3HTSB

Heat shock transcription factor/dna complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
91
structure length
82
Chain Sequence
MARPAFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMYGWHKVQNNDSRWEFENER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A new use for the 'wing' of the 'winged' helix-turn-helix motif in the HSF-DNA cocrystal.
pubmed doi rcsb
source organism Kluyveromyces lactis
molecule tags Transcription/dna
molecule keywords 5'-D(*GP*GP*TP*TP*CP*TP*AP*GP*AP*AP*CP*C)-3'
total genus 22
structure length 82
sequence length 91
ec nomenclature
pdb deposition date 1998-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3htsB00
5D4RA 3LAPA 1K6OA 1R36A 4WWCA 2WWYA 3FMRA 5HLIA 1MGTA 4M6XA 2G9WA 3M8FA 2VXZA 1XCVA 4OOIA 3N97A 1XCBA 5ICEA 3ZN1A 4U0YA 2FEZA 3HHGA 4NB5A 3COAC 4OIPF 4KDPA 3GZ5A 1YW7A 3GEZA 4UUVA 3HSFA 5AIQA 4B8XA 3E6CC 1B6AA 2DK5A 4KN4X 3IRQA 5LLQA 4UVAA 3BOQA 2FNAA 5D6EA 4BQAA 3IHUA 3SQNA 3U2RA 2A07F 2ZNZA 1KU9A 2M8EA 3V7CA 3O3KA 2RNJA 3NRVA 3FM5A 1XGMA 4G8XA 3DFGA 1G3WA 4RGUA 2OBPA 4RGSA 3F6OA 2V1XA 4P9FA 3W6KB 1ZLKA 2CGPA 2FBKA 2HKOA 2P4WA 1QGPA 4KYWA 3I54A 2VBYA 2XHKA 4PGHA 4U88A 1U78A 4KFCA 5E1XA 4EGZA 3ZPLA 3FM3A 2V1UA 1GHCA 3GFMA 5EEHA 1H9TA 3U9GA 1SFEA 4PZJA 4YFNF 4L0ZB 1FY7A 1KQ9A 4ZYEA 4BH9A 3BWGA 2IP2A 1O7FA 1W7PB 5D4SA 1T38A 2R3SA 1R23A 2QUFA 5HDKA 3BP8A 2OQGA 1USSA 2L4AA 4EV0A 3HSEA 1V4RA 1JXSA 4NQWA 4LLGF 1I6XA 2CWEA 5JFRA 4U7DA 1UCRA 2M87A 3FX3A 3G73A 3CUQB 3ISPA 4HV6A 2EFWA 5HS7A 4WXHA 4O6JA 1FWZA 4ON0A 2VBXA 2PI0A 3I5UA 4EJUA 3M8EA 2ZFWA 1AOYA 1SD4A 3LQRA 1BBYA 1XB4A 1BI0A 2IJLA 3CUQA 1FP1D 2DO7A 4LFUA 3TGNA 2DPDA 2FOKA 1TLHB 2P5KA 5D8KB 5HDNA 5DD8A 3HRMA 3SHFA 5IT3A 1FP2A 2V9VA 2ISYA 3B73A 5FD6A 3RKWA 2PJPA 4GCVA 2EFQA 2QLZA 2R7DA 2IPQX 2VODA 5D5WB 4LG0A 1F5TA 4L18B 4I0BA 1YLFA 2OZ6A 4ENNA 2XKPA 1QZYA 4L9JA 2P6SA 1LQ1A 4BHCA 4MEXF 2FMLA 1R7JA 5LGNA 4LLLA 4Q47A 4KNYA 3IC7A 2VOOA 1O57A 1J9IA 5CJ9A 2L4MA 3E6DA 5IT9K 1DP7P 5D5UB 4UXNA 4HDUA 5FLXK 3S2WA 1T0FA 2EK5A 4MGRA 1OYWA 4M74A 4BNCA 2Y75A 2CW0F 1STZA 2FF4A 2P8TA 4AIKA 1IXCA 3U1DA 3HOTA 4M72A 4P96A 4R8HA 4HZFA 1PDNC 1LDKB 4IHTA 1BIAA 4UHTA 3FWEA 1IXRC 1F1ZA 2FXAA 4IF4A 1U5TA 2KJBA 4XRFA 3MZHA 3WTXC 4IJAA 1D3YA 1RNLA 4OMZA 1IN4A 3OOPA 2ZCWA 2XKOA 1P6RA 3TO9A 2JSCA 2W57A 1MDMA 4A0ZA 4WF2A 3F72A 3JTGA 1OYYA 2VN2A 3R6SA 3PFIA 4EJTA 2AS5F 2MA3A 4HLYA 5E17F 4LB6B 1YQAA 2RV8A 3FXQA 1GXPA 5TJJA 1OPCA 1RUOA 3RKXA 2HEOA 2BE5F 2E7XA 1DPRA 2LF8A 5CVJA 2VC0A 3QAHA 1OMIA 2CO5A 2STTA 1HSTA 1IN8A 2VT3A 2FA5A 3QOPA 4N0BA 1FNNA 3GX4X 3HRSA 3F8FA 1XSVA 4N9HA 1I1SA 2A68F 2PMHA 3RYRA 2BBYA 3HSRA 1DDNA 2K86A 3DQVC 2Q8KA 3R60A 2HYFA 5L3GA 3ABUA 2VOPA 3I59A 4OMYA 3KETA 1P4XA 5DCMB 2QZ8A 2D1HA 2HZTA 2DW4A 2ACJA 3BY6A 1REPC 2L3DA 2W84A 4EVIA 2PBIA 1FYMA 3F21A 4MQVA 4PDKA 4ESFA 5DD4A 1IUYA 4KIFA 2XASA 4NHJA 1Z6TA 4IXAA 4IRIA 2A69F 2GA2A 2XAGA 3T1BA 1J0RA 2PLYA 3GFIA 1CGPA 3L2CA 4IHSA 5ICCA 5LHIA 4I09A 3CLOA 2HQRA 4JBAA 4OIRF 4JK1X 2L01A 2HTJA 4OU0A 1EV7A 1LDJA 1R00A 2KKOA 3SXYA 5L3DA 4AD9A 3GVAA 1YYVA 3CUQC 1RUNA 3QU6A 3MFKA 2LDUA 1L3LA 2IA1A 2XAHA 2OA4A 4L9TA 3VFZA 3BZ6A 1VTNC 1ZG5A 4OINF 3WTWC 3DP7A 2FSWA 2CG4A 2ISZA 4MTEA 1Z05A 3WODF 2BGCA 1XGOA 3Q9VA 4I98B 5LEJA 2EWNA 3GLXA 2IT0A 2VT2A 3REOA 5L3BA 1HKQA 3OV8A 5TRDA 1WQ2A 5K5RA 5FO5A 1IW7F 3ELKA 3HUGA 1ZREA 1B1BA 5JHUA 3H92A 4HF2A 3VB2A 3EYIA 3L09A 3T8TA 1WKMA 2GA1A 2IA0A 2YX4A 1ZG1A 1ULYA 3BPVA 3R0AA 3MZYA 2EV5A 5DUKA 2A6EF 2P5LC 3ECHA 3C18A 4HX8A 2UWMA 2DQRA 2LKPA 5F6FA 2IA2A 2NNNA 5F1RA 4S04A 2M30A 4LK0F 3TQNA 5HLHA 3RTRA 3J80K 1YW8A 3MAJA 3T0YA 1ZRDA 2L54A 1IRGA 4GO1A 3TDUC 1Z1DA 1X3UA 4XSXF 1Z7UA 2WV0A 2MBFA 2OZUA 5BS6A 1LEBA 3LA3A 2HKXA 4AWXB 3F22A 1YS6A 4G94A 1R1TA 5E1ZB 2YPRA 3ROUA 4H0EA 4CHUA 3BJ6A 2JPCA 1J75A 2ZO4A 3KCCA 2F5EA 4ZYHA 1FBUA 1U8RA 2IVMA 5ILSA 2YX7A 3H3UA 3WTSC 4YIFA 1USTA 1XD7A 1O3RA 2NS0A 2MH9A 2XAQA 3HRTA 1ZYRF 3D5LA 2M5WA 2K4BA 4FT8A 1BI2A 2MD5A 1B59A 3I4PA 3ABTA 5LHGA 3F6VA 1P4WA 1HW1A 4G7OF 4A5NA 1XMAA 4KUMA 2P6TA 1LDDA 1TNTA 1C0WA 1JE8A 1FT9A 2GZWA 2JZYA 3GFJA 1SMTA 5JR3A 3V8LA 1G6NA 2V6CA 1RIOH 5FB2A 1SD5A 1KU2A 2XVCA 1QBJA 2FU4A 4HF1A 3VOEA 1MJAA 4RB0A 2EFPA 1HXDA 3WU1B 3IL2A 2PG4A 1F4KA 2ZJ2A 4MQ9F 1ONVA 3QU3A 3C7JA 3HRUA 2QM3A 2HR3A 3FHZA 4HX4A 4GGGA 4HF0A 2IRFG 1SAXA 4Y17A 3P9CA 1KYZA 4M71A 1JGSA 5DCFA 4DQ2A 3T5XA 5CVVA 2D1VA 2X4HA 2A6HF 2XGXA 5FD5A 3F3XA 2H6CA 2IW5A 1LVAA 2WC2A 3M1EA 2O03A 2O3FA 4E70A 1XDUA 3CUOA 1YIOA 3E5UA 3KZZA 1ZRCA 2GWRA 2HTSA 2HGCA 1WWXA 4MHGA 4M9SA 4IRGA 4P55A 1S7AA 2ELHA 2FBIA 3D0SA 4UVCA 4ASNA 1QZZA 2ZMEA 4EJOA 1QQIA 4R1HA 3P9IA 4O3MA 3HHHA 5KVRA 5LRRA 4KA4A 1AWCA 4HOBA 4A2UA 4HYEA 5CLSA 5HVQC 2CYYA 1BI3A 2JT1A 4ESBA 5H6RA 3E6BA 2ZBKA 3CO7C 4EJVA 1HKTA 2K7LA 2Z5UA 4GXOA 3QPTA 3WTZA 3WGHA 2Z33A 4I02A 3V7SA 3MEXA 1ZAOA 2BYVE 5LRSA 4A12A 4EM1A 5E8IA 4ZZDA 2HOEA 2V1DA 4G7ZF 2WTEA 4A0XA 1YTYA 5L3EA 2COMA 1XSXA 1B9MA 4L9NA 3DF8A 3KEOA 1UHMA 1IXSB 1SFXA 1TQPA 3JSOA 4G6DA 2K02A 2XAFA 4M6YA 2HQNA 2RDPA 5CVRA 2VE9A 1IN5A 4ENMA 3TOBA 2UZKA 2D2WA 1WSUA 4IVNA 2EFOA 4KIBA 4KIGA 3E5QA 1FSEA 1KGSA 2VBWA 1GXQA 2D45A 3M9AA 3FXRA 1XGNA 4I01A 1K7AA 2HYGD 3KFWX 2RN7A 2HDCA 2QVOA 3F8NA 1HKSA 2ZKZA 1LNWA 3ML6A 4XSZF 4GYGA 2RKHA 3FF5A 1U2WA 4LMYA 1YS7A 1U5TB 1MZBA 3VODA 3E97A 1O3TA 2GXGA 4FHTA 3FZVA 5ILVA 1S7OA 2HS5A 5LHHA 1G3SA 4WCGA 4HQMA 1U3EM 5DYMA 1FLIA 5LBQA 4I0AA 4HAMA 3KZYA 1Y0UA 1S6LA 3K2ZA 3K69A 4RB3C 2EV6A 3WE2A 3PQKA 2EA2A 4KT5C 3WG9A 2JPBA 3GXOA 5ERIA 3ZMTA 1H9GA 3ZMVA 5BPIA 1I5ZA 3CDHA 1OYIA 1HSJA 4YFXF 1YG2A 1SD6A 3QP6A 1BJAA 1KA8A 1F9NA 2X0LA 4HDVA 4HA8A 4CZZA 3ECOA 2YR2A 4I2OA 3KLOA 5HOOA 1W5SA 4LG0B 1K79A 1BC8C 1W7PA 5LGUA 1HBXG 3Q9SA 5F64A 2KIUA 2DQLA 4XLNF 1U6GA 1HQCA 3ZMUA 1FOKA 2EV0A 4RGXA 3WGGA 4XLPF 2PN6A 2B0LA 4WK8F 1LB2A 4RGRA 3EDPA 4PCQA 1LEAA 1PP8F 5A2QZ 4Q5SF 3EETA 5CVUA 2XROA 2BV6A 3F8CA 2YU3A 3DEUA 1TNSA 2MC3A 1EH8A 2ZXJA 4IPAA 2RC4A 2QENA 2XAJA 1OR7A 3V7RA 3I59B 4PGGA 5K5QA 1JHHA 2A5YB 4U0WA 3R0JA 4F7ZA 4AIJA 3JW4A 2ETHA 1U5TC 1MKMA 2FNPA 2J5OA 1R1VA 2G7UA 3TDZC 2R7FA 2DK8A 3NEUA 3G3ZA 1BN5A 5LEKA 3CJNA 4EQQA 2QBYA 4QWQA 2DAOA 2O61A 1BOAA 1FC3A 3HYIA 4DNCA 4ESJA 3GUDA 3IWZA 4RS8A 4L5IA 1TQMA 2DT5A 5IT9Z 3B02A 1ZGJA 1B4AA 2VONA 4BAYA 3KE2A 5D5VB 3AAFA 2C6YA 2BEOA 4S05A 2H6BA 2Z99A 1WI9A 5J6XA 3EYYA 4L5JA 5JI6A 5FFZA 1D8KA 4IRHA 3I53A 2OU2A 2A61A 1R5HA 4KMFA 1P4AA 4UNOA 4AIHA 2G7HA 3HTSB 1MJ9A 1P92A 2TDXA 5D8LB 2XIGA 5DV5A 1T2KA 3F8MA 3JAMK 1YFHA 3RKYA 5AIPA 1CF7A 3KLNA 4AVPA 2MLGA 1TTYA 1ZARA 4EMSA 3R61A 3RIRA 2PQ8A 3WGIA 3O2PE 5DCMA 4FX0A 1ODDA 3BROA 1RZ4A 1D5VA 3M7GA 3DXJF 2LNBA 4D0PA 1IF1A 4RB1A 2QQBA 4UVBA 2M45A 3K1MA 5HS9A 3IKVA 1SD7A 4TV7A 2CQKA 5HDGA 5E18F 1YW9A 2Q2EA 5KK1A 5E8GA 3RJPA 5BOXA 4XBFA 3ZQ7A 3KP4A 1T6SA 5J8FA 1IZ1A 3FMSA 4HBLA 2FQ3A 3BJOA 3K9TA 4JQFA 1PUEE 4O5VA 5JVTA 4LLNA 2E1NA 1IN7A 3ZMDA 2EA4A 3LSTA 4N9IA 4Z2YA 2A3SA 1SMYF 1ZHFA 3LWFA 2J5PA 5BMZA 3T8RA 5FLXZ 4MNUA 1BC7C 3HIFA 3O6BB 4HQEA 5ILUA 3KP3A 3DKWA 3TO6A 3WTVC 4KMUX 3MCZA 5LGTA 4RAZA 1KQ0A 5BPDA 3SFZA 1ZN2A 4CXFA 2GXBA 3C3WA 4A6DA 3J81K 4L0YB 2H09A 4B09A 3F8BA 1I1GA 3K1PA 4CO8A 2O8XA 2ESHA 1Q1HA 2W85A 1JHFA 1DUXC 5J8CA 5FGMA 1Z91A 4K2EA 1FZPB 2P5VA 3QRFF 4MEYF 2P7VB 1I27A 4Y15A 1XGSA 4BHPA 1K78A 3H3ZA 3LQQA 3J81Z 4KN7X 1QPMA 5CVIA 3WTTC 2VBZA 3P7NA 3E5XA 3E6MA 3JAMZ 1XSDA 3NQOA 2DU9A 2YSRA 5E20A 4ENKA 1ZH5A 1KU7A 2F2EA 1O3QA 3PQJA 2FRHA 4P9UA 3K1NA 2JRTA 1KU3A 3DPLC 3LAJA 1FBQA 3QP5A 5BQTA 1ZGAA 2DBBA 5ED4A 1FX7A 1O7LA 2Z3YA 3ERED 1J59A 2OD5A 2MLKA 3WU0A 3GF2A 3I0TA 3HOSA 3JSPA 4YG2F 4OIQF 1XN7A 3V8KA 3ULQB 2STWA 2MH2A 1FBSA 4WX9A 3I58A 5H6QA 2JTVA 1EH7A 4R79A 2F5DA 3TOAA 1LJ9A 1SFUA 4ZZLA 1T39A 1HW2A 2UXXA 5DDGA 2DI3A 4UV8A 2AXLA 2H27A 2ZNYA 4FX4A 4G9YA 1H0MA 3ZN0A 4LD5A 1D8JA 5K5OA 1J2XA 1K78B 2FE3A 3BJAA 4ENJA 4Q48A 2EJRA 1S8NA 4HV5A 2NAZA 5FFXA 2NYXA 2F5FA 2CSOA 2ADUA 4LGWA 2ESNA 1J5YA 1E2XA 5E1WA 5AONA 2GAUA 4KICA 5H20A 1A04A 4G6QA 4G7HF 2HWVA 3KEQA 4EM0B 2RGVA 4A6EA 2Y48A 1NHAA 3GWZA 4P5OA 3TO7A 2E7WA 1EH6A 3BPXA 1ZRFA 3EUHA 2KIMA 1S29A 1GVJA 2DPUA 2QYOA 2KRFA 1W5TA 4A0YA 2LSOA 1RI7A 2RQPA 3KP6A 4EM2A 3W6JB 3J7AO 2F5CA 3LFKA 4RAYA 1BIBA 3WE3A 2Q0OA 1ZLJA 2QQ9A 3V4GA 4RB2C 1G3TA 2KIFA 4M9ZA 1R22A 1E17A 1IRFA 4I7HA 2RVCA 1Z9CA 1ZG3A 2W24A 1UHWA 4ETSA 3P9KA 3MQ0A 3LA7A 4HW0A 1G4DA 3QPHA 2L02A 2O0YA 4YIIA 4U0VA 4Y13A 3LA2A 3GYHX 3RDIA 2H94A 2K4JA 2XV4S 1TBXA 1UFMA 4ZYDA 2NRAC 1W7PD 1HW5A 1R5GA 3BDDA 2E1CA 1MJBA 1R58A 1T98A 2QQAA 1PP7U 4EGYA 2QBYB 3RPUA 2PFBA 4L9VA 1TQIA 3KP7A 1KQ8A 3CTAA 2GQQA 2P7CB 4GYIA 4M9XA 3JTHA 1FYLA 2PEXA 3J80Z 4ZH4F 2Y0MA 3N4MA 3C1DA 1IN6A 1S3JA 2W25A 1G3YA 3GFLA 2XRNA 4QLCU 3IKTA 1MD0A 3IRRA 4WXCA 2VE8A 5D6FA 4Q4ZF 3F23A 2CFXA 4LJZF 4CGZA 3V8JA 4BXUA 3KP2A 5CYVA 4CICA 4U7BA 1TW2A 3ZMZA 3L9FA 2K27A 1R1UA 5DEQA 5HLGA 3FXUA 1MDMB 3WTYC 4MTDA 4WXDA 3RPQA 4UV9A 3SZTA 4EJWA 5D5XB 4CDGA 4OIOF 3GO5A 2M1BA 3FMQA 2OAZA 3MWMA 3R4KA 2FMYA 2EFNA 3HTUA 1FSHA 4BYYA 3RYPA 3GZ6A 3ZP5A 5ICGA 2Z9OA 1XDSA 3K0LA 5DUIA 5ICFA 1FYKA 2DFIA 2EB7A 4CYDA 1W4MA 3WTUC 1J7KA 3L7WA 1ON1A 1WRJA 2FBHA 3RI4A 1O3SA 1QNTA 4LK1F 2ZMEB 1ON2A 2QWWA 1BI1A 3TKYA 2VC1A 2OQRA 2V79A 4A5MA 1CF7B 5HS8A 3Q5FA 2O6GE 3E3VA 2DTRA 3ZMSA 1V3FA 3DV8A 1OKRA 5EEGA 4BHBA 2LF7A 4M73A 1YO5C 2GIVA 5L3FA 4ZYGA 2KJCA 3EQLF 1P2FA 3I71A 3SZPA 1BM9A 4HX7A 3VEPA 3DPTA 3CO6C 1FPQA 4HLXA 2PMUA 3IWFA 1L0OC 4LB5A 1UB9A 4YFKF 2DLLA 3GW2A 6PAXA 2XUBA 1TW3A 2HFHA 5A2QK 3I64A 1B9NA 1XMKA 1QO0D 5L3CA 3L00A 1KYWA 3KP5A 2NNYA 1IAWA 2UXNA 5K1YA 1DPUA 1Z6RA
chains in the Genus database with same CATH superfamily
3PUFA 2LKXA 1I3AA 5D4RA 3LAPA 1SC7A 1K6OA 3JR9A 2W7NA 4JX4A 1R36A 2CQ7A 4WWCA 1TWHJ 3S3OA 2WWYA 3FMRA 1ENHA 3PNVA 2E36A 5HLIA 1MGTA 3L2UA 4M6XA 3GTKJ 2JUCA 2G9WA 3M8FA 2VXZA 1XCVA 4OOIA 1LKXA 5C3EJ 3N97A 1XCBA 1A5JA 1YX3A 3AFHA 2AQFA 5ICEA 3ZN1A 4FE4A 4U0YA 2FEZA 3HHGA 4NB5A 3BG3A 2DDAA 3COAC 4OIPF 4XNFA 5E3LA 2WAEA 4A3LJ 4G12A 5H2FC 3D5SC 4IX7A 4KDPA 3GZ5A 1YW7A 5FKOA 3GEZA 4UUVA 5M3MJ 3HSFA 5AIQA 2MG4A 3BR1A 4B8XA 2DODA 2VI6A 3E6CC 5DTDA 5K7ZA 1SFKA 1B6AA 2DA5A 2DK5A 4KN4X 5EEAA 4YIRX 3IRQA 5LLQA 3TP0A 4UVAA 3BOQA 1X58A 2FNAA 5D6EA 1DPUA 4BQAA 2LKSA 2DFHA 3IHUA 2JA2A 3SQNA 3U2RA 2A07F 2CMPA 2ZNZA 3ZCOA 3CC4I 4HNUA 1KU9A 2CV2A 4ZC3A 2CV0A 2M8EA 3V7CA 3O3KA 2RNJA 3NRVA 3CF2A 2EBIA 3FM5A 1FIPA 1XGMA 2I8DA 4G8XA 5J4VA 3DFGA 1G3WA 4RGUA 2OBPA 4LIUA 4RGSA 5K7HA 3F6OA 3K70D 2V1XA 4P9FA 3W6KB 4UUSB 4ANJA 5M3FJ 1ZLKA 2CGPA 2FBKA 2K9NA 2HKOA 3IUOA 1B72A 5FRMA 2P4WA 1QGPA 4KYWA 3DEWA 4MFDA 3I4NJ 3I54A 2VBYA 2XHKA 4PGHA 4U88A 1U78A 4RDUA 3HGGA 4KFCA 5E1XA 4EGZA 3ZPLA 3FM3A 2V1UA 2DT6A 1GHCA 2KLOA 3GFMA 1D1BA 2E2JJ 2K40A 5EEHA 2KP6A 5F0FA 1SFEA 4PZJA 2WA0A 3U9GA 1H9TA 1A6IA 4YFNF 2F48A 4L0ZB 1FY7A 1KQ9A 4HG2A 4ZYEA 2O5RA 4BH9A 1JKPC 3BWGA 2IP2A 3JRHA 1O7FA 1W7PB 5D4SA 3PO2J 3OYBA 1T38A 4FASD 1R71A 2HVRA 1QA6A 2R3SA 1R23A 1ETKA 2QUFA 5HDKA 2V9PA 2UV1A 3BP8A 2OQGA 2Y9ZA 1USSA 2L4AA 3G1OA 4EV0A 3OYJA 3HSEA 1V4RA 2A05A 1JXSA 3DKYA 4NQWA 2HI3A 4LLGF 3HZJA 1S72I 4ZDPA 1I6XA 1WJ5A 3OSGA 2GXAA 2CWEA 2FX0A 5JFRA 1A6QA 1T33A 2EILH 5GAEJ 4U7DA 1LE8A 1UCRA 5IP6A 2M87A 4RLFA 4PJLA 2BHYA 3FX3A 3G73A 3CUQB 3ISPA 4HV6A 2EFWA 3K4JA 1BW6A 1X3ZB 1XTAA 3MKLA 5HS7A 4WXHA 2M0CA 3L2WA 4HSRA 4O6JA 2NOJB 1FWZA 4ON0A 3OYNA 1JUMA 2VBXA 2X6XA 2PI0A 3I5UA 4EJUA 3CESA 3M8EA 1SVMA 3KIOA 2ZFWA 1AOYA 3NARA 4RAGA 5GADJ 1SD4A 3LQRA 1BBYA 1XB4A 1BI0A 5JLXA 2IJLA 3CUQA 4II2A 4BE0A 1FP1D 1JJ6C 1FJLA 2DO7A 4LFUA 3TGNA 1R4NB 1FIAA 2DPDA 2FOKA 1TLHB 2VXDA 3PUBA 2P5KA 5D8KB 5HDNA 4A3FJ 5DD8A 1Y8RB 2EIMH 3HRMA 3SHFA 5IT3A 3H36A 1FP2A 2V9VA 2DA3A 4QIWN 2ISYA 3B73A 2JA6J 3H3VK 3OS1A 2H1LA 1WJBA 5FD6A 3RKWA 3CC7I 2JWTA 4PK4A 2PJPA 4GCVA 4E7HA 2CFOA 3HPGA 2EFQA 3VYUB 4CCOA 4NBQA 4DGWB 2E2IJ 4GRIA 2QLZA 1ZELA 3S93A 2R7DA 2IPQX 2VJIA 4UB6C 5D5WB 4LG0A 1F5TA 2VODA 5F27A 1GUUA 1FOWA 4L18B 3CCLI 4I0BA 1WVRA 3BTIA 4X6AJ 1YLFA 2OZ6A 4ENNA 1AA7A 2AO9A 2XKPA 2Y30A 2CQXA 3GTOJ 5FKKA 1QZYA 4L9JA 2FOWA 2P6SA 1LQ1A 1DU0A 4BHCA 3B6CA 4MEXF 2LBFB 3SDGA 1X1BA 2FMLA 3M1CA 2BOLA 2NS8A 4QSHA 4B3XA 2M9HA 3H9GA 1R7JA 1Z3YA 5IP7J 4A3IJ 1BJZA 3S14J 5LGNA 4LLLA 3A01A 4Q47A 3DBLB 3NWTA 1ZQ3P 4IKFA 2VKVA 3K70C 1MNMC 4IHXA 4XOPA 3TW7A 2M7AA 2Z2SB 4KNYA 5KCMA 4CSWA 3IC7A 2VOOA 1O57A 4J00A 1J9IA 5CJ9A 2RAEA 2L4MA 3E6DA 1TWGJ 5IT9K 5FJ8J 1D0ZA 1ETVA 2HZDA 1DP7P 2H8RA 3FXOA 5D5UB 2H1KA 4UXNA 1IG7A 4XLEA 1X1PA 4HDUA 5FLXK 3S2WA 3MKYB 1T0FA 2EK5A 4IL6C 1ZK8A 4RAFA 4MGRA 1OYWA 2R92J 4XOTA 2JVGA 4M74A 4BNCA 3CMMA 2Y75A 2L2OA 5FKNA 5J1RA 3G6EI 1IGNA 2CW0F 1STZA 4DIQA 4F93B 2OTJI 1QU3A 2FF4A 1OCZH 2P8TA 3WG7H 1PVEA 4AIKA 1IXCA 3G1MA 3U1DA 3HOTA 1A36A 2K9SA 4M72A 3FXMA 4P96A 4R8HA 2Z16A 4HZFA 1PDNC 1LDKB 4IHTA 3JRCA 1BIAA 4UHTA 3FWEA 1IXRC 1HOMA 1ETXA 2UUZA 2NVQJ 2X6OA 1F1ZA 2FXAA 4IF4A 1U5TA 2KJBA 4XRFA 4CCNA 1RRJA 3MZHA 3WTXC 4IJAA 2ECCA 1UHSA 1D3YA 2L9NA 3M07A 1YE9A 1RNLA 1YI2I 4OMZA 4BY1J 1X4OA 1IN4A 3OOPA 5JHFA 2ZCWA 4I76A 2XKOA 1P6RA 3TO9A 1HCRA 2GIZA 3S1MJ 3FK7A 3LSGA 2JSCA 2OCCH 1SAUA 2W57A 1UG0A 2E2HJ 4CH7A 5J1YA 1MDMA 3PIOF 4A0ZA 4WF2A 4DYQA 3K4LA 3DTEA 3K4MA 3F72A 1JUPA 3JTGA 1ACIA 1OYYA 2V7FA 1LFPA 2VN2A 4XONA 4A93J 2LY9A 1XMXA 2V26A 3R6SA 2R7VA 3PFIA 4BL0B 1OCTC 1QRYA 4AYBA 4ZYAA 4EJTA 2X48A 2AS5F 2MA3A 4HLYA 3JRAA 1R9TJ 5E17F 4G6TB 4LB6B 4A3EJ 1YQAA 2IS2A 2RV8A 3FXQA 1GXPA 2WY8Q 2PMZN 2HVSA 3HPHA 2EZHA 5TJJA 1OPCA 2L9RA 1PUFA 1VQ9I 4F55A 1JT6A 1RUOA 3OOUA 3RKXA 2HEOA 4MLOA 1VQLI 4D9JA 4IEJA 4A3CJ 2BE5F 2E7XA 1DPRA 2LF8A 5CVJA 2VC0A 3QAHA 1OMIA 2CO5A 2STTA 3BG6A 3W2VA 4CUGA 1HSTA 1IN8A 2VT3A 2LR8A 5CKTA 3OYHA 2FA5A 2LBFA 1BR4A 3QOPA 4N0BA 2OPTA 1FNNA 3CMYA 4AIDA 3GX4X 3HRSA 3F8FA 3S17J 4MO7A 1IDZA 1RR7A 1XSVA 4N9HA 1DP3A 2CQNA 1I1SA 3KZIC 4BBRJ 2JQ7A 3K2AA 2A68F 5HNHA 2PMHA 3L2QA 1PJRA 3CDLA 3RYRA 1RPWA 2BBYA 2ZXIA 3DU6A 4XORA 1WPKA 3HSRA 1DDNA 2K86A 3DQVC 5EZHA 2K3PA 2Q8KA 3BTJA 4PJNA 4EATA 3R60A 2R7ZJ 3EUKL 2DMTA 2HYFA 5L3GA 3J7AY 1WGXA 2MABA 3ABUA 2VOPA 3I59A 4OMYA 3KETA 1P4XA 5DCMB 2KFDA 2QZ8A 2DA2A 1VF9A 2D1HA 1YRNB 2DXIA 2I10A 2HZTA 2DW4A 3OR2C 4NC8A 1MMDA 1ZKGA 3VYSB 2ACJA 3BY6A 2GM4A 4Y33A 4DBRA 1REPC 3TBIA 3CCMI 4A3DJ 2L3DA 4CCLA 2W84A 3JREA 4EVIA 4ZDOA 2PBIA 2CJJA 2JJ7A 2Y9YA 1FYMA 3F21A 4MQVA 4PDKA 1U9OA 3D5RC 1VQPI 1H88C 4ESFA 5IOYA 5DD4A 1IUYA 1S5LC 3HG9A 1SVOA 1SVLA 2LC2A 1VI0A 3A1YA 4KIFA 5M5XJ 1IV6A 2XASA 3CD6I 3ZQCA 4NHJA 2LYCA 1OCOH 1Z6TA 3H5AA 3G4SI 4IXAA 1ETYA 4XQFA 4IRIA 2KISA 2WY7Q 3PO3J 2A69F 2GA2A 2XAGA 2F4MB 3T1BA 1J0RA 3ZQIA 2PLYA 5GTIC 3GFIA 1BW5A 1CGPA 2VQHA 5HNFA 2WAQA 1D0YA 3L2CA 1YJNI 3ONQA 4IHSA 5ICCA 4KT6A 5LHIA 4I09A 2BZTA 3K4BA 3CLOA 5M5YJ 2BVMA 1D1CA 4E7KA 5CQEA 2R4GA 2DYSH 1ETWA 2HQRA 3B6AA 3JRDA 4YEJA 2LY1A 2LFBA 4JBAA 4OIRF 1WH7A 3PSIA 2KQRA 4JK1X 2L01A 4NDLA 2HTJA 2V4JC 4OU0A 1EV7A 1LDJA 1R00A 2KKOA 3SXYA 3ZXSA 4CA0A 3BG9A 4M3EA 1F36A 2PX9A 5L3DA 4AD9A 3GVAA 3K10A 3DWLE 3IH2A 1YYVA 3CUQC 2B7EA 1RUNA 5FLMJ 2ZFUA 1VZ0A 3QU6A 1WI3A 2V1NA 3X2QH 1PUFB 3MFKA 2LDUA 1L3LA 3CCQI 3CF5F 2EIKH 3OS0A 4D7MA 1B8IA 2Z1DA 2IA1A 2XAHA 2OA4A 4BQOA 4L9TA 3VFZA 3HOXJ 2HXOA 3BZ6A 4A3BJ 5IYBJ 2LG4A 1VTNC 4OINF 1WJAA 3DP7A 3WTWC 1ZG5A 2NVYJ 2E1OA 1SANA 4XKWA 2FSWA 3FISA 4HPQA 3CCJI 2CG4A 2ISZA 1Y0NA 4MTEA 1Z05A 3WODF 3S2HJ 2BGCA 1XGOA 3Q9VA 1UELB 2R7OA 2KPMA 1RETA 4I98B 5E79C 3CP8A 1XG1A 2BY1A 2LK2A 4XL9A 5LEJA 2MYSA 2EWNA 1M1EB 2IGOA 4JX6A 3GLXA 3AG2H 2IT0A 2VT2A 3REOA 3UKGA 3CC2I 5L3BA 3A03A 1HKQA 2QGUA 3OV8A 5TRDA 1WQ2A 5EZGA 5K5RA 3OSFA 5FO5A 1IW7F 1FMWA 3ELKA 3HUGA 3HKZA 1ZREA 1B1BA 3GZNB 4UY8I 5JHUA 1TT0A 3H92A 3LL7A 4HF2A 1AKHB 3VB2A 4Z6YA 3EYIA 4BBSJ 1UJ8A 3L09A 4GFBA 2ZC2A 3A4CA 3T8TA 2ZJPF 3IAM2 1WKMA 3FKJA 1JKQC 4IOAF 2YX4A 3AG1H 2GA1A 2IA0A 1ZG1A 1TWFJ 3P5JA 3HBLA 4XR6A 4B44A 1P9QC 1ULYA 3BPVA 3R0AA 3MZYA 2EV5A 5TGTA 5DUKA 2A6EF 3DCFA 4KJZA 2P5LC 3ECHA 4BS9A 3C18A 2R7SA 2R5YA 4HX8A 2UWMA 2DQRA 1WCMJ 2LKPA 1X1DA 5F6FA 1WZ2A 2EZIA 2IA2A 1RKTA 2NNNA 5F1RA 2ZMEC 2WBMA 9ANTA 1D0XA 5M5WJ 4S04A 2M30A 1R5ID 4LK0F 5E3MA 2QSHX 3TQNA 2I5UA 5HLHA 3QYBA 3ESWB 3RTRA 3J80K 4PJMA 2VUMJ 2YS9A 2CH0A 1YW8A 2BXZA 3MAJA 2DTZA 2MGQA 5CPRB 3T0YA 2VPRA 1ZRDA 3RZOJ 4C2UA 1TP4A 4UUSA 2L54A 2CUJA 3AG3H 1I39A 1IRGA 4GO1A 3TDUC 1Z1DA 1X3UA 4XSXF 1Z7UA 1IC8A 2CUEA 2WV0A 2MBFA 2OZUA 5BS6A 5C4JJ 1LEBA 3LA3A 2HKXA 4AWXB 3F22A 1YS6A 4G94A 1R1TA 3QWLA 3U21A 2MFZA 5E1ZB 1E3HA 2LMDA 4DJAA 2YPRA 4XLCA 3ASNH 2CU7A 3ROUA 4H0EA 2K9QA 4CHUA 3BJ6A 2JPCA 4ZTJA 2K9MA 1N75A 3ABKH 4IQ4A 2ZO4A 1J75A 2X1EA 2XB5A 3CCEI 3KCCA 2F5EA 1OISA 2BW3B 4ZYHA 1FBUA 1U8RA 3FIWA 2IVMA 5ILSA 2YX7A 3GMEA 3I55I 3AG4H 3H3UA 3IAS2 1H89C 1E3OC 3WTSC 4YIFA 1USTA 1XD7A 2L5QA 2NS0A 2WB1A 1O3RA 2QSFX 2EZKA 2MH9A 4B1RA 1YHQI 1E0EA 2L9SA 3GTQJ 2XAQA 3CMEI 3HRTA 3W2AA 3ASOH 4DZPA 1XPXA 5B3SH 4XIDA 1ZYRF 1JKRC 3D5LA 2JVHA 2M5WA 2K4BA 3DU5A 4FT8A 5J47A 1BI2A 2MD5A 1B59A 3I4PA 3NAUA 3ABTA 5LHGA 3V42A 3F6VA 3OIPA 2R7TA 1P4WA 1HW1A 2JRMA 4G7OF 4A5NA 1XMAA 4KUMA 2P6TA 3MKZA 2BHZA 1LDDA 4RM3A 1TNTA 1C0WA 1JE8A 1FT9A 1K6YA 2GZWA 2JZYA 3GFJA 1SMTA 2QEXI 2DMNA 5JR3A 2KT0A 3W6VA 1Z3XA 3TMOA 3V8LA 2ZJRF 1G6NA 2V6CA 2VQCA 3MMYB 1RIOH 1MSFC 5FB2A 1SD5A 1K4TA 1KU2A 2XVCA 1QBJA 2FU4A 4HF1A 1X4PA 3FXLA 2XPVA 3Q0UA 3VOEA 3S1NJ 1MJAA 4RB0A 3OYAA 2DOAA 2EFPA 5F08A 2DN0A 1HXDA 4M3GA 1Q1VA 3WU1B 3CZ6A 3IL2A 2PG4A 3H35A 2DA7A 2HXIA 1F4KA 2ZJ2A 3BR2A 2WB1N 2WADA 1ONVA 4MQ9F 1NH3A 3QU3A 3C7JA 2JUGA 3HRUA 1VFCA 3IH3A 2QM3A 4C2MJ 2HR3A 3FHZA 4H4KC 4HX4A 1W0UA 3VWBA 4GGGA 4QPQA 3I56I 2PJRB 4X0GA 4HF0A 2IRFG 1SAXA 4Y17A 5C44J 3P9CA 3J7YJ 1KYZA 4CYCB 1Y1VJ 4M71A 4AYBN 1JGSA 2WAQN 1MIJA 2GOMA 3H0GJ 5DCFA 1Y56A 4DQ2A 3T5XA 5CVVA 1RC9A 3OWTA 2D1VA 1N77A 2X4HA 2A6HF 2XGXA 5FD5A 4BU2A 3F3XA 1OCCH 2H6CA 2IW5A 3VYRB 5B1AH 2IGKA 4LIVA 1P7JA 3BT9A 3OIQA 1LVAA 2WC2A 3M1EA 3G71I 2O03A 3AL0B 2O3FA 4E70A 1XDUA 4ZTFA 2LD5A 2CS3A 3K4KA 3CUOA 5DS9A 2AQEA 1YIOA 3E5UA 3KZZA 1ZRCA 4IHWA 2GWRA 2HTSA 1R49A 2MD0A 1G8XA 2HGCA 5E3OA 1WWXA 4BEHA 1QHGA 1Y6IA 2LRDA 4MHGA 2B63J 4M9SA 4JX5A 4M3BA 2ME6A 2DA6A 4PUSA 4IRGA 4P55A 2DA1A 1S7AA 4FETA 2ELHA 2FBIA 3D0SA 3G1LA 4P1WA 4UVCA 4ASNA 1D5YA 1QZZA 2ZMEA 2VKDA 4NNJA 4CCMA 4EJOA 4IHVA 1QQIA 2DJNA 2ZXWH 2IAIA 4R1HA 3P9IA 3OYCA 2KRCA 1TL8A 3DBRB 3AKZA 4O3MA 1B72B 3HHHA 3I4MJ 3ERMA 1N78A 4DOZA 1NK2P 5KVRA 5LRRA 4KA4A 1AWCA 1DU6A 4BXXJ 4HOBA 1GVDA 4A2UA 4HYEA 2GOXB 3DLLF 5CLSA 4XICA 2MSYA 3A0BC 5HVQC 2CYYA 4E4HA 1V5EA 2DOEA 3K4CA 4Y7NJ 1BI3A 2JT1A 2Q1ZB 1UZCA 4ESBA 2K9LA 3DTIA 3DKXA 5H6RA 1JTXA 3E6BA 2ZBKA 4RBOA 3CO7C 2QSGX 4EJVA 1HKTA 2K7LA 2Z5UA 4GXOA 2E60A 3QPTA 4XLAA 1WJDA 2HPIA 3WTZA 3BG7A 3WGHA 5DM7F 2Z33A 4XRSA 2E35A 2N8GA 4I02A 3V7SA 4F92B 3CLQA 1ZAOA 2BYVE 2DT7B 3MEXA 5LRSA 1LE8B 4HNTA 4A12A 3CJRB 4A3MJ 1W5CC 1VNDA 4EM1A 5E8IA 4ZZDA 1MH3A 2HOEA 4NQWB 1MBEA 3LSHA 2V1DA 4OWRB 4G7ZF 2WTEA 4A0XA 1YTYA 5L3EA 2COMA 1XSXA 2RREA 1B9MA 4II3A 4L9NA 3DF8A 3GLLA 3HOVJ 3KEOA 3TL4X 1UHMA 1IXSB 1JTYA 1SFXA 4PJJA 2CV1A 5K7FA 2E34A 1TQPA 1OJLA 2E5ZA 4G6DA 3JSOA 2Y69H 5GP9A 4AU7A 1K83J 2K02A 3OYDA 2IS1A 2XAFA 4M6YA 2HQNA 3CP2A 2RDPA 2XF7A 1BOBA 2Y0SA 4BJ5C 4NC6A 5CVRA 2VE9A 1IN5A 2DFFA 4ENMA 3HL2A 3BR6A 3Q0WA 3C2BA 3TOBA 2UZKA 2GLOA 4HNVA 2L0KA 2LH9A 3PSFA 2D2WA 1WH5A 3RPUD 5KNLA 5B5EC 1WSUA 2LOOA 1AU7A 4IVNA 1YJ9I 4A69C 4PFPA 3RCOA 2EFOA 4KIBA 1ZR2A 4KIGA 1D1AA 3I3LA 3LSIA 3E5QA 1FSEA 3TW6A 2R5YB 4FTHA 4CCKA 2FJ1A 1KGSA 2HOSA 2VBWA 1GXQA 1DQUA 2D45A 3M9AA 3FXRA 3KPHA 1XGNA 2X1CA 4I01A 3UR3C 2HYGD 4PSXA 3KFWX 2RN7A 3QYFA 3WHCA 2QVOA 4C3IJ 2HDCA 3F8NA 1HKSA 2ZKZA 1LNWA 3ML6A 4XSZF 3H9QA 3PM1A 4GYGA 4W1UA 3CCUI 2XPWA 3H5NA 3NWSA 4CCJA 2RKHA 3FF5A 1U2WA 4HEA2 1YS7A 4LMYA 1EA3A 1U5TB 1MZBA 3S3MA 3VODA 2BXYA 3E97A 1O3TA 2GXGA 2XF6A 4FHTA 3ZQFA 3BTCA 3FZVA 5ILVA 2W00A 4CYCA 1S7OA 2HS5A 5LHHA 1G3SA 3DBHB 1QZEA 3BTLA 5IOZA 5EG0B 1BR1A 4XKBA 1E3PA 2KDOA 4FCYA 3Q0VA 3AL0C 4WCGA 3QPSA 1MBFA 4AM3A 5EGOB 2H8WA 4HQMA 4D5FA 1U3EM 4A3GJ 5DYMA 1FLIA 1HDPA 5LBQA 2HOAA 2XF5A 3HEFA 4I0AA 4HAMA 3KZYA 1Y0UA 5J1UA 4E7IA 5IYDJ 1S6LA 3KYLA 1MBGA 1TWAJ 1MNEA 3S1RJ 1Z0XA 3CDIA 3K2ZA 3K69A 4RB3C 2ID6A 2EV6A 3M4OJ 3WE2A 4BQQA 2M7BA 3PQKA 2EA2A 4KT5C 3WG9A 1A35A 1IUFA 1QHHD 1I6HJ 4UUTA 2JPBA 3GXOA 1MBJA 5ERIA 3ZMTA 4BEHB 3C2HA 4IZZA 1H9GA 3ZMVA 1JUSA 1T08B 4RMNA 1I5ZA 5BPIA 3CDHA 1OYIA 1HSJA 1RKWA 4DZJA 4YFXF 2NVTJ 1EKEA 2PMZA 1MBKA 1MW7A 1YG2A 1SD6A 2VPLA 2DMPA 3QP6A 1BJAA 1KA8A 1F9NA 1WJEA 2X0LA 3ZQQA 4HDVA 4HA8A 4CZZA 1OFCX 3IH4A 3E1SA 4B4CA 4E7JA 5HODA 3ECOA 2A5WA 2YR2A 4I2OA 5FKLA 3KLOA 3DTKA 2OC6A 2R7RA 5HOOA 1W5SA 2ZJQF 2M4KA 4LG0B 1K79A 3VSLA 1BC8C 1S9HA 1FTZA 1W7PA 4PFOA 5LGUA 3SDBA 1HBXG 3CCVI 2R93J 4A3JJ 3Q9SA 5F64A 1U0JA 2TRTA 2KIUA 2DQLA 4XLNF 1IJWC 3L2RA 1U6GA 1LUJB 4F91B 1HQCA 2EQRA 1V55H 4RLQA 3HM5A 3ZMUA 3OMYA 1FOKA 4J19A 2EV0A 4RGXA 3WGGA 4XLPF 2PN6A 3FXJA 2B0LA 4WK8F 3OYEA 4KISA 2CW7A 1LB2A 4B48A 1FEXA 2KIQA 4RGRA 3EDPA 4PCQA 1O4XA 2NVUB 1LEAA 1PP8F 4XM3A 2KDZA 5A2QZ 3MVPA 1JGGA 4BDZA 2KRHA 5B66C 2CUZA 4Q5SF 3A02A 3RZDJ 1OQYA 3EETA 5CVUA 2XROA 1DGRM 5JVGF 3HKZN 1P7IA 2BV6A 3F8CA 3S16J 2YU3A 3DEUA 4HRIA 1TNSA 5GPAA 2MC3A 2VJ5A 2VB6A 1EH8A 3LSMA 3Q3SA 3D1NI 1EF4A 2BY3A 2ZXJA 4IPAA 4IQJA 2RC4A 2QENA 3LSRA 2QA4I 2XAJA 1OR7A 3V7RA 3I59B 3O8HA 1FOXA 4PGGA 3CJQB 1HLVA 4RA2A 2VKEA 5K5QA 5F1JA 1JHHA 3M8JA 2A5YB 4U0WA 4I99C 3LMMA 3QPLA 2R7UA 3R0JA 4F7ZA 4AIJA 3JW4A 2ETHA 1U5TC 3QOEA 2K5CA 3E7LA 1MKMA 2FNPA 2J5OA 1R1VA 2G7UA 2IBDA 3ZGKA 2R5ZA 3TDZC 2R7FA 2DK8A 3NEUA 2XRLA 1VQNI 3G3ZA 5EGOA 1BN5A 5LEKA 5LD2C 2O7OA 3CJNA 4EQQA 2QBYA 4QWQA 2DAOA 4M3DA 1W1WE 4D5CA 1T56A 2O61A 1BOAA 3PNTA 1FC3A 1MMSA 3HYIA 4DNCA 2V9KA 4ESJA 3GUDA 3VPRA 1WFXA 3IWZA 3HGYA 4RS8A 4L5IA 4ABZA 1TQMA 2DT5A 4BACA 5IT9Z 5FROA 3B02A 1ZGJA 2ZXHA 4XRMA 1Y1WJ 1B4AA 2X1DA 2VONA 2F6CA 2DYRH 1XS9A 5KHDA 2M0MA 1RESA 4FQGA 4BAYA 3ZQLA 1X1AA 1QVTA 2W1OA 1IRXA 3KE2A 1GDTA 5D5VB 3AAFA 2C6YA 2BEOA 4S05A 2H6BA 2XDVA 1WI9A 2Z99A 5J6XA 3EYYA 4L5JA 3ZQGA 3RSNA 5JI6A 3OS2A 2VIXA 4ITVA 5FFZA 4I6ZA 2XB0X 4FE7A 1D8KA 4IRHA 5EDNA 3I53A 3A01B 4U87A 2OU2A 2A61A 3CQZJ 1R5HA 1UMQA 1P4AA 3HDDA 4KMFA 3H9JA 5B1BH 4AIHA 4UNOA 2G7HA 3HTSB 4E6KG 1MJ9A 2XIGA 1P92A 2TDXA 5D8LB 1ETOA 5DV5A 1T2KA 4CZCA 2DCEA 3F8MA 3JAMK 1YFHA 3RKYA 2IGMA 2LP0A 1SEUA 5AIPA 3LSJA 1CF7A 3KLNA 4AVPA 2D5VA 2MLGA 1TTYA 1ZARA 4EMSA 4XRSG 3R61A 1X19A 2OV7A 3RIRA 5F0HA 4XLHA 2DA4A 2PQ8A 2FUG2 4C2TA 3WGIA 2L7KA 3IV5A 3O2PE 2HYJA 3H0DA 4XMYA 2DOFA 5DCMA 4FX0A 1ODDA 1V5FA 3BROA 1RZ4A 1D5VA 3M7GA 3DXJF 2LNBA 5GPCA 2Q2EB 3ABLH 3GCMA 3OL3A 4UB8C 3HXLA 4D0PA 1IF1A 4RB1A 1TZLA 2QQBA 4UVBA 2M45A 3K1MA 1YOVB 5HS9A 3IKVA 1SD7A 2IS6A 3RQIA 2F5VA 3ZOBA 1G2HA 4C9YA 4TV7A 1YITI 3OR1C 2CQKA 5HDGA 5E18F 4ZJZA 2Q2EA 1YW9A 2EPFA 5KK1A 5E8GA 3RJPA 1BA5A 3BZCA 5BOXA 4XBFA 3ZQ7A 3KP4A 3OYFA 2WAFA 1T6SA 2M8GX 1VQ7I 2OJED 5J8FA 1K61A 2HVQA 1IZ1A 4YELA 3FMSA 1T8IA 1POGA 2KHMA 1OLTA 1VQ5I 2XSJC 1BL0A 4HBLA 2FQ3A 3BJOA 4AVZA 3OYKA 3PJRA 3K9TA 4JQFA 1PUEE 2CQQA 4O5VA 5JVTA 2R0QC 1X2NA 3OYMA 4M3FA 3WU2C 4LLNA 2E1NA 1IN7A 3ZMDA 5GAHJ 2LVSA 2EA4A 3LSTA 4N9IA 4Z2YA 2A3SA 1SMYF 1W0TA 1H8AC 4RM2A 1ZHFA 5F0CA 4C3HJ 3LWFA 2CUFA 2J5PA 5BMZA 1ZR4A 1Y39A 3JCUC 3T8RA 5FLXZ 3SZGA 2MW8A 4MNUA 1LFBA 3HIFA 3O6BB 4HQEA 1BC7C 2QCOA 3PFYA 5ILUA 3KP3A 2DFEA 2CRGA 3DKWA 4F52A 3TO6A 3WTVC 4KMUX 3MCZA 5LGTA 4RAZA 1KQ0A 5BPDA 2QQ8A 2E71A 3SFZA 1ZN2A 2HU9A 4CXFA 3L1PA 2G0EA 4DYRA 2GXBA 1VQOI 3C3WA 4A6DA 1N25A 3J81K 4L0YB 2H09A 4QPOA 1UG2A 3F8BA 2QF7A 1I1GA 4LG3A 4B09A 1NTCA 2IGNA 2E19A 3CJTB 2GBYA 3K1PA 1VQ4I 4CO8A 1YJWI 3K6GA 2R7XA 2L7MP 4C30A 1HA8A 2O8XA 3TEDA 2ESHA 2JN6A 1Q1HA 3KYDB 2W85A 3GBGA 1JHFA 2V6EA 3BR5A 1S7EA 2DJIA 2Y0SN 5FGMA 5J8CA 1Z91A 4K2EA 1DUXC 1FZPB 2P5VA 3QRFF 1VQ6I 4MEYF 2BY2A 4XK4A 5HLTA 1I3QJ 2RNGA 2JSPA 2P7VB 1I27A 1WJCA 4N4OB 4Y15A 1XGSA 3BZKA 4BHPA 1VQKI 2KZGA 2X51A 2E1MB 2KL4A 2P81A 3JRGA 1K78A 3H3ZA 1FOYA 3LQQA 3J81Z 4KN7X 5J3LA 3K4NA 1QPMA 3IP4B 5CVIA 3WTTC 2A6TA 2VBZA 3P7NA 3E5XA 3E6MA 1LFUP 3JAMZ 1XSDA 5DM6F 4D1QA 2F4OB 2HPMA 2NOGA 1WHUA 3NQOA 1YRNA 2DU9A 1ZTRA 2YSRA 3UNGC 1MSEC 1GT0C 5E20A 4ENKA 1ZH5A 2K3FA 1Y8QB 1KU7A 2QKMB 2F2EA 4AC0A 3DPUA 1O3QA 3PQJA 2HQAA 2FRHA 3A0HC 1PYVA 1ERDA 1CQTA 5FKMA 3F0CA 4P9UA 2M34A 2LLKA 3K1NA 4BJ6C 4DYCA 1U8BA 2JRTA 1KU3A 3DPLC 3VYTB 3LAJA 1FBQA 3QP5A 4JOMA 5KAIC 3JRBA 1G59A 5BQTA 1ZGAA 1GV5A 2DBBA 2JMWA 5ED4A 1FX7A 1O7LA 1DGWY 2Z3YA 3ERED 3ZRGA 1J59A 2OD5A 2MLKA 3MKWB 2QKLB 3WU0A 1T0FC 3GF2A 1TWCJ 2BW3A 3I0TA 3HOSA 3JSPA 4GDFA 4YG2F 3HJEA 5J40A 3C2GA 3FXKA 3KEYA 4E7ZA 4OIQF 4M6VA 2W48A 5FLVA 1XN7A 2ICWG 1OCRH 3V8KA 1W36C 3SEZA 3DEEA 1YX5A 2XAUA 3ULQB 1ITYA 2STWA 2MH2A 2VJJA 1FBSA 4BUPA 4WX9A 2ZSIB 3I58A 3MD2A 1R4MB 5H6QA 2JTVA 3BG5A 1EH7A 4R79A 2F5DA 2ZB9A 3TOAA 4BY7J 1LJ9A 1SFUA 4ZZLA 1T39A 1HW2A 2UXXA 4X1EA 5DDGA 1T95A 3H5RA 1NK3P 4F3QA 5BNGA 2DI3A 4UV8A 2AXLA 2H27A 2ZNYA 4FX4A 4G9YA 2XSDC 1H0MA 1IV8A 2WV1A 3QODA 3W3CA 3L2VA 2OCEA 3HB9A 3ZN0A 3CMAI 3CCRI 2IS4A 3EPZA 4BXFA 1MMAA 4Y4RA 4LD5A 1D8JA 3RQ4A 1IDYA 5F04A 5EG0A 2K85A 5K5OA 1J2XA 1K78B 2FE3A 4NC7A 3BJAA 1FMVA 2R7QA 4ENJA 4Q48A 4IHYA 2EJRA 1S8NA 4HV5A 3PL8A 2NAZA 1W36D 3BQZA 5C4XJ 3FHNA 3HOZJ 5FFXA 2NYXA 4PJ0C 2O9LA 3GTGJ 1OR7C 3G2BA 2F5FA 1MMNA 2ME0A 2CSOA 2ADUA 1HC8A 1EJ9A 5J4YA 2HQ5A 3RKQA 4LGWA 2M3AA 5EYRA 3HUGB 2O8KA 3FBIB 2ESNA 1WJFA 1J5YA 1E2XA 1KZHA 1R6RA 5E1WA 5AONA 5FRNA 3LOCA 3I9V2 2GAUA 4KICA 4ZDLA 5H20A 1A04A 1MMGA 4G6QA 4C3JJ 4D7NA 4G7HF 1IO2A 4YRVA 2HWVA 1LVKA 1V5GA 3KEQA 4JYKA 4EM0B 3FDYA 2RGVA 3LFUA 1Z77A 2Y48A 4A6EA 1NHAA 3GWZA 4P5OA 3TO7A 2E7WA 5EF6A 1ZGWA 3QQAA 2LREA 1EH6A 3FBNB 1GLNA 1F43A 3BPXA 2HDWA 1IRZA 1ZRFA 1Z7LA 3EUHA 3PIPF 2KIMA 3SYTA 1S29A 2M2EA 3BR0A 1GVJA 5EJCA 2DPUA 2QYOA 3H1CA 2E1MC 2KRFA 1W5TA 4A0YA 5CQGA 1K4SA 2LSOA 4BQNA 4AUXA 4OAZA 4LOCA 4E7LA 2NS7A 4OAYA 1RI7A 3KX2A 2RQPA 1RR8C 3CCSI 3GTMJ 3KP6A 4EM2A 3HOYJ 2L7FP 3W6JB 3FK6A 3J7AO 2TCTA 2F5CA 5TISC 4BE2A 3LFKA 4RAYA 1KONA 3OY9A 1Z21A 2M4GA 1BIBA 2EZLA 3WE3A 2Q0OA 1AHDP 3LNQA 1K7AA 1ZLJA 1JKOC 4W97A 4XKCA 3PNYA 2QQ9A 3V4GA 4XKVA 4RB2C 1VQ8I 1G3TA 2KIFA 4M9ZA 2IXSA 1R22A 2Y2ZA 1E17A 1IRFA 3DLAA 4I7HA 2RVCA 1GV2A 1Z9CA 1ZG3A 2W24A 2R7WA 1UHWA 4ETSA 3P9KA 3MQ0A 3LA7A 4HW0A 1VQMI 1G4DA 3S32A 2BY0A 3QPHA 4V2FA 2L02A 2RQQA 1ETQA 2VJ4A 3EUAA 2O0YA 1TT5B 4YIIA 4FISA 4U0VA 4Y13A 1HDDC 3LA2A 3GYHX 3RDIA 2H94A 4V2GA 2K4JA 2XV4S 1TBXA 1UFMA 4DBQA 2E5NA 4ZYDA 2W4SA 2NRAC 3GTPJ 3OYGA 2FQ4A 4MFEA 1W7PD 1HW5A 2OF7A 2MC4A 1R5GA 3BDDA 2E1CA 1MJBA 1R58A 3OIOA 1T98A 2QQAA 1PP7U 4EGYA 2QBYB 3GTJJ 3RPUA 1UAAA 1FTTA 2VLAA 2PFBA 4L9VA 1TQIA 2R5ZB 3KP7A 1KQ8A 2W82A 2COBA 3CTAA 2GQQA 2L9VA 2P7CB 4GYIA 4M9XA 3JTHA 1FYLA 1QPIA 2PEXA 3J80Z 4XN3A 3TP3A 4ZH4F 2Y0MA 3ZQHA 3N4MA 3C1DA 1IN6A 3BC8A 1S3JA 2W25A 1G3YA 3GFLA 2XRNA 4QLCU 1HF0A 3IKTA 1B8IB 2HOTA 2NXNB 1MD0A 2YUSA 3MZ8A 3IRRA 1SFOJ 1XX5A 3BR3A 2X6YA 2ECBA 4WXCA 4BE1A 1X1CA 4A3KJ 2ZSHB 4Y3OA 2LY2A 2FD5A 2VE8A 5D6FA 2NVXJ 4Q4ZF 3F23A 2L7ZA 4XLFA 3A2KA 2CFXA 4IOCF 2ID3A 4LJZF 1A31A 2EINH 3JRFA 4CGZA 3V8JA 4BXUA 5E3NA 3KP2A 5CYVA 1YIJI 5LFAA 4CICA 4U7BA 3F9KA 1TW2A 1JT0A 1ORKA 2LTPA 3L9FA 3N05A 3ZMZA 3O8GA 2AXTC 2VASA 3QYEA 2K27A 3MN2A 1R1UA 5KAFC 3ZR8X 4B3AA 5DEQA 5HLGA 3FXUA 1I50J 2DMUA 3S3NA 1MDMB 2VKHA 2OTLI 3WTYC 4MTDA 5IYCJ 1AKHA 2JA5J 4WXDA 2PJRA 3RPQA 3GTLJ 4UV9A 3SZTA 4EJWA 5D5XB 4CDGA 3VSKA 2XGCA 4OIOF 1J09A 3GO5A 2KMUA 2M1BA 3FMQA 2OAZA 2ELKA 2DDBA 1U9NA 1MBHA 3MWMA 4E7SA 1QVUA 3R4KA 3SJMA 5GTHC 1V54H 2FMYA 2HNHA 4B43A 2EFNA 3HTUA 1FSHA 4BYYA 3RYPA 3GZ6A 3ZP5A 3HOWJ 4L5EA 5ICGA 1MNDA 2Z9OA 1XDSA 3HC7A 3VDXA 5GAGJ 2ELJA 3K0LA 2VL8A 5DUIA 5ICFA 1FYKA 2DFIA 2EB7A 4HSTA 3OYIA 3S15J 3WHBA 3BQYA 5JLWA 4IO9F 4CYDA 3OL4A 2JK3A 1W4MA 3WTUC 4NUBA 2XGDA 1JJ8C 1JI8A 2VQLA 1J7KA 3L7WA 1ON1A 1WRJA 2FBHA 3RI4A 1O3SA 2JA8J 1QNTA 4LK1F 2ZMEB 5IY5H 2F4IA 2OUMA 4MIMA 1ON2A 2QWWA 1BI1A 2P0WA 3TKYA 1OCPA 2VC1A 3CCYA 2OQRA 2V79A 1BR2A 2X9DA 2AHQA 4PSWA 3U1KA 4B47A 3EUHC 3K7AJ 4S0HB 4A5MA 1CF7B 5HS8A 4XN0A 3Q5FA 3SEQA 4V19K 1X2MA 2B9SA 2O6GE 2X85A 3E3VA 3JRIA 3SFIA 2DTRA 2Y31A 3ZMSA 2YU9J 1V3FA 1NG6A 1LPQA 2BVLA 3DV8A 4JP0A 1OKRA 2IEKA 5EEGA 4BHBA 2LF7A 4M73A 1APLC 3J7ZI 1YO5C 2X6WA 2GIVA 5L3FA 2HDDA 2VQGA 4ZYGA 2JA7J 2KJCA 3KYCB 4BDYA 3BCBA 3EQLF 1P2FA 4BGDA 3S8PA 1Z67A 2DMQA 2XGEA 3I71A 3SZPA 1BM9A 4KITB 1MH4A 4HX7A 3E0JB 4DW6A 3W2WA 3VEPA 3DPTA 4BJTA 3CO6C 2KZVA 1FPQA 1NG7A 4HLXA 2PMUA 3IWFA 5IPAA 4QTRA 3FKIJ 1L0OC 4LB5A 1UB9A 4YFKF 3HOUJ 2DLLA 3GW2A 3BLYA 6PAXA 2XUBA 1TW3A 1TC3C 2EH3A 3ABMH 4BKXA 5IP9J 2HFHA 2XC7A 5A2QK 3I64A 3S1QJ 3S2DJ 1B9NA 1XMKA 1X3WB 4Y52J 1QO0D 5L3CA 4J01A 3BCAA 3L00A 4LITA 1KYWA 3OYLA 2CW8A 2EIJH 4EEFG 3LSPA 3KP5A 2NNYA 3M3YJ 1XC5A 3LSKA 1IAWA 2UXNA 5K1YA 2XPUA 1Z6RA 4N4NB
chains in the Genus database with same CATH topology
5D4RA 3LAPA 1K6OA 1R36A 4WWCA 2WWYA 3FMRA 5HLIA 1MGTA 4M6XA 2G9WA 3M8FA 2VXZA 1XCVA 4OOIA 3N97A 1XCBA 5ICEA 3ZN1A 4U0YA 2FEZA 3HHGA 4NB5A 3COAC 4OIPF 4KDPA 3GZ5A 1YW7A 3GEZA 4UUVA 3HSFA 5AIQA 4B8XA 3E6CC 1B6AA 2DK5A 4KN4X 3IRQA 5LLQA 4UVAA 3BOQA 2FNAA 5D6EA 4BQAA 3IHUA 3SQNA 3U2RA 2A07F 2ZNZA 1KU9A 2M8EA 3V7CA 3O3KA 2RNJA 3NRVA 3FM5A 1XGMA 4G8XA 3DFGA 1G3WA 4RGUA 2OBPA 4RGSA 3F6OA 2V1XA 4P9FA 3W6KB 1ZLKA 2CGPA 2FBKA 2HKOA 2P4WA 1QGPA 4KYWA 3I54A 2VBYA 2XHKA 4PGHA 4U88A 1U78A 4KFCA 5E1XA 4EGZA 3ZPLA 3FM3A 2V1UA 1GHCA 3GFMA 5EEHA 1H9TA 3U9GA 1SFEA 4PZJA 4YFNF 4L0ZB 1FY7A 1KQ9A 4ZYEA 4BH9A 3BWGA 2IP2A 1O7FA 1W7PB 5D4SA 1T38A 2R3SA 1R23A 2QUFA 5HDKA 3BP8A 2OQGA 1USSA 2L4AA 4EV0A 3HSEA 1V4RA 1JXSA 4NQWA 4LLGF 1I6XA 2CWEA 5JFRA 4U7DA 1UCRA 2M87A 3FX3A 3G73A 3CUQB 3ISPA 4HV6A 2EFWA 5HS7A 4WXHA 4O6JA 1FWZA 4ON0A 2VBXA 2PI0A 3I5UA 4EJUA 3M8EA 2ZFWA 1AOYA 1SD4A 3LQRA 1BBYA 1XB4A 1BI0A 2IJLA 3CUQA 1FP1D 2DO7A 4LFUA 3TGNA 2DPDA 2FOKA 1TLHB 2P5KA 5D8KB 5HDNA 5DD8A 3HRMA 3SHFA 5IT3A 1FP2A 2V9VA 2ISYA 3B73A 5FD6A 3RKWA 2PJPA 4GCVA 2EFQA 2QLZA 2R7DA 2IPQX 2VODA 5D5WB 4LG0A 1F5TA 4L18B 4I0BA 1YLFA 2OZ6A 4ENNA 2XKPA 1QZYA 4L9JA 2P6SA 1LQ1A 4BHCA 4MEXF 2FMLA 1R7JA 5LGNA 4LLLA 4Q47A 4KNYA 3IC7A 2VOOA 1O57A 1J9IA 5CJ9A 2L4MA 3E6DA 5IT9K 1DP7P 5D5UB 4UXNA 4HDUA 5FLXK 3S2WA 1T0FA 2EK5A 4MGRA 1OYWA 4M74A 4BNCA 2Y75A 2CW0F 1STZA 2FF4A 2P8TA 4AIKA 1IXCA 3U1DA 3HOTA 4M72A 4P96A 4R8HA 4HZFA 1PDNC 1LDKB 4IHTA 1BIAA 4UHTA 3FWEA 1IXRC 1F1ZA 2FXAA 4IF4A 1U5TA 2KJBA 4XRFA 3MZHA 3WTXC 4IJAA 1D3YA 1RNLA 4OMZA 1IN4A 3OOPA 2ZCWA 2XKOA 1P6RA 3TO9A 2JSCA 2W57A 1MDMA 4A0ZA 4WF2A 3F72A 3JTGA 1OYYA 2VN2A 3R6SA 3PFIA 4EJTA 2AS5F 2MA3A 4HLYA 5E17F 4LB6B 1YQAA 2RV8A 3FXQA 1GXPA 5TJJA 1OPCA 1RUOA 3RKXA 2HEOA 2BE5F 2E7XA 1DPRA 2LF8A 5CVJA 2VC0A 3QAHA 1OMIA 2CO5A 2STTA 1HSTA 1IN8A 2VT3A 2FA5A 3QOPA 4N0BA 1FNNA 3GX4X 3HRSA 3F8FA 1XSVA 4N9HA 1I1SA 2A68F 2PMHA 3RYRA 2BBYA 3HSRA 1DDNA 2K86A 3DQVC 2Q8KA 3R60A 2HYFA 5L3GA 3ABUA 2VOPA 3I59A 4OMYA 3KETA 1P4XA 5DCMB 2QZ8A 2D1HA 2HZTA 2DW4A 2ACJA 3BY6A 1REPC 2L3DA 2W84A 4EVIA 2PBIA 1FYMA 3F21A 4MQVA 4PDKA 4ESFA 5DD4A 1IUYA 4KIFA 2XASA 4NHJA 1Z6TA 4IXAA 4IRIA 2A69F 2GA2A 2XAGA 3T1BA 1J0RA 2PLYA 3GFIA 1CGPA 3L2CA 4IHSA 5ICCA 5LHIA 4I09A 3CLOA 2HQRA 4JBAA 4OIRF 4JK1X 2L01A 2HTJA 4OU0A 1EV7A 1LDJA 1R00A 2KKOA 3SXYA 5L3DA 4AD9A 3GVAA 1YYVA 3CUQC 1RUNA 3QU6A 3MFKA 2LDUA 1L3LA 2IA1A 2XAHA 2OA4A 4L9TA 3VFZA 3BZ6A 1VTNC 1ZG5A 4OINF 3WTWC 3DP7A 2FSWA 2CG4A 2ISZA 4MTEA 1Z05A 3WODF 2BGCA 1XGOA 3Q9VA 4I98B 5LEJA 2EWNA 3GLXA 2IT0A 2VT2A 3REOA 5L3BA 1HKQA 3OV8A 5TRDA 1WQ2A 5K5RA 5FO5A 1IW7F 3ELKA 3HUGA 1ZREA 1B1BA 5JHUA 3H92A 4HF2A 3VB2A 3EYIA 3L09A 3T8TA 1WKMA 2GA1A 2IA0A 2YX4A 1ZG1A 1ULYA 3BPVA 3R0AA 3MZYA 2EV5A 5DUKA 2A6EF 2P5LC 3ECHA 3C18A 4HX8A 2UWMA 2DQRA 2LKPA 5F6FA 2IA2A 2NNNA 5F1RA 4S04A 2M30A 4LK0F 3TQNA 5HLHA 3RTRA 3J80K 1YW8A 3MAJA 3T0YA 1ZRDA 2L54A 1IRGA 4GO1A 3TDUC 1Z1DA 1X3UA 4XSXF 1Z7UA 2WV0A 2MBFA 2OZUA 5BS6A 1LEBA 3LA3A 2HKXA 4AWXB 3F22A 1YS6A 4G94A 1R1TA 5E1ZB 2YPRA 3ROUA 4H0EA 4CHUA 3BJ6A 2JPCA 1J75A 2ZO4A 3KCCA 2F5EA 4ZYHA 1FBUA 1U8RA 2IVMA 5ILSA 2YX7A 3H3UA 3WTSC 4YIFA 1USTA 1XD7A 1O3RA 2NS0A 2MH9A 2XAQA 3HRTA 1ZYRF 3D5LA 2M5WA 2K4BA 4FT8A 1BI2A 2MD5A 1B59A 3I4PA 3ABTA 5LHGA 3F6VA 1P4WA 1HW1A 4G7OF 4A5NA 1XMAA 4KUMA 2P6TA 1LDDA 1TNTA 1C0WA 1JE8A 1FT9A 2GZWA 2JZYA 3GFJA 1SMTA 5JR3A 3V8LA 1G6NA 2V6CA 1RIOH 5FB2A 1SD5A 1KU2A 2XVCA 1QBJA 2FU4A 4HF1A 3VOEA 1MJAA 4RB0A 2EFPA 1HXDA 3WU1B 3IL2A 2PG4A 1F4KA 2ZJ2A 4MQ9F 1ONVA 3QU3A 3C7JA 3HRUA 2QM3A 2HR3A 3FHZA 4HX4A 4GGGA 4HF0A 2IRFG 1SAXA 4Y17A 3P9CA 1KYZA 4M71A 1JGSA 5DCFA 4DQ2A 3T5XA 5CVVA 2D1VA 2X4HA 2A6HF 2XGXA 5FD5A 3F3XA 2H6CA 2IW5A 1LVAA 2WC2A 3M1EA 2O03A 2O3FA 4E70A 1XDUA 3CUOA 1YIOA 3E5UA 3KZZA 1ZRCA 2GWRA 2HTSA 2HGCA 1WWXA 4MHGA 4M9SA 4IRGA 4P55A 1S7AA 2ELHA 2FBIA 3D0SA 4UVCA 4ASNA 1QZZA 2ZMEA 4EJOA 1QQIA 4R1HA 3P9IA 4O3MA 3HHHA 5KVRA 5LRRA 4KA4A 1AWCA 4HOBA 4A2UA 4HYEA 5CLSA 5HVQC 2CYYA 1BI3A 2JT1A 4ESBA 5H6RA 3E6BA 2ZBKA 3CO7C 4EJVA 1HKTA 2K7LA 2Z5UA 4GXOA 3QPTA 3WTZA 3WGHA 2Z33A 4I02A 3V7SA 3MEXA 1ZAOA 2BYVE 5LRSA 4A12A 4EM1A 5E8IA 4ZZDA 2HOEA 2V1DA 4G7ZF 2WTEA 4A0XA 1YTYA 5L3EA 2COMA 1XSXA 1B9MA 4L9NA 3DF8A 3KEOA 1UHMA 1IXSB 1SFXA 1TQPA 3JSOA 4G6DA 2K02A 2XAFA 4M6YA 2HQNA 2RDPA 5CVRA 2VE9A 1IN5A 4ENMA 3TOBA 2UZKA 2D2WA 1WSUA 4IVNA 2EFOA 4KIBA 4KIGA 3E5QA 1FSEA 1KGSA 2VBWA 1GXQA 2D45A 3M9AA 3FXRA 1XGNA 4I01A 1K7AA 2HYGD 3KFWX 2RN7A 2HDCA 2QVOA 3F8NA 1HKSA 2ZKZA 1LNWA 3ML6A 4XSZF 4GYGA 2RKHA 3FF5A 1U2WA 4LMYA 1YS7A 1U5TB 1MZBA 3VODA 3E97A 1O3TA 2GXGA 4FHTA 3FZVA 5ILVA 1S7OA 2HS5A 5LHHA 1G3SA 4WCGA 4HQMA 1U3EM 5DYMA 1FLIA 5LBQA 4I0AA 4HAMA 3KZYA 1Y0UA 1S6LA 3K2ZA 3K69A 4RB3C 2EV6A 3WE2A 3PQKA 2EA2A 4KT5C 3WG9A 2JPBA 3GXOA 5ERIA 3ZMTA 1H9GA 3ZMVA 5BPIA 1I5ZA 3CDHA 1OYIA 1HSJA 4YFXF 1YG2A 1SD6A 3QP6A 1BJAA 1KA8A 1F9NA 2X0LA 4HDVA 4HA8A 4CZZA 3ECOA 2YR2A 4I2OA 3KLOA 5HOOA 1W5SA 4LG0B 1K79A 1BC8C 1W7PA 5LGUA 1HBXG 3Q9SA 5F64A 2KIUA 2DQLA 4XLNF 1U6GA 1HQCA 3ZMUA 1FOKA 2EV0A 4RGXA 3WGGA 4XLPF 2PN6A 2B0LA 4WK8F 1LB2A 4RGRA 3EDPA 4PCQA 1LEAA 1PP8F 5A2QZ 4Q5SF 3EETA 5CVUA 2XROA 2BV6A 3F8CA 2YU3A 3DEUA 1TNSA 2MC3A 1EH8A 2ZXJA 4IPAA 2RC4A 2QENA 2XAJA 1OR7A 3V7RA 3I59B 4PGGA 5K5QA 1JHHA 2A5YB 4U0WA 3R0JA 4F7ZA 4AIJA 3JW4A 2ETHA 1U5TC 1MKMA 2FNPA 2J5OA 1R1VA 2G7UA 3TDZC 2R7FA 2DK8A 3NEUA 3G3ZA 1BN5A 5LEKA 3CJNA 4EQQA 2QBYA 4QWQA 2DAOA 2O61A 1BOAA 1FC3A 3HYIA 4DNCA 4ESJA 3GUDA 3IWZA 4RS8A 4L5IA 1TQMA 2DT5A 5IT9Z 3B02A 1ZGJA 1B4AA 2VONA 4BAYA 3KE2A 5D5VB 3AAFA 2C6YA 2BEOA 4S05A 2H6BA 2Z99A 1WI9A 5J6XA 3EYYA 4L5JA 5JI6A 5FFZA 1D8KA 4IRHA 3I53A 2OU2A 2A61A 1R5HA 4KMFA 1P4AA 4UNOA 4AIHA 2G7HA 3HTSB 1MJ9A 1P92A 2TDXA 5D8LB 2XIGA 5DV5A 1T2KA 3F8MA 3JAMK 1YFHA 3RKYA 5AIPA 1CF7A 3KLNA 4AVPA 2MLGA 1TTYA 1ZARA 4EMSA 3R61A 3RIRA 2PQ8A 3WGIA 3O2PE 5DCMA 4FX0A 1ODDA 3BROA 1RZ4A 1D5VA 3M7GA 3DXJF 2LNBA 4D0PA 1IF1A 4RB1A 2QQBA 4UVBA 2M45A 3K1MA 5HS9A 3IKVA 1SD7A 4TV7A 2CQKA 5HDGA 5E18F 1YW9A 2Q2EA 5KK1A 5E8GA 3RJPA 5BOXA 4XBFA 3ZQ7A 3KP4A 1T6SA 5J8FA 1IZ1A 3FMSA 4HBLA 2FQ3A 3BJOA 3K9TA 4JQFA 1PUEE 4O5VA 5JVTA 4LLNA 2E1NA 1IN7A 3ZMDA 2EA4A 3LSTA 4N9IA 4Z2YA 2A3SA 1SMYF 1ZHFA 3LWFA 2J5PA 5BMZA 3T8RA 5FLXZ 4MNUA 1BC7C 3HIFA 3O6BB 4HQEA 5ILUA 3KP3A 3DKWA 3TO6A 3WTVC 4KMUX 3MCZA 5LGTA 4RAZA 1KQ0A 5BPDA 3SFZA 1ZN2A 4CXFA 2GXBA 3C3WA 4A6DA 3J81K 4L0YB 2H09A 4B09A 3F8BA 1I1GA 3K1PA 4CO8A 2O8XA 2ESHA 1Q1HA 2W85A 1JHFA 1DUXC 5J8CA 5FGMA 1Z91A 4K2EA 1FZPB 2P5VA 3QRFF 4MEYF 2P7VB 1I27A 4Y15A 1XGSA 4BHPA 1K78A 3H3ZA 3LQQA 3J81Z 4KN7X 1QPMA 5CVIA 3WTTC 2VBZA 3P7NA 3E5XA 3E6MA 3JAMZ 1XSDA 3NQOA 2DU9A 2YSRA 5E20A 4ENKA 1ZH5A 1KU7A 2F2EA 1O3QA 3PQJA 2FRHA 4P9UA 3K1NA 2JRTA 1KU3A 3DPLC 3LAJA 1FBQA 3QP5A 5BQTA 1ZGAA 2DBBA 5ED4A 1FX7A 1O7LA 2Z3YA 3ERED 1J59A 2OD5A 2MLKA 3WU0A 3GF2A 3I0TA 3HOSA 3JSPA 4YG2F 4OIQF 1XN7A 3V8KA 3ULQB 2STWA 2MH2A 1FBSA 4WX9A 3I58A 5H6QA 2JTVA 1EH7A 4R79A 2F5DA 3TOAA 1LJ9A 1SFUA 4ZZLA 1T39A 1HW2A 2UXXA 5DDGA 2DI3A 4UV8A 2AXLA 2H27A 2ZNYA 4FX4A 4G9YA 1H0MA 3ZN0A 4LD5A 1D8JA 5K5OA 1J2XA 1K78B 2FE3A 3BJAA 4ENJA 4Q48A 2EJRA 1S8NA 4HV5A 2NAZA 5FFXA 2NYXA 2F5FA 2CSOA 2ADUA 4LGWA 2ESNA 1J5YA 1E2XA 5E1WA 5AONA 2GAUA 4KICA 5H20A 1A04A 4G6QA 4G7HF 2HWVA 3KEQA 4EM0B 2RGVA 4A6EA 2Y48A 1NHAA 3GWZA 4P5OA 3TO7A 2E7WA 1EH6A 3BPXA 1ZRFA 3EUHA 2KIMA 1S29A 1GVJA 2DPUA 2QYOA 2KRFA 1W5TA 4A0YA 2LSOA 1RI7A 2RQPA 3KP6A 4EM2A 3W6JB 3J7AO 2F5CA 3LFKA 4RAYA 1BIBA 3WE3A 2Q0OA 1ZLJA 2QQ9A 3V4GA 4RB2C 1G3TA 2KIFA 4M9ZA 1R22A 1E17A 1IRFA 4I7HA 2RVCA 1Z9CA 1ZG3A 2W24A 1UHWA 4ETSA 3P9KA 3MQ0A 3LA7A 4HW0A 1G4DA 3QPHA 2L02A 2O0YA 4YIIA 4U0VA 4Y13A 3LA2A 3GYHX 3RDIA 2H94A 2K4JA 2XV4S 1TBXA 1UFMA 4ZYDA 2NRAC 1W7PD 1HW5A 1R5GA 3BDDA 2E1CA 1MJBA 1R58A 1T98A 2QQAA 1PP7U 4EGYA 2QBYB 3RPUA 2PFBA 4L9VA 1TQIA 3KP7A 1KQ8A 3CTAA 2GQQA 2P7CB 4GYIA 4M9XA 3JTHA 1FYLA 2PEXA 3J80Z 4ZH4F 2Y0MA 3N4MA 3C1DA 1IN6A 1S3JA 2W25A 1G3YA 3GFLA 2XRNA 4QLCU 3IKTA 1MD0A 3IRRA 4WXCA 2VE8A 5D6FA 4Q4ZF 3F23A 2CFXA 4LJZF 4CGZA 3V8JA 4BXUA 3KP2A 5CYVA 4CICA 4U7BA 1TW2A 3ZMZA 3L9FA 2K27A 1R1UA 5DEQA 5HLGA 3FXUA 1MDMB 3WTYC 4MTDA 4WXDA 3RPQA 4UV9A 3SZTA 4EJWA 5D5XB 4CDGA 4OIOF 3GO5A 2M1BA 3FMQA 2OAZA 3MWMA 3R4KA 2FMYA 2EFNA 3HTUA 1FSHA 4BYYA 3RYPA 3GZ6A 3ZP5A 5ICGA 2Z9OA 1XDSA 3K0LA 5DUIA 5ICFA 1FYKA 2DFIA 2EB7A 4CYDA 1W4MA 3WTUC 1J7KA 3L7WA 1ON1A 1WRJA 2FBHA 3RI4A 1O3SA 1QNTA 4LK1F 2ZMEB 1ON2A 2QWWA 1BI1A 3TKYA 2VC1A 2OQRA 2V79A 4A5MA 1CF7B 5HS8A 3Q5FA 2O6GE 3E3VA 2DTRA 3ZMSA 1V3FA 3DV8A 1OKRA 5EEGA 4BHBA 2LF7A 4M73A 1YO5C 2GIVA 5L3FA 4ZYGA 2KJCA 3EQLF 1P2FA 3I71A 3SZPA 1BM9A 4HX7A 3VEPA 3DPTA 3CO6C 1FPQA 4HLXA 2PMUA 3IWFA 1L0OC 4LB5A 1UB9A 4YFKF 2DLLA 3GW2A 6PAXA 2XUBA 1TW3A 2HFHA 5A2QK 3I64A 1B9NA 1XMKA 1QO0D 5L3CA 3L00A 1KYWA 3KP5A 2NNYA 1IAWA 2UXNA 5K1YA 1DPUA 1Z6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D4R A;  3LAP A;  1K6O A;  1R36 A;  4WWC A;  2WWY A;  3FMR A;  5HLI A;  1MGT A;  4M6X A;  2G9W A;  3M8F A;  2VXZ A;  1XCV A;  4OOI A;  3N97 A;  1XCB A;  5ICE A;  3ZN1 A;  4U0Y A;  2FEZ A;  3HHG A;  4NB5 A;  3COA C;  4OIP F;  4KDP A;  3GZ5 A;  1YW7 A;  3GEZ A;  4UUV A;  3HSF A;  5AIQ A;  4B8X A;  3E6C C;  1B6A A;  2DK5 A;  4KN4 X;  3IRQ A;  5LLQ A;  4UVA A;  3BOQ A;  2FNA A;  5D6E A;  4BQA A;  3IHU A;  3SQN A;  3U2R A;  2A07 F;  2ZNZ A;  1KU9 A;  2M8E A;  3V7C A;  3O3K A;  2RNJ A;  3NRV A;  3FM5 A;  1XGM A;  4G8X A;  3DFG A;  1G3W A;  4RGU A;  2OBP A;  4RGS A;  3F6O A;  2V1X A;  4P9F A;  3W6K B;  1ZLK A;  2CGP A;  2FBK A;  2HKO A;  2P4W A;  1QGP A;  4KYW A;  3I54 A;  2VBY A;  2XHK A;  4PGH A;  4U88 A;  1U78 A;  4KFC A;  5E1X A;  4EGZ A;  3ZPL A;  3FM3 A;  2V1U A;  1GHC A;  3GFM A;  5EEH A;  1H9T A;  3U9G A;  1SFE A;  4PZJ A;  4YFN F;  4L0Z B;  1FY7 A;  1KQ9 A;  4ZYE A;  4BH9 A;  3BWG A;  2IP2 A;  1O7F A;  1W7P B;  5D4S A;  1T38 A;  2R3S A;  1R23 A;  2QUF A;  5HDK A;  3BP8 A;  2OQG A;  1USS A;  2L4A A;  4EV0 A;  3HSE A;  1V4R A;  1JXS A;  4NQW A;  4LLG F;  1I6X A;  2CWE A;  5JFR A;  4U7D A;  1UCR A;  2M87 A;  3FX3 A;  3G73 A;  3CUQ B;  3ISP A;  4HV6 A;  2EFW A;  5HS7 A;  4WXH A;  4O6J A;  1FWZ A;  4ON0 A;  2VBX A;  2PI0 A;  3I5U A;  4EJU A;  3M8E A;  2ZFW A;  1AOY A;  1SD4 A;  3LQR A;  1BBY A;  1XB4 A;  1BI0 A;  2IJL A;  3CUQ A;  1FP1 D;  2DO7 A;  4LFU A;  3TGN A;  2DPD A;  2FOK A;  1TLH B;  2P5K A;  5D8K B;  5HDN A;  5DD8 A;  3HRM A;  3SHF A;  5IT3 A;  1FP2 A;  2V9V A;  2ISY A;  3B73 A;  5FD6 A;  3RKW A;  2PJP A;  4GCV A;  2EFQ A;  2QLZ A;  2R7D A;  2IPQ X;  2VOD A;  5D5W B;  4LG0 A;  1F5T A;  4L18 B;  4I0B A;  1YLF A;  2OZ6 A;  4ENN A;  2XKP A;  1QZY A;  4L9J A;  2P6S A;  1LQ1 A;  4BHC A;  4MEX F;  2FML A;  1R7J A;  5LGN A;  4LLL A;  4Q47 A;  4KNY A;  3IC7 A;  2VOO A;  1O57 A;  1J9I A;  5CJ9 A;  2L4M A;  3E6D A;  5IT9 K;  1DP7 P;  5D5U B;  4UXN A;  4HDU A;  5FLX K;  3S2W A;  1T0F A;  2EK5 A;  4MGR A;  1OYW A;  4M74 A;  4BNC A;  2Y75 A;  2CW0 F;  1STZ A;  2FF4 A;  2P8T A;  4AIK A;  1IXC A;  3U1D A;  3HOT A;  4M72 A;  4P96 A;  4R8H A;  4HZF A;  1PDN C;  1LDK B;  4IHT A;  1BIA A;  4UHT A;  3FWE A;  1IXR C;  1F1Z A;  2FXA A;  4IF4 A;  1U5T A;  2KJB A;  4XRF A;  3MZH A;  3WTX C;  4IJA A;  1D3Y A;  1RNL A;  4OMZ A;  1IN4 A;  3OOP A;  2ZCW A;  2XKO A;  1P6R A;  3TO9 A;  2JSC A;  2W57 A;  1MDM A;  4A0Z A;  4WF2 A;  3F72 A;  3JTG A;  1OYY A;  2VN2 A;  3R6S A;  3PFI A;  4EJT A;  2AS5 F;  2MA3 A;  4HLY A;  5E17 F;  4LB6 B;  1YQA A;  2RV8 A;  3FXQ A;  1GXP A;  5TJJ A;  1OPC A;  1RUO A;  3RKX A;  2HEO A;  2BE5 F;  2E7X A;  1DPR A;  2LF8 A;  5CVJ A;  2VC0 A;  3QAH A;  1OMI A;  2CO5 A;  2STT A;  1HST A;  1IN8 A;  2VT3 A;  2FA5 A;  3QOP A;  4N0B A;  1FNN A;  3GX4 X;  3HRS A;  3F8F A;  1XSV A;  4N9H A;  1I1S A;  2A68 F;  2PMH A;  3RYR A;  2BBY A;  3HSR A;  1DDN A;  2K86 A;  3DQV C;  2Q8K A;  3R60 A;  2HYF A;  5L3G A;  3ABU A;  2VOP A;  3I59 A;  4OMY A;  3KET A;  1P4X A;  5DCM B;  2QZ8 A;  2D1H A;  2HZT A;  2DW4 A;  2ACJ A;  3BY6 A;  1REP C;  2L3D A;  2W84 A;  4EVI A;  2PBI A;  1FYM A;  3F21 A;  4MQV A;  4PDK A;  4ESF A;  5DD4 A;  1IUY A;  4KIF A;  2XAS A;  4NHJ A;  1Z6T A;  4IXA A;  4IRI A;  2A69 F;  2GA2 A;  2XAG A;  3T1B A;  1J0R A;  2PLY A;  3GFI A;  1CGP A;  3L2C A;  4IHS A;  5ICC A;  5LHI A;  4I09 A;  3CLO A;  2HQR A;  4JBA A;  4OIR F;  4JK1 X;  2L01 A;  2HTJ A;  4OU0 A;  1EV7 A;  1LDJ A;  1R00 A;  2KKO A;  3SXY A;  5L3D A;  4AD9 A;  3GVA A;  1YYV A;  3CUQ C;  1RUN A;  3QU6 A;  3MFK A;  2LDU A;  1L3L A;  2IA1 A;  2XAH A;  2OA4 A;  4L9T A;  3VFZ A;  3BZ6 A;  1VTN C;  1ZG5 A;  4OIN F;  3WTW C;  3DP7 A;  2FSW A;  2CG4 A;  2ISZ A;  4MTE A;  1Z05 A;  3WOD F;  2BGC A;  1XGO A;  3Q9V A;  4I98 B;  5LEJ A;  2EWN A;  3GLX A;  2IT0 A;  2VT2 A;  3REO A;  5L3B A;  1HKQ A;  3OV8 A;  5TRD A;  1WQ2 A;  5K5R A;  5FO5 A;  1IW7 F;  3ELK A;  3HUG A;  1ZRE A;  1B1B A;  5JHU A;  3H92 A;  4HF2 A;  3VB2 A;  3EYI A;  3L09 A;  3T8T A;  1WKM A;  2GA1 A;  2IA0 A;  2YX4 A;  1ZG1 A;  1ULY A;  3BPV A;  3R0A A;  3MZY A;  2EV5 A;  5DUK A;  2A6E F;  2P5L C;  3ECH A;  3C18 A;  4HX8 A;  2UWM A;  2DQR A;  2LKP A;  5F6F A;  2IA2 A;  2NNN A;  5F1R A;  4S04 A;  2M30 A;  4LK0 F;  3TQN A;  5HLH A;  3RTR A;  3J80 K;  1YW8 A;  3MAJ A;  3T0Y A;  1ZRD A;  2L54 A;  1IRG A;  4GO1 A;  3TDU C;  1Z1D A;  1X3U A;  4XSX F;  1Z7U A;  2WV0 A;  2MBF A;  2OZU A;  5BS6 A;  1LEB A;  3LA3 A;  2HKX A;  4AWX B;  3F22 A;  1YS6 A;  4G94 A;  1R1T A;  5E1Z B;  2YPR A;  3ROU A;  4H0E A;  4CHU A;  3BJ6 A;  2JPC A;  1J75 A;  2ZO4 A;  3KCC A;  2F5E A;  4ZYH A;  1FBU A;  1U8R A;  2IVM A;  5ILS A;  2YX7 A;  3H3U A;  3WTS C;  4YIF A;  1UST A;  1XD7 A;  1O3R A;  2NS0 A;  2MH9 A;  2XAQ A;  3HRT A;  1ZYR F;  3D5L A;  2M5W A;  2K4B A;  4FT8 A;  1BI2 A;  2MD5 A;  1B59 A;  3I4P A;  3ABT A;  5LHG A;  3F6V A;  1P4W A;  1HW1 A;  4G7O F;  4A5N A;  1XMA A;  4KUM A;  2P6T A;  1LDD A;  1TNT A;  1C0W A;  1JE8 A;  1FT9 A;  2GZW A;  2JZY A;  3GFJ A;  1SMT A;  5JR3 A;  3V8L A;  1G6N A;  2V6C A;  1RIO H;  5FB2 A;  1SD5 A;  1KU2 A;  2XVC A;  1QBJ A;  2FU4 A;  4HF1 A;  3VOE A;  1MJA A;  4RB0 A;  2EFP A;  1HXD A;  3WU1 B;  3IL2 A;  2PG4 A;  1F4K A;  2ZJ2 A;  4MQ9 F;  1ONV A;  3QU3 A;  3C7J A;  3HRU A;  2QM3 A;  2HR3 A;  3FHZ A;  4HX4 A;  4GGG A;  4HF0 A;  2IRF G;  1SAX A;  4Y17 A;  3P9C A;  1KYZ A;  4M71 A;  1JGS A;  5DCF A;  4DQ2 A;  3T5X A;  5CVV A;  2D1V A;  2X4H A;  2A6H F;  2XGX A;  5FD5 A;  3F3X A;  2H6C A;  2IW5 A;  1LVA A;  2WC2 A;  3M1E A;  2O03 A;  2O3F A;  4E70 A;  1XDU A;  3CUO A;  1YIO A;  3E5U A;  3KZZ A;  1ZRC A;  2GWR A;  2HTS A;  2HGC A;  1WWX A;  4MHG A;  4M9S A;  4IRG A;  4P55 A;  1S7A A;  2ELH A;  2FBI A;  3D0S A;  4UVC A;  4ASN A;  1QZZ A;  2ZME A;  4EJO A;  1QQI A;  4R1H A;  3P9I A;  4O3M A;  3HHH A;  5KVR A;  5LRR A;  4KA4 A;  1AWC A;  4HOB A;  4A2U A;  4HYE A;  5CLS A;  5HVQ C;  2CYY A;  1BI3 A;  2JT1 A;  4ESB A;  5H6R A;  3E6B A;  2ZBK A;  3CO7 C;  4EJV A;  1HKT A;  2K7L A;  2Z5U A;  4GXO A;  3QPT A;  3WTZ A;  3WGH A;  2Z33 A;  4I02 A;  3V7S A;  3MEX A;  1ZAO A;  2BYV E;  5LRS A;  4A12 A;  4EM1 A;  5E8I A;  4ZZD A;  2HOE A;  2V1D A;  4G7Z F;  2WTE A;  4A0X A;  1YTY A;  5L3E A;  2COM A;  1XSX A;  1B9M A;  4L9N A;  3DF8 A;  3KEO A;  1UHM A;  1IXS B;  1SFX A;  1TQP A;  3JSO A;  4G6D A;  2K02 A;  2XAF A;  4M6Y A;  2HQN A;  2RDP A;  5CVR A;  2VE9 A;  1IN5 A;  4ENM A;  3TOB A;  2UZK A;  2D2W A;  1WSU A;  4IVN A;  2EFO A;  4KIB A;  4KIG A;  3E5Q A;  1FSE A;  1KGS A;  2VBW A;  1GXQ A;  2D45 A;  3M9A A;  3FXR A;  1XGN A;  4I01 A;  1K7A A;  2HYG D;  3KFW X;  2RN7 A;  2HDC A;  2QVO A;  3F8N A;  1HKS A;  2ZKZ A;  1LNW A;  3ML6 A;  4XSZ F;  4GYG A;  2RKH A;  3FF5 A;  1U2W A;  4LMY A;  1YS7 A;  1U5T B;  1MZB A;  3VOD A;  3E97 A;  1O3T A;  2GXG A;  4FHT A;  3FZV A;  5ILV A;  1S7O A;  2HS5 A;  5LHH A;  1G3S A;  4WCG A;  4HQM A;  1U3E M;  5DYM A;  1FLI A;  5LBQ A;  4I0A A;  4HAM A;  3KZY A;  1Y0U A;  1S6L A;  3K2Z A;  3K69 A;  4RB3 C;  2EV6 A;  3WE2 A;  3PQK A;  2EA2 A;  4KT5 C;  3WG9 A;  2JPB A;  3GXO A;  5ERI A;  3ZMT A;  1H9G A;  3ZMV A;  5BPI A;  1I5Z A;  3CDH A;  1OYI A;  1HSJ A;  4YFX F;  1YG2 A;  1SD6 A;  3QP6 A;  1BJA A;  1KA8 A;  1F9N A;  2X0L A;  4HDV A;  4HA8 A;  4CZZ A;  3ECO A;  2YR2 A;  4I2O A;  3KLO A;  5HOO A;  1W5S A;  4LG0 B;  1K79 A;  1BC8 C;  1W7P A;  5LGU A;  1HBX G;  3Q9S A;  5F64 A;  2KIU A;  2DQL A;  4XLN F;  1U6G A;  1HQC A;  3ZMU A;  1FOK A;  2EV0 A;  4RGX A;  3WGG A;  4XLP F;  2PN6 A;  2B0L A;  4WK8 F;  1LB2 A;  4RGR A;  3EDP A;  4PCQ A;  1LEA A;  1PP8 F;  5A2Q Z;  4Q5S F;  3EET A;  5CVU A;  2XRO A;  2BV6 A;  3F8C A;  2YU3 A;  3DEU A;  1TNS A;  2MC3 A;  1EH8 A;  2ZXJ A;  4IPA A;  2RC4 A;  2QEN A;  2XAJ A;  1OR7 A;  3V7R A;  3I59 B;  4PGG A;  5K5Q A;  1JHH A;  2A5Y B;  4U0W A;  3R0J A;  4F7Z A;  4AIJ A;  3JW4 A;  2ETH A;  1U5T C;  1MKM A;  2FNP A;  2J5O A;  1R1V A;  2G7U A;  3TDZ C;  2R7F A;  2DK8 A;  3NEU A;  3G3Z A;  1BN5 A;  5LEK A;  3CJN A;  4EQQ A;  2QBY A;  4QWQ A;  2DAO A;  2O61 A;  1BOA A;  1FC3 A;  3HYI A;  4DNC A;  4ESJ A;  3GUD A;  3IWZ A;  4RS8 A;  4L5I A;  1TQM A;  2DT5 A;  5IT9 Z;  3B02 A;  1ZGJ A;  1B4A A;  2VON A;  4BAY A;  3KE2 A;  5D5V B;  3AAF A;  2C6Y A;  2BEO A;  4S05 A;  2H6B A;  2Z99 A;  1WI9 A;  5J6X A;  3EYY A;  4L5J A;  5JI6 A;  5FFZ A;  1D8K A;  4IRH A;  3I53 A;  2OU2 A;  2A61 A;  1R5H A;  4KMF A;  1P4A A;  4UNO A;  4AIH A;  2G7H A;  3HTS B;  1MJ9 A;  1P92 A;  2TDX A;  5D8L B;  2XIG A;  5DV5 A;  1T2K A;  3F8M A;  3JAM K;  1YFH A;  3RKY A;  5AIP A;  1CF7 A;  3KLN A;  4AVP A;  2MLG A;  1TTY A;  1ZAR A;  4EMS A;  3R61 A;  3RIR A;  2PQ8 A;  3WGI A;  3O2P E;  5DCM A;  4FX0 A;  1ODD A;  3BRO A;  1RZ4 A;  1D5V A;  3M7G A;  3DXJ F;  2LNB A;  4D0P A;  1IF1 A;  4RB1 A;  2QQB A;  4UVB A;  2M45 A;  3K1M A;  5HS9 A;  3IKV A;  1SD7 A;  4TV7 A;  2CQK A;  5HDG A;  5E18 F;  1YW9 A;  2Q2E A;  5KK1 A;  5E8G A;  3RJP A;  5BOX A;  4XBF A;  3ZQ7 A;  3KP4 A;  1T6S A;  5J8F A;  1IZ1 A;  3FMS A;  4HBL A;  2FQ3 A;  3BJO A;  3K9T A;  4JQF A;  1PUE E;  4O5V A;  5JVT A;  4LLN A;  2E1N A;  1IN7 A;  3ZMD A;  2EA4 A;  3LST A;  4N9I A;  4Z2Y A;  2A3S A;  1SMY F;  1ZHF A;  3LWF A;  2J5P A;  5BMZ A;  3T8R A;  5FLX Z;  4MNU A;  1BC7 C;  3HIF A;  3O6B B;  4HQE A;  5ILU A;  3KP3 A;  3DKW A;  3TO6 A;  3WTV C;  4KMU X;  3MCZ A;  5LGT A;  4RAZ A;  1KQ0 A;  5BPD A;  3SFZ A;  1ZN2 A;  4CXF A;  2GXB A;  3C3W A;  4A6D A;  3J81 K;  4L0Y B;  2H09 A;  4B09 A;  3F8B A;  1I1G A;  3K1P A;  4CO8 A;  2O8X A;  2ESH A;  1Q1H A;  2W85 A;  1JHF A;  1DUX C;  5J8C A;  5FGM A;  1Z91 A;  4K2E A;  1FZP B;  2P5V A;  3QRF F;  4MEY F;  2P7V B;  1I27 A;  4Y15 A;  1XGS A;  4BHP A;  1K78 A;  3H3Z A;  3LQQ A;  3J81 Z;  4KN7 X;  1QPM A;  5CVI A;  3WTT C;  2VBZ A;  3P7N A;  3E5X A;  3E6M A;  3JAM Z;  1XSD A;  3NQO A;  2DU9 A;  2YSR A;  5E20 A;  4ENK A;  1ZH5 A;  1KU7 A;  2F2E A;  1O3Q A;  3PQJ A;  2FRH A;  4P9U A;  3K1N A;  2JRT A;  1KU3 A;  3DPL C;  3LAJ A;  1FBQ A;  3QP5 A;  5BQT A;  1ZGA A;  2DBB A;  5ED4 A;  1FX7 A;  1O7L A;  2Z3Y A;  3ERE D;  1J59 A;  2OD5 A;  2MLK A;  3WU0 A;  3GF2 A;  3I0T A;  3HOS A;  3JSP A;  4YG2 F;  4OIQ F;  1XN7 A;  3V8K A;  3ULQ B;  2STW A;  2MH2 A;  1FBS A;  4WX9 A;  3I58 A;  5H6Q A;  2JTV A;  1EH7 A;  4R79 A;  2F5D A;  3TOA A;  1LJ9 A;  1SFU A;  4ZZL A;  1T39 A;  1HW2 A;  2UXX A;  5DDG A;  2DI3 A;  4UV8 A;  2AXL A;  2H27 A;  2ZNY A;  4FX4 A;  4G9Y A;  1H0M A;  3ZN0 A;  4LD5 A;  1D8J A;  5K5O A;  1J2X A;  1K78 B;  2FE3 A;  3BJA A;  4ENJ A;  4Q48 A;  2EJR A;  1S8N A;  4HV5 A;  2NAZ A;  5FFX A;  2NYX A;  2F5F A;  2CSO A;  2ADU A;  4LGW A;  2ESN A;  1J5Y A;  1E2X A;  5E1W A;  5AON A;  2GAU A;  4KIC A;  5H20 A;  1A04 A;  4G6Q A;  4G7H F;  2HWV A;  3KEQ A;  4EM0 B;  2RGV A;  4A6E A;  2Y48 A;  1NHA A;  3GWZ A;  4P5O A;  3TO7 A;  2E7W A;  1EH6 A;  3BPX A;  1ZRF A;  3EUH A;  2KIM A;  1S29 A;  1GVJ A;  2DPU A;  2QYO A;  2KRF A;  1W5T A;  4A0Y A;  2LSO A;  1RI7 A;  2RQP A;  3KP6 A;  4EM2 A;  3W6J B;  3J7A O;  2F5C A;  3LFK A;  4RAY A;  1BIB A;  3WE3 A;  2Q0O A;  1ZLJ A;  2QQ9 A;  3V4G A;  4RB2 C;  1G3T A;  2KIF A;  4M9Z A;  1R22 A;  1E17 A;  1IRF A;  4I7H A;  2RVC A;  1Z9C A;  1ZG3 A;  2W24 A;  1UHW A;  4ETS A;  3P9K A;  3MQ0 A;  3LA7 A;  4HW0 A;  1G4D A;  3QPH A;  2L02 A;  2O0Y A;  4YII A;  4U0V A;  4Y13 A;  3LA2 A;  3GYH X;  3RDI A;  2H94 A;  2K4J A;  2XV4 S;  1TBX A;  1UFM A;  4ZYD A;  2NRA C;  1W7P D;  1HW5 A;  1R5G A;  3BDD A;  2E1C A;  1MJB A;  1R58 A;  1T98 A;  2QQA A;  1PP7 U;  4EGY A;  2QBY B;  3RPU A;  2PFB A;  4L9V A;  1TQI A;  3KP7 A;  1KQ8 A;  3CTA A;  2GQQ A;  2P7C B;  4GYI A;  4M9X A;  3JTH A;  1FYL A;  2PEX A;  3J80 Z;  4ZH4 F;  2Y0M A;  3N4M A;  3C1D A;  1IN6 A;  1S3J A;  2W25 A;  1G3Y A;  3GFL A;  2XRN A;  4QLC U;  3IKT A;  1MD0 A;  3IRR A;  4WXC A;  2VE8 A;  5D6F A;  4Q4Z F;  3F23 A;  2CFX A;  4LJZ F;  4CGZ A;  3V8J A;  4BXU A;  3KP2 A;  5CYV A;  4CIC A;  4U7B A;  1TW2 A;  3ZMZ A;  3L9F A;  2K27 A;  1R1U A;  5DEQ A;  5HLG A;  3FXU A;  1MDM B;  3WTY C;  4MTD A;  4WXD A;  3RPQ A;  4UV9 A;  3SZT A;  4EJW A;  5D5X B;  4CDG A;  4OIO F;  3GO5 A;  2M1B A;  3FMQ A;  2OAZ A;  3MWM A;  3R4K A;  2FMY A;  2EFN A;  3HTU A;  1FSH A;  4BYY A;  3RYP A;  3GZ6 A;  3ZP5 A;  5ICG A;  2Z9O A;  1XDS A;  3K0L A;  5DUI A;  5ICF A;  1FYK A;  2DFI A;  2EB7 A;  4CYD A;  1W4M A;  3WTU C;  1J7K A;  3L7W A;  1ON1 A;  1WRJ A;  2FBH A;  3RI4 A;  1O3S A;  1QNT A;  4LK1 F;  2ZME B;  1ON2 A;  2QWW A;  1BI1 A;  3TKY A;  2VC1 A;  2OQR A;  2V79 A;  4A5M A;  1CF7 B;  5HS8 A;  3Q5F A;  2O6G E;  3E3V A;  2DTR A;  3ZMS A;  1V3F A;  3DV8 A;  1OKR A;  5EEG A;  4BHB A;  2LF7 A;  4M73 A;  1YO5 C;  2GIV A;  5L3F A;  4ZYG A;  2KJC A;  3EQL F;  1P2F A;  3I71 A;  3SZP A;  1BM9 A;  4HX7 A;  3VEP A;  3DPT A;  3CO6 C;  1FPQ A;  4HLX A;  2PMU A;  3IWF A;  1L0O C;  4LB5 A;  1UB9 A;  4YFK F;  2DLL A;  3GW2 A;  6PAX A;  2XUB A;  1TW3 A;  2HFH A;  5A2Q K;  3I64 A;  1B9N A;  1XMK A;  1QO0 D;  5L3C A;  3L00 A;  1KYW A;  3KP5 A;  2NNY A;  1IAW A;  2UXN A;  5K1Y A;  1DPU A;  1Z6R A; 
#chains in the Genus database with same CATH topology
 3PUF A;  2LKX A;  1I3A A;  5D4R A;  3LAP A;  1SC7 A;  1K6O A;  3JR9 A;  2W7N A;  4JX4 A;  1R36 A;  2CQ7 A;  4WWC A;  1TWH J;  3S3O A;  2WWY A;  3FMR A;  1ENH A;  3PNV A;  2E36 A;  5HLI A;  1MGT A;  3L2U A;  4M6X A;  3GTK J;  2JUC A;  2G9W A;  3M8F A;  2VXZ A;  1XCV A;  4OOI A;  1LKX A;  5C3E J;  3N97 A;  1XCB A;  1A5J A;  1YX3 A;  3AFH A;  2AQF A;  5ICE A;  3ZN1 A;  4FE4 A;  4U0Y A;  2FEZ A;  3HHG A;  4NB5 A;  3BG3 A;  2DDA A;  3COA C;  4OIP F;  4XNF A;  5E3L A;  2WAE A;  4A3L J;  4G12 A;  5H2F C;  3D5S C;  4IX7 A;  4KDP A;  3GZ5 A;  1YW7 A;  5FKO A;  3GEZ A;  4UUV A;  5M3M J;  3HSF A;  5AIQ A;  2MG4 A;  3BR1 A;  4B8X A;  2DOD A;  2VI6 A;  3E6C C;  5DTD A;  5K7Z A;  1SFK A;  1B6A A;  2DA5 A;  2DK5 A;  4KN4 X;  5EEA A;  4YIR X;  3IRQ A;  5LLQ A;  3TP0 A;  4UVA A;  3BOQ A;  1X58 A;  2FNA A;  5D6E A;  1DPU A;  4BQA A;  2LKS A;  2DFH A;  3IHU A;  2JA2 A;  3SQN A;  3U2R A;  2A07 F;  2CMP A;  2ZNZ A;  3ZCO A;  3CC4 I;  4HNU A;  1KU9 A;  2CV2 A;  4ZC3 A;  2CV0 A;  2M8E A;  3V7C A;  3O3K A;  2RNJ A;  3NRV A;  3CF2 A;  2EBI A;  3FM5 A;  1FIP A;  1XGM A;  2I8D A;  4G8X A;  5J4V A;  3DFG A;  1G3W A;  4RGU A;  2OBP A;  4LIU A;  4RGS A;  5K7H A;  3F6O A;  3K70 D;  2V1X A;  4P9F A;  3W6K B;  4UUS B;  4ANJ A;  5M3F J;  1ZLK A;  2CGP A;  2FBK A;  2K9N A;  2HKO A;  3IUO A;  1B72 A;  5FRM A;  2P4W A;  1QGP A;  4KYW A;  3DEW A;  4MFD A;  3I4N J;  3I54 A;  2VBY A;  2XHK A;  4PGH A;  4U88 A;  1U78 A;  4RDU A;  3HGG A;  4KFC A;  5E1X A;  4EGZ A;  3ZPL A;  3FM3 A;  2V1U A;  2DT6 A;  1GHC A;  2KLO A;  3GFM A;  1D1B A;  2E2J J;  2K40 A;  5EEH A;  2KP6 A;  5F0F A;  1SFE A;  4PZJ A;  2WA0 A;  3U9G A;  1H9T A;  1A6I A;  4YFN F;  2F48 A;  4L0Z B;  1FY7 A;  1KQ9 A;  4HG2 A;  4ZYE A;  2O5R A;  4BH9 A;  1JKP C;  3BWG A;  2IP2 A;  3JRH A;  1O7F A;  1W7P B;  5D4S A;  3PO2 J;  3OYB A;  1T38 A;  4FAS D;  1R71 A;  2HVR A;  1QA6 A;  2R3S A;  1R23 A;  1ETK A;  2QUF A;  5HDK A;  2V9P A;  2UV1 A;  3BP8 A;  2OQG A;  2Y9Z A;  1USS A;  2L4A A;  3G1O A;  4EV0 A;  3OYJ A;  3HSE A;  1V4R A;  2A05 A;  1JXS A;  3DKY A;  4NQW A;  2HI3 A;  4LLG F;  3HZJ A;  1S72 I;  4ZDP A;  1I6X A;  1WJ5 A;  3OSG A;  2GXA A;  2CWE A;  2FX0 A;  5JFR A;  1A6Q A;  1T33 A;  2EIL H;  5GAE J;  4U7D A;  1LE8 A;  1UCR A;  5IP6 A;  2M87 A;  4RLF A;  4PJL A;  2BHY A;  3FX3 A;  3G73 A;  3CUQ B;  3ISP A;  4HV6 A;  2EFW A;  3K4J A;  1BW6 A;  1X3Z B;  1XTA A;  3MKL A;  5HS7 A;  4WXH A;  2M0C A;  3L2W A;  4HSR A;  4O6J A;  2NOJ B;  1FWZ A;  4ON0 A;  3OYN A;  1JUM A;  2VBX A;  2X6X A;  2PI0 A;  3I5U A;  4EJU A;  3CES A;  3M8E A;  1SVM A;  3KIO A;  2ZFW A;  1AOY A;  3NAR A;  4RAG A;  5GAD J;  1SD4 A;  3LQR A;  1BBY A;  1XB4 A;  1BI0 A;  5JLX A;  2IJL A;  3CUQ A;  4II2 A;  4BE0 A;  1FP1 D;  1JJ6 C;  1FJL A;  2DO7 A;  4LFU A;  3TGN A;  1R4N B;  1FIA A;  2DPD A;  2FOK A;  1TLH B;  2VXD A;  3PUB A;  2P5K A;  5D8K B;  5HDN A;  4A3F J;  5DD8 A;  1Y8R B;  2EIM H;  3HRM A;  3SHF A;  5IT3 A;  3H36 A;  1FP2 A;  2V9V A;  2DA3 A;  4QIW N;  2ISY A;  3B73 A;  2JA6 J;  3H3V K;  3OS1 A;  2H1L A;  1WJB A;  5FD6 A;  3RKW A;  3CC7 I;  2JWT A;  4PK4 A;  2PJP A;  4GCV A;  4E7H A;  2CFO A;  3HPG A;  2EFQ A;  3VYU B;  4CCO A;  4NBQ A;  4DGW B;  2E2I J;  4GRI A;  2QLZ A;  1ZEL A;  3S93 A;  2R7D A;  2IPQ X;  2VJI A;  4UB6 C;  5D5W B;  4LG0 A;  1F5T A;  2VOD A;  5F27 A;  1GUU A;  1FOW A;  4L18 B;  3CCL I;  4I0B A;  1WVR A;  3BTI A;  4X6A J;  1YLF A;  2OZ6 A;  4ENN A;  1AA7 A;  2AO9 A;  2XKP A;  2Y30 A;  2CQX A;  3GTO J;  5FKK A;  1QZY A;  4L9J A;  2FOW A;  2P6S A;  1LQ1 A;  1DU0 A;  4BHC A;  3B6C A;  4MEX F;  2LBF B;  3SDG A;  1X1B A;  2FML A;  3M1C A;  2BOL A;  2NS8 A;  4QSH A;  4B3X A;  2M9H A;  3H9G A;  1R7J A;  1Z3Y A;  5IP7 J;  4A3I J;  1BJZ A;  3S14 J;  5LGN A;  4LLL A;  3A01 A;  4Q47 A;  3DBL B;  3NWT A;  1ZQ3 P;  4IKF A;  2VKV A;  3K70 C;  1MNM C;  4IHX A;  4XOP A;  3TW7 A;  2M7A A;  2Z2S B;  4KNY A;  5KCM A;  4CSW A;  3IC7 A;  2VOO A;  1O57 A;  4J00 A;  1J9I A;  5CJ9 A;  2RAE A;  2L4M A;  3E6D A;  1TWG J;  5IT9 K;  5FJ8 J;  1D0Z A;  1ETV A;  2HZD A;  1DP7 P;  2H8R A;  3FXO A;  5D5U B;  2H1K A;  4UXN A;  1IG7 A;  4XLE A;  1X1P A;  4HDU A;  5FLX K;  3S2W A;  3MKY B;  1T0F A;  2EK5 A;  4IL6 C;  1ZK8 A;  4RAF A;  4MGR A;  1OYW A;  2R92 J;  4XOT A;  2JVG A;  4M74 A;  4BNC A;  3CMM A;  2Y75 A;  2L2O A;  5FKN A;  5J1R A;  3G6E I;  1IGN A;  2CW0 F;  1STZ A;  4DIQ A;  4F93 B;  2OTJ I;  1QU3 A;  2FF4 A;  1OCZ H;  2P8T A;  3WG7 H;  1PVE A;  4AIK A;  1IXC A;  3G1M A;  3U1D A;  3HOT A;  1A36 A;  2K9S A;  4M72 A;  3FXM A;  4P96 A;  4R8H A;  2Z16 A;  4HZF A;  1PDN C;  1LDK B;  4IHT A;  3JRC A;  1BIA A;  4UHT A;  3FWE A;  1IXR C;  1HOM A;  1ETX A;  2UUZ A;  2NVQ J;  2X6O A;  1F1Z A;  2FXA A;  4IF4 A;  1U5T A;  2KJB A;  4XRF A;  4CCN A;  1RRJ A;  3MZH A;  3WTX C;  4IJA A;  2ECC A;  1UHS A;  1D3Y A;  2L9N A;  3M07 A;  1YE9 A;  1RNL A;  1YI2 I;  4OMZ A;  4BY1 J;  1X4O A;  1IN4 A;  3OOP A;  5JHF A;  2ZCW A;  4I76 A;  2XKO A;  1P6R A;  3TO9 A;  1HCR A;  2GIZ A;  3S1M J;  3FK7 A;  3LSG A;  2JSC A;  2OCC H;  1SAU A;  2W57 A;  1UG0 A;  2E2H J;  4CH7 A;  5J1Y A;  1MDM A;  3PIO F;  4A0Z A;  4WF2 A;  4DYQ A;  3K4L A;  3DTE A;  3K4M A;  3F72 A;  1JUP A;  3JTG A;  1ACI A;  1OYY A;  2V7F A;  1LFP A;  2VN2 A;  4XON A;  4A93 J;  2LY9 A;  1XMX A;  2V26 A;  3R6S A;  2R7V A;  3PFI A;  4BL0 B;  1OCT C;  1QRY A;  4AYB A;  4ZYA A;  4EJT A;  2X48 A;  2AS5 F;  2MA3 A;  4HLY A;  3JRA A;  1R9T J;  5E17 F;  4G6T B;  4LB6 B;  4A3E J;  1YQA A;  2IS2 A;  2RV8 A;  3FXQ A;  1GXP A;  2WY8 Q;  2PMZ N;  2HVS A;  3HPH A;  2EZH A;  5TJJ A;  1OPC A;  2L9R A;  1PUF A;  1VQ9 I;  4F55 A;  1JT6 A;  1RUO A;  3OOU A;  3RKX A;  2HEO A;  4MLO A;  1VQL I;  4D9J A;  4IEJ A;  4A3C J;  2BE5 F;  2E7X A;  1DPR A;  2LF8 A;  5CVJ A;  2VC0 A;  3QAH A;  1OMI A;  2CO5 A;  2STT A;  3BG6 A;  3W2V A;  4CUG A;  1HST A;  1IN8 A;  2VT3 A;  2LR8 A;  5CKT A;  3OYH A;  2FA5 A;  2LBF A;  1BR4 A;  3QOP A;  4N0B A;  2OPT A;  1FNN A;  3CMY A;  4AID A;  3GX4 X;  3HRS A;  3F8F A;  3S17 J;  4MO7 A;  1IDZ A;  1RR7 A;  1XSV A;  4N9H A;  1DP3 A;  2CQN A;  1I1S A;  3KZI C;  4BBR J;  2JQ7 A;  3K2A A;  2A68 F;  5HNH A;  2PMH A;  3L2Q A;  1PJR A;  3CDL A;  3RYR A;  1RPW A;  2BBY A;  2ZXI A;  3DU6 A;  4XOR A;  1WPK A;  3HSR A;  1DDN A;  2K86 A;  3DQV C;  5EZH A;  2K3P A;  2Q8K A;  3BTJ A;  4PJN A;  4EAT A;  3R60 A;  2R7Z J;  3EUK L;  2DMT A;  2HYF A;  5L3G A;  3J7A Y;  1WGX A;  2MAB A;  3ABU A;  2VOP A;  3I59 A;  4OMY A;  3KET A;  1P4X A;  5DCM B;  2KFD A;  2QZ8 A;  2DA2 A;  1VF9 A;  2D1H A;  1YRN B;  2DXI A;  2I10 A;  2HZT A;  2DW4 A;  3OR2 C;  4NC8 A;  1MMD A;  1ZKG A;  3VYS B;  2ACJ A;  3BY6 A;  2GM4 A;  4Y33 A;  4DBR A;  1REP C;  3TBI A;  3CCM I;  4A3D J;  2L3D A;  4CCL A;  2W84 A;  3JRE A;  4EVI A;  4ZDO A;  2PBI A;  2CJJ A;  2JJ7 A;  2Y9Y A;  1FYM A;  3F21 A;  4MQV A;  4PDK A;  1U9O A;  3D5R C;  1VQP I;  1H88 C;  4ESF A;  5IOY A;  5DD4 A;  1IUY A;  1S5L C;  3HG9 A;  1SVO A;  1SVL A;  2LC2 A;  1VI0 A;  3A1Y A;  4KIF A;  5M5X J;  1IV6 A;  2XAS A;  3CD6 I;  3ZQC A;  4NHJ A;  2LYC A;  1OCO H;  1Z6T A;  3H5A A;  3G4S I;  4IXA A;  1ETY A;  4XQF A;  4IRI A;  2KIS A;  2WY7 Q;  3PO3 J;  2A69 F;  2GA2 A;  2XAG A;  2F4M B;  3T1B A;  1J0R A;  3ZQI A;  2PLY A;  5GTI C;  3GFI A;  1BW5 A;  1CGP A;  2VQH A;  5HNF A;  2WAQ A;  1D0Y A;  3L2C A;  1YJN I;  3ONQ A;  4IHS A;  5ICC A;  4KT6 A;  5LHI A;  4I09 A;  2BZT A;  3K4B A;  3CLO A;  5M5Y J;  2BVM A;  1D1C A;  4E7K A;  5CQE A;  2R4G A;  2DYS H;  1ETW A;  2HQR A;  3B6A A;  3JRD A;  4YEJ A;  2LY1 A;  2LFB A;  4JBA A;  4OIR F;  1WH7 A;  3PSI A;  2KQR A;  4JK1 X;  2L01 A;  4NDL A;  2HTJ A;  2V4J C;  4OU0 A;  1EV7 A;  1LDJ A;  1R00 A;  2KKO A;  3SXY A;  3ZXS A;  4CA0 A;  3BG9 A;  4M3E A;  1F36 A;  2PX9 A;  5L3D A;  4AD9 A;  3GVA A;  3K10 A;  3DWL E;  3IH2 A;  1YYV A;  3CUQ C;  2B7E A;  1RUN A;  5FLM J;  2ZFU A;  1VZ0 A;  3QU6 A;  1WI3 A;  2V1N A;  3X2Q H;  1PUF B;  3MFK A;  2LDU A;  1L3L A;  3CCQ I;  3CF5 F;  2EIK H;  3OS0 A;  4D7M A;  1B8I A;  2Z1D A;  2IA1 A;  2XAH A;  2OA4 A;  4BQO A;  4L9T A;  3VFZ A;  3HOX J;  2HXO A;  3BZ6 A;  4A3B J;  5IYB J;  2LG4 A;  1VTN C;  4OIN F;  1WJA A;  3DP7 A;  3WTW C;  1ZG5 A;  2NVY J;  2E1O A;  1SAN A;  4XKW A;  2FSW A;  3FIS A;  4HPQ A;  3CCJ I;  2CG4 A;  2ISZ A;  1Y0N A;  4MTE A;  1Z05 A;  3WOD F;  3S2H J;  2BGC A;  1XGO A;  3Q9V A;  1UEL B;  2R7O A;  2KPM A;  1RET A;  4I98 B;  5E79 C;  3CP8 A;  1XG1 A;  2BY1 A;  2LK2 A;  4XL9 A;  5LEJ A;  2MYS A;  2EWN A;  1M1E B;  2IGO A;  4JX6 A;  3GLX A;  3AG2 H;  2IT0 A;  2VT2 A;  3REO A;  3UKG A;  3CC2 I;  5L3B A;  3A03 A;  1HKQ A;  2QGU A;  3OV8 A;  5TRD A;  1WQ2 A;  5EZG A;  5K5R A;  3OSF A;  5FO5 A;  1IW7 F;  1FMW A;  3ELK A;  3HUG A;  3HKZ A;  1ZRE A;  1B1B A;  3GZN B;  4UY8 I;  5JHU A;  1TT0 A;  3H92 A;  3LL7 A;  4HF2 A;  1AKH B;  3VB2 A;  4Z6Y A;  3EYI A;  4BBS J;  1UJ8 A;  3L09 A;  4GFB A;  2ZC2 A;  3A4C A;  3T8T A;  2ZJP F;  3IAM 2;  1WKM A;  3FKJ A;  1JKQ C;  4IOA F;  2YX4 A;  3AG1 H;  2GA1 A;  2IA0 A;  1ZG1 A;  1TWF J;  3P5J A;  3HBL A;  4XR6 A;  4B44 A;  1P9Q C;  1ULY A;  3BPV A;  3R0A A;  3MZY A;  2EV5 A;  5TGT A;  5DUK A;  2A6E F;  3DCF A;  4KJZ A;  2P5L C;  3ECH A;  4BS9 A;  3C18 A;  2R7S A;  2R5Y A;  4HX8 A;  2UWM A;  2DQR A;  1WCM J;  2LKP A;  1X1D A;  5F6F A;  1WZ2 A;  2EZI A;  2IA2 A;  1RKT A;  2NNN A;  5F1R A;  2ZME C;  2WBM A;  9ANT A;  1D0X A;  5M5W J;  4S04 A;  2M30 A;  1R5I D;  4LK0 F;  5E3M A;  2QSH X;  3TQN A;  2I5U A;  5HLH A;  3QYB A;  3ESW B;  3RTR A;  3J80 K;  4PJM A;  2VUM J;  2YS9 A;  2CH0 A;  1YW8 A;  2BXZ A;  3MAJ A;  2DTZ A;  2MGQ A;  5CPR B;  3T0Y A;  2VPR A;  1ZRD A;  3RZO J;  4C2U A;  1TP4 A;  4UUS A;  2L54 A;  2CUJ A;  3AG3 H;  1I39 A;  1IRG A;  4GO1 A;  3TDU C;  1Z1D A;  1X3U A;  4XSX F;  1Z7U A;  1IC8 A;  2CUE A;  2WV0 A;  2MBF A;  2OZU A;  5BS6 A;  5C4J J;  1LEB A;  3LA3 A;  2HKX A;  4AWX B;  3F22 A;  1YS6 A;  4G94 A;  1R1T A;  3QWL A;  3U21 A;  2MFZ A;  5E1Z B;  1E3H A;  2LMD A;  4DJA A;  2YPR A;  4XLC A;  3ASN H;  2CU7 A;  3ROU A;  4H0E A;  2K9Q A;  4CHU A;  3BJ6 A;  2JPC A;  4ZTJ A;  2K9M A;  1N75 A;  3ABK H;  4IQ4 A;  2ZO4 A;  1J75 A;  2X1E A;  2XB5 A;  3CCE I;  3KCC A;  2F5E A;  1OIS A;  2BW3 B;  4ZYH A;  1FBU A;  1U8R A;  3FIW A;  2IVM A;  5ILS A;  2YX7 A;  3GME A;  3I55 I;  3AG4 H;  3H3U A;  3IAS 2;  1H89 C;  1E3O C;  3WTS C;  4YIF A;  1UST A;  1XD7 A;  2L5Q A;  2NS0 A;  2WB1 A;  1O3R A;  2QSF X;  2EZK A;  2MH9 A;  4B1R A;  1YHQ I;  1E0E A;  2L9S A;  3GTQ J;  2XAQ A;  3CME I;  3HRT A;  3W2A A;  3ASO H;  4DZP A;  1XPX A;  5B3S H;  4XID A;  1ZYR F;  1JKR C;  3D5L A;  2JVH A;  2M5W A;  2K4B A;  3DU5 A;  4FT8 A;  5J47 A;  1BI2 A;  2MD5 A;  1B59 A;  3I4P A;  3NAU A;  3ABT A;  5LHG A;  3V42 A;  3F6V A;  3OIP A;  2R7T A;  1P4W A;  1HW1 A;  2JRM A;  4G7O F;  4A5N A;  1XMA A;  4KUM A;  2P6T A;  3MKZ A;  2BHZ A;  1LDD A;  4RM3 A;  1TNT A;  1C0W A;  1JE8 A;  1FT9 A;  1K6Y A;  2GZW A;  2JZY A;  3GFJ A;  1SMT A;  2QEX I;  2DMN A;  5JR3 A;  2KT0 A;  3W6V A;  1Z3X A;  3TMO A;  3V8L A;  2ZJR F;  1G6N A;  2V6C A;  2VQC A;  3MMY B;  1RIO H;  1MSF C;  5FB2 A;  1SD5 A;  1K4T A;  1KU2 A;  2XVC A;  1QBJ A;  2FU4 A;  4HF1 A;  1X4P A;  3FXL A;  2XPV A;  3Q0U A;  3VOE A;  3S1N J;  1MJA A;  4RB0 A;  3OYA A;  2DOA A;  2EFP A;  5F08 A;  2DN0 A;  1HXD A;  4M3G A;  1Q1V A;  3WU1 B;  3CZ6 A;  3IL2 A;  2PG4 A;  3H35 A;  2DA7 A;  2HXI A;  1F4K A;  2ZJ2 A;  3BR2 A;  2WB1 N;  2WAD A;  1ONV A;  4MQ9 F;  1NH3 A;  3QU3 A;  3C7J A;  2JUG A;  3HRU A;  1VFC A;  3IH3 A;  2QM3 A;  4C2M J;  2HR3 A;  3FHZ A;  4H4K C;  4HX4 A;  1W0U A;  3VWB A;  4GGG A;  4QPQ A;  3I56 I;  2PJR B;  4X0G A;  4HF0 A;  2IRF G;  1SAX A;  4Y17 A;  5C44 J;  3P9C A;  3J7Y J;  1KYZ A;  4CYC B;  1Y1V J;  4M71 A;  4AYB N;  1JGS A;  2WAQ N;  1MIJ A;  2GOM A;  3H0G J;  5DCF A;  1Y56 A;  4DQ2 A;  3T5X A;  5CVV A;  1RC9 A;  3OWT A;  2D1V A;  1N77 A;  2X4H A;  2A6H F;  2XGX A;  5FD5 A;  4BU2 A;  3F3X A;  1OCC H;  2H6C A;  2IW5 A;  3VYR B;  5B1A H;  2IGK A;  4LIV A;  1P7J A;  3BT9 A;  3OIQ A;  1LVA A;  2WC2 A;  3M1E A;  3G71 I;  2O03 A;  3AL0 B;  2O3F A;  4E70 A;  1XDU A;  4ZTF A;  2LD5 A;  2CS3 A;  3K4K A;  3CUO A;  5DS9 A;  2AQE A;  1YIO A;  3E5U A;  3KZZ A;  1ZRC A;  4IHW A;  2GWR A;  2HTS A;  1R49 A;  2MD0 A;  1G8X A;  2HGC A;  5E3O A;  1WWX A;  4BEH A;  1QHG A;  1Y6I A;  2LRD A;  4MHG A;  2B63 J;  4M9S A;  4JX5 A;  4M3B A;  2ME6 A;  2DA6 A;  4PUS A;  4IRG A;  4P55 A;  2DA1 A;  1S7A A;  4FET A;  2ELH A;  2FBI A;  3D0S A;  3G1L A;  4P1W A;  4UVC A;  4ASN A;  1D5Y A;  1QZZ A;  2ZME A;  2VKD A;  4NNJ A;  4CCM A;  4EJO A;  4IHV A;  1QQI A;  2DJN A;  2ZXW H;  2IAI A;  4R1H A;  3P9I A;  3OYC A;  2KRC A;  1TL8 A;  3DBR B;  3AKZ A;  4O3M A;  1B72 B;  3HHH A;  3I4M J;  3ERM A;  1N78 A;  4DOZ A;  1NK2 P;  5KVR A;  5LRR A;  4KA4 A;  1AWC A;  1DU6 A;  4BXX J;  4HOB A;  1GVD A;  4A2U A;  4HYE A;  2GOX B;  3DLL F;  5CLS A;  4XIC A;  2MSY A;  3A0B C;  5HVQ C;  2CYY A;  4E4H A;  1V5E A;  2DOE A;  3K4C A;  4Y7N J;  1BI3 A;  2JT1 A;  2Q1Z B;  1UZC A;  4ESB A;  2K9L A;  3DTI A;  3DKX A;  5H6R A;  1JTX A;  3E6B A;  2ZBK A;  4RBO A;  3CO7 C;  2QSG X;  4EJV A;  1HKT A;  2K7L A;  2Z5U A;  4GXO A;  2E60 A;  3QPT A;  4XLA A;  1WJD A;  2HPI A;  3WTZ A;  3BG7 A;  3WGH A;  5DM7 F;  2Z33 A;  4XRS A;  2E35 A;  2N8G A;  4I02 A;  3V7S A;  4F92 B;  3CLQ A;  1ZAO A;  2BYV E;  2DT7 B;  3MEX A;  5LRS A;  1LE8 B;  4HNT A;  4A12 A;  3CJR B;  4A3M J;  1W5C C;  1VND A;  4EM1 A;  5E8I A;  4ZZD A;  1MH3 A;  2HOE A;  4NQW B;  1MBE A;  3LSH A;  2V1D A;  4OWR B;  4G7Z F;  2WTE A;  4A0X A;  1YTY A;  5L3E A;  2COM A;  1XSX A;  2RRE A;  1B9M A;  4II3 A;  4L9N A;  3DF8 A;  3GLL A;  3HOV J;  3KEO A;  3TL4 X;  1UHM A;  1IXS B;  1JTY A;  1SFX A;  4PJJ A;  2CV1 A;  5K7F A;  2E34 A;  1TQP A;  1OJL A;  2E5Z A;  4G6D A;  3JSO A;  2Y69 H;  5GP9 A;  4AU7 A;  1K83 J;  2K02 A;  3OYD A;  2IS1 A;  2XAF A;  4M6Y A;  2HQN A;  3CP2 A;  2RDP A;  2XF7 A;  1BOB A;  2Y0S A;  4BJ5 C;  4NC6 A;  5CVR A;  2VE9 A;  1IN5 A;  2DFF A;  4ENM A;  3HL2 A;  3BR6 A;  3Q0W A;  3C2B A;  3TOB A;  2UZK A;  2GLO A;  4HNV A;  2L0K A;  2LH9 A;  3PSF A;  2D2W A;  1WH5 A;  3RPU D;  5KNL A;  5B5E C;  1WSU A;  2LOO A;  1AU7 A;  4IVN A;  1YJ9 I;  4A69 C;  4PFP A;  3RCO A;  2EFO A;  4KIB A;  1ZR2 A;  4KIG A;  1D1A A;  3I3L A;  3LSI A;  3E5Q A;  1FSE A;  3TW6 A;  2R5Y B;  4FTH A;  4CCK A;  2FJ1 A;  1KGS A;  2HOS A;  2VBW A;  1GXQ A;  1DQU A;  2D45 A;  3M9A A;  3FXR A;  3KPH A;  1XGN A;  2X1C A;  4I01 A;  3UR3 C;  2HYG D;  4PSX A;  3KFW X;  2RN7 A;  3QYF A;  3WHC A;  2QVO A;  4C3I J;  2HDC A;  3F8N A;  1HKS A;  2ZKZ A;  1LNW A;  3ML6 A;  4XSZ F;  3H9Q A;  3PM1 A;  4GYG A;  4W1U A;  3CCU I;  2XPW A;  3H5N A;  3NWS A;  4CCJ A;  2RKH A;  3FF5 A;  1U2W A;  4HEA 2;  1YS7 A;  4LMY A;  1EA3 A;  1U5T B;  1MZB A;  3S3M A;  3VOD A;  2BXY A;  3E97 A;  1O3T A;  2GXG A;  2XF6 A;  4FHT A;  3ZQF A;  3BTC A;  3FZV A;  5ILV A;  2W00 A;  4CYC A;  1S7O A;  2HS5 A;  5LHH A;  1G3S A;  3DBH B;  1QZE A;  3BTL A;  5IOZ A;  5EG0 B;  1BR1 A;  4XKB A;  1E3P A;  2KDO A;  4FCY A;  3Q0V A;  3AL0 C;  4WCG A;  3QPS A;  1MBF A;  4AM3 A;  5EGO B;  2H8W A;  4HQM A;  4D5F A;  1U3E M;  4A3G J;  5DYM A;  1FLI A;  1HDP A;  5LBQ A;  2HOA A;  2XF5 A;  3HEF A;  4I0A A;  4HAM A;  3KZY A;  1Y0U A;  5J1U A;  4E7I A;  5IYD J;  1S6L A;  3KYL A;  1MBG A;  1TWA J;  1MNE A;  3S1R J;  1Z0X A;  3CDI A;  3K2Z A;  3K69 A;  4RB3 C;  2ID6 A;  2EV6 A;  3M4O J;  3WE2 A;  4BQQ A;  2M7B A;  3PQK A;  2EA2 A;  4KT5 C;  3WG9 A;  1A35 A;  1IUF A;  1QHH D;  1I6H J;  4UUT A;  2JPB A;  3GXO A;  1MBJ A;  5ERI A;  3ZMT A;  4BEH B;  3C2H A;  4IZZ A;  1H9G A;  3ZMV A;  1JUS A;  1T08 B;  4RMN A;  1I5Z A;  5BPI A;  3CDH A;  1OYI A;  1HSJ A;  1RKW A;  4DZJ A;  4YFX F;  2NVT J;  1EKE A;  2PMZ A;  1MBK A;  1MW7 A;  1YG2 A;  1SD6 A;  2VPL A;  2DMP A;  3QP6 A;  1BJA A;  1KA8 A;  1F9N A;  1WJE A;  2X0L A;  3ZQQ A;  4HDV A;  4HA8 A;  4CZZ A;  1OFC X;  3IH4 A;  3E1S A;  4B4C A;  4E7J A;  5HOD A;  3ECO A;  2A5W A;  2YR2 A;  4I2O A;  5FKL A;  3KLO A;  3DTK A;  2OC6 A;  2R7R A;  5HOO A;  1W5S A;  2ZJQ F;  2M4K A;  4LG0 B;  1K79 A;  3VSL A;  1BC8 C;  1S9H A;  1FTZ A;  1W7P A;  4PFO A;  5LGU A;  3SDB A;  1HBX G;  3CCV I;  2R93 J;  4A3J J;  3Q9S A;  5F64 A;  1U0J A;  2TRT A;  2KIU A;  2DQL A;  4XLN F;  1IJW C;  3L2R A;  1U6G A;  1LUJ B;  4F91 B;  1HQC A;  2EQR A;  1V55 H;  4RLQ A;  3HM5 A;  3ZMU A;  3OMY A;  1FOK A;  4J19 A;  2EV0 A;  4RGX A;  3WGG A;  4XLP F;  2PN6 A;  3FXJ A;  2B0L A;  4WK8 F;  3OYE A;  4KIS A;  2CW7 A;  1LB2 A;  4B48 A;  1FEX A;  2KIQ A;  4RGR A;  3EDP A;  4PCQ A;  1O4X A;  2NVU B;  1LEA A;  1PP8 F;  4XM3 A;  2KDZ A;  5A2Q Z;  3MVP A;  1JGG A;  4BDZ A;  2KRH A;  5B66 C;  2CUZ A;  4Q5S F;  3A02 A;  3RZD J;  1OQY A;  3EET A;  5CVU A;  2XRO A;  1DGR M;  5JVG F;  3HKZ N;  1P7I A;  2BV6 A;  3F8C A;  3S16 J;  2YU3 A;  3DEU A;  4HRI A;  1TNS A;  5GPA A;  2MC3 A;  2VJ5 A;  2VB6 A;  1EH8 A;  3LSM A;  3Q3S A;  3D1N I;  1EF4 A;  2BY3 A;  2ZXJ A;  4IPA A;  4IQJ A;  2RC4 A;  2QEN A;  3LSR A;  2QA4 I;  2XAJ A;  1OR7 A;  3V7R A;  3I59 B;  3O8H A;  1FOX A;  4PGG A;  3CJQ B;  1HLV A;  4RA2 A;  2VKE A;  5K5Q A;  5F1J A;  1JHH A;  3M8J A;  2A5Y B;  4U0W A;  4I99 C;  3LMM A;  3QPL A;  2R7U A;  3R0J A;  4F7Z A;  4AIJ A;  3JW4 A;  2ETH A;  1U5T C;  3QOE A;  2K5C A;  3E7L A;  1MKM A;  2FNP A;  2J5O A;  1R1V A;  2G7U A;  2IBD A;  3ZGK A;  2R5Z A;  3TDZ C;  2R7F A;  2DK8 A;  3NEU A;  2XRL A;  1VQN I;  3G3Z A;  5EGO A;  1BN5 A;  5LEK A;  5LD2 C;  2O7O A;  3CJN A;  4EQQ A;  2QBY A;  4QWQ A;  2DAO A;  4M3D A;  1W1W E;  4D5C A;  1T56 A;  2O61 A;  1BOA A;  3PNT A;  1FC3 A;  1MMS A;  3HYI A;  4DNC A;  2V9K A;  4ESJ A;  3GUD A;  3VPR A;  1WFX A;  3IWZ A;  3HGY A;  4RS8 A;  4L5I A;  4ABZ A;  1TQM A;  2DT5 A;  4BAC A;  5IT9 Z;  5FRO A;  3B02 A;  1ZGJ A;  2ZXH A;  4XRM A;  1Y1W J;  1B4A A;  2X1D A;  2VON A;  2F6C A;  2DYR H;  1XS9 A;  5KHD A;  2M0M A;  1RES A;  4FQG A;  4BAY A;  3ZQL A;  1X1A A;  1QVT A;  2W1O A;  1IRX A;  3KE2 A;  1GDT A;  5D5V B;  3AAF A;  2C6Y A;  2BEO A;  4S05 A;  2H6B A;  2XDV A;  1WI9 A;  2Z99 A;  5J6X A;  3EYY A;  4L5J A;  3ZQG A;  3RSN A;  5JI6 A;  3OS2 A;  2VIX A;  4ITV A;  5FFZ A;  4I6Z A;  2XB0 X;  4FE7 A;  1D8K A;  4IRH A;  5EDN A;  3I53 A;  3A01 B;  4U87 A;  2OU2 A;  2A61 A;  3CQZ J;  1R5H A;  1UMQ A;  1P4A A;  3HDD A;  4KMF A;  3H9J A;  5B1B H;  4AIH A;  4UNO A;  2G7H A;  3HTS B;  4E6K G;  1MJ9 A;  2XIG A;  1P92 A;  2TDX A;  5D8L B;  1ETO A;  5DV5 A;  1T2K A;  4CZC A;  2DCE A;  3F8M A;  3JAM K;  1YFH A;  3RKY A;  2IGM A;  2LP0 A;  1SEU A;  5AIP A;  3LSJ A;  1CF7 A;  3KLN A;  4AVP A;  2D5V A;  2MLG A;  1TTY A;  1ZAR A;  4EMS A;  4XRS G;  3R61 A;  1X19 A;  2OV7 A;  3RIR A;  5F0H A;  4XLH A;  2DA4 A;  2PQ8 A;  2FUG 2;  4C2T A;  3WGI A;  2L7K A;  3IV5 A;  3O2P E;  2HYJ A;  3H0D A;  4XMY A;  2DOF A;  5DCM A;  4FX0 A;  1ODD A;  1V5F A;  3BRO A;  1RZ4 A;  1D5V A;  3M7G A;  3DXJ F;  2LNB A;  5GPC A;  2Q2E B;  3ABL H;  3GCM A;  3OL3 A;  4UB8 C;  3HXL A;  4D0P A;  1IF1 A;  4RB1 A;  1TZL A;  2QQB A;  4UVB A;  2M45 A;  3K1M A;  1YOV B;  5HS9 A;  3IKV A;  1SD7 A;  2IS6 A;  3RQI A;  2F5V A;  3ZOB A;  1G2H A;  4C9Y A;  4TV7 A;  1YIT I;  3OR1 C;  2CQK A;  5HDG A;  5E18 F;  4ZJZ A;  2Q2E A;  1YW9 A;  2EPF A;  5KK1 A;  5E8G A;  3RJP A;  1BA5 A;  3BZC A;  5BOX A;  4XBF A;  3ZQ7 A;  3KP4 A;  3OYF A;  2WAF A;  1T6S A;  2M8G X;  1VQ7 I;  2OJE D;  5J8F A;  1K61 A;  2HVQ A;  1IZ1 A;  4YEL A;  3FMS A;  1T8I A;  1POG A;  2KHM A;  1OLT A;  1VQ5 I;  2XSJ C;  1BL0 A;  4HBL A;  2FQ3 A;  3BJO A;  4AVZ A;  3OYK A;  3PJR A;  3K9T A;  4JQF A;  1PUE E;  2CQQ A;  4O5V A;  5JVT A;  2R0Q C;  1X2N A;  3OYM A;  4M3F A;  3WU2 C;  4LLN A;  2E1N A;  1IN7 A;  3ZMD A;  5GAH J;  2LVS A;  2EA4 A;  3LST A;  4N9I A;  4Z2Y A;  2A3S A;  1SMY F;  1W0T A;  1H8A C;  4RM2 A;  1ZHF A;  5F0C A;  4C3H J;  3LWF A;  2CUF A;  2J5P A;  5BMZ A;  1ZR4 A;  1Y39 A;  3JCU C;  3T8R A;  5FLX Z;  3SZG A;  2MW8 A;  4MNU A;  1LFB A;  3HIF A;  3O6B B;  4HQE A;  1BC7 C;  2QCO A;  3PFY A;  5ILU A;  3KP3 A;  2DFE A;  2CRG A;  3DKW A;  4F52 A;  3TO6 A;  3WTV C;  4KMU X;  3MCZ A;  5LGT A;  4RAZ A;  1KQ0 A;  5BPD A;  2QQ8 A;  2E71 A;  3SFZ A;  1ZN2 A;  2HU9 A;  4CXF A;  3L1P A;  2G0E A;  4DYR A;  2GXB A;  1VQO I;  3C3W A;  4A6D A;  1N25 A;  3J81 K;  4L0Y B;  2H09 A;  4QPO A;  1UG2 A;  3F8B A;  2QF7 A;  1I1G A;  4LG3 A;  4B09 A;  1NTC A;  2IGN A;  2E19 A;  3CJT B;  2GBY A;  3K1P A;  1VQ4 I;  4CO8 A;  1YJW I;  3K6G A;  2R7X A;  2L7M P;  4C30 A;  1HA8 A;  2O8X A;  3TED A;  2ESH A;  2JN6 A;  1Q1H A;  3KYD B;  2W85 A;  3GBG A;  1JHF A;  2V6E A;  3BR5 A;  1S7E A;  2DJI A;  2Y0S N;  5FGM A;  5J8C A;  1Z91 A;  4K2E A;  1DUX C;  1FZP B;  2P5V A;  3QRF F;  1VQ6 I;  4MEY F;  2BY2 A;  4XK4 A;  5HLT A;  1I3Q J;  2RNG A;  2JSP A;  2P7V B;  1I27 A;  1WJC A;  4N4O B;  4Y15 A;  1XGS A;  3BZK A;  4BHP A;  1VQK I;  2KZG A;  2X51 A;  2E1M B;  2KL4 A;  2P81 A;  3JRG A;  1K78 A;  3H3Z A;  1FOY A;  3LQQ A;  3J81 Z;  4KN7 X;  5J3L A;  3K4N A;  1QPM A;  3IP4 B;  5CVI A;  3WTT C;  2A6T A;  2VBZ A;  3P7N A;  3E5X A;  3E6M A;  1LFU P;  3JAM Z;  1XSD A;  5DM6 F;  4D1Q A;  2F4O B;  2HPM A;  2NOG A;  1WHU A;  3NQO A;  1YRN A;  2DU9 A;  1ZTR A;  2YSR A;  3UNG C;  1MSE C;  1GT0 C;  5E20 A;  4ENK A;  1ZH5 A;  2K3F A;  1Y8Q B;  1KU7 A;  2QKM B;  2F2E A;  4AC0 A;  3DPU A;  1O3Q A;  3PQJ A;  2HQA A;  2FRH A;  3A0H C;  1PYV A;  1ERD A;  1CQT A;  5FKM A;  3F0C A;  4P9U A;  2M34 A;  2LLK A;  3K1N A;  4BJ6 C;  4DYC A;  1U8B A;  2JRT A;  1KU3 A;  3DPL C;  3VYT B;  3LAJ A;  1FBQ A;  3QP5 A;  4JOM A;  5KAI C;  3JRB A;  1G59 A;  5BQT A;  1ZGA A;  1GV5 A;  2DBB A;  2JMW A;  5ED4 A;  1FX7 A;  1O7L A;  1DGW Y;  2Z3Y A;  3ERE D;  3ZRG A;  1J59 A;  2OD5 A;  2MLK A;  3MKW B;  2QKL B;  3WU0 A;  1T0F C;  3GF2 A;  1TWC J;  2BW3 A;  3I0T A;  3HOS A;  3JSP A;  4GDF A;  4YG2 F;  3HJE A;  5J40 A;  3C2G A;  3FXK A;  3KEY A;  4E7Z A;  4OIQ F;  4M6V A;  2W48 A;  5FLV A;  1XN7 A;  2ICW G;  1OCR H;  3V8K A;  1W36 C;  3SEZ A;  3DEE A;  1YX5 A;  2XAU A;  3ULQ B;  1ITY A;  2STW A;  2MH2 A;  2VJJ A;  1FBS A;  4BUP A;  4WX9 A;  2ZSI B;  3I58 A;  3MD2 A;  1R4M B;  5H6Q A;  2JTV A;  3BG5 A;  1EH7 A;  4R79 A;  2F5D A;  2ZB9 A;  3TOA A;  4BY7 J;  1LJ9 A;  1SFU A;  4ZZL A;  1T39 A;  1HW2 A;  2UXX A;  4X1E A;  5DDG A;  1T95 A;  3H5R A;  1NK3 P;  4F3Q A;  5BNG A;  2DI3 A;  4UV8 A;  2AXL A;  2H27 A;  2ZNY A;  4FX4 A;  4G9Y A;  2XSD C;  1H0M A;  1IV8 A;  2WV1 A;  3QOD A;  3W3C A;  3L2V A;  2OCE A;  3HB9 A;  3ZN0 A;  3CMA I;  3CCR I;  2IS4 A;  3EPZ A;  4BXF A;  1MMA A;  4Y4R A;  4LD5 A;  1D8J A;  3RQ4 A;  1IDY A;  5F04 A;  5EG0 A;  2K85 A;  5K5O A;  1J2X A;  1K78 B;  2FE3 A;  4NC7 A;  3BJA A;  1FMV A;  2R7Q A;  4ENJ A;  4Q48 A;  4IHY A;  2EJR A;  1S8N A;  4HV5 A;  3PL8 A;  2NAZ A;  1W36 D;  3BQZ A;  5C4X J;  3FHN A;  3HOZ J;  5FFX A;  2NYX A;  4PJ0 C;  2O9L A;  3GTG J;  1OR7 C;  3G2B A;  2F5F A;  1MMN A;  2ME0 A;  2CSO A;  2ADU A;  1HC8 A;  1EJ9 A;  5J4Y A;  2HQ5 A;  3RKQ A;  4LGW A;  2M3A A;  5EYR A;  3HUG B;  2O8K A;  3FBI B;  2ESN A;  1WJF A;  1J5Y A;  1E2X A;  1KZH A;  1R6R A;  5E1W A;  5AON A;  5FRN A;  3LOC A;  3I9V 2;  2GAU A;  4KIC A;  4ZDL A;  5H20 A;  1A04 A;  1MMG A;  4G6Q A;  4C3J J;  4D7N A;  4G7H F;  1IO2 A;  4YRV A;  2HWV A;  1LVK A;  1V5G A;  3KEQ A;  4JYK A;  4EM0 B;  3FDY A;  2RGV A;  3LFU A;  1Z77 A;  2Y48 A;  4A6E A;  1NHA A;  3GWZ A;  4P5O A;  3TO7 A;  2E7W A;  5EF6 A;  1ZGW A;  3QQA A;  2LRE A;  1EH6 A;  3FBN B;  1GLN A;  1F43 A;  3BPX A;  2HDW A;  1IRZ A;  1ZRF A;  1Z7L A;  3EUH A;  3PIP F;  2KIM A;  3SYT A;  1S29 A;  2M2E A;  3BR0 A;  1GVJ A;  5EJC A;  2DPU A;  2QYO A;  3H1C A;  2E1M C;  2KRF A;  1W5T A;  4A0Y A;  5CQG A;  1K4S A;  2LSO A;  4BQN A;  4AUX A;  4OAZ A;  4LOC A;  4E7L A;  2NS7 A;  4OAY A;  1RI7 A;  3KX2 A;  2RQP A;  1RR8 C;  3CCS I;  3GTM J;  3KP6 A;  4EM2 A;  3HOY J;  2L7F P;  3W6J B;  3FK6 A;  3J7A O;  2TCT A;  2F5C A;  5TIS C;  4BE2 A;  3LFK A;  4RAY A;  1KON A;  3OY9 A;  1Z21 A;  2M4G A;  1BIB A;  2EZL A;  3WE3 A;  2Q0O A;  1AHD P;  3LNQ A;  1K7A A;  1ZLJ A;  1JKO C;  4W97 A;  4XKC A;  3PNY A;  2QQ9 A;  3V4G A;  4XKV A;  4RB2 C;  1VQ8 I;  1G3T A;  2KIF A;  4M9Z A;  2IXS A;  1R22 A;  2Y2Z A;  1E17 A;  1IRF A;  3DLA A;  4I7H A;  2RVC A;  1GV2 A;  1Z9C A;  1ZG3 A;  2W24 A;  2R7W A;  1UHW A;  4ETS A;  3P9K A;  3MQ0 A;  3LA7 A;  4HW0 A;  1VQM I;  1G4D A;  3S32 A;  2BY0 A;  3QPH A;  4V2F A;  2L02 A;  2RQQ A;  1ETQ A;  2VJ4 A;  3EUA A;  2O0Y A;  1TT5 B;  4YII A;  4FIS A;  4U0V A;  4Y13 A;  1HDD C;  3LA2 A;  3GYH X;  3RDI A;  2H94 A;  4V2G A;  2K4J A;  2XV4 S;  1TBX A;  1UFM A;  4DBQ A;  2E5N A;  4ZYD A;  2W4S A;  2NRA C;  3GTP J;  3OYG A;  2FQ4 A;  4MFE A;  1W7P D;  1HW5 A;  2OF7 A;  2MC4 A;  1R5G A;  3BDD A;  2E1C A;  1MJB A;  1R58 A;  3OIO A;  1T98 A;  2QQA A;  1PP7 U;  4EGY A;  2QBY B;  3GTJ J;  3RPU A;  1UAA A;  1FTT A;  2VLA A;  2PFB A;  4L9V A;  1TQI A;  2R5Z B;  3KP7 A;  1KQ8 A;  2W82 A;  2COB A;  3CTA A;  2GQQ A;  2L9V A;  2P7C B;  4GYI A;  4M9X A;  3JTH A;  1FYL A;  1QPI A;  2PEX A;  3J80 Z;  4XN3 A;  3TP3 A;  4ZH4 F;  2Y0M A;  3ZQH A;  3N4M A;  3C1D A;  1IN6 A;  3BC8 A;  1S3J A;  2W25 A;  1G3Y A;  3GFL A;  2XRN A;  4QLC U;  1HF0 A;  3IKT A;  1B8I B;  2HOT A;  2NXN B;  1MD0 A;  2YUS A;  3MZ8 A;  3IRR A;  1SFO J;  1XX5 A;  3BR3 A;  2X6Y A;  2ECB A;  4WXC A;  4BE1 A;  1X1C A;  4A3K J;  2ZSH B;  4Y3O A;  2LY2 A;  2FD5 A;  2VE8 A;  5D6F A;  2NVX J;  4Q4Z F;  3F23 A;  2L7Z A;  4XLF A;  3A2K A;  2CFX A;  4IOC F;  2ID3 A;  4LJZ F;  1A31 A;  2EIN H;  3JRF A;  4CGZ A;  3V8J A;  4BXU A;  5E3N A;  3KP2 A;  5CYV A;  1YIJ I;  5LFA A;  4CIC A;  4U7B A;  3F9K A;  1TW2 A;  1JT0 A;  1ORK A;  2LTP A;  3L9F A;  3N05 A;  3ZMZ A;  3O8G A;  2AXT C;  2VAS A;  3QYE A;  2K27 A;  3MN2 A;  1R1U A;  5KAF C;  3ZR8 X;  4B3A A;  5DEQ A;  5HLG A;  3FXU A;  1I50 J;  2DMU A;  3S3N A;  1MDM B;  2VKH A;  2OTL I;  3WTY C;  4MTD A;  5IYC J;  1AKH A;  2JA5 J;  4WXD A;  2PJR A;  3RPQ A;  3GTL J;  4UV9 A;  3SZT A;  4EJW A;  5D5X B;  4CDG A;  3VSK A;  2XGC A;  4OIO F;  1J09 A;  3GO5 A;  2KMU A;  2M1B A;  3FMQ A;  2OAZ A;  2ELK A;  2DDB A;  1U9N A;  1MBH A;  3MWM A;  4E7S A;  1QVU A;  3R4K A;  3SJM A;  5GTH C;  1V54 H;  2FMY A;  2HNH A;  4B43 A;  2EFN A;  3HTU A;  1FSH A;  4BYY A;  3RYP A;  3GZ6 A;  3ZP5 A;  3HOW J;  4L5E A;  5ICG A;  1MND A;  2Z9O A;  1XDS A;  3HC7 A;  3VDX A;  5GAG J;  2ELJ A;  3K0L A;  2VL8 A;  5DUI A;  5ICF A;  1FYK A;  2DFI A;  2EB7 A;  4HST A;  3OYI A;  3S15 J;  3WHB A;  3BQY A;  5JLW A;  4IO9 F;  4CYD A;  3OL4 A;  2JK3 A;  1W4M A;  3WTU C;  4NUB A;  2XGD A;  1JJ8 C;  1JI8 A;  2VQL A;  1J7K A;  3L7W A;  1ON1 A;  1WRJ A;  2FBH A;  3RI4 A;  1O3S A;  2JA8 J;  1QNT A;  4LK1 F;  2ZME B;  5IY5 H;  2F4I A;  2OUM A;  4MIM A;  1ON2 A;  2QWW A;  1BI1 A;  2P0W A;  3TKY A;  1OCP A;  2VC1 A;  3CCY A;  2OQR A;  2V79 A;  1BR2 A;  2X9D A;  2AHQ A;  4PSW A;  3U1K A;  4B47 A;  3EUH C;  3K7A J;  4S0H B;  4A5M A;  1CF7 B;  5HS8 A;  4XN0 A;  3Q5F A;  3SEQ A;  4V19 K;  1X2M A;  2B9S A;  2O6G E;  2X85 A;  3E3V A;  3JRI A;  3SFI A;  2DTR A;  2Y31 A;  3ZMS A;  2YU9 J;  1V3F A;  1NG6 A;  1LPQ A;  2BVL A;  3DV8 A;  4JP0 A;  1OKR A;  2IEK A;  5EEG A;  4BHB A;  2LF7 A;  4M73 A;  1APL C;  3J7Z I;  1YO5 C;  2X6W A;  2GIV A;  5L3F A;  2HDD A;  2VQG A;  4ZYG A;  2JA7 J;  2KJC A;  3KYC B;  4BDY A;  3BCB A;  3EQL F;  1P2F A;  4BGD A;  3S8P A;  1Z67 A;  2DMQ A;  2XGE A;  3I71 A;  3SZP A;  1BM9 A;  4KIT B;  1MH4 A;  4HX7 A;  3E0J B;  4DW6 A;  3W2W A;  3VEP A;  3DPT A;  4BJT A;  3CO6 C;  2KZV A;  1FPQ A;  1NG7 A;  4HLX A;  2PMU A;  3IWF A;  5IPA A;  4QTR A;  3FKI J;  1L0O C;  4LB5 A;  1UB9 A;  4YFK F;  3HOU J;  2DLL A;  3GW2 A;  3BLY A;  6PAX A;  2XUB A;  1TW3 A;  1TC3 C;  2EH3 A;  3ABM H;  4BKX A;  5IP9 J;  2HFH A;  2XC7 A;  5A2Q K;  3I64 A;  3S1Q J;  3S2D J;  1B9N A;  1XMK A;  1X3W B;  4Y52 J;  1QO0 D;  5L3C A;  4J01 A;  3BCA A;  3L00 A;  4LIT A;  1KYW A;  3OYL A;  2CW8 A;  2EIJ H;  4EEF G;  3LSP A;  3KP5 A;  2NNY A;  3M3Y J;  1XC5 A;  3LSK A;  1IAW A;  2UXN A;  5K1Y A;  2XPU A;  1Z6R A;  4N4N B; 
#chains in the Genus database with same CATH homology
 5D4R A;  3LAP A;  1K6O A;  1R36 A;  4WWC A;  2WWY A;  3FMR A;  5HLI A;  1MGT A;  4M6X A;  2G9W A;  3M8F A;  2VXZ A;  1XCV A;  4OOI A;  3N97 A;  1XCB A;  5ICE A;  3ZN1 A;  4U0Y A;  2FEZ A;  3HHG A;  4NB5 A;  3COA C;  4OIP F;  4KDP A;  3GZ5 A;  1YW7 A;  3GEZ A;  4UUV A;  3HSF A;  5AIQ A;  4B8X A;  3E6C C;  1B6A A;  2DK5 A;  4KN4 X;  3IRQ A;  5LLQ A;  4UVA A;  3BOQ A;  2FNA A;  5D6E A;  4BQA A;  3IHU A;  3SQN A;  3U2R A;  2A07 F;  2ZNZ A;  1KU9 A;  2M8E A;  3V7C A;  3O3K A;  2RNJ A;  3NRV A;  3FM5 A;  1XGM A;  4G8X A;  3DFG A;  1G3W A;  4RGU A;  2OBP A;  4RGS A;  3F6O A;  2V1X A;  4P9F A;  3W6K B;  1ZLK A;  2CGP A;  2FBK A;  2HKO A;  2P4W A;  1QGP A;  4KYW A;  3I54 A;  2VBY A;  2XHK A;  4PGH A;  4U88 A;  1U78 A;  4KFC A;  5E1X A;  4EGZ A;  3ZPL A;  3FM3 A;  2V1U A;  1GHC A;  3GFM A;  5EEH A;  1H9T A;  3U9G A;  1SFE A;  4PZJ A;  4YFN F;  4L0Z B;  1FY7 A;  1KQ9 A;  4ZYE A;  4BH9 A;  3BWG A;  2IP2 A;  1O7F A;  1W7P B;  5D4S A;  1T38 A;  2R3S A;  1R23 A;  2QUF A;  5HDK A;  3BP8 A;  2OQG A;  1USS A;  2L4A A;  4EV0 A;  3HSE A;  1V4R A;  1JXS A;  4NQW A;  4LLG F;  1I6X A;  2CWE A;  5JFR A;  4U7D A;  1UCR A;  2M87 A;  3FX3 A;  3G73 A;  3CUQ B;  3ISP A;  4HV6 A;  2EFW A;  5HS7 A;  4WXH A;  4O6J A;  1FWZ A;  4ON0 A;  2VBX A;  2PI0 A;  3I5U A;  4EJU A;  3M8E A;  2ZFW A;  1AOY A;  1SD4 A;  3LQR A;  1BBY A;  1XB4 A;  1BI0 A;  2IJL A;  3CUQ A;  1FP1 D;  2DO7 A;  4LFU A;  3TGN A;  2DPD A;  2FOK A;  1TLH B;  2P5K A;  5D8K B;  5HDN A;  5DD8 A;  3HRM A;  3SHF A;  5IT3 A;  1FP2 A;  2V9V A;  2ISY A;  3B73 A;  5FD6 A;  3RKW A;  2PJP A;  4GCV A;  2EFQ A;  2QLZ A;  2R7D A;  2IPQ X;  2VOD A;  5D5W B;  4LG0 A;  1F5T A;  4L18 B;  4I0B A;  1YLF A;  2OZ6 A;  4ENN A;  2XKP A;  1QZY A;  4L9J A;  2P6S A;  1LQ1 A;  4BHC A;  4MEX F;  2FML A;  1R7J A;  5LGN A;  4LLL A;  4Q47 A;  4KNY A;  3IC7 A;  2VOO A;  1O57 A;  1J9I A;  5CJ9 A;  2L4M A;  3E6D A;  5IT9 K;  1DP7 P;  5D5U B;  4UXN A;  4HDU A;  5FLX K;  3S2W A;  1T0F A;  2EK5 A;  4MGR A;  1OYW A;  4M74 A;  4BNC A;  2Y75 A;  2CW0 F;  1STZ A;  2FF4 A;  2P8T A;  4AIK A;  1IXC A;  3U1D A;  3HOT A;  4M72 A;  4P96 A;  4R8H A;  4HZF A;  1PDN C;  1LDK B;  4IHT A;  1BIA A;  4UHT A;  3FWE A;  1IXR C;  1F1Z A;  2FXA A;  4IF4 A;  1U5T A;  2KJB A;  4XRF A;  3MZH A;  3WTX C;  4IJA A;  1D3Y A;  1RNL A;  4OMZ A;  1IN4 A;  3OOP A;  2ZCW A;  2XKO A;  1P6R A;  3TO9 A;  2JSC A;  2W57 A;  1MDM A;  4A0Z A;  4WF2 A;  3F72 A;  3JTG A;  1OYY A;  2VN2 A;  3R6S A;  3PFI A;  4EJT A;  2AS5 F;  2MA3 A;  4HLY A;  5E17 F;  4LB6 B;  1YQA A;  2RV8 A;  3FXQ A;  1GXP A;  5TJJ A;  1OPC A;  1RUO A;  3RKX A;  2HEO A;  2BE5 F;  2E7X A;  1DPR A;  2LF8 A;  5CVJ A;  2VC0 A;  3QAH A;  1OMI A;  2CO5 A;  2STT A;  1HST A;  1IN8 A;  2VT3 A;  2FA5 A;  3QOP A;  4N0B A;  1FNN A;  3GX4 X;  3HRS A;  3F8F A;  1XSV A;  4N9H A;  1I1S A;  2A68 F;  2PMH A;  3RYR A;  2BBY A;  3HSR A;  1DDN A;  2K86 A;  3DQV C;  2Q8K A;  3R60 A;  2HYF A;  5L3G A;  3ABU A;  2VOP A;  3I59 A;  4OMY A;  3KET A;  1P4X A;  5DCM B;  2QZ8 A;  2D1H A;  2HZT A;  2DW4 A;  2ACJ A;  3BY6 A;  1REP C;  2L3D A;  2W84 A;  4EVI A;  2PBI A;  1FYM A;  3F21 A;  4MQV A;  4PDK A;  4ESF A;  5DD4 A;  1IUY A;  4KIF A;  2XAS A;  4NHJ A;  1Z6T A;  4IXA A;  4IRI A;  2A69 F;  2GA2 A;  2XAG A;  3T1B A;  1J0R A;  2PLY A;  3GFI A;  1CGP A;  3L2C A;  4IHS A;  5ICC A;  5LHI A;  4I09 A;  3CLO A;  2HQR A;  4JBA A;  4OIR F;  4JK1 X;  2L01 A;  2HTJ A;  4OU0 A;  1EV7 A;  1LDJ A;  1R00 A;  2KKO A;  3SXY A;  5L3D A;  4AD9 A;  3GVA A;  1YYV A;  3CUQ C;  1RUN A;  3QU6 A;  3MFK A;  2LDU A;  1L3L A;  2IA1 A;  2XAH A;  2OA4 A;  4L9T A;  3VFZ A;  3BZ6 A;  1VTN C;  1ZG5 A;  4OIN F;  3WTW C;  3DP7 A;  2FSW A;  2CG4 A;  2ISZ A;  4MTE A;  1Z05 A;  3WOD F;  2BGC A;  1XGO A;  3Q9V A;  4I98 B;  5LEJ A;  2EWN A;  3GLX A;  2IT0 A;  2VT2 A;  3REO A;  5L3B A;  1HKQ A;  3OV8 A;  5TRD A;  1WQ2 A;  5K5R A;  5FO5 A;  1IW7 F;  3ELK A;  3HUG A;  1ZRE A;  1B1B A;  5JHU A;  3H92 A;  4HF2 A;  3VB2 A;  3EYI A;  3L09 A;  3T8T A;  1WKM A;  2GA1 A;  2IA0 A;  2YX4 A;  1ZG1 A;  1ULY A;  3BPV A;  3R0A A;  3MZY A;  2EV5 A;  5DUK A;  2A6E F;  2P5L C;  3ECH A;  3C18 A;  4HX8 A;  2UWM A;  2DQR A;  2LKP A;  5F6F A;  2IA2 A;  2NNN A;  5F1R A;  4S04 A;  2M30 A;  4LK0 F;  3TQN A;  5HLH A;  3RTR A;  3J80 K;  1YW8 A;  3MAJ A;  3T0Y A;  1ZRD A;  2L54 A;  1IRG A;  4GO1 A;  3TDU C;  1Z1D A;  1X3U A;  4XSX F;  1Z7U A;  2WV0 A;  2MBF A;  2OZU A;  5BS6 A;  1LEB A;  3LA3 A;  2HKX A;  4AWX B;  3F22 A;  1YS6 A;  4G94 A;  1R1T A;  5E1Z B;  2YPR A;  3ROU A;  4H0E A;  4CHU A;  3BJ6 A;  2JPC A;  1J75 A;  2ZO4 A;  3KCC A;  2F5E A;  4ZYH A;  1FBU A;  1U8R A;  2IVM A;  5ILS A;  2YX7 A;  3H3U A;  3WTS C;  4YIF A;  1UST A;  1XD7 A;  1O3R A;  2NS0 A;  2MH9 A;  2XAQ A;  3HRT A;  1ZYR F;  3D5L A;  2M5W A;  2K4B A;  4FT8 A;  1BI2 A;  2MD5 A;  1B59 A;  3I4P A;  3ABT A;  5LHG A;  3F6V A;  1P4W A;  1HW1 A;  4G7O F;  4A5N A;  1XMA A;  4KUM A;  2P6T A;  1LDD A;  1TNT A;  1C0W A;  1JE8 A;  1FT9 A;  2GZW A;  2JZY A;  3GFJ A;  1SMT A;  5JR3 A;  3V8L A;  1G6N A;  2V6C A;  1RIO H;  5FB2 A;  1SD5 A;  1KU2 A;  2XVC A;  1QBJ A;  2FU4 A;  4HF1 A;  3VOE A;  1MJA A;  4RB0 A;  2EFP A;  1HXD A;  3WU1 B;  3IL2 A;  2PG4 A;  1F4K A;  2ZJ2 A;  4MQ9 F;  1ONV A;  3QU3 A;  3C7J A;  3HRU A;  2QM3 A;  2HR3 A;  3FHZ A;  4HX4 A;  4GGG A;  4HF0 A;  2IRF G;  1SAX A;  4Y17 A;  3P9C A;  1KYZ A;  4M71 A;  1JGS A;  5DCF A;  4DQ2 A;  3T5X A;  5CVV A;  2D1V A;  2X4H A;  2A6H F;  2XGX A;  5FD5 A;  3F3X A;  2H6C A;  2IW5 A;  1LVA A;  2WC2 A;  3M1E A;  2O03 A;  2O3F A;  4E70 A;  1XDU A;  3CUO A;  1YIO A;  3E5U A;  3KZZ A;  1ZRC A;  2GWR A;  2HTS A;  2HGC A;  1WWX A;  4MHG A;  4M9S A;  4IRG A;  4P55 A;  1S7A A;  2ELH A;  2FBI A;  3D0S A;  4UVC A;  4ASN A;  1QZZ A;  2ZME A;  4EJO A;  1QQI A;  4R1H A;  3P9I A;  4O3M A;  3HHH A;  5KVR A;  5LRR A;  4KA4 A;  1AWC A;  4HOB A;  4A2U A;  4HYE A;  5CLS A;  5HVQ C;  2CYY A;  1BI3 A;  2JT1 A;  4ESB A;  5H6R A;  3E6B A;  2ZBK A;  3CO7 C;  4EJV A;  1HKT A;  2K7L A;  2Z5U A;  4GXO A;  3QPT A;  3WTZ A;  3WGH A;  2Z33 A;  4I02 A;  3V7S A;  3MEX A;  1ZAO A;  2BYV E;  5LRS A;  4A12 A;  4EM1 A;  5E8I A;  4ZZD A;  2HOE A;  2V1D A;  4G7Z F;  2WTE A;  4A0X A;  1YTY A;  5L3E A;  2COM A;  1XSX A;  1B9M A;  4L9N A;  3DF8 A;  3KEO A;  1UHM A;  1IXS B;  1SFX A;  1TQP A;  3JSO A;  4G6D A;  2K02 A;  2XAF A;  4M6Y A;  2HQN A;  2RDP A;  5CVR A;  2VE9 A;  1IN5 A;  4ENM A;  3TOB A;  2UZK A;  2D2W A;  1WSU A;  4IVN A;  2EFO A;  4KIB A;  4KIG A;  3E5Q A;  1FSE A;  1KGS A;  2VBW A;  1GXQ A;  2D45 A;  3M9A A;  3FXR A;  1XGN A;  4I01 A;  1K7A A;  2HYG D;  3KFW X;  2RN7 A;  2HDC A;  2QVO A;  3F8N A;  1HKS A;  2ZKZ A;  1LNW A;  3ML6 A;  4XSZ F;  4GYG A;  2RKH A;  3FF5 A;  1U2W A;  4LMY A;  1YS7 A;  1U5T B;  1MZB A;  3VOD A;  3E97 A;  1O3T A;  2GXG A;  4FHT A;  3FZV A;  5ILV A;  1S7O A;  2HS5 A;  5LHH A;  1G3S A;  4WCG A;  4HQM A;  1U3E M;  5DYM A;  1FLI A;  5LBQ A;  4I0A A;  4HAM A;  3KZY A;  1Y0U A;  1S6L A;  3K2Z A;  3K69 A;  4RB3 C;  2EV6 A;  3WE2 A;  3PQK A;  2EA2 A;  4KT5 C;  3WG9 A;  2JPB A;  3GXO A;  5ERI A;  3ZMT A;  1H9G A;  3ZMV A;  5BPI A;  1I5Z A;  3CDH A;  1OYI A;  1HSJ A;  4YFX F;  1YG2 A;  1SD6 A;  3QP6 A;  1BJA A;  1KA8 A;  1F9N A;  2X0L A;  4HDV A;  4HA8 A;  4CZZ A;  3ECO A;  2YR2 A;  4I2O A;  3KLO A;  5HOO A;  1W5S A;  4LG0 B;  1K79 A;  1BC8 C;  1W7P A;  5LGU A;  1HBX G;  3Q9S A;  5F64 A;  2KIU A;  2DQL A;  4XLN F;  1U6G A;  1HQC A;  3ZMU A;  1FOK A;  2EV0 A;  4RGX A;  3WGG A;  4XLP F;  2PN6 A;  2B0L A;  4WK8 F;  1LB2 A;  4RGR A;  3EDP A;  4PCQ A;  1LEA A;  1PP8 F;  5A2Q Z;  4Q5S F;  3EET A;  5CVU A;  2XRO A;  2BV6 A;  3F8C A;  2YU3 A;  3DEU A;  1TNS A;  2MC3 A;  1EH8 A;  2ZXJ A;  4IPA A;  2RC4 A;  2QEN A;  2XAJ A;  1OR7 A;  3V7R A;  3I59 B;  4PGG A;  5K5Q A;  1JHH A;  2A5Y B;  4U0W A;  3R0J A;  4F7Z A;  4AIJ A;  3JW4 A;  2ETH A;  1U5T C;  1MKM A;  2FNP A;  2J5O A;  1R1V A;  2G7U A;  3TDZ C;  2R7F A;  2DK8 A;  3NEU A;  3G3Z A;  1BN5 A;  5LEK A;  3CJN A;  4EQQ A;  2QBY A;  4QWQ A;  2DAO A;  2O61 A;  1BOA A;  1FC3 A;  3HYI A;  4DNC A;  4ESJ A;  3GUD A;  3IWZ A;  4RS8 A;  4L5I A;  1TQM A;  2DT5 A;  5IT9 Z;  3B02 A;  1ZGJ A;  1B4A A;  2VON A;  4BAY A;  3KE2 A;  5D5V B;  3AAF A;  2C6Y A;  2BEO A;  4S05 A;  2H6B A;  2Z99 A;  1WI9 A;  5J6X A;  3EYY A;  4L5J A;  5JI6 A;  5FFZ A;  1D8K A;  4IRH A;  3I53 A;  2OU2 A;  2A61 A;  1R5H A;  4KMF A;  1P4A A;  4UNO A;  4AIH A;  2G7H A;  3HTS B;  1MJ9 A;  1P92 A;  2TDX A;  5D8L B;  2XIG A;  5DV5 A;  1T2K A;  3F8M A;  3JAM K;  1YFH A;  3RKY A;  5AIP A;  1CF7 A;  3KLN A;  4AVP A;  2MLG A;  1TTY A;  1ZAR A;  4EMS A;  3R61 A;  3RIR A;  2PQ8 A;  3WGI A;  3O2P E;  5DCM A;  4FX0 A;  1ODD A;  3BRO A;  1RZ4 A;  1D5V A;  3M7G A;  3DXJ F;  2LNB A;  4D0P A;  1IF1 A;  4RB1 A;  2QQB A;  4UVB A;  2M45 A;  3K1M A;  5HS9 A;  3IKV A;  1SD7 A;  4TV7 A;  2CQK A;  5HDG A;  5E18 F;  1YW9 A;  2Q2E A;  5KK1 A;  5E8G A;  3RJP A;  5BOX A;  4XBF A;  3ZQ7 A;  3KP4 A;  1T6S A;  5J8F A;  1IZ1 A;  3FMS A;  4HBL A;  2FQ3 A;  3BJO A;  3K9T A;  4JQF A;  1PUE E;  4O5V A;  5JVT A;  4LLN A;  2E1N A;  1IN7 A;  3ZMD A;  2EA4 A;  3LST A;  4N9I A;  4Z2Y A;  2A3S A;  1SMY F;  1ZHF A;  3LWF A;  2J5P A;  5BMZ A;  3T8R A;  5FLX Z;  4MNU A;  1BC7 C;  3HIF A;  3O6B B;  4HQE A;  5ILU A;  3KP3 A;  3DKW A;  3TO6 A;  3WTV C;  4KMU X;  3MCZ A;  5LGT A;  4RAZ A;  1KQ0 A;  5BPD A;  3SFZ A;  1ZN2 A;  4CXF A;  2GXB A;  3C3W A;  4A6D A;  3J81 K;  4L0Y B;  2H09 A;  4B09 A;  3F8B A;  1I1G A;  3K1P A;  4CO8 A;  2O8X A;  2ESH A;  1Q1H A;  2W85 A;  1JHF A;  1DUX C;  5J8C A;  5FGM A;  1Z91 A;  4K2E A;  1FZP B;  2P5V A;  3QRF F;  4MEY F;  2P7V B;  1I27 A;  4Y15 A;  1XGS A;  4BHP A;  1K78 A;  3H3Z A;  3LQQ A;  3J81 Z;  4KN7 X;  1QPM A;  5CVI A;  3WTT C;  2VBZ A;  3P7N A;  3E5X A;  3E6M A;  3JAM Z;  1XSD A;  3NQO A;  2DU9 A;  2YSR A;  5E20 A;  4ENK A;  1ZH5 A;  1KU7 A;  2F2E A;  1O3Q A;  3PQJ A;  2FRH A;  4P9U A;  3K1N A;  2JRT A;  1KU3 A;  3DPL C;  3LAJ A;  1FBQ A;  3QP5 A;  5BQT A;  1ZGA A;  2DBB A;  5ED4 A;  1FX7 A;  1O7L A;  2Z3Y A;  3ERE D;  1J59 A;  2OD5 A;  2MLK A;  3WU0 A;  3GF2 A;  3I0T A;  3HOS A;  3JSP A;  4YG2 F;  4OIQ F;  1XN7 A;  3V8K A;  3ULQ B;  2STW A;  2MH2 A;  1FBS A;  4WX9 A;  3I58 A;  5H6Q A;  2JTV A;  1EH7 A;  4R79 A;  2F5D A;  3TOA A;  1LJ9 A;  1SFU A;  4ZZL A;  1T39 A;  1HW2 A;  2UXX A;  5DDG A;  2DI3 A;  4UV8 A;  2AXL A;  2H27 A;  2ZNY A;  4FX4 A;  4G9Y A;  1H0M A;  3ZN0 A;  4LD5 A;  1D8J A;  5K5O A;  1J2X A;  1K78 B;  2FE3 A;  3BJA A;  4ENJ A;  4Q48 A;  2EJR A;  1S8N A;  4HV5 A;  2NAZ A;  5FFX A;  2NYX A;  2F5F A;  2CSO A;  2ADU A;  4LGW A;  2ESN A;  1J5Y A;  1E2X A;  5E1W A;  5AON A;  2GAU A;  4KIC A;  5H20 A;  1A04 A;  4G6Q A;  4G7H F;  2HWV A;  3KEQ A;  4EM0 B;  2RGV A;  4A6E A;  2Y48 A;  1NHA A;  3GWZ A;  4P5O A;  3TO7 A;  2E7W A;  1EH6 A;  3BPX A;  1ZRF A;  3EUH A;  2KIM A;  1S29 A;  1GVJ A;  2DPU A;  2QYO A;  2KRF A;  1W5T A;  4A0Y A;  2LSO A;  1RI7 A;  2RQP A;  3KP6 A;  4EM2 A;  3W6J B;  3J7A O;  2F5C A;  3LFK A;  4RAY A;  1BIB A;  3WE3 A;  2Q0O A;  1ZLJ A;  2QQ9 A;  3V4G A;  4RB2 C;  1G3T A;  2KIF A;  4M9Z A;  1R22 A;  1E17 A;  1IRF A;  4I7H A;  2RVC A;  1Z9C A;  1ZG3 A;  2W24 A;  1UHW A;  4ETS A;  3P9K A;  3MQ0 A;  3LA7 A;  4HW0 A;  1G4D A;  3QPH A;  2L02 A;  2O0Y A;  4YII A;  4U0V A;  4Y13 A;  3LA2 A;  3GYH X;  3RDI A;  2H94 A;  2K4J A;  2XV4 S;  1TBX A;  1UFM A;  4ZYD A;  2NRA C;  1W7P D;  1HW5 A;  1R5G A;  3BDD A;  2E1C A;  1MJB A;  1R58 A;  1T98 A;  2QQA A;  1PP7 U;  4EGY A;  2QBY B;  3RPU A;  2PFB A;  4L9V A;  1TQI A;  3KP7 A;  1KQ8 A;  3CTA A;  2GQQ A;  2P7C B;  4GYI A;  4M9X A;  3JTH A;  1FYL A;  2PEX A;  3J80 Z;  4ZH4 F;  2Y0M A;  3N4M A;  3C1D A;  1IN6 A;  1S3J A;  2W25 A;  1G3Y A;  3GFL A;  2XRN A;  4QLC U;  3IKT A;  1MD0 A;  3IRR A;  4WXC A;  2VE8 A;  5D6F A;  4Q4Z F;  3F23 A;  2CFX A;  4LJZ F;  4CGZ A;  3V8J A;  4BXU A;  3KP2 A;  5CYV A;  4CIC A;  4U7B A;  1TW2 A;  3ZMZ A;  3L9F A;  2K27 A;  1R1U A;  5DEQ A;  5HLG A;  3FXU A;  1MDM B;  3WTY C;  4MTD A;  4WXD A;  3RPQ A;  4UV9 A;  3SZT A;  4EJW A;  5D5X B;  4CDG A;  4OIO F;  3GO5 A;  2M1B A;  3FMQ A;  2OAZ A;  3MWM A;  3R4K A;  2FMY A;  2EFN A;  3HTU A;  1FSH A;  4BYY A;  3RYP A;  3GZ6 A;  3ZP5 A;  5ICG A;  2Z9O A;  1XDS A;  3K0L A;  5DUI A;  5ICF A;  1FYK A;  2DFI A;  2EB7 A;  4CYD A;  1W4M A;  3WTU C;  1J7K A;  3L7W A;  1ON1 A;  1WRJ A;  2FBH A;  3RI4 A;  1O3S A;  1QNT A;  4LK1 F;  2ZME B;  1ON2 A;  2QWW A;  1BI1 A;  3TKY A;  2VC1 A;  2OQR A;  2V79 A;  4A5M A;  1CF7 B;  5HS8 A;  3Q5F A;  2O6G E;  3E3V A;  2DTR A;  3ZMS A;  1V3F A;  3DV8 A;  1OKR A;  5EEG A;  4BHB A;  2LF7 A;  4M73 A;  1YO5 C;  2GIV A;  5L3F A;  4ZYG A;  2KJC A;  3EQL F;  1P2F A;  3I71 A;  3SZP A;  1BM9 A;  4HX7 A;  3VEP A;  3DPT A;  3CO6 C;  1FPQ A;  4HLX A;  2PMU A;  3IWF A;  1L0O C;  4LB5 A;  1UB9 A;  4YFK F;  2DLL A;  3GW2 A;  6PAX A;  2XUB A;  1TW3 A;  2HFH A;  5A2Q K;  3I64 A;  1B9N A;  1XMK A;  1QO0 D;  5L3C A;  3L00 A;  1KYW A;  3KP5 A;  2NNY A;  1IAW A;  2UXN A;  5K1Y A;  1DPU A;  1Z6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...