A 3EETA 1JGSA 1XCBA 4RGUA 5D6EA 2VT3A 1R58A 2Y75A 1KU7A 3R4KA 1QO0D 3K1PA 2Q8KA 4OMYA 2NYXA 3SXYA 2YX7A 3QAHA 2JT1A 3IRRA 1OYYA 5HOOA 1YS7A 3KP7A 2QZ8A 5D6FA 5DYMA 4EJVA 5DD8A 5DCFA 3LQRA 2MC3A 2FXAA 5FO5A 2FBKA 4BHBA 1U3EM 1IN5A 2XROA 1TQMA 4N9HA 5BS6A 1JHFA 2HS5A 4YIFA 2QM3A 2ETHA 3C3WA 4YG2F 1YFHA 4Y15A 2O6GE 1WWXA 2MA3A 3HTSB 4I09A 4CZZA 3LA3A 3ZMSA 3GWZA 2HZTA 2L54A 2P5VA 2Z9OA 3FXUA 1ON2A 2RKHA 4I2OA 1P92A 1TW2A 4KIGA 1WSUA 1UCRA 1IXSB 1E2XA 3KP4A 1W7PA 4I02A 5ICFA 1IN6A 2EFWA 1YW7A 1FBQA 2STWA 3I53A 1O7FA 2KIUA 3TOBA 3COAC 3ROUA 2RVCA 2LDUA 5E1ZB 3TO6A 4JBAA 1S3JA 1D8KA 1F9NA 4WK8F 2ZCWA 1E17A 4RB2C 1R1VA 2E7WA 3IKVA 2DBBA 5D8KB 1WI9A 5JVTA 1CF7B 3AAFA 2ZJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCM B;  1XMK A;  4LLL A;  1U78 A;  2EFO A;  2ZFW A;  4FHT A;  2DFI A;  2UZK A;  2A61 A;  3V8K A;  4R79 A;  3VFZ A;  2KKO A;  4HLY A;  4EQQ A;  1UST A;  3F72 A;  3J81 K;  4M6Y A;  1LJ9 A;  4G6Q A;  5E1X A;  1LQ1 A;  3QPH A;  1LB2 A;  4ZH4 F;  4S05 A;  2HQR A;  1KYZ A;  2WWY A;  3VB2 A;  3ZN0 A;  2PQ8 A;  1BOA A;  2XAJ A;  5H6Q A;  2M8E A;  5HLG A;  1HKQ A;  1EH8 A;  5L3B A;  1B9N A;  1I1G A;  4IXA A;  3J7A O;  5H6R A;  2X4H A;  1OPC A;  2RC4 A;  1QPM A;  4CDG A;  1SD7 A;  1UFM A;  2HTJ A;  3HOS A;  2PG4 A;  3WGH A;  5CVU A;  3DEU A;  1L3L A;  2F5D A;  2CFX A;  2GZW A;  4XBF A;  3GVA A;  2ZXJ A;  5DCM A;  1S7O A;  5LLQ A;  2W84 A;  4HW0 A;  4KMF A;  2D45 A;  1T38 A;  2A68 F;  1W5S A;  2GA1 A;  3GX4 X;  4BHP A;  5E17 F;  3IWZ A;  5FGM A;  3F8F A;  5ILV A;  4HX8 A;  3BZ6 A;  1Z9C A;  1MGT A;  4AIJ A;  1MDM B;  2VBW A;  2J5O A;  1FLI A;  6PAX A;  3T8T A;  3TOA A;  4K2E A;  4LMY A;  3LA7 A;  1R1T A;  4OIN F;  5IT9 Z;  1K6O A;  2VBZ A;  3GO5 A;  3E3V A;  2A3S A;  3KZY A;  4LB6 B;  5K5Q A;  4HF2 A;  3IHU A;  2Y0M A;  1ZN2 A;  4P5O A;  3TQN A;  2GXB A;  2K7L A;  3MCZ A;  1K7A A;  3GZ6 A;  4NHJ A;  4RAY A;  5FD5 A;  3JAM Z;  4M9S A;  5ILS A;  1DP7 P;  5IT9 K;  1Y0U A;  1XB4 A;  3HRS A;  2DAO A;  1ZLK A;  3IKT A;  5DDG A;  4CO8 A;  4S04 A;  2HYF A;  4H0E A;  4JK1 X;  2RGV A;  1R22 A;  4M74 A;  1R36 A;  2XGX A;  5ED4 A;  4P9U A;  4UVC A;  4UUV A;  2GA2 A;  4B09 A;  1KU9 A;  2FU4 A;  4HF0 A;  3DPT A;  4L9V A;  3BY6 A;  3K69 A;  1FYL A;  1R7J A;  3E6C C;  2G7H A;  1QBJ A;  1V4R A;  4L18 B;  4ON0 A;  2E1N A;  2V1U A;  4RB0 A;  1P6R A;  1JHH A;  4ZZD A;  2R3S A;  3DF8 A;  2VOO A;  2ESH A;  3I0T A;  4EJT A;  1I27 A;  3DV8 A;  4ESB A;  5KVR A;  2LF7 A;  5D4S A;  1AWC A;  1J9I A;  3IL2 A;  1SD6 A;  2PMH A;  3L09 A;  1O3R A;  1O3T A;  2F2E A;  2IVM A;  4LG0 A;  4LG0 B;  1I5Z A;  3U1D A;  1ZGA A;  1HXD A;  5JFR A;  4L5I A;  4RB1 A;  1NHA A;  5D5X B;  4EJW A;  4IF4 A;  4KN4 X;  2EV5 A;  2M87 A;  1ZRD A;  4XSX F;  4UHT A;  2CWE A;  1PUE E;  1ZG3 A;  3RPU A;  2Z3Y A;  1O3Q A;  2V1D A;  4PGH A;  4L0Y B;  2PFB A;  2NNN A;  3BRO A;  3FMR A;  3SFZ A;  3NQO A;  3N4M A;  3NEU A;  4HBL A;  4F7Z A;  2VE8 A;  3Q5F A;  1ZAR A;  2XKO A;  4FT8 A;  1YO5 C;  3MZH A;  5CVV A;  4G6D A;  4OIQ F;  5LGT A;  2B0L A;  2WTE A;  1H9T A;  1LVA A;  1U8R A;  4MGR A;  2DT5 A;  1KQ0 A;  4ZYD A;  4I0B A;  3V8L A;  2EFQ A;  2IRF G;  4PGG A;  3HRU A;  1XGM A;  2W25 A;  4L9J A;  1J0R A;  4RB3 C;  2YX4 A;  3VOD A;  2JPB A;  3BJO A;  2ESN A;  4EJU A;  1FBS A;  2XAS A;  3E6M A;  2RQP A;  3SQN A;  1G3T A;  3U9G A;  1HST A;  4N0B A;  4E70 A;  2A6E F;  1F1Z A;  1G3W A;  5CVJ A;  4XLN F;  3I54 A;  2MD5 A;  3HHG A;  3QOP A;  2H27 A;  1JXS A;  1GXQ A;  2OZ6 A;  4EMS A;  2R7D A;  3FM5 A;  2YU3 A;  4I7H A;  3DFG A;  5BPI A;  4AIH A;  3WTS C;  4HDV A;  2KRF A;  3QP5 A;  1HW2 A;  2EA2 A;  2H94 A;  3GFM A;  3DPL C;  4EJO A;  5LGU A;  3V7R A;  4ZYG A;  5FD6 A;  1R23 A;  3BJA A;  3JSO A;  2IW5 A;  2QLZ A;  1XDU A;  4HX4 A;  1FWZ A;  1R5G A;  2MH9 A;  1FNN A;  3IWF A;  3F6O A;  3F8M A;  3EQL F;  5DEQ A;  1YS6 A;  4IPA A;  4KA4 A;  2NS0 A;  3DP7 A;  3H3U A;  4Q4Z F;  1ZG1 A;  1U5T A;  2O8X A;  1HKT A;  1ZAO A;  3NRV A;  3C1D A;  2DQL A;  5EEH A;  1KQ9 A;  3WTW C;  2ISY A;  5TRD A;  3P7N A;  3CUQ B;  4U7B A;  3LQQ A;  4Q5S F;  4FX4 A;  4ENN A;  2QUF A;  1FZP B;  3VEP A;  1S6L A;  3BP8 A;  5CLS A;  2DQR A;  2KJB A;  4EVI A;  2A69 F;  2VT2 A;  1YLF A;  4L9T A;  4AIK A;  5CVR A;  4KYW A;  2XRN A;  3GFI A;  3HOT A;  2YSR A;  1K78 A;  3JTH A;  2FMY A;  1IUY A;  4A5M A;  2RNJ A;  1MZB A;  2K4B A;  4A0Z A;  3WTV C;  4A0Y A;  1HKS A;  2HFH A;  4OOI A;  4MNU A;  1HBX G;  5LRS A;  3ZP5 A;  3WG9 A;  4GYI A;  2QQB A;  5J8F A;  3C18 A;  3CUQ C;  4L0Z B;  1D8J A;  4R8H A;  2VN2 A;  3P9C A;  2Q0O A;  4ESF A;  3M8E A;  2FSW A;  4MTD A;  5FFX A;  1W5T A;  1ONV A;  3BDD A;  5D4R A;  1J5Y A;  5ICG A;  3KZZ A;  2HKO A;  3DXJ F;  3KLO A;  4RGR A;  2MBF A;  3RPQ A;  2WC2 A;  1K78 B;  2VON A;  3TO9 A;  4O5V A;  4QLC U;  2V79 A;  3WTT C;  4OMZ A;  1SD5 A;  5D5U B;  4XSZ F;  1T2K A;  1TNT A;  2DW4 A;  3WU1 B;  2GWR A;  1LEB A;  2BYV E;  4FX0 A;  4KN7 X;  1KGS A;  1R1U A;  4WF2 A;  2DU9 A;  1YIO A;  4B8X A;  3O3K A;  5E8G A;  2D2W A;  4QWQ A;  3GFL A;  3I58 A;  5CJ9 A;  1BI3 A;  4M72 A;  2ZME B;  3MEX A;  5JI6 A;  4HYE A;  5K5O A;  2O0Y A;  1RNL A;  5K5R A;  4KT5 C;  1J75 A;  3HUG A;  5DUI A;  2DPU A;  1BM9 A;  2FE3 A;  4A6D A;  3V8J A;  1FBU A;  3F21 A;  1XSX A;  1BN5 A;  3FZV A;  2FML A;  3MZY A;  2KIF A;  2ZNZ A;  3SZT A;  1BIB A;  1IF1 A;  1KU2 A;  2GXG A;  3M1E A;  2DPD A;  3ZN1 A;  2COM A;  2NNY A;  3OOP A;  1GXP A;  3TKY A;  3RYP A;  2FNP A;  2IA2 A;  2IA1 A;  1HW5 A;  4M9X A;  4PDK A;  2ADU A;  3V4G A;  2XAF A;  2L4M A;  4LFU A;  2W57 A;  4G7H F;  4HF1 A;  1WKM A;  1FSH A;  1OKR A;  4N9I A;  3KLN A;  3LFK A;  4P96 A;  4Y17 A;  4MEX F;  3GUD A;  1G3Y A;  3ELK A;  4YFK F;  4U0V A;  4KDP A;  1YYV A;  2LNB A;  1Q1H A;  1FSE A;  4M6X A;  2R7F A;  2OA4 A;  5BPD A;  2P7V B;  1G3S A;  5A2Q K;  3JW4 A;  3FX3 A;  3I64 A;  5TJJ A;  5ICE A;  3K0L A;  2O03 A;  1XCV A;  3M9A A;  1T6S A;  4WCG A;  2K4J A;  4L5J A;  2UWM A;  3FF5 A;  3IRQ A;  4GYG A;  2Q2E A;  1IN7 A;  2QBY B;  3PQJ A;  2FQ3 A;  2HEO A;  1BI2 A;  2VC1 A;  4Z2Y A;  4GXO A;  2PN6 A;  1U5T C;  4WXH A;  3I5U A;  1GVJ A;  3HTU A;  3LWF A;  3FMQ A;  3LA2 A;  2LSO A;  1TQP A;  2BE5 F;  1SFU A;  3F6V A;  4WXD A;  3L2C A;  4Y13 A;  3LAP A;  2HR3 A;  1WQ2 A;  4UXN A;  2JTV A;  4NB5 A;  2GQQ A;  3KP2 A;  4EM2 A;  1IN4 A;  3CO6 C;  1XGO A;  1PP7 U;  4IJA A;  3WGI A;  2A5Y B;  1SAX A;  1TTY A;  5LHG A;  4LLN A;  2VXZ A;  4G9Y A;  1IXC A;  2BBY A;  2RN7 A;  3K1M A;  2D1V A;  2M5W A;  2H09 A;  4MEY F;  4A2U A;  1T98 A;  2DO7 A;  2W85 A;  3EDP A;  3G73 A;  5FFZ A;  1ZH5 A;  5E18 F;  2XVC A;  2NAZ A;  2PJP A;  4HQE A;  3GLX A;  4LD5 A;  2H6C A;  2IA0 A;  2VOP A;  4HAM A;  2RV8 A;  3M8F A;  4CIC A;  5J8C A;  4JQF A;  4Q47 A;  2UXX A;  2BGC A;  2DI3 A;  3F8B A;  5HS7 A;  1PP8 F;  1Z7U A;  2DK5 A;  5L3C A;  2PEX A;  3CUO A;  5JR3 A;  2P5K A;  4IHT A;  1OYI A;  3O6B B;  3I71 A;  1DPR A;  1J7K A;  1T39 A;  1MDM A;  1BC7 C;  1UHM A;  1I6X A;  2CW0 F;  2P6T A;  1C0W A;  1J2X A;  3CTA A;  3KP6 A;  4KUM A;  3EYI A;  5J6X A;  3ERE D;  2FA5 A;  3E5U A;  1L0O C;  3ML6 A;  4BQA A;  1RZ4 A;  4BHC A;  1IW7 F;  3D0S A;  4RGX A;  3REO A;  3FWE A;  1D5V A;  2DLL A;  1B1B A;  5H20 A;  1MKM A;  2LF8 A;  3H92 A;  3PQK A;  1YW9 A;  3P9K A;  1FX7 A;  2QEN A;  2VBY A;  3T0Y A;  5HDN A;  2FBH A;  1HSJ A;  3K1N A;  3SZP A;  1IAW A;  4MTE A;  1S7A A;  2Z99 A;  1U6G A;  3F22 A;  3U2R A;  2D1H A;  4GGG A;  4O3M A;  5A2Q Z;  2TDX A;  2EFP A;  2M1B A;  4R1H A;  1P4X A;  2HTS A;  3GZ5 A;  4ZYH A;  4HLX A;  1MJB A;  1XGN A;  2EFN A;  4LLG F;  1PDN C;  1P4A A;  2VBX A;  1FYM A;  4IVN A;  2Z33 A;  1QQI A;  3ZMZ A;  3LST A;  3GEZ A;  3KFW X;  3WTY C;  2GAU A;  4ENJ A;  4UVA A;  1RUO A;  3ABU A;  1D3Y A;  3RTR A;  3PFI A;  2E7X A;  3WE2 A;  3I59 B;  3R0A A;  2LKP A;  5LHH A;  1T0F A;  4M9Z A;  2OU2 A;  3OV8 A;  3Q9V A;  2XIG A;  4M71 A;  5D8L B;  1MD0 A;  3E6D A;  3QPT A;  2P6S A;  1EH7 A;  3G3Z A;  1U2W A;  2YR2 A;  3WTU C;  4U0Y A;  2XAG A;  1Z6R A;  3QU3 A;  5AIP A;  2M30 A;  4HV5 A;  5HDG A;  3ECH A;  2BV6 A;  4KIF A;  4EM0 B;  1F4K A;  4XRF A;  3WE3 A;  4UVB A;  3JAM K;  2PLY A;  2JZY A;  4ZYE A;  2OD5 A;  4KIC A;  3H3Z A;  5DD4 A;  3HRM A;  2FNA A;  1TNS A;  4U0W A;  4KIB A;  4CHU A;  1R5H A;  2QQ9 A;  2QWW A;  1LDK B;  3FXR A;  3WOD F;  4A5N A;  4G94 A;  3J80 K;  3F23 A;  1HW1 A;  4YFX F;  1FP2 A;  1TBX A;  4DNC A;  3T1B A;  3MQ0 A;  1F5T A;  3E5Q A;  4HX7 A;  2M45 A;  4MQV A;  3KP3 A;  5ICC A;  1RUN A;  2PI0 A;  1X3U A;  5L3G A;  2HQN A;  3CJN A;  3R6S A;  2FRH A;  1BJA A;  2CO5 A;  4IHS A;  2BEO A;  2CQK A;  4IRH A;  1XD7 A;  1W7P B;  2K02 A;  4CGZ A;  5F6F A;  5LEJ A;  3MFK A;  2CGP A;  2JPC A;  2RDP A;  1SFX A;  3ISP A;  1KA8 A;  2W24 A;  5AON A;  4BXU A;  2IT0 A;  4LB5 A;  1O7L A;  3BOQ A;  1QZZ A;  1H0M A;  2WV0 A;  1REP C;  4ZZL A;  2HKX A;  1LDD A;  3GXO A;  2VOD A;  4D0P A;  3SHF A;  4P55 A;  3S2W A;  2EB7 A;  4P9F A;  3ZMT A;  4IRG A;  2O3F A;  4GCV A;  1CF7 A;  4L9N A;  4OIO F;  1XSD A;  3HSE A;  2F5E A;  3I59 A;  1ZRE A;  2MLG A;  1USS A;  1Z1D A;  1B6A A;  1FT9 A;  2ELH A;  4KMU X;  2OQR A;  2ZKZ A;  2P7C B;  1P2F A;  5LRR A;  3HRT A;  1IRG A;  1TW3 A;  1AOY A;  2VC0 A;  5IT3 A;  1LDJ A;  3KP5 A;  1XSV A;  3TGN A;  3HYI A;  5E20 A;  4G7Z F;  3TO7 A;  1FY7 A;  4AD9 A;  1WRJ A;  3MWM A;  2F5F A;  2XUB A;  1IRF A;  1XN7 A;  3FM3 A;  3RYR A;  4HQM A;  1RIO H;  3R61 A;  2VE9 A;  3VOE A;  3F8C A;  2KIM A;  3K9T A;  3GW2 A;  2XV4 S;  3EUH A;  3MAJ A;  1K79 A;  1IN8 A;  4BAY A;  2C6Y A;  1SFE A;  4BNC A;  3V7S A;  3FXQ A;  1FP1 D;  1FC3 A;  4YFN F;  1OMI A;  3RDI A;  3CDH A;  1KYW A;  3TDU C;  4GO1 A;  1BI1 A;  5HVQ C;  1DPU A;  2DK8 A;  2L4A A;  1QGP A;  4U7D A;  3DKW A;  2H6B A;  2CYY A;  2MH2 A;  2EA4 A;  4RS8 A;  3E6B A;  5E1W A;  3HSR A;  3LAJ A;  5ERI A;  4BH9 A;  3E97 A;  5DUK A;  3ZPL A;  2EV6 A;  3F3X A;  1OYW A;  1P4W A;  3CUQ A;  3J80 Z;  2OBP A;  1FYK A;  3RIR A;  4HZF A;  4KFC A;  4OIP F;  3ZMD A;  3GF2 A;  4A12 A;  2K27 A;  1CGP A;  1I1S A;  3FMS A;  2HGC A;  3L7W A;  1SMT A;  4MHG A;  4LK0 F;  1O3S A;  1SMY F;  2V1X A;  4I98 B;  5FB2 A;  2L3D A;  2IPQ X;  2PBI A;  2EWN A;  2EJR A;  5LEK A;  4ETS A;  4WWC A;  3GFJ A;  2J5P A;  2CSO A;  1ULY A;  4HDU A;  4MQ9 F;  3T8R A;  5HDK A;  4EGY A;  1BIA A;  1ON1 A;  1Z6T A;  1XDS A;  2FEZ A;  1XGS A;  2V9V A;  1W7P D;  4PZJ A;  3W6K B;  3C7J A;  2P4W A;  1ZHF A;  1ZG5 A;  2E1C A;  5KK1 A;  2EK5 A;  1U5T B;  2Y48 A;  1ZYR F;  3KEO A;  5L3F A;  4CXF A;  1MJA A;  3KE2 A;  1TLH B;  3T5X A;  3HSF A;  3ZMU A;  5HS8 A;  3R60 A;  1FOK A;  3E5X A;  2ACJ A;  4ASN A;  4WXC A;  3BWG A;  1KU3 A;  1ZLJ A;  4ESJ A;  1B9M A;  1BI0 A;  4DQ2 A;  1TQI A;  1Z91 A;  3ECO A;  2ISZ A;  3V7C A;  5K1Y A;  2ZNY A;  4M73 A;  5HS9 A;  3FHZ A;  3WTZ A;  5LHI A;  4RGS A;  2GIV A;  5LGN A;  4ENM A;  4HOB A;  5ILU A;  5FLX Z;  1B4A A;  1YQA A;  4Q48 A;  2V6C A;  2HOE A;  4BYY A;  3QP6 A;  1XMA A;  1ZRC A;  3EYY A;  2F5C A;  3KCC A;  3D5L A;  1RI7 A;  3QRF F;  3ZMV A;  2ZBK A;  3ZQ7 A;  5L3E A;  2O61 A;  4LJZ F;  3L00 A;  5AIQ A;  2MLK A;  4UV8 A;  1S29 A;  1BC8 C;  2KJC A;  4I0A A;  1W4M A;  2G9W A;  2Z5U A;  4G8X A;  2P8T A;  5JHU A;  5L3D A;  1B59 A;  3Q9S A;  3N97 A;  2FBI A;  2QVO A;  1O57 A;  4O6J A;  3HIF A;  1KQ8 A;  4YII A;  3HHH A;  5F64 A;  2OAZ A;  1BBY A;  2STT A;  2G7U A;  5BQT A;  5HLI A;  2PMU A;  1G6N A;  3BPV A;  5FLX K;  2AXL A;  1HQC A;  5LBQ A;  3IC7 A;  3I4P A;  4OIR F;  3WTX C;  1JE8 A;  3B02 A;  1IXR C;  1ZGJ A;  2YPR A;  3W6J B;  1UB9 A;  5HLH A;  1STZ A;  1Z05 A;  3WU0 A;  1G4D A;  5BMZ A;  4U88 A;  3P9I A;  3O2P E;  3RI4 A;  1J59 A;  3L9F A;  4G7O F;  1SD4 A;  1IZ1 A;  2OQG A;  3KET A;  3QU6 A;  4KNY A;  2QBY A;  4OU0 A;  2HWV A;  3R0J A;  2L01 A;  5D5W B;  2EV0 A;  2FOK A;  4AWX B;  2XKP A;  1ZRF A;  3K2Z A;  2ZME A;  3RKW A;  5BOX A;  2ZO4 A;  5DV5 A;  1DUX C;  3KEQ A;  4HV6 A;  4EGZ A;  3B73 A;  3GYH X;  3F8N A;  5EEG A;  4RAZ A;  2AS5 F;  5E8I A;  3CLO A;  4UV9 A;  1UHW A;  1V3F A;  2K86 A;  2QQA A;  3WGG A;  3JTG A;  4EM1 A;  2CG4 A;  1MJ9 A;  2A6H F;  2XHK A;  2HYG D;  1OR7 A;  1YW8 A;  4AVP A;  1EV7 A;  4I01 A;  4IRI A;  3ABT A;  2A07 F;  2IP2 A;  3RKX A;  2XAQ A;  2XAH A;  2DTR A;  4LK1 F;  3M7G A;  4PCQ A;  4LGW A;  3RKY A;  3CO7 C;  4ENK A;  3DQV C;  1DDN A;  2X0L A;  1EH6 A;  1YG2 A;  4WX9 A;  2L02 A;  5CYV A;  2HDC A;  4A6E A;  2JSC A;  2P5L C;  1VTN C;  1H9G A;  3RJP A;  3BJ6 A;  2UXN A;  3J81 Z;  4HA8 A;  2QYO A;  3TDZ C;  4XLP F;  4UNO A;  4A0X A;  1QZY A;  5F1R A;  2NRA C;  1FPQ A;  1ODD A;  2IJL A;  2FF4 A;  1QNT A;  2OZU A;  1GHC A;  3JSP A;  5D5V B;  1LEA A;  1YTY A;  1R00 A;  4NQW A;  1S8N A;  3BPX A;  1LNW A;  4TV7 A;  3ULQ B;  4CYD A;  1A04 A;  5CVI A;  2JRT A;  4EV0 A;  3EET A;  1JGS A;  1XCB A;  4RGU A;  5D6E A;  2VT3 A;  1R58 A;  2Y75 A;  1KU7 A;  3R4K A;  1QO0 D;  3K1P A;  2Q8K A;  4OMY A;  2NYX A;  3SXY A;  2YX7 A;  3QAH A;  2JT1 A;  3IRR A;  1OYY A;  5HOO A;  1YS7 A;  3KP7 A;  2QZ8 A;  5D6F A;  5DYM A;  4EJV A;  5DD8 A;  5DCF A;  3LQR A;  2MC3 A;  2FXA A;  5FO5 A;  2FBK A;  4BHB A;  1U3E M;  1IN5 A;  2XRO A;  1TQM A;  4N9H A;  5BS6 A;  1JHF A;  2HS5 A;  4YIF A;  2QM3 A;  2ETH A;  3C3W A;  4YG2 F;  1YFH A;  4Y15 A;  2O6G E;  1WWX A;  2MA3 A;  3HTS B;  4I09 A;  4CZZ A;  3LA3 A;  3ZMS A;  3GWZ A;  2HZT A;  2L54 A;  2P5V A;  2Z9O A;  3FXU A;  1ON2 A;  2RKH A;  4I2O A;  1P92 A;  1TW2 A;  4KIG A;  1WSU A;  1UCR A;  1IXS B;  1E2X A;  3KP4 A;  1W7P A;  4I02 A;  5ICF A;  1IN6 A;  2EFW A;  1YW7 A;  1FBQ A;  2STW A;  3I53 A;  1O7F A;  2KIU A;  3TOB A;  3COA C;  3ROU A;  2RVC A;  2LDU A;  5E1Z B;  3TO6 A;  4JBA A;  1S3J A;  1D8K A;  1F9N A;  4WK8 F;  2ZCW A;  1E17 A;  4RB2 C;  1R1V A;  2E7W A;  3IKV A;  2DBB A;  5D8K B;  1WI9 A;  5JVT A;  1CF7 B;  3AAF A;  2ZJ2 A; 
#chains in the Genus database with same CATH topology
 4X6A J;  4JX5 A;  1XMK A;  2DDA A;  5DCM B;  4ZYA A;  4LLL A;  2EFO A;  1R71 A;  1U78 A;  1X2M A;  2ZFW A;  4FHT A;  4XLH A;  1DP3 A;  1ITY A;  2JWT A;  2DFI A;  2UZK A;  2A61 A;  2OJE D;  3V8K A;  3EUH C;  3JRA A;  2M7B A;  4MLO A;  2MYS A;  4R79 A;  3VFZ A;  2BZT A;  2XPW A;  2KKO A;  2P0W A;  4HLY A;  4EQQ A;  2M9H A;  4IO9 F;  1ETV A;  1UST A;  3LSP A;  2JA8 J;  3F72 A;  4BJ5 C;  3J81 K;  1X19 A;  1LPQ A;  2IGN A;  4M6Y A;  1WJE A;  3PSI A;  1FOY A;  1LJ9 A;  3BCA A;  4G6Q A;  4JX6 A;  5E1X A;  1LQ1 A;  4XLA A;  1Y8Q B;  3QPH A;  1NH3 A;  3KYD B;  2E1M C;  1LB2 A;  4ZH4 F;  4S05 A;  2HU9 A;  2HQR A;  1ETY A;  1KYZ A;  2NS7 A;  2L5Q A;  3JRE A;  1NK3 P;  1W1W E;  3MMY B;  4IOC F;  2WWY A;  3VB2 A;  3ZN0 A;  2PQ8 A;  5IY5 H;  1BOA A;  3GTG J;  2XAJ A;  5H6Q A;  2M8E A;  5HLG A;  1HKQ A;  2LBF B;  1EH8 A;  5L3B A;  3LNQ A;  1B9N A;  5KAI C;  2ZC2 A;  1I1G A;  4CCL A;  2DA3 A;  4IXA A;  3J7A O;  5H6R A;  2M3A A;  2X4H A;  2W7N A;  1OPC A;  2BVM A;  2RC4 A;  3DEE A;  1PUF A;  3HGY A;  3DBR B;  1FIP A;  1NTC A;  1QPM A;  4E7L A;  1HDP A;  1PJR A;  4CDG A;  1SD7 A;  1UFM A;  3I9V 2;  2HTJ A;  3C2H A;  3HOS A;  3OS0 A;  2PG4 A;  3H35 A;  1Z3X A;  3WGH A;  1FMW A;  5CVU A;  4ZDP A;  2DMQ A;  3DEU A;  2JUC A;  4MO7 A;  1L3L A;  2F5D A;  1D1C A;  2CFX A;  2GZW A;  4XBF A;  3GVA A;  2ZXJ A;  5DCM A;  2E1M B;  1S7O A;  2F5V A;  3C2B A;  5LLQ A;  2W84 A;  5EGO A;  3PJR A;  5J47 A;  5EGO B;  4HW0 A;  4KMF A;  4GFB A;  3SDG A;  4II2 A;  2XRL A;  1RPW A;  2D45 A;  1T38 A;  3HEF A;  2A68 F;  1W5S A;  2GA1 A;  4D5F A;  3GX4 X;  2GBY A;  4BHP A;  5E17 F;  3IWZ A;  1QHG A;  5FGM A;  3F8F A;  5C4X J;  5ILV A;  4HX8 A;  3BZ6 A;  4J00 A;  1Z9C A;  1MGT A;  4C30 A;  2OTJ I;  2EIJ H;  2DOE A;  2JVG A;  2VBW A;  4AIJ A;  1MDM B;  2J5O A;  4FAS D;  2E19 A;  3U21 A;  3S2H J;  1XTA A;  1FLI A;  3QOE A;  3ZOB A;  1JTY A;  1H89 C;  2KL4 A;  6PAX A;  5EJC A;  3T8T A;  2W00 A;  3TOA A;  4H4K C;  3VYS B;  4NC8 A;  1IDY A;  3FXO A;  3A01 B;  3OYM A;  4XNF A;  3A01 A;  4K2E A;  2LKS A;  3LA7 A;  4LMY A;  5E3N A;  1R1T A;  1E3P A;  4OIN F;  1MND A;  5IT9 Z;  3KYC B;  1K6O A;  4ZDO A;  2VBZ A;  3GO5 A;  4XID A;  3E3V A;  2A3S A;  3SJM A;  3KZY A;  4YEL A;  4LB6 B;  5K5Q A;  4OAZ A;  4IHW A;  4HF2 A;  4QIW N;  3BG3 A;  3IHU A;  2Y0M A;  1ZN2 A;  2ME0 A;  1YIJ I;  4P5O A;  2BY2 A;  4PSW A;  3TQN A;  1XG1 A;  2GXB A;  4B4C A;  2K7L A;  5IP7 J;  3MCZ A;  1K7A A;  3GZ6 A;  5FLV A;  1TWF J;  1SEU A;  2DA6 A;  4NHJ A;  4A69 C;  5IYB J;  4RAY A;  5FD5 A;  3JAM Z;  3H9Q A;  4M9S A;  5ILS A;  1DP7 P;  5IT9 K;  1Y0U A;  3QYF A;  1XB4 A;  3HRS A;  2DAO A;  1ZLK A;  3DU6 A;  3IKT A;  2IAI A;  3CJT B;  5DDG A;  4PJ0 C;  4YEJ A;  4CUG A;  4CO8 A;  4S04 A;  2HYF A;  4H0E A;  4JK1 X;  2RGV A;  1ZGW A;  4KT6 A;  1R22 A;  2BW3 B;  2F4O B;  4M74 A;  1VQ4 I;  4FET A;  1YJ9 I;  3OS1 A;  3J7Y J;  1VQ9 I;  1R49 A;  3H5A A;  2ZB9 A;  4E7S A;  1R36 A;  2KFD A;  2IGO A;  2XGX A;  5ED4 A;  1JGG A;  2O5R A;  2L0K A;  1JUP A;  1QU3 A;  3CF2 A;  3CDL A;  4P9U A;  4UVC A;  4UUV A;  2DDB A;  3K4B A;  3FXL A;  2W4S A;  2GA2 A;  4B09 A;  1KU9 A;  1Z3Y A;  2FU4 A;  4HF0 A;  3DPT A;  4L9V A;  2HOS A;  1N75 A;  3BY6 A;  3BG5 A;  2QSF X;  2X9D A;  2R7S A;  3K69 A;  1FYL A;  5IP9 J;  3SZG A;  1LFB A;  2R92 J;  5F0F A;  2LC2 A;  1MMS A;  2VPR A;  1R7J A;  3E6C C;  2G7H A;  1MBK A;  2MW8 A;  1QBJ A;  1U9O A;  4A3M J;  4ANJ A;  1V4R A;  4L18 B;  1Q1V A;  1Y8R B;  1ZQ3 P;  4A3D J;  3B6C A;  4IHY A;  3ONQ A;  2CQX A;  3OYL A;  4ON0 A;  2E1N A;  2V1U A;  4RB0 A;  5IOY A;  1GVD A;  1P6R A;  1JHH A;  4ZZD A;  5M5X J;  1VZ0 A;  3ZR8 X;  2R3S A;  1WJD A;  3DF8 A;  2VOO A;  2ESH A;  1S7E A;  3I0T A;  4UY8 I;  4EJT A;  1I27 A;  4E7H A;  3DV8 A;  3GTP J;  1Y56 A;  4ESB A;  2M2E A;  5KVR A;  2DOD A;  3G1L A;  2LF7 A;  3SEZ A;  5D4S A;  1AWC A;  4KIS A;  1ZK8 A;  3CF5 F;  2G0E A;  1J9I A;  3IL2 A;  3O8G A;  1SD6 A;  2PMH A;  3L09 A;  2KLO A;  1N77 A;  1O3R A;  2B63 J;  1O3T A;  4ABZ A;  2F2E A;  1OCO H;  4RMN A;  4XRS G;  1LE8 A;  4OAY A;  2IVM A;  4LG0 A;  4LG0 B;  1I5Z A;  2DN0 A;  3CCS I;  3U1D A;  2R7R A;  3TW7 A;  2CU7 A;  1ZGA A;  1HXD A;  3OL3 A;  5KCM A;  5JFR A;  1AU7 A;  4L5I A;  4RB1 A;  1NHA A;  5D5X B;  3CCU I;  4EJW A;  1V55 H;  4IF4 A;  4KN4 X;  4MFD A;  2EV5 A;  2M87 A;  1ZRD A;  1RES A;  2E1O A;  3JR9 A;  4XSX F;  4UHT A;  2CWE A;  5JLW A;  1MNM C;  1PUE E;  1ZG3 A;  1D1A A;  3RPU A;  5F0C A;  1LKX A;  2Z3Y A;  2R0Q C;  2LY9 A;  1O3Q A;  2V1D A;  4PGH A;  2Y69 H;  4L0Y B;  2WY7 Q;  4CCK A;  2PFB A;  2NNN A;  3TP0 A;  3BRO A;  4B3A A;  3FBI B;  1QVU A;  3FMR A;  3SFZ A;  3NQO A;  3N4M A;  3CJR B;  3NEU A;  2VKV A;  2PMZ A;  5IYD J;  4HBL A;  4F7Z A;  1Y0N A;  3I4M J;  2VE8 A;  2MC4 A;  3Q5F A;  1JUM A;  1VQM I;  1ZAR A;  2XKO A;  4FT8 A;  2Z16 A;  1YO5 C;  3MZH A;  5CVV A;  3M1C A;  4G6D A;  3ZQC A;  2N8G A;  5JLX A;  2BW3 A;  5GP9 A;  2B7E A;  4OIQ F;  2M8G X;  5LGT A;  2B0L A;  2WTE A;  1H9T A;  1LVA A;  3GCM A;  2ZXH A;  3VSK A;  1U8R A;  2Z1D A;  3H36 A;  4MGR A;  2DT5 A;  1KQ0 A;  4ZYD A;  4I0B A;  1V54 H;  3V8L A;  2EFQ A;  4BGD A;  4HRI A;  4PJJ A;  2IRF G;  1PYV A;  2JN6 A;  3X2Q H;  2R7O A;  4PGG A;  1VQ5 I;  2VB6 A;  3HXL A;  4NC7 A;  2B9S A;  5HNF A;  4GRI A;  4V2G A;  2NVU B;  5FKN A;  3HRU A;  1M1E B;  1XGM A;  3M3Y J;  1B8I A;  2W25 A;  4L9J A;  3J7A Y;  1J0R A;  4F92 B;  4RB3 C;  3HBL A;  5EF6 A;  2YX4 A;  3QPS A;  3VOD A;  2VAS A;  2JPB A;  3BLY A;  3G1O A;  3BJO A;  2ESN A;  1BR1 A;  3IAM 2;  4PFO A;  4EJU A;  4A3B J;  1FBS A;  4XOP A;  2XAS A;  3E6M A;  2RQP A;  3SQN A;  1WJ5 A;  1G3T A;  3U9G A;  2YS9 A;  4RLQ A;  1HST A;  4N0B A;  4E70 A;  2GOX B;  3K2A A;  2A6E F;  1F1Z A;  1G3W A;  5F27 A;  5CVJ A;  1HC8 A;  2M4G A;  4XLN F;  4C2T A;  4LIU A;  3I54 A;  3HHG A;  2MD5 A;  1ZEL A;  3QOP A;  2H27 A;  1JXS A;  4RLF A;  2R7Z J;  4FIS A;  1G8X A;  1GXQ A;  2OZ6 A;  4RAG A;  4EMS A;  1IUF A;  2R7D A;  3FM5 A;  3NAU A;  3WG7 H;  2YU3 A;  2W1O A;  4I7H A;  1TZL A;  5K7Z A;  1MIJ A;  4B44 A;  3J7Z I;  3DFG A;  5BPI A;  1RR7 A;  2QGU A;  2YUS A;  4AIH A;  3WTS C;  3HOX J;  4HDV A;  2KRF A;  3QP5 A;  5IP6 A;  1NK2 P;  1WPK A;  1HW2 A;  1AA7 A;  1D0X A;  2EA2 A;  2ZXW H;  3OYG A;  2LOO A;  2H94 A;  3GFM A;  3DPL C;  2HPI A;  2ZJP F;  4EJO A;  5GAH J;  5LGU A;  3V7R A;  4ZYG A;  2LRD A;  2F48 A;  1Z67 A;  2HYJ A;  5B3S H;  2VKE A;  3QOD A;  5FD6 A;  1T33 A;  3EUK L;  1R23 A;  3BJA A;  3JSO A;  2OUM A;  4PFP A;  2IW5 A;  2QLZ A;  4A3F J;  3FK6 A;  1XDU A;  2IS4 A;  4HX4 A;  4D7N A;  2F4M B;  1JT0 A;  2PMZ N;  1FWZ A;  3GBG A;  1R5G A;  2MH9 A;  1FNN A;  4F55 A;  5M3M J;  3IWF A;  1ETW A;  3F6O A;  1B8I B;  3F8M A;  1YOV B;  4Y4R A;  5FRN A;  3EQL F;  2JA6 J;  5DEQ A;  1YS6 A;  2XGC A;  5KHD A;  3H9J A;  4IPA A;  2W48 A;  4KA4 A;  2NS0 A;  3DP7 A;  3H3U A;  4Q4Z F;  1ZG1 A;  4GDF A;  2XGD A;  1U5T A;  2O8X A;  1UAA A;  1HKT A;  4CYC B;  3JRI A;  1ZAO A;  5GTH C;  1TP4 A;  3LL7 A;  3NRV A;  3K4J A;  2AO9 A;  3OYK A;  1Y1W J;  3OYA A;  3C1D A;  2UUZ A;  2DQL A;  5EEH A;  1APL C;  5C44 J;  1KQ9 A;  5GAG J;  3WTW C;  2NVQ J;  2ISY A;  5TRD A;  2CUF A;  3P7N A;  3CUQ B;  4U7B A;  3LQQ A;  1YI2 I;  2R7V A;  3M8J A;  4Q5S F;  2X1D A;  4FX4 A;  4CCN A;  3VDX A;  1IV8 A;  3H3V K;  3I55 I;  2DCE A;  4ENN A;  2VKH A;  2QUF A;  1FZP B;  3Q3S A;  1S5L C;  1POG A;  2EZK A;  4B1R A;  1FMV A;  3VEP A;  1S6L A;  3BP8 A;  5CLS A;  2QCO A;  2DMU A;  5HNH A;  2DQR A;  1P7I A;  5B1B H;  2KMU A;  3PIO F;  4JP0 A;  2KJB A;  4EVI A;  2A69 F;  2DFH A;  2VT2 A;  3OS2 A;  1YLF A;  5HOD A;  4C3I J;  1T95 A;  3HOY J;  2K40 A;  4L9T A;  4AIK A;  3RQI A;  4Y7N J;  4XOT A;  5CVR A;  3M07 A;  4KYW A;  2XRN A;  2OCC H;  3GFI A;  3HC7 A;  3K4L A;  1OCZ H;  3HOT A;  2JQ7 A;  4IKF A;  2YSR A;  1K78 A;  3JTH A;  2FMY A;  1X4P A;  1OIS A;  2LMD A;  1YX5 A;  1IUY A;  2VUM J;  1E0E A;  3ASO H;  4A5M A;  1R4M B;  2GOM A;  1CQT A;  3BT9 A;  2RNJ A;  1MZB A;  3BQY A;  2K4B A;  2YU9 J;  4A0Z A;  2CQQ A;  4C9Y A;  1RR8 C;  3WTV C;  1MBJ A;  1ZR4 A;  4Y3O A;  4E7J A;  4A0Y A;  1HKS A;  2HFH A;  2EIN H;  3SEQ A;  2LTP A;  3MKL A;  4MNU A;  4OOI A;  1HBX G;  3DWL E;  5F0H A;  5LRS A;  3ZP5 A;  3WHB A;  4A3C J;  3OIP A;  3OYI A;  4BL0 B;  1HOM A;  3WG9 A;  4GYI A;  2PJR B;  2QQB A;  1ZTR A;  1OCC H;  5J8F A;  2RQQ A;  3C18 A;  1GUU A;  2RAE A;  4LG3 A;  1K83 J;  3CUQ C;  4QPO A;  4NQW B;  4L0Z B;  2E2I J;  3ABL H;  4R8H A;  5DM6 F;  1D8J A;  2VN2 A;  2DJI A;  2I10 A;  3DEW A;  3P9C A;  4PJM A;  3CCE I;  1JJ8 C;  2Q0O A;  4KJZ A;  3MVP A;  4F91 B;  1A6Q A;  3KX2 A;  2E34 A;  2ZJQ F;  1QRY A;  4ESF A;  1X4O A;  3M8E A;  3W2A A;  2FSW A;  3K70 C;  4MTD A;  3FK7 A;  5FFX A;  1W5T A;  3BZC A;  1ONV A;  3BDD A;  5D4R A;  3FBN B;  1J5Y A;  1Z77 A;  2HVQ A;  2CJJ A;  3SFI A;  5ICG A;  3KZZ A;  4XKB A;  3CQZ J;  2HKO A;  3DXJ F;  5C4J J;  1MH3 A;  3KLO A;  3KPH A;  4XM3 A;  2K3P A;  2Y31 A;  3DPU A;  1ORK A;  4RGR A;  2MBF A;  3RPQ A;  2NOG A;  2WC2 A;  1IJW C;  4XON A;  1A36 A;  2ELK A;  4RDU A;  3TO9 A;  4O5V A;  1K78 B;  2VON A;  4QLC U;  2V79 A;  3WTT C;  4A3J J;  4OMZ A;  1SD5 A;  1WJB A;  5D5U B;  3CP8 A;  4XSZ F;  1T2K A;  2WY8 Q;  3BR6 A;  2LH9 A;  3CME I;  1TNT A;  2WAQ A;  2XAU A;  4P1W A;  1W36 C;  4Y52 J;  2DW4 A;  3WU1 B;  2GWR A;  3LSM A;  5B5E C;  1LEB A;  3IP4 B;  4B3X A;  4IX7 A;  2V6E A;  1F36 A;  2BYV E;  3BG9 A;  2IGM A;  4FX0 A;  4KN7 X;  4EEF G;  1KGS A;  1R1U A;  4WF2 A;  2DU9 A;  1X3W B;  1YIO A;  1OCP A;  4NDL A;  3BQZ A;  3BTI A;  2WV1 A;  4B8X A;  3O3K A;  5E8G A;  2D2W A;  3OL4 A;  4LIT A;  2RNG A;  3DTE A;  4QWQ A;  2A05 A;  3W3C A;  3DU5 A;  4U87 A;  1JJ6 C;  1TWC J;  4C2U A;  2CRG A;  3GFL A;  1B72 A;  3I58 A;  3AG1 H;  4BBS J;  5CJ9 A;  1BI3 A;  4M72 A;  4XIC A;  2ZME B;  1B72 B;  4DBR A;  1VF9 A;  3MEX A;  4BDZ A;  5JI6 A;  1OCR H;  4HYE A;  4ZTJ A;  1U8B A;  4F93 B;  3IH3 A;  3OYH A;  5K5O A;  2O0Y A;  1BW6 A;  3CDI A;  1RNL A;  5K5R A;  2CV0 A;  1S9H A;  4KT5 C;  1SAN A;  3OMY A;  1J75 A;  4HNU A;  2QQ8 A;  3HUG A;  3VYT B;  3PSF A;  5DUI A;  2DPU A;  1BM9 A;  2COB A;  3RZD J;  1X2N A;  4RA2 A;  2FE3 A;  4A6D A;  3V8J A;  1FBU A;  3F21 A;  2F6C A;  1XSX A;  1BN5 A;  5GPC A;  3H9G A;  3FZV A;  2FML A;  3MZY A;  2AQE A;  3E7L A;  2KIF A;  3FIW A;  2ZNZ A;  3SZT A;  5GTI C;  1BIB A;  2GIZ A;  1X1C A;  1BOB A;  2K9N A;  2PJR A;  4DGW B;  4XRM A;  1WCM J;  3OYE A;  1IF1 A;  1KU2 A;  2FD5 A;  2GXG A;  3M1E A;  3ZQH A;  5EDN A;  1ETO A;  2DPD A;  3ZN1 A;  2DA4 A;  2COM A;  2NNY A;  3OOP A;  4BEH A;  1GXP A;  3TMO A;  3TKY A;  3RYP A;  2EPF A;  2FNP A;  2IA2 A;  2IA1 A;  2E2H J;  1HW5 A;  3QWL A;  2CS3 A;  2K3F A;  4M9X A;  4D1Q A;  2L7M P;  4I76 A;  1VQ7 I;  2DXI A;  4PDK A;  2ADU A;  3V4G A;  2AHQ A;  4V19 K;  2XAF A;  2L4M A;  4LFU A;  2TCT A;  2W57 A;  4G7H F;  4HF1 A;  1WKM A;  1FSH A;  2E36 A;  4FE7 A;  4BE2 A;  1OKR A;  4N9I A;  3RCO A;  3UKG A;  3KLN A;  3LFK A;  4P96 A;  4Y17 A;  1ACI A;  1QA6 A;  4MEX F;  1FOW A;  1ERD A;  3GUD A;  5FKM A;  1G3Y A;  3DTK A;  3ELK A;  2CQ7 A;  1D1B A;  4YFK F;  3JRF A;  3K4C A;  4U0V A;  1YYV A;  4KDP A;  3FXJ A;  1HDD C;  2EIL H;  2LNB A;  1Q1H A;  2IS6 A;  1FSE A;  4M6X A;  1TWH J;  2OA4 A;  2R7F A;  5BPD A;  1T0F C;  3QQA A;  2P7V B;  1G3S A;  5A2Q K;  1X1A A;  4PJN A;  3JW4 A;  3FX3 A;  3KZI C;  1DGR M;  2X51 A;  4ITV A;  3I64 A;  5TJJ A;  5ICE A;  3K0L A;  1UZC A;  1SVL A;  2O03 A;  1XCV A;  1WJF A;  3M9A A;  1ETK A;  1T6S A;  3HPG A;  5E79 C;  2O7O A;  4WCG A;  2K4J A;  4L5J A;  2UWM A;  1JI8 A;  1KON A;  1WGX A;  1W0T A;  3FF5 A;  3IRQ A;  2Q2E B;  3K4K A;  4GYG A;  1H88 C;  2Q2E A;  1IN7 A;  4HST A;  2QBY B;  3L2V A;  3F0C A;  3PQJ A;  4BJ6 C;  3PUF A;  2FQ3 A;  3PNY A;  3OYN A;  4BE1 A;  3S8P A;  2HEO A;  3S16 J;  1BI2 A;  3LSK A;  4CA0 A;  2OPT A;  1O4X A;  4AC0 A;  2E35 A;  2VC1 A;  4Z2Y A;  3S32 A;  4GXO A;  2PN6 A;  2DYR H;  1U5T C;  4WXH A;  5E3O A;  3I5U A;  1GVJ A;  1UEL B;  3HTU A;  3LWF A;  3GME A;  2VJJ A;  1K4S A;  3FMQ A;  3LA2 A;  4Y33 A;  1VI0 A;  2LSO A;  1BJZ A;  1TQP A;  5IOZ A;  4JOM A;  2BE5 F;  3AKZ A;  3DLL F;  1D5Y A;  3W2V A;  3OSF A;  3HOZ J;  2IGK A;  2I8D A;  1SFU A;  2Z2S B;  1MBH A;  3F6V A;  4WXD A;  3L2C A;  3S1Q J;  4A93 J;  1RRJ A;  2EH3 A;  3H1C A;  4Y13 A;  4ZJZ A;  4D5C A;  3LAP A;  2HR3 A;  1WQ2 A;  4UXN A;  2JTV A;  3OYF A;  4NB5 A;  2GQQ A;  2R7X A;  1KZH A;  3DKY A;  3KP2 A;  3PFY A;  1IN4 A;  2KRC A;  2EZI A;  4EM2 A;  3CCR I;  3CO6 C;  4IHX A;  1XGO A;  1PP7 U;  4IJA A;  2R7T A;  3MD2 A;  2A5W A;  3WGI A;  2A5Y B;  2LP0 A;  3FIS A;  1SAX A;  1TTY A;  5LHG A;  3G71 I;  2D5V A;  2R5Z A;  1XC5 A;  4X0G A;  3VPR A;  2R5Z B;  2JJ7 A;  3ZRG A;  2VIX A;  3V42 A;  2VXZ A;  4LLN A;  4C2M J;  2CUJ A;  4G9Y A;  1IXC A;  2BBY A;  3S1R J;  1QPI A;  2RN7 A;  3BCB A;  3K1M A;  2D1V A;  4DYQ A;  2HDD A;  1SFK A;  2H09 A;  2M5W A;  2IS2 A;  2BHZ A;  4MEY F;  4A2U A;  1MSE C;  1U9N A;  4UUS B;  1HF0 A;  3K4M A;  1T98 A;  2DO7 A;  2HNH A;  3EDP A;  2W85 A;  3BZK A;  3FXK A;  5FFZ A;  3G73 A;  2R5Y A;  3TED A;  1P9Q C;  1MBF A;  2DOF A;  1ZH5 A;  5E18 F;  2XVC A;  2KDO A;  3HZJ A;  2NAZ A;  1GV2 A;  2X6O A;  3LSR A;  2PJP A;  2DA1 A;  1X1B A;  4ZDL A;  3MKY B;  4HQE A;  3GLX A;  3HDD A;  4LD5 A;  1GV5 A;  2KQR A;  2VI6 A;  1FTZ A;  2H6C A;  2IA0 A;  1WVR A;  2VOP A;  2MSY A;  3CES A;  2OV7 A;  3LSH A;  4HAM A;  2I5U A;  2RV8 A;  5C3E J;  3M8F A;  4CIC A;  5J8C A;  2X6W A;  4JQF A;  4M3D A;  4Q47 A;  2UXX A;  2QA4 I;  2WAE A;  2VJ4 A;  2CMP A;  2BGC A;  2DI3 A;  1RET A;  3F8B A;  5HS7 A;  1PP8 F;  1Z7U A;  1BR4 A;  2DK5 A;  5L3C A;  2PEX A;  4HPQ A;  4BU2 A;  2LKX A;  3CUO A;  5JR3 A;  2P5K A;  2E2J J;  4IHT A;  1OYI A;  3EPZ A;  3TW6 A;  2FOW A;  3O6B B;  3AFH A;  3I71 A;  1SVO A;  2DT6 A;  1DPR A;  1J7K A;  4B48 A;  1T39 A;  1MDM A;  1BC7 C;  1UHM A;  1I6X A;  4A3L J;  2CW0 F;  1RKT A;  1VQN I;  4NUB A;  3A1Y A;  2P6T A;  2ICW G;  3HB9 A;  1C0W A;  5CQE A;  2HQA A;  1J2X A;  2JA2 A;  3CTA A;  3KP6 A;  3NAR A;  4KUM A;  3ZGK A;  2HPM A;  4XKV A;  3EYI A;  3KEY A;  5J6X A;  3I4N J;  3ERE D;  2ECB A;  2FA5 A;  1LFU P;  4RBO A;  1Z21 A;  3E5U A;  2FX0 A;  2CW7 A;  4E7Z A;  2O8K A;  3JRB A;  2O9L A;  1L0O C;  2K9Q A;  3ML6 A;  2ID3 A;  4BQA A;  4NC6 A;  1RZ4 A;  4BJT A;  2WA0 A;  3TL4 X;  4BBR J;  4BHC A;  2GM4 A;  2HQ5 A;  1WH5 A;  3CZ6 A;  3M4O J;  1IW7 F;  4UUS A;  2IS1 A;  4G6T B;  3AG3 H;  3D0S A;  4RGX A;  3ZQQ A;  3REO A;  2CQN A;  3FWE A;  1D5V A;  2DLL A;  1IGN A;  2HXO A;  1B1B A;  5H20 A;  1G59 A;  2LD5 A;  1GT0 C;  1MKM A;  2LF8 A;  2ID6 A;  3H92 A;  3CCY A;  3PQK A;  2XF7 A;  1YW9 A;  3P9K A;  3CD6 I;  1FX7 A;  2QEN A;  2JUG A;  2VBY A;  3T0Y A;  5HDN A;  2FBH A;  3PNV A;  5EZG A;  1HSJ A;  3I3L A;  3IH2 A;  1WJC A;  3K1N A;  3SZP A;  1IAW A;  2R7W A;  1HLV A;  4MTE A;  1S7A A;  2Z99 A;  1U6G A;  3F22 A;  4A3G J;  3HOV J;  3U2R A;  2D1H A;  2L9N A;  4GGG A;  3OYJ A;  4O3M A;  5A2Q Z;  2EZH A;  1GLN A;  4IL6 C;  5J3L A;  3CCM I;  2TDX A;  2EFP A;  5GAE J;  3A4C A;  1DU0 A;  2H1K A;  2M1B A;  3S3O A;  3JRC A;  4R1H A;  2K9L A;  2LY1 A;  2NOJ B;  2M4K A;  1P4X A;  2HTS A;  3GZ5 A;  4CCJ A;  4HLX A;  4ZYH A;  4PK4 A;  1MJB A;  1XGN A;  1MBG A;  4IHV A;  3LSG A;  3OIQ A;  2EFN A;  2Y0S N;  4LLG F;  1PDN C;  1P4A A;  2XC7 A;  2VBX A;  3LSI A;  2BXY A;  3DKX A;  1FYM A;  4IVN A;  1W36 D;  2Z33 A;  1QQI A;  3ZMZ A;  1UJ8 A;  3LST A;  1VFC A;  3GEZ A;  3KFW X;  3WTY C;  2GAU A;  2HZD A;  4ENJ A;  5GAD J;  3N05 A;  4UVA A;  1RUO A;  1MBE A;  3ABU A;  3GTM J;  1D3Y A;  2BXZ A;  3RTR A;  3PFI A;  2E7X A;  2DYS H;  3WE2 A;  3S1N J;  4M6V A;  3I59 B;  5BNG A;  3R0A A;  2LKP A;  4EAT A;  5LHH A;  1T0F A;  1VQK I;  4M9Z A;  4G12 A;  1VND A;  2OU2 A;  3OV8 A;  3Q9V A;  2XIG A;  4M71 A;  1IRZ A;  5D8L B;  1MD0 A;  5CKT A;  3E6D A;  3QPT A;  3QYB A;  2P6S A;  1EH7 A;  3G3Z A;  1U2W A;  1ZKG A;  2YR2 A;  3WTU C;  1YE9 A;  4U0Y A;  2XAG A;  1Z6R A;  1IC8 A;  3QU3 A;  3GTQ J;  5AIP A;  1LFP A;  2M30 A;  2XSJ C;  5FLM J;  4HV5 A;  3NWT A;  4XKW A;  5HDG A;  3ECH A;  2BV6 A;  4KIF A;  4M3E A;  4EM0 B;  1SC7 A;  1H8A C;  1F4K A;  4XRF A;  5M5Y J;  3A0H C;  3WE3 A;  1PVE A;  3BTC A;  3A0B C;  2X1C A;  1A6I A;  3VYU B;  4UB8 C;  1S72 I;  4AID A;  3S15 J;  4UVB A;  3JAM K;  2XPU A;  2PLY A;  3OWT A;  2JZY A;  4ZYE A;  3OYD A;  3U1K A;  2OD5 A;  4KIC A;  4AM3 A;  1TT0 A;  3H3Z A;  3HRM A;  5DD4 A;  2MFZ A;  1A31 A;  2HI3 A;  1WJA A;  4S0H B;  2FNA A;  1TNS A;  2ZJR F;  4I99 C;  2DMN A;  4DOZ A;  2LYC A;  4U0W A;  2WB1 A;  4KIB A;  4CHU A;  2KHM A;  4FTH A;  1R5H A;  2QQ9 A;  4CSW A;  2QWW A;  2NVX J;  1LDK B;  1V5G A;  1PUF B;  3KYL A;  5HLT A;  1TWG J;  1UHS A;  3FXR A;  3WOD F;  4A5N A;  4G94 A;  4NBQ A;  3J80 K;  2ECC A;  3SDB A;  3F23 A;  1HW1 A;  4YFX F;  1FP2 A;  1TBX A;  4DNC A;  3T1B A;  3MQ0 A;  1F5T A;  3E5Q A;  3BG6 A;  2M45 A;  4HX7 A;  4MQV A;  5F08 A;  3WHC A;  3OOU A;  1V5F A;  3KP3 A;  5E3L A;  1LE8 B;  5ICC A;  1RUN A;  2PI0 A;  1X3U A;  5L3G A;  2HQN A;  3CJN A;  3R6S A;  4AUX A;  2HVR A;  2FRH A;  3FKJ A;  2KRH A;  1BJA A;  2E71 A;  2CO5 A;  4IHS A;  2BEO A;  2L9V A;  3D1N I;  2CQK A;  3ZQL A;  4IRH A;  1XD7 A;  1W7P B;  2LG4 A;  2FJ1 A;  2K02 A;  4CGZ A;  2XF5 A;  1A5J A;  1IRX A;  5F6F A;  5LEJ A;  3MFK A;  2CGP A;  2JPC A;  1T08 B;  2RDP A;  3CP2 A;  1DU6 A;  1SFX A;  2WAQ N;  4F3Q A;  4UB6 C;  3ISP A;  3PO2 J;  1KA8 A;  2W24 A;  5AON A;  4BXU A;  4E6K G;  2IT0 A;  4CZC A;  4LB5 A;  1O7L A;  3BOQ A;  1QZZ A;  2DT7 B;  2EQR A;  2VQC A;  3L1P A;  1H0M A;  2WV0 A;  1YX3 A;  1REP C;  4ZZL A;  1JKO C;  2HKX A;  1LDD A;  3GXO A;  2VOD A;  3G2B A;  4D0P A;  3SHF A;  4P55 A;  3KIO A;  2EB7 A;  4P9F A;  3S2W A;  3ZMT A;  4IRG A;  2O3F A;  4YRV A;  4GCV A;  3L2Q A;  4ZC3 A;  1CF7 A;  4L9N A;  4AVZ A;  4OIO F;  3RKQ A;  1XSD A;  3HSE A;  2Y9Z A;  5GPA A;  3RSN A;  4C3J J;  2F5E A;  1IV6 A;  3I59 A;  4BY1 J;  1ZRE A;  2HOT A;  2E60 A;  1VQP I;  4HG2 A;  2MLG A;  1EA3 A;  1USS A;  1Z1D A;  2VKD A;  3HGG A;  4B47 A;  4DIQ A;  5KAF C;  4DYR A;  2V9P A;  1B6A A;  1WI3 A;  1FT9 A;  2ELH A;  4A3I J;  4KMU X;  2OQR A;  2ZKZ A;  3FDY A;  4DJA A;  3VYR B;  2K5C A;  3D5S C;  2P7C B;  2XPV A;  1P2F A;  3ZQG A;  5LD2 C;  2EIK H;  3AL0 B;  4X1E A;  2XGE A;  2P81 A;  1JTX A;  4N4O B;  5LRR A;  5JHF A;  4BE0 A;  4BXF A;  2FUG 2;  1K6Y A;  1MMD A;  2QKL B;  3HRT A;  1R9T J;  2VJ5 A;  1IRG A;  5FRO A;  2KP6 A;  1TW3 A;  1AOY A;  2M0M A;  2VC0 A;  3S93 A;  5IT3 A;  1EF4 A;  1LDJ A;  4AU7 A;  1VQ6 I;  3KP5 A;  5JVG F;  1XSV A;  3TGN A;  5J1U A;  3HYI A;  5E20 A;  1VQO I;  3HL2 A;  4G7Z F;  1IG7 A;  5DM7 F;  2R7U A;  4M3F A;  3TO7 A;  1FY7 A;  3OIO A;  4BXX J;  4AD9 A;  1ETX A;  2LR8 A;  3AG2 H;  3H0G J;  4AYB A;  5IYC J;  2E5N A;  3BR3 A;  1WRJ A;  3MWM A;  2F5F A;  2XUB A;  1IRF A;  1XN7 A;  3FM3 A;  4E7I A;  4C3H J;  2X6Y A;  4HQM A;  3RYR A;  2M0C A;  5EG0 B;  5FJ8 J;  1RIO H;  2OF7 A;  3R61 A;  2WAF A;  3G4S I;  2VE9 A;  1AKH B;  3VOE A;  5E3M A;  1T8I A;  1AKH A;  3F8C A;  2KIM A;  3K9T A;  3HPH A;  2F4I A;  4IEJ A;  3GW2 A;  1E3O C;  2XV4 S;  3CMM A;  3EUH A;  3MAJ A;  1YHQ I;  3PUB A;  3L2R A;  4CCM A;  1K79 A;  1IN8 A;  3S17 J;  4BAY A;  2C6Y A;  2V9K A;  1SFE A;  4BNC A;  3V7S A;  3BTJ A;  4M3G A;  1TC3 C;  3FXQ A;  4XOR A;  2HXI A;  4UUT A;  1FP1 D;  2JRM A;  5DTD A;  1FC3 A;  2A6T A;  4II3 A;  3LMM A;  4YFN F;  1OMI A;  3MZ8 A;  2JA7 J;  4RM2 A;  1BR2 A;  5K7H A;  3L2U A;  3RDI A;  3CDH A;  5FKO A;  1HCR A;  1KYW A;  3TDU C;  4GO1 A;  1BI1 A;  5HVQ C;  2CW8 A;  3ABM H;  1DPU A;  2DK8 A;  2L4A A;  4J01 A;  1QGP A;  4NNJ A;  3WU2 C;  4U7D A;  2JA5 J;  3DKW A;  1X1P A;  1QHH D;  2H6B A;  3UR3 C;  2CYY A;  2DOA A;  3PIP F;  3Q0V A;  2MH2 A;  1IDZ A;  3BR2 A;  2EA4 A;  4RS8 A;  4N4N B;  3E6B A;  1FIA A;  4E4H A;  5E1W A;  3HSR A;  3LAJ A;  5ERI A;  4BH9 A;  1BL0 A;  2KIQ A;  3E97 A;  2WBM A;  4XLE A;  5DUK A;  2NVT J;  3ZPL A;  2EV6 A;  3H0D A;  2VQH A;  1LVK A;  3AG4 H;  1I39 A;  3F3X A;  2EIM H;  3I56 I;  1OYW A;  1P4W A;  3E1S A;  1HA8 A;  4XL9 A;  2DFF A;  3CUQ A;  4MFE A;  3J80 Z;  2OBP A;  1FYK A;  1WH7 A;  3RIR A;  2BOL A;  4HZF A;  4KFC A;  4OIP F;  2Y9Y A;  3ZMD A;  3GF2 A;  5M3F J;  2K27 A;  4A12 A;  3NWS A;  2L9S A;  1CGP A;  1I1S A;  3FMS A;  2HGC A;  2ZFU A;  1WFX A;  4L5E A;  3ABK H;  3CMA I;  3ERM A;  3L7W A;  4OWR B;  1SMT A;  4MHG A;  3S3M A;  4LK0 F;  2XF6 A;  1O3S A;  1SMY F;  1BW5 A;  1QZE A;  2V1X A;  4I98 B;  2X1E A;  4DBQ A;  1IO2 A;  5FB2 A;  4HSR A;  1EJ9 A;  3MN2 A;  2L3D A;  2IPQ X;  2PBI A;  2EWN A;  2BVL A;  2TRT A;  4AYB N;  2EJR A;  4D9J A;  5LEK A;  4ETS A;  1I3A A;  4BQN A;  2WB1 N;  5TIS C;  4WWC A;  3GFJ A;  1OFC X;  2J5P A;  4B43 A;  2DA7 A;  2QEX I;  1FTT A;  4D7M A;  2CSO A;  1ULY A;  4HDU A;  4MQ9 F;  2LVS A;  3W2W A;  3T8R A;  5HDK A;  1J09 A;  1RC9 A;  4EGY A;  1BIA A;  9ANT A;  1MMA A;  3L2W A;  2NS8 A;  4XLF A;  1A35 A;  1ON1 A;  1Z6T A;  1XDS A;  2FEZ A;  1XGS A;  2MD0 A;  1MH4 A;  2V9V A;  2XB5 A;  1W7P D;  4PZJ A;  5TGT A;  3W6K B;  3C7J A;  2P4W A;  1ZHF A;  1ZG5 A;  2E1C A;  4DYC A;  5KK1 A;  1UG2 A;  3A02 A;  2LLK A;  2EK5 A;  5J4Y A;  3IV5 A;  3EUA A;  5B1A H;  2QKM B;  3JRD A;  1U5T B;  2X85 A;  1Y39 A;  2Y48 A;  1ZYR F;  3KEO A;  1TL8 A;  5L3F A;  2X6X A;  2VQL A;  4CXF A;  1MJA A;  3QPL A;  1N25 A;  3KE2 A;  1T56 A;  1TLH B;  4M3B A;  3T5X A;  2LFB A;  3HSF A;  4XRS A;  2V4J C;  3ZMU A;  4ZTF A;  5HS8 A;  3R60 A;  3OR2 C;  1FOK A;  1R6R A;  4V2F A;  3E5X A;  2ACJ A;  4ASN A;  4WXC A;  3BWG A;  3PL8 A;  1KU3 A;  1ZLJ A;  4ESJ A;  3S2D J;  1B9M A;  1BI0 A;  1Y6I A;  3Q0W A;  2H1L A;  4DQ2 A;  2K9M A;  3CC7 I;  2JVH A;  1TQI A;  1Z91 A;  3HG9 A;  3ECO A;  2ISZ A;  3V7C A;  1P7J A;  5K1Y A;  2ZNY A;  4M73 A;  3IH4 A;  1WZ2 A;  2BY3 A;  3IUO A;  5HS9 A;  3FHZ A;  2JMW A;  1V5E A;  2FQ4 A;  3WTZ A;  5LHI A;  2E5Z A;  4RGS A;  2RRE A;  2GIV A;  5LGN A;  3HOW J;  4BDY A;  3HKZ A;  4LIV A;  4ENM A;  4HOB A;  5ILU A;  2CV1 A;  5FLX Z;  5IPA A;  1FEX A;  1B4A A;  1YQA A;  2DMP A;  4Q48 A;  4XN0 A;  2V6C A;  3LSJ A;  2HOE A;  4BYY A;  3QP6 A;  1XMA A;  4DZJ A;  1ZRC A;  3JRH A;  4HEA 2;  4KIT B;  2IXS A;  5J4V A;  1D0Z A;  1OJL A;  3EYY A;  2F5C A;  4MIM A;  3RQ4 A;  2CFO A;  3JRG A;  2KZG A;  5H2F C;  3KCC A;  3D5L A;  1RI7 A;  3S14 J;  3QRF F;  3ZMV A;  2ZBK A;  3ZQ7 A;  5L3E A;  3A2K A;  2O61 A;  5EG0 A;  3MKW B;  4BKX A;  4LJZ F;  5F04 A;  2BHY A;  1SAU A;  3L00 A;  3W6V A;  5AIQ A;  2MLK A;  1E3H A;  4UV8 A;  1S29 A;  1BC8 C;  3K70 D;  2KJC A;  2GXA A;  2HVS A;  2IEK A;  4I0A A;  1UMQ A;  1W4M A;  2G9W A;  3CCQ I;  1I6H J;  3MKZ A;  3FHN A;  2Z5U A;  4G8X A;  2ZSH B;  3HKZ N;  3H5N A;  2L7F P;  4XK4 A;  3BTL A;  2P8T A;  5JHU A;  3RZO J;  5EYR A;  5L3D A;  1B59 A;  1X3Z B;  3Q9S A;  3N97 A;  2FBI A;  4XQF A;  2QVO A;  3DLA A;  2K85 A;  1O57 A;  2CUE A;  2CUZ A;  3A03 A;  3OR1 C;  4O6J A;  3HIF A;  1KQ8 A;  2NXN B;  2Y30 A;  4YII A;  1XS9 A;  3O8H A;  4XN3 A;  4I6Z A;  3HHH A;  5F64 A;  2KDZ A;  3ZQI A;  2OAZ A;  3HM5 A;  1BBY A;  2STT A;  1Y1V J;  1YIT I;  2G7U A;  5BQT A;  5HLI A;  2MGQ A;  2PMU A;  1G6N A;  4PJL A;  3BPV A;  3FKI J;  4HNT A;  5FLX K;  1Z7L A;  2AXL A;  5FRM A;  1HQC A;  3AL0 C;  5LBQ A;  3IC7 A;  2JK3 A;  2OTL I;  3I4P A;  2ZME C;  4CYC A;  3C2G A;  4OIR F;  2OC6 A;  3WTX C;  1JE8 A;  3B02 A;  1IXR C;  1ZGJ A;  2YPR A;  3W6J B;  1UB9 A;  5HLH A;  1STZ A;  1U0J A;  3FXM A;  2VXD A;  3CCJ I;  4RM3 A;  1QVT A;  2ZXI A;  1Z05 A;  3WU0 A;  1OQY A;  1G4D A;  3H5R A;  5BMZ A;  1JKR C;  2JSP A;  2VQG A;  4U88 A;  3P9I A;  2UV1 A;  3O2P E;  3RI4 A;  4JYK A;  1VQ8 I;  1J59 A;  3L9F A;  4G7O F;  1SD4 A;  2DMT A;  1NG7 A;  2XB0 X;  1VQL I;  2R5Y B;  3DCF A;  2QSG X;  3PO3 J;  1IZ1 A;  1R4N B;  2OQG A;  2XSD C;  3KET A;  3QU6 A;  2QBY A;  4KNY A;  4OU0 A;  2HWV A;  3RPU D;  2PX9 A;  3IAS 2;  3R0J A;  2L01 A;  5D5W B;  2EV0 A;  2FOK A;  2M34 A;  2QSH X;  4AWX B;  2XKP A;  1D0Y A;  1ZRF A;  3BR1 A;  3DBH B;  3K2Z A;  2ZME A;  3RKW A;  3ZCO A;  3OYB A;  3CC4 I;  4Z6Y A;  1YRN B;  3CMY A;  5BOX A;  2ZO4 A;  5DV5 A;  1DUX C;  3KEQ A;  4HV6 A;  1UG0 A;  3CCL I;  4EGZ A;  4QSH A;  3B73 A;  3GYH X;  1RKW A;  3F8N A;  4A3E J;  3PM1 A;  1ENH A;  4JX4 A;  1DGW Y;  2DA5 A;  5J1Y A;  5LFA A;  2R7Q A;  5EEG A;  4RAZ A;  2MAB A;  3P5J A;  2AS5 F;  2BY0 A;  5E8I A;  2EBI A;  2OCE A;  3CLO A;  4UV9 A;  1UHW A;  1V3F A;  2K86 A;  3GTJ J;  2QQA A;  3WGG A;  5FKK A;  3JTG A;  1XMX A;  4BY7 J;  4YIR X;  4EM1 A;  2KPM A;  2CG4 A;  2HOA A;  2M7A A;  1WHU A;  5F1J A;  1OR7 C;  4HNV A;  1MJ9 A;  4W1U A;  2A6H F;  3ASN H;  1W5C C;  1XPX A;  4BQQ A;  1JKP C;  2XHK A;  4BEH B;  2HYG D;  2KIS A;  1OR7 A;  1YW8 A;  4W97 A;  5J1R A;  4J19 A;  1G2H A;  4AVP A;  1EV7 A;  5EZH A;  1SFO J;  3E0J B;  2L2O A;  2Q1Z B;  1JT6 A;  4I01 A;  3G1M A;  3VSL A;  3CCV I;  2NVY J;  2MG4 A;  3UNG C;  4FCY A;  4IRI A;  2DFE A;  3ABT A;  1I3Q J;  2A07 F;  2BY1 A;  2V26 A;  2IP2 A;  3PNT A;  2GLO A;  1OLT A;  3RKX A;  1LUJ B;  2XAQ A;  2XAH A;  2DTR A;  4LK1 F;  3G6E I;  2R93 J;  3M7G A;  4PCQ A;  4LOC A;  2CV2 A;  1TT5 B;  2IBD A;  4LGW A;  1N78 A;  2LK2 A;  3GTO J;  3RKY A;  1XX5 A;  4PUS A;  3CO7 C;  3OYC A;  4ENK A;  3DQV C;  4DW6 A;  3S1M J;  3OSG A;  1FOX A;  1DDN A;  2X0L A;  1EH6 A;  1YG2 A;  4WX9 A;  5K7F A;  1MMG A;  2L02 A;  5CYV A;  2KT0 A;  2HDC A;  4A6E A;  4RAF A;  3HJE A;  2JSC A;  2H8R A;  4XR6 A;  2ME6 A;  1MSF C;  2L7Z A;  2P5L C;  1VTN C;  1H9G A;  3RJP A;  4QPQ A;  3BJ6 A;  1F43 A;  2UXN A;  3J81 Z;  1JKQ C;  4HA8 A;  2QYO A;  1BA5 A;  4IQ4 A;  3TDZ C;  2QF7 A;  4XLP F;  3GZN B;  4UNO A;  3D5R C;  4A0X A;  1K4T A;  1QZY A;  5F1R A;  2NRA C;  3QYE A;  1FPQ A;  1ODD A;  2KZV A;  2H8W A;  3F9K A;  3K10 A;  2IJL A;  2FF4 A;  1QNT A;  5EEA A;  1Z0X A;  2VPL A;  2OZU A;  5M5W J;  1GHC A;  4E7K A;  3JSP A;  5D5V B;  2X48 A;  1LEA A;  3JCU C;  1YTY A;  1R00 A;  4NQW A;  4XMY A;  1S8N A;  2ELJ A;  3HOU J;  3BPX A;  1LNW A;  4TV7 A;  3ULQ B;  2ZSI B;  1JUS A;  4CH7 A;  1YRN A;  1A04 A;  5CVI A;  4CYD A;  2JRT A;  4EV0 A;  4XKC A;  5FKL A;  1AHD P;  4BS9 A;  3TBI A;  3EET A;  1JGS A;  1XCB A;  4RGU A;  5D6E A;  1R5I D;  2VT3 A;  1R58 A;  3HUG B;  2LRE A;  1GDT A;  2Y75 A;  2EZL A;  4A3K J;  1KU7 A;  1X1D A;  3R4K A;  1K61 A;  4IOA F;  1QO0 D;  3K1P A;  2Q8K A;  4OMY A;  2NYX A;  1FJL A;  3SXY A;  1TWA J;  2YX7 A;  4XLC A;  3BC8 A;  3K6G A;  2W82 A;  3QAH A;  2JT1 A;  3IRR A;  1OYY A;  3DBL B;  1YS7 A;  3K7A J;  5HOO A;  3BR5 A;  4F52 A;  3KP7 A;  2QZ8 A;  5D6F A;  5DYM A;  2V7F A;  4EJV A;  3SYT A;  3VWB A;  3K4N A;  4FE4 A;  5DD8 A;  2L7K A;  3LQR A;  5DCF A;  2MC3 A;  2FXA A;  5FO5 A;  2FBK A;  4BHB A;  1U3E M;  2DJN A;  3Q0U A;  1IN5 A;  2XRO A;  3CJQ B;  1TQM A;  4N9H A;  1X58 A;  1DQU A;  1MNE A;  5BS6 A;  2VL8 A;  3GLL A;  1JHF A;  2HDW A;  3ESW B;  2HS5 A;  4YIF A;  2QM3 A;  4IQJ A;  4IZZ A;  2ETH A;  3C3W A;  4YG2 F;  1YFH A;  4Y15 A;  2O6G E;  1WWX A;  3CLQ A;  2MA3 A;  3HTS B;  4I09 A;  5B66 C;  1I50 J;  2LY2 A;  4BUP A;  4CZZ A;  3LA3 A;  3ZMS A;  3GWZ A;  4PSX A;  2HZT A;  2L54 A;  3LOC A;  3GTK J;  3OY9 A;  2P5V A;  3ZQF A;  2Z9O A;  4DZP A;  2L9R A;  4BQO A;  2AXT C;  3FXU A;  3ZXS A;  1ZR2 A;  4FQG A;  1SVM A;  3B6A A;  2R4G A;  1ON2 A;  2Y0S A;  2RKH A;  2K9S A;  4I2O A;  1P92 A;  1TW2 A;  4QTR A;  1W0U A;  4KIG A;  2DA2 A;  1WSU A;  2CH0 A;  1UCR A;  1IXS B;  1E2X A;  3KP4 A;  2VLA A;  1W7P A;  4I02 A;  3S3N A;  4BAC A;  5ICF A;  1IN6 A;  2EFW A;  1YW7 A;  2LBF A;  1FBQ A;  2Y2Z A;  2STW A;  3I53 A;  1O7F A;  1YJN I;  2KIU A;  1ETQ A;  3TOB A;  5CPR B;  3COA C;  1MMN A;  5J40 A;  3ROU A;  2V1N A;  5KNL A;  1OCT C;  1YJW I;  2RVC A;  3BR0 A;  1EKE A;  2LDU A;  5CQG A;  2WAD A;  5E1Z B;  3TO6 A;  2AQF A;  5DS9 A;  3GTL J;  2VJI A;  4JBA A;  1S3J A;  3TP3 A;  1D8K A;  1F9N A;  4WK8 F;  1NG6 A;  2ZCW A;  1E17 A;  4RB2 C;  1R1V A;  2E7W A;  3IKV A;  2DBB A;  4CCO A;  3LFU A;  2XDV A;  5D8K B;  2DTZ A;  1WI9 A;  3BG7 A;  1MW7 A;  3CC2 I;  3DTI A;  5JVT A;  1CF7 B;  3AAF A;  2ZJ2 A; 
#chains in the Genus database with same CATH homology
 5DCM B;  1XMK A;  4LLL A;  1U78 A;  2EFO A;  2ZFW A;  4FHT A;  2DFI A;  2UZK A;  2A61 A;  3V8K A;  4R79 A;  3VFZ A;  2KKO A;  4HLY A;  4EQQ A;  1UST A;  3F72 A;  3J81 K;  4M6Y A;  1LJ9 A;  4G6Q A;  5E1X A;  1LQ1 A;  3QPH A;  1LB2 A;  4ZH4 F;  4S05 A;  2HQR A;  1KYZ A;  2WWY A;  3VB2 A;  3ZN0 A;  2PQ8 A;  1BOA A;  2XAJ A;  5H6Q A;  2M8E A;  5HLG A;  1HKQ A;  1EH8 A;  5L3B A;  1B9N A;  1I1G A;  4IXA A;  3J7A O;  5H6R A;  2X4H A;  1OPC A;  2RC4 A;  1QPM A;  4CDG A;  1SD7 A;  1UFM A;  2HTJ A;  3HOS A;  2PG4 A;  3WGH A;  5CVU A;  3DEU A;  1L3L A;  2F5D A;  2CFX A;  2GZW A;  4XBF A;  3GVA A;  2ZXJ A;  5DCM A;  1S7O A;  5LLQ A;  2W84 A;  4HW0 A;  4KMF A;  2D45 A;  1T38 A;  2A68 F;  1W5S A;  2GA1 A;  3GX4 X;  4BHP A;  5E17 F;  3IWZ A;  5FGM A;  3F8F A;  5ILV A;  4HX8 A;  3BZ6 A;  1Z9C A;  1MGT A;  4AIJ A;  1MDM B;  2VBW A;  2J5O A;  1FLI A;  6PAX A;  3T8T A;  3TOA A;  4K2E A;  4LMY A;  3LA7 A;  1R1T A;  4OIN F;  5IT9 Z;  1K6O A;  2VBZ A;  3GO5 A;  3E3V A;  2A3S A;  3KZY A;  4LB6 B;  5K5Q A;  4HF2 A;  3IHU A;  2Y0M A;  1ZN2 A;  4P5O A;  3TQN A;  2GXB A;  2K7L A;  3MCZ A;  1K7A A;  3GZ6 A;  4NHJ A;  4RAY A;  5FD5 A;  3JAM Z;  4M9S A;  5ILS A;  1DP7 P;  5IT9 K;  1Y0U A;  1XB4 A;  3HRS A;  2DAO A;  1ZLK A;  3IKT A;  5DDG A;  4CO8 A;  4S04 A;  2HYF A;  4H0E A;  4JK1 X;  2RGV A;  1R22 A;  4M74 A;  1R36 A;  2XGX A;  5ED4 A;  4P9U A;  4UVC A;  4UUV A;  2GA2 A;  4B09 A;  1KU9 A;  2FU4 A;  4HF0 A;  3DPT A;  4L9V A;  3BY6 A;  3K69 A;  1FYL A;  1R7J A;  3E6C C;  2G7H A;  1QBJ A;  1V4R A;  4L18 B;  4ON0 A;  2E1N A;  2V1U A;  4RB0 A;  1P6R A;  1JHH A;  4ZZD A;  2R3S A;  3DF8 A;  2VOO A;  2ESH A;  3I0T A;  4EJT A;  1I27 A;  3DV8 A;  4ESB A;  5KVR A;  2LF7 A;  5D4S A;  1AWC A;  1J9I A;  3IL2 A;  1SD6 A;  2PMH A;  3L09 A;  1O3R A;  1O3T A;  2F2E A;  2IVM A;  4LG0 A;  4LG0 B;  1I5Z A;  3U1D A;  1ZGA A;  1HXD A;  5JFR A;  4L5I A;  4RB1 A;  1NHA A;  5D5X B;  4EJW A;  4IF4 A;  4KN4 X;  2EV5 A;  2M87 A;  1ZRD A;  4XSX F;  4UHT A;  2CWE A;  1PUE E;  1ZG3 A;  3RPU A;  2Z3Y A;  1O3Q A;  2V1D A;  4PGH A;  4L0Y B;  2PFB A;  2NNN A;  3BRO A;  3FMR A;  3SFZ A;  3NQO A;  3N4M A;  3NEU A;  4HBL A;  4F7Z A;  2VE8 A;  3Q5F A;  1ZAR A;  2XKO A;  4FT8 A;  1YO5 C;  3MZH A;  5CVV A;  4G6D A;  4OIQ F;  5LGT A;  2B0L A;  2WTE A;  1H9T A;  1LVA A;  1U8R A;  4MGR A;  2DT5 A;  1KQ0 A;  4ZYD A;  4I0B A;  3V8L A;  2EFQ A;  2IRF G;  4PGG A;  3HRU A;  1XGM A;  2W25 A;  4L9J A;  1J0R A;  4RB3 C;  2YX4 A;  3VOD A;  2JPB A;  3BJO A;  2ESN A;  4EJU A;  1FBS A;  2XAS A;  3E6M A;  2RQP A;  3SQN A;  1G3T A;  3U9G A;  1HST A;  4N0B A;  4E70 A;  2A6E F;  1F1Z A;  1G3W A;  5CVJ A;  4XLN F;  3I54 A;  2MD5 A;  3HHG A;  3QOP A;  2H27 A;  1JXS A;  1GXQ A;  2OZ6 A;  4EMS A;  2R7D A;  3FM5 A;  2YU3 A;  4I7H A;  3DFG A;  5BPI A;  4AIH A;  3WTS C;  4HDV A;  2KRF A;  3QP5 A;  1HW2 A;  2EA2 A;  2H94 A;  3GFM A;  3DPL C;  4EJO A;  5LGU A;  3V7R A;  4ZYG A;  5FD6 A;  1R23 A;  3BJA A;  3JSO A;  2IW5 A;  2QLZ A;  1XDU A;  4HX4 A;  1FWZ A;  1R5G A;  2MH9 A;  1FNN A;  3IWF A;  3F6O A;  3F8M A;  3EQL F;  5DEQ A;  1YS6 A;  4IPA A;  4KA4 A;  2NS0 A;  3DP7 A;  3H3U A;  4Q4Z F;  1ZG1 A;  1U5T A;  2O8X A;  1HKT A;  1ZAO A;  3NRV A;  3C1D A;  2DQL A;  5EEH A;  1KQ9 A;  3WTW C;  2ISY A;  5TRD A;  3P7N A;  3CUQ B;  4U7B A;  3LQQ A;  4Q5S F;  4FX4 A;  4ENN A;  2QUF A;  1FZP B;  3VEP A;  1S6L A;  3BP8 A;  5CLS A;  2DQR A;  2KJB A;  4EVI A;  2A69 F;  2VT2 A;  1YLF A;  4L9T A;  4AIK A;  5CVR A;  4KYW A;  2XRN A;  3GFI A;  3HOT A;  2YSR A;  1K78 A;  3JTH A;  2FMY A;  1IUY A;  4A5M A;  2RNJ A;  1MZB A;  2K4B A;  4A0Z A;  3WTV C;  4A0Y A;  1HKS A;  2HFH A;  4OOI A;  4MNU A;  1HBX G;  5LRS A;  3ZP5 A;  3WG9 A;  4GYI A;  2QQB A;  5J8F A;  3C18 A;  3CUQ C;  4L0Z B;  1D8J A;  4R8H A;  2VN2 A;  3P9C A;  2Q0O A;  4ESF A;  3M8E A;  2FSW A;  4MTD A;  5FFX A;  1W5T A;  1ONV A;  3BDD A;  5D4R A;  1J5Y A;  5ICG A;  3KZZ A;  2HKO A;  3DXJ F;  3KLO A;  4RGR A;  2MBF A;  3RPQ A;  2WC2 A;  1K78 B;  2VON A;  3TO9 A;  4O5V A;  4QLC U;  2V79 A;  3WTT C;  4OMZ A;  1SD5 A;  5D5U B;  4XSZ F;  1T2K A;  1TNT A;  2DW4 A;  3WU1 B;  2GWR A;  1LEB A;  2BYV E;  4FX0 A;  4KN7 X;  1KGS A;  1R1U A;  4WF2 A;  2DU9 A;  1YIO A;  4B8X A;  3O3K A;  5E8G A;  2D2W A;  4QWQ A;  3GFL A;  3I58 A;  5CJ9 A;  1BI3 A;  4M72 A;  2ZME B;  3MEX A;  5JI6 A;  4HYE A;  5K5O A;  2O0Y A;  1RNL A;  5K5R A;  4KT5 C;  1J75 A;  3HUG A;  5DUI A;  2DPU A;  1BM9 A;  2FE3 A;  4A6D A;  3V8J A;  1FBU A;  3F21 A;  1XSX A;  1BN5 A;  3FZV A;  2FML A;  3MZY A;  2KIF A;  2ZNZ A;  3SZT A;  1BIB A;  1IF1 A;  1KU2 A;  2GXG A;  3M1E A;  2DPD A;  3ZN1 A;  2COM A;  2NNY A;  3OOP A;  1GXP A;  3TKY A;  3RYP A;  2FNP A;  2IA2 A;  2IA1 A;  1HW5 A;  4M9X A;  4PDK A;  2ADU A;  3V4G A;  2XAF A;  2L4M A;  4LFU A;  2W57 A;  4G7H F;  4HF1 A;  1WKM A;  1FSH A;  1OKR A;  4N9I A;  3KLN A;  3LFK A;  4P96 A;  4Y17 A;  4MEX F;  3GUD A;  1G3Y A;  3ELK A;  4YFK F;  4U0V A;  4KDP A;  1YYV A;  2LNB A;  1Q1H A;  1FSE A;  4M6X A;  2R7F A;  2OA4 A;  5BPD A;  2P7V B;  1G3S A;  5A2Q K;  3JW4 A;  3FX3 A;  3I64 A;  5TJJ A;  5ICE A;  3K0L A;  2O03 A;  1XCV A;  3M9A A;  1T6S A;  4WCG A;  2K4J A;  4L5J A;  2UWM A;  3FF5 A;  3IRQ A;  4GYG A;  2Q2E A;  1IN7 A;  2QBY B;  3PQJ A;  2FQ3 A;  2HEO A;  1BI2 A;  2VC1 A;  4Z2Y A;  4GXO A;  2PN6 A;  1U5T C;  4WXH A;  3I5U A;  1GVJ A;  3HTU A;  3LWF A;  3FMQ A;  3LA2 A;  2LSO A;  1TQP A;  2BE5 F;  1SFU A;  3F6V A;  4WXD A;  3L2C A;  4Y13 A;  3LAP A;  2HR3 A;  1WQ2 A;  4UXN A;  2JTV A;  4NB5 A;  2GQQ A;  3KP2 A;  4EM2 A;  1IN4 A;  3CO6 C;  1XGO A;  1PP7 U;  4IJA A;  3WGI A;  2A5Y B;  1SAX A;  1TTY A;  5LHG A;  4LLN A;  2VXZ A;  4G9Y A;  1IXC A;  2BBY A;  2RN7 A;  3K1M A;  2D1V A;  2M5W A;  2H09 A;  4MEY F;  4A2U A;  1T98 A;  2DO7 A;  2W85 A;  3EDP A;  3G73 A;  5FFZ A;  1ZH5 A;  5E18 F;  2XVC A;  2NAZ A;  2PJP A;  4HQE A;  3GLX A;  4LD5 A;  2H6C A;  2IA0 A;  2VOP A;  4HAM A;  2RV8 A;  3M8F A;  4CIC A;  5J8C A;  4JQF A;  4Q47 A;  2UXX A;  2BGC A;  2DI3 A;  3F8B A;  5HS7 A;  1PP8 F;  1Z7U A;  2DK5 A;  5L3C A;  2PEX A;  3CUO A;  5JR3 A;  2P5K A;  4IHT A;  1OYI A;  3O6B B;  3I71 A;  1DPR A;  1J7K A;  1T39 A;  1MDM A;  1BC7 C;  1UHM A;  1I6X A;  2CW0 F;  2P6T A;  1C0W A;  1J2X A;  3CTA A;  3KP6 A;  4KUM A;  3EYI A;  5J6X A;  3ERE D;  2FA5 A;  3E5U A;  1L0O C;  3ML6 A;  4BQA A;  1RZ4 A;  4BHC A;  1IW7 F;  3D0S A;  4RGX A;  3REO A;  3FWE A;  1D5V A;  2DLL A;  1B1B A;  5H20 A;  1MKM A;  2LF8 A;  3H92 A;  3PQK A;  1YW9 A;  3P9K A;  1FX7 A;  2QEN A;  2VBY A;  3T0Y A;  5HDN A;  2FBH A;  1HSJ A;  3K1N A;  3SZP A;  1IAW A;  4MTE A;  1S7A A;  2Z99 A;  1U6G A;  3F22 A;  3U2R A;  2D1H A;  4GGG A;  4O3M A;  5A2Q Z;  2TDX A;  2EFP A;  2M1B A;  4R1H A;  1P4X A;  2HTS A;  3GZ5 A;  4ZYH A;  4HLX A;  1MJB A;  1XGN A;  2EFN A;  4LLG F;  1PDN C;  1P4A A;  2VBX A;  1FYM A;  4IVN A;  2Z33 A;  1QQI A;  3ZMZ A;  3LST A;  3GEZ A;  3KFW X;  3WTY C;  2GAU A;  4ENJ A;  4UVA A;  1RUO A;  3ABU A;  1D3Y A;  3RTR A;  3PFI A;  2E7X A;  3WE2 A;  3I59 B;  3R0A A;  2LKP A;  5LHH A;  1T0F A;  4M9Z A;  2OU2 A;  3OV8 A;  3Q9V A;  2XIG A;  4M71 A;  5D8L B;  1MD0 A;  3E6D A;  3QPT A;  2P6S A;  1EH7 A;  3G3Z A;  1U2W A;  2YR2 A;  3WTU C;  4U0Y A;  2XAG A;  1Z6R A;  3QU3 A;  5AIP A;  2M30 A;  4HV5 A;  5HDG A;  3ECH A;  2BV6 A;  4KIF A;  4EM0 B;  1F4K A;  4XRF A;  3WE3 A;  4UVB A;  3JAM K;  2PLY A;  2JZY A;  4ZYE A;  2OD5 A;  4KIC A;  3H3Z A;  5DD4 A;  3HRM A;  2FNA A;  1TNS A;  4U0W A;  4KIB A;  4CHU A;  1R5H A;  2QQ9 A;  2QWW A;  1LDK B;  3FXR A;  3WOD F;  4A5N A;  4G94 A;  3J80 K;  3F23 A;  1HW1 A;  4YFX F;  1FP2 A;  1TBX A;  4DNC A;  3T1B A;  3MQ0 A;  1F5T A;  3E5Q A;  4HX7 A;  2M45 A;  4MQV A;  3KP3 A;  5ICC A;  1RUN A;  2PI0 A;  1X3U A;  5L3G A;  2HQN A;  3CJN A;  3R6S A;  2FRH A;  1BJA A;  2CO5 A;  4IHS A;  2BEO A;  2CQK A;  4IRH A;  1XD7 A;  1W7P B;  2K02 A;  4CGZ A;  5F6F A;  5LEJ A;  3MFK A;  2CGP A;  2JPC A;  2RDP A;  1SFX A;  3ISP A;  1KA8 A;  2W24 A;  5AON A;  4BXU A;  2IT0 A;  4LB5 A;  1O7L A;  3BOQ A;  1QZZ A;  1H0M A;  2WV0 A;  1REP C;  4ZZL A;  2HKX A;  1LDD A;  3GXO A;  2VOD A;  4D0P A;  3SHF A;  4P55 A;  3S2W A;  2EB7 A;  4P9F A;  3ZMT A;  4IRG A;  2O3F A;  4GCV A;  1CF7 A;  4L9N A;  4OIO F;  1XSD A;  3HSE A;  2F5E A;  3I59 A;  1ZRE A;  2MLG A;  1USS A;  1Z1D A;  1B6A A;  1FT9 A;  2ELH A;  4KMU X;  2OQR A;  2ZKZ A;  2P7C B;  1P2F A;  5LRR A;  3HRT A;  1IRG A;  1TW3 A;  1AOY A;  2VC0 A;  5IT3 A;  1LDJ A;  3KP5 A;  1XSV A;  3TGN A;  3HYI A;  5E20 A;  4G7Z F;  3TO7 A;  1FY7 A;  4AD9 A;  1WRJ A;  3MWM A;  2F5F A;  2XUB A;  1IRF A;  1XN7 A;  3FM3 A;  3RYR A;  4HQM A;  1RIO H;  3R61 A;  2VE9 A;  3VOE A;  3F8C A;  2KIM A;  3K9T A;  3GW2 A;  2XV4 S;  3EUH A;  3MAJ A;  1K79 A;  1IN8 A;  4BAY A;  2C6Y A;  1SFE A;  4BNC A;  3V7S A;  3FXQ A;  1FP1 D;  1FC3 A;  4YFN F;  1OMI A;  3RDI A;  3CDH A;  1KYW A;  3TDU C;  4GO1 A;  1BI1 A;  5HVQ C;  1DPU A;  2DK8 A;  2L4A A;  1QGP A;  4U7D A;  3DKW A;  2H6B A;  2CYY A;  2MH2 A;  2EA4 A;  4RS8 A;  3E6B A;  5E1W A;  3HSR A;  3LAJ A;  5ERI A;  4BH9 A;  3E97 A;  5DUK A;  3ZPL A;  2EV6 A;  3F3X A;  1OYW A;  1P4W A;  3CUQ A;  3J80 Z;  2OBP A;  1FYK A;  3RIR A;  4HZF A;  4KFC A;  4OIP F;  3ZMD A;  3GF2 A;  4A12 A;  2K27 A;  1CGP A;  1I1S A;  3FMS A;  2HGC A;  3L7W A;  1SMT A;  4MHG A;  4LK0 F;  1O3S A;  1SMY F;  2V1X A;  4I98 B;  5FB2 A;  2L3D A;  2IPQ X;  2PBI A;  2EWN A;  2EJR A;  5LEK A;  4ETS A;  4WWC A;  3GFJ A;  2J5P A;  2CSO A;  1ULY A;  4HDU A;  4MQ9 F;  3T8R A;  5HDK A;  4EGY A;  1BIA A;  1ON1 A;  1Z6T A;  1XDS A;  2FEZ A;  1XGS A;  2V9V A;  1W7P D;  4PZJ A;  3W6K B;  3C7J A;  2P4W A;  1ZHF A;  1ZG5 A;  2E1C A;  5KK1 A;  2EK5 A;  1U5T B;  2Y48 A;  1ZYR F;  3KEO A;  5L3F A;  4CXF A;  1MJA A;  3KE2 A;  1TLH B;  3T5X A;  3HSF A;  3ZMU A;  5HS8 A;  3R60 A;  1FOK A;  3E5X A;  2ACJ A;  4ASN A;  4WXC A;  3BWG A;  1KU3 A;  1ZLJ A;  4ESJ A;  1B9M A;  1BI0 A;  4DQ2 A;  1TQI A;  1Z91 A;  3ECO A;  2ISZ A;  3V7C A;  5K1Y A;  2ZNY A;  4M73 A;  5HS9 A;  3FHZ A;  3WTZ A;  5LHI A;  4RGS A;  2GIV A;  5LGN A;  4ENM A;  4HOB A;  5ILU A;  5FLX Z;  1B4A A;  1YQA A;  4Q48 A;  2V6C A;  2HOE A;  4BYY A;  3QP6 A;  1XMA A;  1ZRC A;  3EYY A;  2F5C A;  3KCC A;  3D5L A;  1RI7 A;  3QRF F;  3ZMV A;  2ZBK A;  3ZQ7 A;  5L3E A;  2O61 A;  4LJZ F;  3L00 A;  5AIQ A;  2MLK A;  4UV8 A;  1S29 A;  1BC8 C;  2KJC A;  4I0A A;  1W4M A;  2G9W A;  2Z5U A;  4G8X A;  2P8T A;  5JHU A;  5L3D A;  1B59 A;  3Q9S A;  3N97 A;  2FBI A;  2QVO A;  1O57 A;  4O6J A;  3HIF A;  1KQ8 A;  4YII A;  3HHH A;  5F64 A;  2OAZ A;  1BBY A;  2STT A;  2G7U A;  5BQT A;  5HLI A;  2PMU A;  1G6N A;  3BPV A;  5FLX K;  2AXL A;  1HQC A;  5LBQ A;  3IC7 A;  3I4P A;  4OIR F;  3WTX C;  1JE8 A;  3B02 A;  1IXR C;  1ZGJ A;  2YPR A;  3W6J B;  1UB9 A;  5HLH A;  1STZ A;  1Z05 A;  3WU0 A;  1G4D A;  5BMZ A;  4U88 A;  3P9I A;  3O2P E;  3RI4 A;  1J59 A;  3L9F A;  4G7O F;  1SD4 A;  1IZ1 A;  2OQG A;  3KET A;  3QU6 A;  4KNY A;  2QBY A;  4OU0 A;  2HWV A;  3R0J A;  2L01 A;  5D5W B;  2EV0 A;  2FOK A;  4AWX B;  2XKP A;  1ZRF A;  3K2Z A;  2ZME A;  3RKW A;  5BOX A;  2ZO4 A;  5DV5 A;  1DUX C;  3KEQ A;  4HV6 A;  4EGZ A;  3B73 A;  3GYH X;  3F8N A;  5EEG A;  4RAZ A;  2AS5 F;  5E8I A;  3CLO A;  4UV9 A;  1UHW A;  1V3F A;  2K86 A;  2QQA A;  3WGG A;  3JTG A;  4EM1 A;  2CG4 A;  1MJ9 A;  2A6H F;  2XHK A;  2HYG D;  1OR7 A;  1YW8 A;  4AVP A;  1EV7 A;  4I01 A;  4IRI A;  3ABT A;  2A07 F;  2IP2 A;  3RKX A;  2XAQ A;  2XAH A;  2DTR A;  4LK1 F;  3M7G A;  4PCQ A;  4LGW A;  3RKY A;  3CO7 C;  4ENK A;  3DQV C;  1DDN A;  2X0L A;  1EH6 A;  1YG2 A;  4WX9 A;  2L02 A;  5CYV A;  2HDC A;  4A6E A;  2JSC A;  2P5L C;  1VTN C;  1H9G A;  3RJP A;  3BJ6 A;  2UXN A;  3J81 Z;  4HA8 A;  2QYO A;  3TDZ C;  4XLP F;  4UNO A;  4A0X A;  1QZY A;  5F1R A;  2NRA C;  1FPQ A;  1ODD A;  2IJL A;  2FF4 A;  1QNT A;  2OZU A;  1GHC A;  3JSP A;  5D5V B;  1LEA A;  1YTY A;  1R00 A;  4NQW A;  1S8N A;  3BPX A;  1LNW A;  4TV7 A;  3ULQ B;  4CYD A;  1A04 A;  5CVI A;  2JRT A;  4EV0 A;  3EET A;  1JGS A;  1XCB A;  4RGU A;  5D6E A;  2VT3 A;  1R58 A;  2Y75 A;  1KU7 A;  3R4K A;  1QO0 D;  3K1P A;  2Q8K A;  4OMY A;  2NYX A;  3SXY A;  2YX7 A;  3QAH A;  2JT1 A;  3IRR A;  1OYY A;  5HOO A;  1YS7 A;  3KP7 A;  2QZ8 A;  5D6F A;  5DYM A;  4EJV A;  5DD8 A;  5DCF A;  3LQR A;  2MC3 A;  2FXA A;  5FO5 A;  2FBK A;  4BHB A;  1U3E M;  1IN5 A;  2XRO A;  1TQM A;  4N9H A;  5BS6 A;  1JHF A;  2HS5 A;  4YIF A;  2QM3 A;  2ETH A;  3C3W A;  4YG2 F;  1YFH A;  4Y15 A;  2O6G E;  1WWX A;  2MA3 A;  3HTS B;  4I09 A;  4CZZ A;  3LA3 A;  3ZMS A;  3GWZ A;  2HZT A;  2L54 A;  2P5V A;  2Z9O A;  3FXU A;  1ON2 A;  2RKH A;  4I2O A;  1P92 A;  1TW2 A;  4KIG A;  1WSU A;  1UCR A;  1IXS B;  1E2X A;  3KP4 A;  1W7P A;  4I02 A;  5ICF A;  1IN6 A;  2EFW A;  1YW7 A;  1FBQ A;  2STW A;  3I53 A;  1O7F A;  2KIU A;  3TOB A;  3COA C;  3ROU A;  2RVC A;  2LDU A;  5E1Z B;  3TO6 A;  4JBA A;  1S3J A;  1D8K A;  1F9N A;  4WK8 F;  2ZCW A;  1E17 A;  4RB2 C;  1R1V A;  2E7W A;  3IKV A;  2DBB A;  5D8K B;  1WI9 A;  5JVT A;  1CF7 B;  3AAF A;  2ZJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...