3HTUA

Crystal structure of the human vps25-vps20 subcomplex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
RRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein-sorting-associated protein 25
publication title Structure and function of the ESCRT-II-III interface in multivesicular body biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 21
structure length 75
sequence length 75
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3htuA00
1PP8F 4Q5SF 3LFKA 2VODA 3ZMTA 3MEXA 2FNAA 2L01A 2EFPA 5DEQA 3I0TA 4P55A 1RZ4A 3GFJA 3QOPA 4EQQA 1VTNC 1MDMB 3FZVA 5ICGA 4A12A 1P6RA 5E1WA 1SD4A 1R23A 2EV6A 2Z9OA 2VE8A 3J81Z 2A61A 2P5VA 1TW2A 2Y75A 3C3WA 2EV5A 1FPQA 5D8LB 3U9GA 2P6SA 4P5OA 3ULQB 5FFZA 2YR2A 4L5JA 4YIFA 4HQMA 1B9NA 1CF7B 4U0YA 1F4KA 3WTXC 1ONVA 4LG0B 3ERED 1IW7F 3O3KA 1S29A 1K78B 5ILUA 4ENMA 4LD5A 5BMZA 2DPDA 2K7LA 2XVCA 1XCBA 1ZG3A 3L00A 2KIUA 1SFUA 3Q9SA 2HGCA 3DEUA 5HOOA 4NHJA 2EFQA 1QGPA 2J5PA 1XCVA 1BC7C 3LAPA 4HDVA 1XD7A 1Q1HA 1KU7A 3V4GA 3REOA 3KCCA 4LLNA 3LSTA 4RB1A 3QAHA 3QP5A 4I98B 3KEOA 4WK8F 4ENJA 3IKTA 3SFZA 1TNTA 4LMYA 4OIPF 3WE2A 5L3CA 1IUYA 1XSXA 2QBYB 1IRFA 4G7HF 3JSOA 2EFNA 4A2UA 2QLZA 4HV5A 3MZYA 5HDGA 3ECOA 1JHHA 3C1DA 3CUQC 3U1DA 1ZHFA 2FNPA 4HF2A 2XAQA 4MEXF 2UXXA 3KZZA 1R36A 4I02A 3R6SA 3H92A 1DPUA 2FSWA 2Q0OA 1R1TA 2EV0A 4I09A 2D45A 1W7PA 2P7VB 3I59A 4G94A 3GF2A 4O6JA 5E20A 1FBUA 4ETSA 4S05A 4XRFA 2M1BA 5K5RA 4UV8A 3KETA 1F1ZA 5D6FA 4L9TA 2ZCWA 5HS8A 1T98A 3CTAA 3E3VA 4U7DA 3KE2A 2OAZA 2P5KA 2GXBA 1E2XA 4GGGA 3TDUC 4KYWA 1IN7A 1WI9A 1Y0UA 5CLSA 3F8CA 1W5SA 3F3XA 4EJUA 1U3EM 3ELKA 2LF7A 2EFOA 2W57A 3SQNA 2D2WA 5BOXA 4M6YA 5ICFA 5CVIA 1HKTA 4IHSA 1IXRC 1LNWA 3EDPA 5CVJA 1G3TA 2C6YA 3KLNA 2M30A 4YFXF 3TQNA 5JVTA 1B59A 4KN4X 1USSA 5D5VB 3TO7A 2IA1A 2Z99A 3I5UA 4DNCA 4UUVA 2E7XA 3KEQA 3EYIA 4ON0A 2F5FA 4HX7A 4RAZA 2FBIA 3E5UA 1H9TA 5F1RA 2CSOA 4BNCA 4OIQF 3LWFA 1P2FA 4EVIA 2PMHA 3R0AA 1IN6A 4QWQA 4UV9A 4U7BA 1B9MA 2LKPA 3GYHX 1DPRA 3DPTA 2FMLA 1BI0A 1GXQA 3I64A 1FNNA 5TRDA 1YS6A 1Z1DA 3E6MA 2CW0F 3U2RA 3WTVC 1T0FA 4UXNA 1LDDA 3CDHA 2MLKA 1CF7A 2K02A 3JAMZ 1J5YA 1ZYRF 4LG0A 1R1VA 1WSUA 5D6EA 2D1HA 5DUIA 3ZP5A 4GYIA 4RGXA 3VODA 5LGNA 2DT5A 3BJOA 3PFIA 4G7ZF 1HW2A 3I53A 4A6DA 1AOYA 1O7LA 1FYMA 2FXAA 3HHHA 2JSCA 2RQPA 1Z6RA 3KP7A 1IN4A 4KT5C 3GFLA 1WRJA 4IRGA 3TO6A 4WCGA 2A3SA 3BDDA 1ODDA 3FM5A 2DPUA 2AS5F 2XUBA 3SZTA 4BQAA 4LK0F 1G6NA 2XKPA 1RNLA 1YYVA 2L02A 3V8LA 2QQ9A 3HOSA 4KMUX 5D5UB 4G7OF 4Z2YA 5FLXZ 1FYKA 4OIOF 3HUGA 2F2EA 4A5MA 5DV5A 1PUEE 2MC3A 3F21A 1OKRA 1U5TA 1ZAOA 2M45A 2QENA 5FD6A 3GEZA 1STZA 4U0WA 3WTZA 3K2ZA 4LB6B 1ZH5A 1FOKA 2OQGA 4ESJA 5KK1A 5K1YA 1XMKA 4M9ZA 1DP7P 4WX9A 2WWYA 4OINF 2O3FA 2XIGA 1YS7A 5AONA 2VE9A 5DCMA 3HTSB 5CVRA 2YX7A 4CDGA 2OA4A 4G9YA 5HDNA 2V6CA 4FHTA 1ZRFA 1REPC 1ZLKA 3M8EA 4IRHA 1SMTA 4D0PA 2ZJ2A 4AIHA 4GCVA 2OZ6A 1S7OA 2QM3A 2RKHA 4UVCA 4UNOA 2RDPA 3F8MA 3K9TA 5FGMA 1T2KA 4RB2C 2R7DA 4F7ZA 1K7AA 2RN7A 2KIFA 5L3GA 2FMYA 2IA2A 4BHCA 4KN7X 2MA3A 2DU9A 2HTSA 5HLGA 3HIFA 4L9JA 4E70A 3HRUA 2Z3YA 3FMQA 4CICA 2IW5A 3GO5A 4KA4A 3M1EA 5DYMA 2IRFG 2HKOA 2PLYA 4KFCA 4CO8A 3WG9A 4A5NA 3CUOA 4HOBA 1P4AA 5EEGA 2NNNA 2IJLA 1GXPA 1U78A 1TNSA 4HLYA 2ESHA 1TBXA 2E1NA 2BV6A 2XAHA 5E8GA 2QUFA 1BI1A 2RGVA 1YW8A 1JXSA 3ECHA 5DDGA 4IHTA 3RPQA 4PGHA 5IT3A 3BOQA 2MH2A 4ZYHA 4MNUA 1Z91A 4MGRA 2FOKA 1BI2A 2GXGA 3J80Z 5BPIA 3EETA 1I6XA 2E7WA 1WWXA 1IAWA 2VT3A 1KQ9A 4HYEA 2VT2A 4RB3C 3WGHA 3LAJA 2VXZA 1JHFA 3C7JA 3HSEA 2O03A 4HQEA 1HBXG 3L7WA 1J59A 5L3BA 5TJJA 4M73A 4LB5A 1MJ9A 2FA5A 1B4AA 4AIJA 2F5DA 4PGGA 4CHUA 1F5TA 1Z9CA 1BBYA 2ETHA 3T5XA 2PG4A 3GFMA 2IVMA 1B6AA 1FP2A 2EK5A 2ZMEB 2FBKA 3D0SA 3KLOA 3NQOA 3M9AA 5JHUA 1YO5C 3BPXA 3ZN1A 3FX3A 2G7UA 4N0BA 4KMFA 5LBQA 3KP5A 3HRSA 3DV8A 2COMA 4G6DA 4HX8A 3B02A 3KP2A 4ZYDA 4UHTA 3GVAA 2KJBA 1K6OA 4S04A 4HLXA 1BJAA 1FSEA 4WF2A 2ISYA 4BHPA 2K4JA 2GA2A 2V1UA 3L09A 4MTEA 1KGSA 3DPLC 2DQRA 1IN5A 3F22A 3DP7A 1FWZA 4KDPA 2P8TA 1SD5A 2H6CA 5HVQC 4BH9A 4KICA 4EJVA 1ZN2A 4L18B 1QZYA 5LRSA 4HX4A 2EA2A 3LA3A 3KP6A 3TDZC 1F9NA 1ON2A 1HKSA 2DO7A 2H6BA 2IP2A 1HXDA 1OPCA 1MJAA 1L0OC 2UXNA 1TW3A 2B0LA 2DI3A 3VB2A 1PDNC 1XDUA 5E17F 3WU1B 3GLXA 3MAJA 1ZRDA 4EJOA 1PP7U 4RGSA 4M71A 4M9XA 2P6TA 2DLLA 5E1XA 1T39A 1BI3A 3WTTC 2G9WA 3KP4A 1XSVA 3S2WA 2HOEA 5D5WB 4XBFA 1IN8A 2A68F 2XAFA 2K27A 4HBLA 2KIMA 2QQBA 1OYWA 3HYIA 4HDUA 1KU9A 4BHBA 1IZ1A 5DUKA 4GO1A 1RUNA 1Z6TA 1J75A 3V7RA 4EM2A 2JT1A 4HW0A 2X0LA 2NS0A 3CJNA 2LF8A 4HA8A 2HYGD 3ZQ7A 2RVCA 5AIPA 2XROA 5A2QK 1TQMA 4QLCU 4IRIA 2NNYA 3Q9VA 1UFMA 1MGTA 1D8KA 1I1GA 4R1HA 4GXOA 1E17A 1YW9A 4LJZF 4R79A 3HOTA 1QPMA 3D5LA 5FO5A 2OU2A 1U5TC 2RV8A 3SXYA 3V7CA 3TOAA 4OMYA 1UHMA 1BC8C 3P9IA 1S6LA 2F5EA 4UVBA 2V9VA 4KUMA 4N9HA 3QU6A 2XV4S 4CYDA 4EMSA 5DCFA 5H6RA 1HKQA 2QVOA 1DDNA 3P9CA 1ZGAA 3K1NA 4O5VA 3QPTA 1MZBA 4I01A 5F64A 2LNBA 1ZRCA 1LEBA 4ZZLA 3WTUC 3FMSA 3ABUA 1KA8A 3GUDA 4JK1X 3GZ6A 1OR7A 1MDMA 3FWEA 1YW7A 4AIKA 3DKWA 1L3LA 4H0EA 2XAGA 2CYYA 1QNTA 3M7GA 3F6OA 3RYPA 3I71A 2M5WA 3IRRA 2FU4A 2RC4A 2F5CA 2VBXA 3IHUA 2Y48A 2L4MA 4ENKA 3V8JA 1EH6A 3HTUA 3IWFA 3EQLF 2W25A 1FX7A 1P4XA 2M87A 1K78A 4MQVA 2EB7A 1TQPA 1HW1A 2P7CB 2P4WA 3QRFF 4NQWA 1O3QA 1J2XA 3ZPLA 5LGUA 2ZKZA 3K1PA 4L0ZB 5H6QA 3F6VA 4L5IA 1BIAA 3OV8A 1R00A 4EM1A 1GHCA 2J5OA 1JE8A 2JTVA 2BYVE 4L0YB 1SFEA 3IRQA 1R7JA 4WWCA 2P5LC 5ILSA 4U88A 2X4HA 3HRMA 4TV7A 2UZKA 2ZBKA 4XLNF 3ROUA 2VBWA 1J0RA 2L4AA 1UHWA 4EV0A 5IT9K 3V8KA 5HS7A 2QBYA 1KYWA 2FRHA 2Y0MA 1LJ9A 5H20A 5LRRA 3R4KA 3J7AO 1HSJA 3LA7A 4IPAA 5E8IA 2IT0A 4BXUA 3P7NA 3FXRA 1U8RA 5LLQA 2GAUA 1RIOH 5CVUA 1R22A 3W6KB 1G3WA 2PFBA 1W7PD 3TGNA 3BP8A 3WGGA 4OMZA 2O8XA 1EH7A 2CWEA 3BWGA 1H0MA 1V3FA 3BJAA 1W4MA 2QZ8A 5J8CA 4RS8A 2HS5A 3F8FA 2OQRA 2OD5A 4I2OA 3KP3A 4U0VA 2O0YA 4EJWA 3J81K 3F23A 1FBQA 5FD5A 3HRTA 4OU0A 4P96A 3BZ6A 4HZFA 1ZLJA 4I0AA 4FX0A 3MQ0A 3NRVA 2PBIA 2BE5F 2VBYA 3GW2A 1UCRA 2IA0A 3RJPA 1IF1A 3RKWA 3K69A 3F8NA 4ZYGA 4A0YA 3T1BA 4YG2F 1IXCA 2ELHA 3FHZA 1WQ2A 2GWRA 1LQ1A 2FQ3A 4XLPF 3T0YA 2HWVA 2O6GE 2DAOA 4LK1F 3TKYA 3WODF 3Q5FA 4EJTA 4NB5A 2K86A 2MD5A 1W7PB 1ULYA 1TLHB 2HTJA 4L9NA 1FSHA 3I59B 3GFIA 4PZJA 1KQ8A 2EJRA 1SD7A 5D4SA 1S3JA 5ILVA 5D5XB 2LDUA 3I4PA 2DW4A 1EV7A 2CO5A 3F72A 1YLFA 2STTA 3JW4A 2PJPA 2JPBA 1QBJA 2G7HA 4LFUA 1T6SA 2HQRA 2XKOA 5JR3A 1X3UA 1O3TA 2EWNA 1D8JA 4OIRF 5BS6A 1R58A 2ESNA 3E6CC 2V1DA 3RIRA 4MEYF 2YX4A 2FE3A 2LSOA 3COAC 3DF8A 3N97A 2W84A 3ISPA 2VC0A 5HDKA 2KRFA 4N9IA 3E97A 2CQKA 3DQVC 1SAXA 1LEAA 1D3YA 2STWA 5LHGA 4MQ9F 2YU3A 3I58A 1NHAA 1TQIA 5EEHA 1XGNA 1C0WA 5CJ9A 2HR3A 1KYZA 4ESFA 2DTRA 1O3RA 1K79A 5KVRA 3E5XA 3QP6A 1LDJA 3BPVA 1I5ZA 5AIQA 3FF5A 4HF1A 2VN2A 2WC2A 5CVVA 3W6JB 1BIBA 4ZH4F 3EYYA 2HFHA 3L2CA 1DUXC 4O3MA 1YG2A 3C18A 1MKMA 3RKYA 4I0BA 5JI6A 5ICCA 3G3ZA 3MWMA 4ESBA 3IL2A 1J9IA 3RKXA 1U2WA 1LVAA 3JSPA 4CXFA 4RAYA 1KU3A 3P9KA 1I1SA 2IPQX 4Y15A 4PCQA 1QO0D 2Z5UA 4M6XA 3VEPA 2KKOA 3RI4A 4HF0A 2R7FA 4Y17A 3H3UA 4EGZA 3CUQB 2Z33A 2HQNA 1ZG5A 5DD4A 3IKVA 1U6GA 3QU3A 5LEKA 1XGOA 3DXJF 2QQAA 2MLGA 4OOIA 3CLOA 2TDXA 5ED4A 2JRTA 2YSRA 4AVPA 3HHGA 3MCZA 1FY7A 3KFWX 2JPCA 4FT8A 2A69F 1MD0A 2Q8KA 1ZG1A 3HSFA 3ML6A 2GZWA 3E6BA 5HLIA 4M72A 3ZMZA 1YIOA 4A0XA 1P92A 3RPUA 3R61A 1HQCA 4B09A 3WU0A 3CO6C 2PEXA 3O6BB 1O7FA 3CO7C 3JAMK 2Q2EA 4UVAA 3N4MA 3TOBA 4YFKF 2BGCA 1KU2A 1U5TB 3ZMDA 1BOAA 2PN6A 5LHHA 1A04A 4Q47A 1JGSA 2FEZA 4GYGA 3IWZA 3O2PE 4MTDA 2EA4A 2OBPA 4P9UA 2FBHA 4AD9A 1XN7A 3SZPA 2ISZA 2JZYA 1SMYF 5DCMB 4G6QA 4RB0A 4ENNA 3ABTA 3WTYC 2VOOA 3HSRA 1YQAA 2W24A 2RNJA 2AXLA 3R60A 4R8HA 4KNYA 3PQKA 2VOPA 2DFIA 4B8XA 4WXCA 2V79A 5HLHA 3IC7A 5J8FA 1ZREA 1I27A 1IRGA 5BQTA 2ACJA 5L3FA 5K5QA 5K5OA 4ZZDA 5FLXK 2ZO4A 2GQQA 2R3SA 3JTGA 2OZUA 1O57A 4KIBA 3G73A 1WKMA 3JTHA 5F6FA 4PDKA 2ZNYA 2NRAC 3VFZA 3WTSC 5FFXA 1HW5A 2PI0A 3E6DA 4I7HA 4LLGF 3WTWC 1R1UA 3R0JA 5JFRA 3T8RA 1P4WA 4DQ2A 2XASA 1XB4A 1XMAA 4ZYEA 4JQFA 1SD6A 1S8NA 2HZTA 3I54A 5E18F 4IJAA 1G3SA 3B73A 3M8FA 5L3EA 2DBBA 3MZHA 1H9GA 2BEOA 3BJ6A 4KIGA 2QWWA 4Q48A 2XAJA 4A0ZA 1FP1D 5D4RA 4CGZA 3GX4X 1O3SA 1OYIA 3FXUA 1MJBA 2XGXA 4CZZA 2L3DA 1FYLA 2ZMEA 1FLIA 2PMUA 4FX4A 2GA1A 4HAMA 3DFGA 1GVJA 3OOPA 1OMIA 1Z05A 5LGTA 4KIFA 1IXSB 4IF4A 3WGIA 3ZN0A 2WV0A 3EUHA 3K1MA 2HEOA 1FZPB 3AAFA 3FM3A 4LGWA 2ZNZA 2MBFA 1HSTA 2H94A 4P9FA 1KQ0A 4XSXF 4HV6A 4L9VA 3RYRA 4M74A 2HKXA 3CUQA 3FMRA 1LDKB 5A2QZ 1ZGJA 2KJCA 2H27A 4LLLA 4YIIA 1FBSA 5ERIA 2WTEA 5ICEA 3GWZA 1R5GA 1TTYA 5LHIA 1EH8A 4IVNA 3QPHA 2FF4A 5LEJA 1ZARA 1FC3A 1G4DA 2YPRA 4M9SA 2ADUA 2D1VA 2A07F 2O61A 3ZMVA 1V4RA 1OYYA 1USTA 1R5HA 3J80K 5BPDA 4WXHA 4AWXB 2ZXJA 4Y13A 2NYXA 5J6XA 4YFNF 2CGPA 6PAXA 1G3YA 1CGPA 3MFKA 2L54A 3KZYA 5E1ZB 1AWCA 3LA2A 3TO9A 1YFHA 3PQJA 2H09A 3SHFA 1YTYA 3E5QA 1J7KA 1XGMA 4ASNA 1RI7A 4XSZF 3GXOA 4JBAA 2VONA 1S7AA 1Z7UA 2MH9A 3BROA 1W5TA 3LQQA 1UB9A 1RUOA 2DQLA 1XGSA 2VBZA 3ZMUA 5DD8A 2XRNA 1QZZA 1BM9A 2A5YB 2NAZA 4MHGA 1XSDA 3V7SA 5D8KB 2DK8A 4K2EA 1QQIA 1SFXA 3T8TA 3RDIA 3ZMSA 4G8XA 2DK5A 2CFXA 3BY6A 4BAYA 5FB2A 2ZFWA 3K0LA 4IXAA 2V1XA 5CYVA 2PQ8A 1B1BA 3FXQA 4BYYA 2W85A 2EFWA 2UWMA 2A6HF 2CG4A 2GIVA 5L3DA 2HDCA 5HS9A 2A6EF 3L9FA 1D5VA 3H3ZA 2VC1A 3RTRA 2M8EA 4Q4ZF 2XHKA 4RGRA 4A6EA 1ON1A 1T38A 2QYOA 1LB2A 3GZ5A 5IT9Z 2K4BA 4RGUA 4EGYA 4WXDA 3WE3A 3NEUA 3VOEA 4EM0B 1BN5A 1XDSA 2E1CA 1FT9A 3F8BA 3LQRA 2BBYA 2HYFA
chains in the Genus database with same CATH superfamily
2XPWA 1PP8F 2ZXIA 2GBYA 3V42A 4Q5SF 3LFKA 2VODA 2IS2A 1ZQ3P 1ORKA 3ZMTA 3OYDA 1POGA 3MEXA 2DTZA 2MABA 2IBDA 2FNAA 5F08A 1R5ID 2L01A 2EFPA 5DEQA 4XK4A 4ZC3A 4NC6A 1OISA 2OC6A 3I0TA 4P55A 4X1EA 1VQ6I 1RZ4A 3GFJA 3QOPA 3QPSA 3LSRA 2EILH 4EQQA 1VTNC 3HEFA 1MDMB 3FZVA 2WBMA 5ICGA 1I50J 2M7AA 2KDZA 4A12A 1JUSA 3WHCA 1P6RA 1R4MB 5CQEA 2R0QC 5E1WA 1A36A 1X19A 1SD4A 3HM5A 2O8KA 4L5EA 1R23A 1D0XA 2EV6A 3NWSA 2Z9OA 3H0DA 2LTPA 1OCPA 2VE8A 3J81Z 2A61A 2P5VA 1TW2A 2Y75A 1OFCX 3H1CA 3C3WA 2EV5A 3VYUB 1FPQA 3ONQA 5D8LB 3U9GA 4XLEA 4IOCF 2P6SA 4P5OA 3ULQB 4XRMA 5DS9A 1NH3A 5FFZA 1DQUA 2YR2A 2WAFA 1OQYA 2R5YA 4L5JA 1YJWI 2DA4A 2DMTA 1WZ2A 3L1PA 2LLKA 2N8GA 4YIFA 4HQMA 3ZXSA 1B9NA 1CF7B 2X6WA 4U0YA 1F4KA 3WTXC 1ONVA 4CSWA 4LG0B 3ERED 2EZLA 4ANJA 1IW7F 3O3KA 1S29A 1K78B 1JT6A 4PJMA 5ILUA 1VQ5I 4ENMA 4XKCA 5JVGF 4LD5A 5BMZA 2P81A 2DPDA 4DYRA 2K7LA 3IH4A 2V26A 3Q0VA 2DA6A 1ZKGA 3OYFA 3BR1A 2XVCA 4ABZA 4E7JA 1O4XA 2NVTJ 1XCBA 2HDWA 3ZCOA 4XORA 1OCCH 1ZG3A 3L00A 5EF6A 4XKVA 4AC0A 1V5GA 4B47A 2KIUA 5GPAA 1SFUA 1PJRA 2ECBA 3Q9SA 3G6EI 2HGCA 3DEUA 5HOOA 4NHJA 2EFQA 1QGPA 2ZMEC 2P0WA 3X2QH 1UELB 2J5PA 4A3MJ 3HOVJ 2R5ZA 1Y8QB 1XCVA 2VPRA 1QPIA 3W3CA 1BC7C 3W6VA 3LAPA 1I6HJ 4HDVA 1XD7A 1Q1HA 1RR7A 2EZHA 4Y3OA 1KU7A 1VI0A 3V4GA 1HLVA 4XRSG 4CZCA 3REOA 3OYNA 3KCCA 3OS0A 3A03A 1ETXA 1Z77A 3LSTA 4LLNA 2V1NA 4RB1A 3QAHA 3QP5A 4I98B 3KEOA 2NOJB 3EUHC 4WK8F 4ENJA 3IKTA 3SFZA 3QODA 1T33A 2KDOA 1TNTA 2L7MP 4LMYA 4OIPF 3WE2A 3Q0UA 5L3CA 1IUYA 2LR8A 1XSXA 2JK3A 4P1WA 4DZPA 2QBYB 4PJJA 3IAS2 1IRFA 4G7HF 4D5CA 3JSOA 4KITB 5J1YA 4W1UA 2WA0A 4CCJA 2EFNA 4NDLA 4A2UA 2QLZA 3A0BC 3MZYA 4HV5A 3HUGB 3IUOA 3OYAA 5HDGA 1R49A 3ECOA 2R7RA 2CJJA 1JHHA 3C1DA 3CUQC 3U1DA 3MD2A 2FQ4A 1ZHFA 2FNPA 2CQXA 2K3PA 4HF2A 4EATA 2XAQA 4MEXF 5J1RA 2UXXA 3EPZA 3BR3A 3KZZA 2JUCA 1R36A 1LPQA 3LL7A 4I02A 3R6SA 1IV6A 3A01B 1JTXA 3H92A 1DPUA 2FSWA 3IV5A 2Q0OA 1R1TA 3EUAA 1WPKA 5C4XJ 2EV0A 3LSHA 4I09A 2D45A 2E5ZA 1IG7A 1W7PA 2E60A 3CZ6A 1TT5B 1ENHA 2P7VB 3I59A 4G94A 3KYDB 4E7KA 3GF2A 4O6JA 5E20A 1MBFA 1HOMA 1FBUA 4ETSA 4S05A 3RKQA 1GLNA 3BR2A 4DJAA 1ETYA 2ZSHB 2B63J 1SVMA 3FXJA 4F55A 4XRFA 2M1BA 5K5RA 4UV8A 2ZC2A 1EJ9A 5LFAA 1F1ZA 5D6FA 3KETA 4L9TA 2ZCWA 2EZIA 5HS8A 1T98A 3CTAA 3E3VA 4U7DA 3KE2A 4ZDLA 2OAZA 2P5KA 3ZQGA 2GXBA 1E2XA 3RQIA 4GGGA 3CCYA 2E2JJ 1MNEA 3TDUC 3WHBA 4KYWA 1IN7A 3A2KA 2KRCA 1WI9A 2DYSH 1Y0UA 5CLSA 3F8CA 3JRDA 1W5SA 3F3XA 4EJUA 1PUFA 2EINH 3A4CA 3ASNH 5J40A 1Y56A 3JREA 2KT0A 3UR3C 1U3EM 3ELKA 3K4JA 2HVSA 2L5QA 2LF7A 4FISA 2EFOA 2W57A 3I9V2 5TGTA 3D1NI 2DXIA 3HZJA 3SQNA 2HVQA 2QSGX 2D2WA 3E0JB 5BOXA 3TBIA 4M6YA 5ICFA 2R7XA 2XSDC 1H89C 2W1OA 3FBNB 3CDLA 5CVIA 1HKTA 4IHSA 1IXRC 3O8GA 5J4YA 4D7MA 1LNWA 3UKGA 4RDUA 2ZB9A 3EDPA 5CVJA 1G3TA 1WCMJ 4QPQA 2C6YA 3S2DJ 3KLNA 3GTKJ 2ELJA 2M30A 3RQ4A 3LFUA 3TQNA 4YFXF 3SDBA 5JVTA 1B59A 4KN4X 1USSA 1IO2A 5D5VB 4I76A 3OIOA 3TO7A 2IA1A 3SEQA 2Z99A 2I10A 3I5UA 2B9SA 3CJTB 5J3LA 5IYDJ 4DNCA 4UUVA 2E7XA 2DA1A 3PSFA 3ESWB 3J7ZI 2JUGA 2M0MA 3KEQA 4FE4A 3DLAA 5FRMA 4BE0A 4ON0A 3G4SI 3EYIA 2F5FA 4HX7A 4RAZA 2O5RA 4ZYAA 1N25A 2FBIA 3E5UA 4XLCA 1H9TA 5F1RA 2CSOA 2EQRA 4BNCA 3G2BA 2W00A 4OIQF 1BL0A 3LWFA 1FMVA 1Z3XA 1P2FA 4EVIA 2PMHA 4BUPA 1ZR4A 3R0AA 1IN6A 4QWQA 2OPTA 3SYTA 4UV9A 4U7BA 4A3BJ 1B9MA 2LKPA 3GYHX 1QHGA 3HGYA 2HU9A 5BNGA 1V55H 1DPRA 2A05A 5FKNA 2JVHA 2NS7A 2CV1A 3DPTA 2FMLA 1BI0A 4DZJA 3K4LA 1GXQA 3I64A 3M8JA 1A31A 4XNFA 1FNNA 2ME6A 3FKJA 2AQFA 4RLFA 5TRDA 1YS6A 5DM6F 1Z1DA 1TP4A 2Y69H 2CW0F 3E6MA 1JI8A 3U2RA 3IP4B 4CYCB 1SFKA 2JSPA 3WTVC 1HA8A 3OYLA 2VJIA 3BCAA 1T0FA 2HI3A 2V9KA 4UXNA 1LDDA 3CDHA 2MLKA 1CF7A 2K02A 2V4JC 1ZTRA 3PO3J 1FOXA 2LY2A 3MMYB 3TP3A 3JAMZ 1J5YA 1ETKA 2BXZA 1K6YA 1ZYRF 2WY8Q 4DIQA 5C4JJ 4LG0A 1R1VA 3HJEA 3BG9A 3D5SC 1WSUA 5D6EA 2D1HA 5DUIA 3ZP5A 4GYIA 4RGXA 3VODA 2CW8A 3DKYA 1OCTC 2R7OA 2G0EA 5LGNA 2DT5A 3BJOA 3PFIA 4IZZA 2OUMA 4G7ZF 1HW2A 3BTLA 2CH0A 3GBGA 2M4KA 3I53A 5CKTA 3ABMH 4A6DA 1VQKI 3QYEA 2IEKA 1LE8A 1AOYA 1O7LA 1FYMA 2FXAA 3HHHA 2JSCA 1R4NB 3BR0A 5HODA 2RQPA 3G1OA 1Z6RA 3KP7A 1IN4A 3OYIA 3DPUA 2JA6J 4A3GJ 2X1EA 4KT5C 3PM1A 4BBRJ 3GFLA 1WRJA 4JOMA 4IRGA 3TO6A 5KNLA 3CD6I 3BR5A 3M1CA 4E6KG 4WCGA 2M8GX 2MW8A 2A3SA 3KEYA 2K5CA 2OTJI 3AKZA 3BDDA 3LSGA 4AIDA 1B72B 1ODDA 3FM5A 2DPUA 3SJMA 2AS5F 2XUBA 3SZTA 2LG4A 4BQAA 4LK0F 2TRTA 2LYCA 5EDNA 2VASA 1G6NA 2YU9J 1MNDA 2XKPA 3C2GA 4BQOA 1RNLA 3MKWB 1YYVA 4E7LA 1YE9A 2L02A 3V8LA 2QQ9A 3VYTB 3C2BA 4BXXJ 1DGRM 3HOSA 3K4NA 4Y7NJ 2VQHA 1I3QJ 4B43A 2X51A 4KMUX 3MKLA 5FJ8J 1VQOI 1IRZA 5D5UB 4UUSA 4C2MJ 1PVEA 4G7OF 3GCMA 4Z2YA 2DOFA 5FLXZ 1X2NA 2V9PA 1FYKA 1X4PA 4OIOF 1MMSA 4M3EA 1AHDP 3HUGA 2F2EA 3J7AY 2ZSIB 4NC7A 3TL4X 3CC2I 3DKXA 4A5MA 5DV5A 1KZHA 1PUEE 2MC3A 4MO7A 1TT0A 2M4GA 1YJNI 3F21A 1OKRA 1U5TA 1P7JA 1Z67A 2IAIA 5IOZA 1ZAOA 2M45A 2QENA 2JA5J 5FD6A 3GEZA 2QKLB 1STZA 2BW3B 4U0WA 3WTZA 3K2ZA 4LB6B 1ZH5A 1MMNA 3U21A 2KZVA 1FOKA 1AKHB 2OQGA 1FOYA 2GOMA 4PFPA 4ZDPA 4ESJA 5KK1A 1W36C 1SVLA 5K1YA 1FTZA 1XMKA 4M9ZA 1DP7P 4WX9A 3VYRB 5E3MA 2WWYA 1ZELA 2CFOA 4OINF 2O3FA 2XIGA 1YS7A 4DYQA 5AONA 2L7KA 2VE9A 2K3FA 5DCMA 1P9QC 1I39A 5IP9J 3HTSB 1G59A 5CVRA 2YX7A 3OSFA 4CDGA 3PIOF 4G6TB 3OWTA 2D5VA 1W0UA 4IQJA 2OA4A 4G9YA 5HDNA 1BA5A 2V6CA 4FHTA 4CCKA 1ZRFA 1REPC 1ZLKA 4A3IJ 3M8EA 1TZLA 4IRHA 3OS1A 1SMTA 2OV7A 2ZJ2A 4AIHA 4GCVA 4D0PA 2OZ6A 2AHQA 3C2HA 2QF7A 1S7OA 4A3FJ 1HC8A 2VI6A 2QM3A 2RKHA 2AO9A 4UVCA 2LMDA 2RDPA 4UNOA 3F8MA 2DJIA 1WJEA 3K9TA 5FGMA 1K4TA 3S14J 5F0HA 1T2KA 1MIJA 2RNGA 4RB2C 2R7DA 4F7ZA 1Y6IA 2MG4A 1FIPA 1K7AA 2Q2EB 1TWAJ 2RN7A 2GLOA 2KIFA 5L3GA 1YHQI 2FMYA 2IA2A 4BHCA 2XB5A 4KN7X 2MA3A 2DU9A 2HTSA 2FOWA 3HC7A 3HIFA 4L9JA 5B3SH 5HLGA 3TEDA 1U8BA 4E70A 3HRUA 2Z3YA 4JX6A 3FMQA 4CICA 1OJLA 2IW5A 4II2A 3GO5A 2DA7A 4KA4A 3M1EA 5DYMA 2IRFG 2HKOA 2PLYA 4KFCA 1Y0NA 1QA6A 3ABKH 3WG9A 4CO8A 3AG3H 4A5NA 4BQNA 5EJCA 3CUOA 4HOBA 3CCQI 4IKFA 2VXDA 3GLLA 1TWFJ 4E4HA 1P4AA 5B5EC 2CV0A 4PJNA 5EEGA 4QIWN 2NNNA 2IJLA 1GXPA 2Z16A 3HB9A 1E3HA 1U78A 1H8AC 1TNSA 4HLYA 2ESHA 3FXLA 1WJCA 5JHFA 1TBXA 2HNHA 2E1NA 2DFEA 2BV6A 2MSYA 2XAHA 3CCLI 5E8GA 1RRJA 2QUFA 1BI1A 3K6GA 2R7VA 2RGVA 5H2FC 1YW8A 2BVLA 1Z21A 3ECHA 2PJRB 1JXSA 2K9QA 5DDGA 4IHTA 4M3DA 2K9MA 4PGHA 3RPQA 5IT3A 3BOQA 1Y1VJ 2MH2A 4ZYHA 4MNUA 1LUJB 1Z91A 2R4GA 5IOYA 2DA5A 4MGRA 4NC8A 4FE7A 1N75A 4B3XA 4H4KC 4RA2A 2FOKA 1BI2A 2GXGA 3J80Z 5FRNA 5BPIA 3EETA 4LOCA 2NVXJ 2LD5A 1SAUA 1I6XA 2E7WA 4BDYA 1B8IB 2HYJA 4HSRA 1WWXA 3H5NA 4F52A 1IAWA 1X1CA 3CESA 3I56I 2JA7J 2VT3A 3CC4I 1KQ9A 4HYEA 2E1MC 2VT2A 5GAGJ 4CCOA 4RB3C 2M3AA 3TW6A 3WGHA 3LAJA 2VXZA 1W1WE 1HF0A 3RCOA 1CQTA 1JHFA 3PNYA 2K9LA 3C7JA 3HPGA 1K4SA 1LFBA 3HSEA 3WU2C 2O03A 4HQEA 1HBXG 2DMQA 4ZTJA 3P5JA 3L7WA 1J59A 5L3BA 5TJJA 2IXSA 1SEUA 1JT0A 3CF2A 2H1KA 4M73A 4LB5A 1V5FA 1MJ9A 2H8WA 2FA5A 3JRAA 1B4AA 4AIJA 3OSGA 1IUFA 3B6CA 2F5DA 3G71I 4PGGA 4CHUA 4RMNA 4CCMA 4FETA 3L2UA 2JWTA 4BDZA 4BY1J 1F5TA 1Z0XA 4RLQA 4CA0A 1Z9CA 3DWLE 1BBYA 4BL0B 3JCUC 4JX4A 2MYSA 1RPWA 2DYRH 1LFUP 3GTQJ 4V19K 2ETHA 3T5XA 2F4OB 3S93A 2F48A 2PG4A 3GFMA 2IVMA 2FJ1A 1B6AA 1FP2A 2WY7Q 2EK5A 4XOPA 1ETQA 3PIPF 2ZMEB 2FBKA 1MNMC 3D0SA 2LREA 3KLOA 4XKBA 3NQOA 3M9AA 5JHUA 1Y8RB 4PSWA 1YO5C 1U0JA 1JKRC 2B7EA 3BPXA 3ZN1A 1XPXA 3FX3A 2G7UA 4N0BA 4KMFA 5LBQA 4NQWB 3KP5A 4B44A 3I4NJ 3HRSA 3DV8A 1MSFC 1S5LC 3S3OA 1T08B 2COMA 4G6DA 4HX8A 3B02A 3KP2A 4M3GA 2L2OA 2QCOA 3G1LA 4ZYDA 1AU7A 2VJ5A 4UHTA 3GVAA 4BU2A 2O7OA 2KJBA 1K6OA 4S04A 4HLXA 1BJAA 4ZTFA 2NXNB 1FSEA 4WF2A 2ISYA 1YRNA 1WH7A 4BHPA 2K4JA 2GA2A 2R7UA 2V1UA 3L09A 4MTEA 3H9QA 1KGSA 4RAFA 3OYGA 1UAAA 3DPLC 2A6TA 2DQRA 3G1MA 1IN5A 1HDDC 5EEAA 3F22A 2F4IA 1ETWA 3DP7A 1FWZA 2DFHA 4KDPA 2P8TA 1SD5A 2H6CA 1GVDA 1LVKA 1T0FC 5HVQC 1NG6A 1Q1VA 3DBHB 4BH9A 4KICA 3I55I 4EJVA 2PMZA 2TCTA 2HPMA 1ZN2A 4B4CA 1QZYA 5LRSA 1AKHA 4L18B 4HX4A 2JA8J 2EA2A 3LA3A 3KP6A 3TDZC 1F9NA 1ON2A 1HKSA 2DO7A 2H6BA 5DTDA 2IP2A 4C9YA 2BZTA 1HXDA 1OPCA 1MJAA 1DGWY 1L0OC 2FUG2 2UXNA 3PNTA 1TW3A 2B0LA 2DI3A 3VB2A 1PDNC 1XDUA 5E17F 3WU1B 1XS9A 3GLXA 3MAJA 2VJJA 4X6AJ 3S1NJ 4E7IA 1ZRDA 5DM7F 3CCVI 4YEJA 4EJOA 1PP7U 4IHWA 4RGSA 4M71A 4M9XA 3VSKA 2P6TA 2DLLA 3H36A 5E1XA 1T39A 3IH2A 4PSXA 1BI3A 1G8XA 3WTTC 2G9WA 3QPLA 3KP4A 4IHVA 2YS9A 1XSVA 3S2WA 2HOEA 2DMPA 1GT0C 3WG7H 5KCMA 5D5WB 1KONA 4XBFA 2ZJRF 1IN8A 1JUPA 4XKWA 2A68F 5EZHA 2XAFA 2K27A 1SC7A 4HBLA 4RBOA 2KIMA 2QQBA 5EGOB 1OYWA 3HYIA 4HDUA 1D5YA 1KU9A 4BHBA 4I6ZA 1IZ1A 4YELA 5DUKA 3FBIB 1Y39A 4GO1A 1RUNA 1Z6TA 4BBSJ 4YIRX 1J75A 1WJFA 2CQQA 3V7RA 4EM2A 4HG2A 2JT1A 2L9SA 3BG5A 1X4OA 3OIPA 4HW0A 3L2WA 2KISA 2X0LA 3GZNB 2NS0A 3CJNA 2LF8A 5M5WJ 4HA8A 1T8IA 3MVPA 2HYGD 3HOZJ 3ZQ7A 2RVCA 5AIPA 2XROA 1YI2I 1X1BA 5A2QK 1XC5A 1BOBA 1TQMA 3MN2A 3E1SA 4QLCU 4IRIA 2NNYA 3Q9VA 3HL2A 2L7FP 3L2VA 3VDXA 1UFMA 1MGTA 2ZJPF 1D8KA 1R9TJ 3OL4A 1I1GA 1JUMA 4GXOA 1ETVA 4R1HA 4J01A 2CUJA 1E17A 1YW9A 4MLOA 5E3NA 2W7NA 2IS4A 4LJZF 4R79A 3HOTA 1QPMA 1EKEA 3QYFA 3SDGA 3D5LA 5FO5A 3W2VA 2OU2A 2VKEA 1U5TC 3LOCA 2RV8A 3SXYA 1DU6A 4CUGA 1N77A 3V7CA 1K83J 3TOAA 4OMYA 4UY8I 3QWLA 1UHMA 1BC8C 3P9IA 1S6LA 2F5EA 4UVBA 2V9VA 1E3OC 2DMNA 4KUMA 4N9HA 2LKXA 3QU6A 1ETOA 4MFDA 2VB6A 2XB0X 2XV4S 1D1AA 4CYDA 1HDPA 1D1CA 4EMSA 1VQLI 5DCFA 5H6RA 1HKQA 2QVOA 3HXLA 2VQLA 1APLC 4AU7A 2KP6A 3P9CA 1DDNA 2LBFB 1ZGAA 3K1NA 4O5VA 3QPTA 1MZBA 4I01A 1A35A 5F64A 2A5WA 3VYSB 2LNBA 4PUSA 1ZRCA 1LEBA 4ZZLA 3WTUC 2E2HJ 3CP2A 3FMSA 3ABUA 1KA8A 3I3LA 3PNVA 1XTAA 5M5XJ 3RSNA 1U9OA 3GUDA 1BJZA 2PMZN 4JK1X 2KFDA 3GZ6A 3K7AJ 1OR7A 1UHSA 3MKZA 4J00A 3HDDA 3FXKA 1MDMA 4XLHA 3FWEA 5GAHJ 2WV1A 1OCRH 1YW7A 4AIKA 3DKWA 5F0FA 2JN6A 1GUUA 2VUMJ 1L3LA 2BY1A 4H0EA 2HOSA 4CH7A 4S0HB 2XAGA 2CYYA 1QNTA 3M7GA 3H9JA 3H3VK 3F6OA 4E7SA 3S1MJ 3F9KA 4ZDOA 5E79C 3HOUJ 1JTYA 3RYPA 3I71A 2M5WA 3IRRA 3PFYA 2QKMB 2FU4A 2RC4A 2F5CA 2VBXA 2X1DA 3AL0C 3IHUA 2Y48A 5GTIC 3S1RJ 2L4MA 4ENKA 4IO9F 3V8JA 1EH6A 2L9NA 3HTUA 3IWFA 3GTMJ 2FD5A 2Y30A 3EQLF 3ZRGA 1S9HA 4DGWB 3SFIA 2W25A 1FX7A 1P4XA 4UB8C 1YOVB 3OOUA 2M87A 3BG7A 5IPAA 1K78A 4MQVA 5LD2C 2KIQA 2EB7A 1TQPA 1HW1A 2P7CB 2P4WA 3QRFF 4NQWA 2JMWA 1O3QA 4XM3A 2LY9A 2KL4A 3E7LA 2MC4A 1J2XA 3ZPLA 5LGUA 2ZKZA 2Y31A 3K1PA 4L0ZB 5H6QA 1XG1A 3F6VA 4L5IA 1BIAA 3OV8A 1ZGWA 1R00A 4EM1A 2ID3A 1GHCA 3H5RA 4XN0A 3ZQFA 2J5OA 3BTCA 1JE8A 2Z2SB 2JTVA 1FEXA 2BYVE 1RETA 4M3FA 4L0YB 1SFEA 2Y9ZA 5IY5H 1TWGJ 5B1AH 3IRQA 3MKYB 1R7JA 3HBLA 3JR9A 5B66C 3JRHA 2Q1ZB 1R71A 4WWCA 2P5LC 5ILSA 4U88A 2X4HA 1QU3A 3HRMA 4TV7A 4LITA 4A3DJ 1F43A 3K4CA 4Z6YA 2K40A 3BG6A 3NWTA 2UZKA 2ZBKA 2L9RA 4XLNF 4PK4A 3ROUA 2VBWA 2LOOA 1J0RA 2F4MB 2R5YB 4N4NB 2L4AA 3BQZA 2Y0SA 5KAFC 2ELKA 1UHWA 2ECCA 4EV0A 5IT9K 5IYBJ 2HOAA 3V8KA 3RPUD 5HS7A 2QBYA 1RKTA 1KYWA 1VQPI 2FRHA 2Y0MA 1YJ9I 1NK3P 1LJ9A 1XMXA 3GTOJ 2BHZA 5H20A 3R4KA 5LRRA 3J7AO 1HSJA 4NNJA 4C3IJ 3LA7A 4IPAA 2CQNA 5E8IA 5J47A 2IT0A 1WH5A 2COBA 4BXUA 2R7ZJ 5K7FA 5E3LA 1IDYA 1E0EA 3PO2J 3P7NA 4CCLA 3FXRA 1BR1A 1U8RA 5LLQA 2GAUA 1RIOH 2DOAA 5CVUA 2EBIA 2RAEA 2UV1A 2L0KA 1R22A 4A3EJ 4U87A 3W6KB 3DBRB 1G3WA 3ABLH 4UUTA 1NG7A 3HKZA 2PFBA 3OYKA 4FCYA 2BY3A 3ZQQA 3I4MJ 3A01A 1W7PD 3TGNA 3BP8A 2DN0A 3WGGA 3HOWJ 2HVRA 4IOAF 4OMZA 1QZEA 4QSHA 1YX5A 2O8XA 4E7ZA 1VQ4I 1EH7A 4XLFA 2CWEA 3CCUI 3BWGA 3TMOA 1H0MA 1V3FA 5E3OA 3K70C 2LY1A 2LVSA 1OLTA 3BJAA 3H0GJ 3OL3A 5M3MJ 1W4MA 2QZ8A 3HPHA 4C3HJ 1TL8A 5J8CA 1MSEC 1X1AA 4RS8A 3K4KA 2HS5A 3F8FA 3DLLF 2OQRA 2OD5A 3IH3A 1MMDA 4I2OA 3KP3A 1MBHA 4U0VA 2O0YA 4EJWA 3J81K 1H88C 3AG1H 1FBQA 3F23A 3S15J 4MFEA 5FD5A 1WJDA 3N05A 3RZDJ 3HRTA 4OU0A 4P96A 3BZ6A 4HZFA 1VF9A 1ZLJA 4I0AA 2XGEA 3BTIA 2DDAA 2EZKA 3MQ0A 4FX0A 3NRVA 2DFFA 2PBIA 2BE5F 2VBYA 3GW2A 1UCRA 2IA0A 3RJPA 1IF1A 1BW5A 3RKWA 3K69A 3F8NA 2DT7B 4ZYGA 2VQCA 1RKWA 4A0YA 3T1BA 2ZXHA 4YG2F 3ZQLA 1IXCA 1J09A 5J1UA 4HEA2 2ELHA 5GADJ 2HPIA 3FHZA 1WQ2A 2E19A 3OIQA 3CJQB 5EG0B 4GFBA 2GWRA 1LQ1A 2FQ3A 4RAGA 3T0YA 2HWVA 4XLPF 2O6GE 2DAOA 3BZKA 4BS9A 3RZOJ 2V7FA 2X48A 2DDBA 4BY7J 3EUKL 4LK1F 1VQ7I 2JQ7A 4D9JA 3TKYA 1F36A 2JA2A 3WODF 3Q5FA 4EJTA 4NB5A 2K86A 2MD5A 2WAEA 1W7PB 1ULYA 3LSJA 1TLHB 2HTJA 4L9NA 4IQ4A 1FSHA 3I59B 3GFIA 2EIKH 2K85A 4PZJA 2EJRA 1KQ8A 1GDTA 1SD7A 2LBFA 2XAUA 5D4SA 1S3JA 4BE1A 5ILVA 2VKHA 5D5XB 2LDUA 1MBEA 3I4PA 2DW4A 3B6AA 3ZQCA 1IRXA 1EV7A 2CO5A 3F72A 1YLFA 2R93J 3NAUA 2STTA 3JW4A 2XGCA 2PJPA 2JPBA 3OYCA 1QBJA 1EF4A 2Y0SN 2G7HA 4LFUA 3TW7A 3LSKA 2E1MB 5HNHA 1LKXA 1T6SA 3DTEA 1WI3A 2HQRA 3H5AA 2XKOA 5JR3A 2VL8A 4J19A 1X3UA 1O3TA 5C44J 2EWNA 4AUXA 3FXOA 1E3PA 3ZGKA 4XICA 1D8JA 1PUFB 4OIRF 1HCRA 2BHYA 4JX5A 2GXAA 5BS6A 1R58A 2ESNA 3E6CC 3LSMA 5K7HA 1VQMI 2V1DA 3RIRA 4MEYF 2LH9A 2FE3A 2LSOA 2VKDA 2YX4A 2Z1DA 1TC3C 4A3CJ 1D0YA 3COAC 3DF8A 5EYRA 2KPMA 3JRFA 3N97A 2GIZA 2W84A 3HKZN 2W4SA 3GTPJ 3ISPA 4CYCA 1BR2A 2VC0A 4IL6C 5HDKA 3FK7A 2ZXWH 2KRFA 4N9IA 3CMEI 3E97A 3GTGJ 1RESA 2CQKA 3OYJA 3DQVC 1SAXA 1LEAA 5CQGA 1D3YA 2CRGA 2STWA 3M3YJ 2GOXB 2Y9YA 5LHGA 3IAM2 1VFCA 2F6CA 2O9LA 3HGGA 4MQ9F 2YU3A 3I58A 1S72I 1NHAA 4I99C 1A6IA 1TQIA 2MFZA 5EEHA 1XGNA 1C0WA 5CJ9A 1UMQA 2HR3A 2L9VA 1VQ9I 1KYZA 4ESFA 4B48A 2JRMA 2HOTA 5M3FJ 2DTRA 1MW7A 1O3RA 2DA3A 1K79A 5GAEJ 5KVRA 3S1QJ 2E34A 3E5XA 3QP6A 1LDJA 3BPVA 1I5ZA 3BZCA 5AIQA 1S7EA 3FF5A 3FKIJ 4HF1A 1WFXA 3SZGA 4C3JJ 2VN2A 2WC2A 4RM2A 5CVVA 3CLQA 2L7ZA 3W6JB 1BIBA 4ZH4F 1TWHJ 3EYYA 4XLAA 3HOXJ 4C2TA 2HFHA 3L2CA 1DUXC 4O3MA 1YG2A 2AQEA 2M9HA 2RQQA 4BJTA 4HNVA 5GP9A 4OWRB 2E2IJ 3C18A 1MKMA 3ZOBA 1B72A 3RKYA 1XX5A 4BEHB 4I0BA 3ZQIA 3CP8A 4PJLA 4OAZA 4C30A 1X3WB 5JI6A 5ICCA 2KMUA 2X1CA 3G3ZA 3MWMA 4F91B 4G12A 2FX0A 2X6XA 4ESBA 4Y33A 5CPRB 3IL2A 1OR7C 1J9IA 2XPVA 3RKXA 1U2WA 1LVAA 5KHDA 3JSPA 4CXFA 4RAYA 1KU3A 2BXYA 1QVTA 1I3AA 5JLWA 3P9KA 2K9NA 1VQ8I 1WVRA 1BR4A 4B3AA 4HRIA 1I1SA 2R7TA 2IPQX 3KZIC 4Y15A 4N4OB 4PCQA 4HNTA 2H8RA 5FKKA 1QO0D 2Z5UA 3VSLA 4W97A 2IS6A 1MBKA 1IDZA 2HDDA 4LIUA 4M6XA 3VEPA 1LE8B 2QSHX 2W48A 3CMYA 2KKOA 3RI4A 1ZR2A 4HF0A 2R7FA 4Y17A 3H3UA 4EGZA 1D1BA 3BLYA 3CUQB 2LC2A 2Z33A 3O8HA 2HQNA 2PX9A 5DD4A 3L2QA 1ZG5A 1BW6A 3IKVA 1U6GA 3QU3A 5LEKA 4HSTA 3CCMI 1XGOA 3DXJF 2QQAA 3HOYJ 4HPQA 2MLGA 1SVOA 2OJED 4F92B 2GM4A 2CUZA 2HXOA 2BW3A 2E35A 4OOIA 3CLOA 2TDXA 5ED4A 3CF5F 2DA2A 1DP3A 2JRTA 4ITVA 2YSRA 3S3MA 4AVPA 3HHGA 1Z3YA 1AA7A 3MCZA 1FY7A 3KFWX 2JPCA 4FT8A 3FK6A 2A69F 9ANTA 1MD0A 1JJ8C 4AM3A 3CC7I 2Q8KA 4M6VA 1ZG1A 3DEEA 3OYHA 3HSFA 3ML6A 3ERMA 1MH4A 1X1DA 1JKQC 4A3KJ 4D1QA 2GZWA 3E6BA 5HLIA 2EIJH 4PFOA 4M72A 3ZMZA 3DU6A 1YIOA 3DEWA 1K61A 1FTTA 1P7IA 1RC9A 1P92A 4IEJA 2QQ8A 4A0XA 4Y4RA 4UUSB 3RPUA 5C3EJ 3TP0A 2R7SA 3R61A 2KZGA 4BJ5C 1HQCA 4BQQA 4FASD 4B09A 3BQYA 3WU0A 3CO6C 4UB6C 5IP7J 1QHHD 4BE2A 3OR1C 2PEXA 3O6BB 1GV5A 1O7FA 1UZCA 3CO7C 1EA3A 4E7HA 4F3QA 3JAMK 2BY2A 1ITYA 2Q2EA 4UVAA 3N4MA 3TOBA 5EG0A 1T95A 4YFKF 3OYMA 2BGCA 1V5EA 1KU2A 2M34A 3L2RA 1U5TB 3ZMDA 1BOAA 1JJ6C 2PN6A 5LHHA 1A04A 4Q47A 1JGSA 3VWBA 2VKVA 3KX2A 3PL8A 4V2GA 4XRSA 2FEZA 4GYGA 3IWZA 4AYBA 3O2PE 2X9DA 1SANA 2XGDA 4MTDA 3CQZJ 2EA4A 2OBPA 4P9UA 2FBHA 2CUEA 4AD9A 3KIOA 2XPUA 4II3A 1XN7A 1YX3A 3SZPA 3PSIA 2ISZA 3FXMA 1NK2P 3LSPA 2E36A 2XRLA 4XOTA 1X58A 2JZYA 1SMYF 2KHMA 5DCMB 3AFHA 4G6QA 4B1RA 4RB0A 2NOGA 4ENNA 2HQAA 1WHUA 2CV2A 2DT6A 3ABTA 2CU7A 3WTYC 2VOOA 3HSRA 3AG4H 2R92J 1YQAA 3CCSI 2W24A 2I5UA 3BC8A 2OCEA 2RNJA 3GMEA 2AXLA 3R60A 4R8HA 2NVQJ 4A93J 5HLTA 4KNYA 3PQKA 2VOPA 2DFIA 4B8XA 4WXCA 2F5VA 2VPLA 1WJAA 2V79A 3DU5A 2PJRA 5TISC 2XSJC 3DCFA 3IC7A 5HLHA 3M07A 5J8FA 2WAQA 2NVUB 4DYCA 5IP6A 2IGKA 2XF7A 4MIMA 1JKPC 1MBGA 1ZREA 3MZ8A 1I27A 3QYBA 2OTLI 1IRGA 2QEXI 1GV2A 3K4MA 5BQTA 1FJLA 1JKOC 2XC7A 5JLXA 5FLVA 4BGDA 2WADA 4EEFG 2ACJA 2LKSA 2QSFX 5L3FA 4DBRA 3JRIA 5K5QA 4M3BA 5K5OA 4ZZDA 1B8IA 3H9GA 5FLXK 4XIDA 2ZO4A 1UG2A 4ZJZA 4BJ6C 1ERDA 2GQQA 2R3SA 3JTGA 2OZUA 1UG0A 1O57A 3AL0B 4KIBA 3G73A 1SFOJ 3OYBA 1WKMA 3JTHA 2OCCH 3BG3A 3FIWA 5F6FA 3Q3SA 4PDKA 2ZNYA 2NRAC 3VFZA 3FISA 5F1JA 3FHNA 4XR6A 5KAIC 5FFXA 1HW5A 3WTSC 2PI0A 4PJ0C 3JRBA 5M5YJ 4KJZA 3E6DA 2XF6A 4I7HA 3JRGA 4XN3A 4LLGF 3WTWC 2IS1A 1R1UA 3R0JA 5JFRA 3T8RA 1P4WA 4DQ2A 3K4BA 2IGNA 2BOLA 2XASA 1XB4A 1XMAA 4ZYEA 1UJ8A 1FOWA 1SD6A 4JQFA 1S8NA 2HZTA 3I54A 4NUBA 3AG2H 5E18F 2DJNA 4IJAA 1G3SA 2YUSA 3B73A 3OS2A 2EPFA 3M8FA 3PUBA 2DBBA 5L3EA 3MZHA 1G2HA 1H9GA 3DTIA 2CMPA 3QOEA 2BEOA 3BJ6A 5B1BH 3ZR8X 4KIGA 3D5RC 2QWWA 4Q48A 1ACIA 2XAJA 4A0ZA 1FP1D 1R6RA 4XONA 1OCOH 5D4RA 2BVMA 1WJBA 4CGZA 3GX4X 1O3SA 1OYIA 2AXTC 1MJBA 2CUFA 2XGXA 3FXUA 3SEZA 4CZZA 1YITI 1RR8C 2L3DA 1FYLA 2ZMEA 3K70D 3BCBA 1MH3A 1W36D 4D5FA 1VZ0A 4LIVA 1TWCJ 2H1LA 2MGQA 1FLIA 2PMUA 4FX4A 4BEHA 1FIAA 2GA1A 4HNUA 1MMGA 4DOZA 1T56A 3DFGA 4HAMA 5F04A 1X2MA 1GVJA 3OOPA 1U9NA 1OMIA 1Z05A 5LGTA 4KIFA 4X0GA 3S3NA 1IXSB 4AYBN 4IF4A 3LNQA 1Z7LA 3ZN0A 3WGIA 2WV0A 3S32A 3EUHA 3K1MA 4RM3A 1FZPB 3AAFA 2HEOA 4IHYA 3DBLB 3FM3A 4LGWA 3S16J 3OYEA 1PYVA 2ZNZA 1IV8A 2XF5A 4D7NA 2MBFA 2WB1A 1HSTA 2H94A 2LP0A 5GPCA 1X1PA 4OAYA 5F0CA 4P9FA 3OR2C 1KQ0A 4XSXF 4XQFA 3ASOH 4HV6A 4L9VA 1MMAA 3RYRA 1A5JA 3DTKA 3CJRB 4M74A 2HKXA 3H35A 1N78A 2KQRA 3CUQA 4AVZA 3FMRA 2VJ4A 3VPRA 1OCZH 1LDKB 5A2QZ 1ZGJA 4DBQA 2W82A 5FKMA 1W0TA 2KJCA 2H27A 2WAQN 4LLLA 2XDVA 4YIIA 2JVGA 3S8PA 1FBSA 5ERIA 3BT9A 2WTEA 5ICEA 2QA4I 5FKOA 3GWZA 1R5GA 1TTYA 5LHIA 1EH8A 1YIJI 4IVNA 2RREA 1VQNI 3QPHA 2EIMH 2FF4A 5GTHC 3NARA 3QQAA 3ZQHA 3UNGC 3PUFA 5LEJA 4XMYA 1ZARA 1W5CC 2IGMA 1FC3A 1G4DA 3KYCB 2YPRA 4LG3A 4M9SA 2ADUA 2D1VA 2A07F 2O61A 3ZMVA 3PJRA 1V4RA 2QGUA 1OYYA 3GTLJ 1USTA 2ZFUA 3BTJA 1R5HA 2DOEA 5FROA 4CCNA 3J80K 1D0ZA 4FTHA 5BPDA 4WXHA 4AWXB 2EH3A 2ZXJA 4Y13A 2NYXA 2KLOA 2X6YA 5J6XA 1V54H 4YFNF 3CMAI 2CGPA 6PAXA 1G3YA 4BXFA 2NVYJ 1YRNB 3K10A 2HXIA 1CGPA 3MFKA 2V6EA 2L54A 2R5ZB 3KZYA 4BKXA 5E1ZB 2M7BA 5J4VA 4F93B 2E5NA 3A0HC 2MD0A 1M1EB 1AWCA 3LA2A 5EGOA 2CQ7A 3TO9A 1YFHA 3CCJI 4GRIA 3PQJA 2H09A 3SHFA 1YTYA 3E5QA 3M4OJ 2I8DA 1WJ5A 1J7KA 3KYLA 1XGMA 2LRDA 4ASNA 5K7ZA 1RI7A 1IGNA 2NS8A 4XSZF 3BR6A 3GXOA 4JBAA 2HQ5A 2VONA 1S7AA 1Z7UA 3FDYA 2MH9A 3BROA 1W5TA 2ME0A 3LQQA 1UB9A 1RUOA 4DW6A 2DQLA 1XGSA 2VBZA 3ZMUA 2VQGA 5DD8A 2LK2A 2XRNA 3GTJJ 1WGXA 1QZZA 4GDFA 1BM9A 3K2AA 5F27A 4KISA 2X85A 3JRCA 2DCEA 2CS3A 2A5YB 2NAZA 1FMWA 1LFPA 5EZGA 5FKLA 4MHGA 1XSDA 3F0CA 3V7SA 5D8KB 2DK8A 2JJ7A 2HZDA 3HG9A 1QQIA 4K2EA 1SFXA 3T8TA 2IGOA 3RDIA 3OY9A 3ZMSA 4G8XA 2KRHA 4BACA 2VLAA 2E71A 3S17J 1A6QA 1MBJA 2CFXA 2DK5A 3S2HJ 2WB1N 3BY6A 2CW7A 4QTRA 4BAYA 2VIXA 3LSIA 5FB2A 2ZFWA 3K0LA 2OF7A 4IXAA 4KT6A 2LFBA 1JGGA 2V1XA 4C2UA 5CYVA 1VNDA 2M2EA 1Y1WJ 2PQ8A 1B1BA 1NTCA 3FXQA 4BYYA 2ZJQF 2W85A 2EFWA 2UWMA 2A6HF 2CG4A 3CMMA 2R7QA 1QVUA 2GIVA 1ZK8A 3Q0WA 3U1KA 2DODA 5L3DA 2BY0A 3KPHA 2M0CA 4QPOA 4IX7A 2ICWG 2ID6A 2R7WA 4A3JJ 3CCEI 1DU0A 2HDCA 5HS9A 4YRVA 2A6EF 4A69C 3CCRI 3L9FA 4NBQA 1D5VA 3CDIA 3OMYA 3H3ZA 2DMUA 3W2AA 2UUZA 2VC1A 3RTRA 2M8EA 4Q4ZF 4JP0A 2K9SA 2XHKA 1IC8A 3A1YA 2E1OA 4RGRA 4A6EA 1ON1A 1T38A 2QYOA 1LB2A 4V2FA 2Y2ZA 3GZ5A 4JYKA 5IT9Z 3J7YJ 4XL9A 1X3ZB 4Y52J 2K4BA 3W2WA 3LMMA 4RGUA 4EGYA 4WXDA 5IYCJ 3WE3A 4IHXA 3NEUA 3VOEA 4EM0B 2X6OA 1IJWC 1BN5A 4FQGA 1XDSA 1QRYA 2E1CA 3A02A 4A3LJ 5HNFA 1FT9A 3F8BA 3LQRA 2BBYA 2HYFA 5FLMJ
chains in the Genus database with same CATH topology
1PP8F 4Q5SF 3LFKA 2VODA 3ZMTA 3MEXA 2FNAA 2L01A 2EFPA 5DEQA 3I0TA 4P55A 1RZ4A 3GFJA 3QOPA 4EQQA 1VTNC 1MDMB 3FZVA 5ICGA 4A12A 1P6RA 5E1WA 1SD4A 1R23A 2EV6A 2Z9OA 2VE8A 3J81Z 2A61A 2P5VA 1TW2A 2Y75A 3C3WA 2EV5A 1FPQA 5D8LB 3U9GA 2P6SA 4P5OA 3ULQB 5FFZA 2YR2A 4L5JA 4YIFA 4HQMA 1B9NA 1CF7B 4U0YA 1F4KA 3WTXC 1ONVA 4LG0B 3ERED 1IW7F 3O3KA 1S29A 1K78B 5ILUA 4ENMA 4LD5A 5BMZA 2DPDA 2K7LA 2XVCA 1XCBA 1ZG3A 3L00A 2KIUA 1SFUA 3Q9SA 2HGCA 3DEUA 5HOOA 4NHJA 2EFQA 1QGPA 2J5PA 1XCVA 1BC7C 3LAPA 4HDVA 1XD7A 1Q1HA 1KU7A 3V4GA 3REOA 3KCCA 4LLNA 3LSTA 4RB1A 3QAHA 3QP5A 4I98B 3KEOA 4WK8F 4ENJA 3IKTA 3SFZA 1TNTA 4LMYA 4OIPF 3WE2A 5L3CA 1IUYA 1XSXA 2QBYB 1IRFA 4G7HF 3JSOA 2EFNA 4A2UA 2QLZA 4HV5A 3MZYA 5HDGA 3ECOA 1JHHA 3C1DA 3CUQC 3U1DA 1ZHFA 2FNPA 4HF2A 2XAQA 4MEXF 2UXXA 3KZZA 1R36A 4I02A 3R6SA 3H92A 1DPUA 2FSWA 2Q0OA 1R1TA 2EV0A 4I09A 2D45A 1W7PA 2P7VB 3I59A 4G94A 3GF2A 4O6JA 5E20A 1FBUA 4ETSA 4S05A 4XRFA 2M1BA 5K5RA 4UV8A 3KETA 1F1ZA 5D6FA 4L9TA 2ZCWA 5HS8A 1T98A 3CTAA 3E3VA 4U7DA 3KE2A 2OAZA 2P5KA 2GXBA 1E2XA 4GGGA 3TDUC 4KYWA 1IN7A 1WI9A 1Y0UA 5CLSA 3F8CA 1W5SA 3F3XA 4EJUA 1U3EM 3ELKA 2LF7A 2EFOA 2W57A 3SQNA 2D2WA 5BOXA 4M6YA 5ICFA 5CVIA 1HKTA 4IHSA 1IXRC 1LNWA 3EDPA 5CVJA 1G3TA 2C6YA 3KLNA 2M30A 4YFXF 3TQNA 5JVTA 1B59A 4KN4X 1USSA 5D5VB 3TO7A 2IA1A 2Z99A 3I5UA 4DNCA 4UUVA 2E7XA 3KEQA 3EYIA 4ON0A 2F5FA 4HX7A 4RAZA 2FBIA 3E5UA 1H9TA 5F1RA 2CSOA 4BNCA 4OIQF 3LWFA 1P2FA 4EVIA 2PMHA 3R0AA 1IN6A 4QWQA 4UV9A 4U7BA 1B9MA 2LKPA 3GYHX 1DPRA 3DPTA 2FMLA 1BI0A 1GXQA 3I64A 1FNNA 5TRDA 1YS6A 1Z1DA 3E6MA 2CW0F 3U2RA 3WTVC 1T0FA 4UXNA 1LDDA 3CDHA 2MLKA 1CF7A 2K02A 3JAMZ 1J5YA 1ZYRF 4LG0A 1R1VA 1WSUA 5D6EA 2D1HA 5DUIA 3ZP5A 4GYIA 4RGXA 3VODA 5LGNA 2DT5A 3BJOA 3PFIA 4G7ZF 1HW2A 3I53A 4A6DA 1AOYA 1O7LA 1FYMA 2FXAA 3HHHA 2JSCA 2RQPA 1Z6RA 3KP7A 1IN4A 4KT5C 3GFLA 1WRJA 4IRGA 3TO6A 4WCGA 2A3SA 3BDDA 1ODDA 3FM5A 2DPUA 2AS5F 2XUBA 3SZTA 4BQAA 4LK0F 1G6NA 2XKPA 1RNLA 1YYVA 2L02A 3V8LA 2QQ9A 3HOSA 4KMUX 5D5UB 4G7OF 4Z2YA 5FLXZ 1FYKA 4OIOF 3HUGA 2F2EA 4A5MA 5DV5A 1PUEE 2MC3A 3F21A 1OKRA 1U5TA 1ZAOA 2M45A 2QENA 5FD6A 3GEZA 1STZA 4U0WA 3WTZA 3K2ZA 4LB6B 1ZH5A 1FOKA 2OQGA 4ESJA 5KK1A 5K1YA 1XMKA 4M9ZA 1DP7P 4WX9A 2WWYA 4OINF 2O3FA 2XIGA 1YS7A 5AONA 2VE9A 5DCMA 3HTSB 5CVRA 2YX7A 4CDGA 2OA4A 4G9YA 5HDNA 2V6CA 4FHTA 1ZRFA 1REPC 1ZLKA 3M8EA 4IRHA 1SMTA 4D0PA 2ZJ2A 4AIHA 4GCVA 2OZ6A 1S7OA 2QM3A 2RKHA 4UVCA 4UNOA 2RDPA 3F8MA 3K9TA 5FGMA 1T2KA 4RB2C 2R7DA 4F7ZA 1K7AA 2RN7A 2KIFA 5L3GA 2FMYA 2IA2A 4BHCA 4KN7X 2MA3A 2DU9A 2HTSA 5HLGA 3HIFA 4L9JA 4E70A 3HRUA 2Z3YA 3FMQA 4CICA 2IW5A 3GO5A 4KA4A 3M1EA 5DYMA 2IRFG 2HKOA 2PLYA 4KFCA 4CO8A 3WG9A 4A5NA 3CUOA 4HOBA 1P4AA 5EEGA 2NNNA 2IJLA 1GXPA 1U78A 1TNSA 4HLYA 2ESHA 1TBXA 2E1NA 2BV6A 2XAHA 5E8GA 2QUFA 1BI1A 2RGVA 1YW8A 1JXSA 3ECHA 5DDGA 4IHTA 3RPQA 4PGHA 5IT3A 3BOQA 2MH2A 4ZYHA 4MNUA 1Z91A 4MGRA 2FOKA 1BI2A 2GXGA 3J80Z 5BPIA 3EETA 1I6XA 2E7WA 1WWXA 1IAWA 2VT3A 1KQ9A 4HYEA 2VT2A 4RB3C 3WGHA 3LAJA 2VXZA 1JHFA 3C7JA 3HSEA 2O03A 4HQEA 1HBXG 3L7WA 1J59A 5L3BA 5TJJA 4M73A 4LB5A 1MJ9A 2FA5A 1B4AA 4AIJA 2F5DA 4PGGA 4CHUA 1F5TA 1Z9CA 1BBYA 2ETHA 3T5XA 2PG4A 3GFMA 2IVMA 1B6AA 1FP2A 2EK5A 2ZMEB 2FBKA 3D0SA 3KLOA 3NQOA 3M9AA 5JHUA 1YO5C 3BPXA 3ZN1A 3FX3A 2G7UA 4N0BA 4KMFA 5LBQA 3KP5A 3HRSA 3DV8A 2COMA 4G6DA 4HX8A 3B02A 3KP2A 4ZYDA 4UHTA 3GVAA 2KJBA 1K6OA 4S04A 4HLXA 1BJAA 1FSEA 4WF2A 2ISYA 4BHPA 2K4JA 2GA2A 2V1UA 3L09A 4MTEA 1KGSA 3DPLC 2DQRA 1IN5A 3F22A 3DP7A 1FWZA 4KDPA 2P8TA 1SD5A 2H6CA 5HVQC 4BH9A 4KICA 4EJVA 1ZN2A 4L18B 1QZYA 5LRSA 4HX4A 2EA2A 3LA3A 3KP6A 3TDZC 1F9NA 1ON2A 1HKSA 2DO7A 2H6BA 2IP2A 1HXDA 1OPCA 1MJAA 1L0OC 2UXNA 1TW3A 2B0LA 2DI3A 3VB2A 1PDNC 1XDUA 5E17F 3WU1B 3GLXA 3MAJA 1ZRDA 4EJOA 1PP7U 4RGSA 4M71A 4M9XA 2P6TA 2DLLA 5E1XA 1T39A 1BI3A 3WTTC 2G9WA 3KP4A 1XSVA 3S2WA 2HOEA 5D5WB 4XBFA 1IN8A 2A68F 2XAFA 2K27A 4HBLA 2KIMA 2QQBA 1OYWA 3HYIA 4HDUA 1KU9A 4BHBA 1IZ1A 5DUKA 4GO1A 1RUNA 1Z6TA 1J75A 3V7RA 4EM2A 2JT1A 4HW0A 2X0LA 2NS0A 3CJNA 2LF8A 4HA8A 2HYGD 3ZQ7A 2RVCA 5AIPA 2XROA 5A2QK 1TQMA 4QLCU 4IRIA 2NNYA 3Q9VA 1UFMA 1MGTA 1D8KA 1I1GA 4R1HA 4GXOA 1E17A 1YW9A 4LJZF 4R79A 3HOTA 1QPMA 3D5LA 5FO5A 2OU2A 1U5TC 2RV8A 3SXYA 3V7CA 3TOAA 4OMYA 1UHMA 1BC8C 3P9IA 1S6LA 2F5EA 4UVBA 2V9VA 4KUMA 4N9HA 3QU6A 2XV4S 4CYDA 4EMSA 5DCFA 5H6RA 1HKQA 2QVOA 1DDNA 3P9CA 1ZGAA 3K1NA 4O5VA 3QPTA 1MZBA 4I01A 5F64A 2LNBA 1ZRCA 1LEBA 4ZZLA 3WTUC 3FMSA 3ABUA 1KA8A 3GUDA 4JK1X 3GZ6A 1OR7A 1MDMA 3FWEA 1YW7A 4AIKA 3DKWA 1L3LA 4H0EA 2XAGA 2CYYA 1QNTA 3M7GA 3F6OA 3RYPA 3I71A 2M5WA 3IRRA 2FU4A 2RC4A 2F5CA 2VBXA 3IHUA 2Y48A 2L4MA 4ENKA 3V8JA 1EH6A 3HTUA 3IWFA 3EQLF 2W25A 1FX7A 1P4XA 2M87A 1K78A 4MQVA 2EB7A 1TQPA 1HW1A 2P7CB 2P4WA 3QRFF 4NQWA 1O3QA 1J2XA 3ZPLA 5LGUA 2ZKZA 3K1PA 4L0ZB 5H6QA 3F6VA 4L5IA 1BIAA 3OV8A 1R00A 4EM1A 1GHCA 2J5OA 1JE8A 2JTVA 2BYVE 4L0YB 1SFEA 3IRQA 1R7JA 4WWCA 2P5LC 5ILSA 4U88A 2X4HA 3HRMA 4TV7A 2UZKA 2ZBKA 4XLNF 3ROUA 2VBWA 1J0RA 2L4AA 1UHWA 4EV0A 5IT9K 3V8KA 5HS7A 2QBYA 1KYWA 2FRHA 2Y0MA 1LJ9A 5H20A 5LRRA 3R4KA 3J7AO 1HSJA 3LA7A 4IPAA 5E8IA 2IT0A 4BXUA 3P7NA 3FXRA 1U8RA 5LLQA 2GAUA 1RIOH 5CVUA 1R22A 3W6KB 1G3WA 2PFBA 1W7PD 3TGNA 3BP8A 3WGGA 4OMZA 2O8XA 1EH7A 2CWEA 3BWGA 1H0MA 1V3FA 3BJAA 1W4MA 2QZ8A 5J8CA 4RS8A 2HS5A 3F8FA 2OQRA 2OD5A 4I2OA 3KP3A 4U0VA 2O0YA 4EJWA 3J81K 3F23A 1FBQA 5FD5A 3HRTA 4OU0A 4P96A 3BZ6A 4HZFA 1ZLJA 4I0AA 4FX0A 3MQ0A 3NRVA 2PBIA 2BE5F 2VBYA 3GW2A 1UCRA 2IA0A 3RJPA 1IF1A 3RKWA 3K69A 3F8NA 4ZYGA 4A0YA 3T1BA 4YG2F 1IXCA 2ELHA 3FHZA 1WQ2A 2GWRA 1LQ1A 2FQ3A 4XLPF 3T0YA 2HWVA 2O6GE 2DAOA 4LK1F 3TKYA 3WODF 3Q5FA 4EJTA 4NB5A 2K86A 2MD5A 1W7PB 1ULYA 1TLHB 2HTJA 4L9NA 1FSHA 3I59B 3GFIA 4PZJA 1KQ8A 2EJRA 1SD7A 5D4SA 1S3JA 5ILVA 5D5XB 2LDUA 3I4PA 2DW4A 1EV7A 2CO5A 3F72A 1YLFA 2STTA 3JW4A 2PJPA 2JPBA 1QBJA 2G7HA 4LFUA 1T6SA 2HQRA 2XKOA 5JR3A 1X3UA 1O3TA 2EWNA 1D8JA 4OIRF 5BS6A 1R58A 2ESNA 3E6CC 2V1DA 3RIRA 4MEYF 2YX4A 2FE3A 2LSOA 3COAC 3DF8A 3N97A 2W84A 3ISPA 2VC0A 5HDKA 2KRFA 4N9IA 3E97A 2CQKA 3DQVC 1SAXA 1LEAA 1D3YA 2STWA 5LHGA 4MQ9F 2YU3A 3I58A 1NHAA 1TQIA 5EEHA 1XGNA 1C0WA 5CJ9A 2HR3A 1KYZA 4ESFA 2DTRA 1O3RA 1K79A 5KVRA 3E5XA 3QP6A 1LDJA 3BPVA 1I5ZA 5AIQA 3FF5A 4HF1A 2VN2A 2WC2A 5CVVA 3W6JB 1BIBA 4ZH4F 3EYYA 2HFHA 3L2CA 1DUXC 4O3MA 1YG2A 3C18A 1MKMA 3RKYA 4I0BA 5JI6A 5ICCA 3G3ZA 3MWMA 4ESBA 3IL2A 1J9IA 3RKXA 1U2WA 1LVAA 3JSPA 4CXFA 4RAYA 1KU3A 3P9KA 1I1SA 2IPQX 4Y15A 4PCQA 1QO0D 2Z5UA 4M6XA 3VEPA 2KKOA 3RI4A 4HF0A 2R7FA 4Y17A 3H3UA 4EGZA 3CUQB 2Z33A 2HQNA 1ZG5A 5DD4A 3IKVA 1U6GA 3QU3A 5LEKA 1XGOA 3DXJF 2QQAA 2MLGA 4OOIA 3CLOA 2TDXA 5ED4A 2JRTA 2YSRA 4AVPA 3HHGA 3MCZA 1FY7A 3KFWX 2JPCA 4FT8A 2A69F 1MD0A 2Q8KA 1ZG1A 3HSFA 3ML6A 2GZWA 3E6BA 5HLIA 4M72A 3ZMZA 1YIOA 4A0XA 1P92A 3RPUA 3R61A 1HQCA 4B09A 3WU0A 3CO6C 2PEXA 3O6BB 1O7FA 3CO7C 3JAMK 2Q2EA 4UVAA 3N4MA 3TOBA 4YFKF 2BGCA 1KU2A 1U5TB 3ZMDA 1BOAA 2PN6A 5LHHA 1A04A 4Q47A 1JGSA 2FEZA 4GYGA 3IWZA 3O2PE 4MTDA 2EA4A 2OBPA 4P9UA 2FBHA 4AD9A 1XN7A 3SZPA 2ISZA 2JZYA 1SMYF 5DCMB 4G6QA 4RB0A 4ENNA 3ABTA 3WTYC 2VOOA 3HSRA 1YQAA 2W24A 2RNJA 2AXLA 3R60A 4R8HA 4KNYA 3PQKA 2VOPA 2DFIA 4B8XA 4WXCA 2V79A 5HLHA 3IC7A 5J8FA 1ZREA 1I27A 1IRGA 5BQTA 2ACJA 5L3FA 5K5QA 5K5OA 4ZZDA 5FLXK 2ZO4A 2GQQA 2R3SA 3JTGA 2OZUA 1O57A 4KIBA 3G73A 1WKMA 3JTHA 5F6FA 4PDKA 2ZNYA 2NRAC 3VFZA 3WTSC 5FFXA 1HW5A 2PI0A 3E6DA 4I7HA 4LLGF 3WTWC 1R1UA 3R0JA 5JFRA 3T8RA 1P4WA 4DQ2A 2XASA 1XB4A 1XMAA 4ZYEA 4JQFA 1SD6A 1S8NA 2HZTA 3I54A 5E18F 4IJAA 1G3SA 3B73A 3M8FA 5L3EA 2DBBA 3MZHA 1H9GA 2BEOA 3BJ6A 4KIGA 2QWWA 4Q48A 2XAJA 4A0ZA 1FP1D 5D4RA 4CGZA 3GX4X 1O3SA 1OYIA 3FXUA 1MJBA 2XGXA 4CZZA 2L3DA 1FYLA 2ZMEA 1FLIA 2PMUA 4FX4A 2GA1A 4HAMA 3DFGA 1GVJA 3OOPA 1OMIA 1Z05A 5LGTA 4KIFA 1IXSB 4IF4A 3WGIA 3ZN0A 2WV0A 3EUHA 3K1MA 2HEOA 1FZPB 3AAFA 3FM3A 4LGWA 2ZNZA 2MBFA 1HSTA 2H94A 4P9FA 1KQ0A 4XSXF 4HV6A 4L9VA 3RYRA 4M74A 2HKXA 3CUQA 3FMRA 1LDKB 5A2QZ 1ZGJA 2KJCA 2H27A 4LLLA 4YIIA 1FBSA 5ERIA 2WTEA 5ICEA 3GWZA 1R5GA 1TTYA 5LHIA 1EH8A 4IVNA 3QPHA 2FF4A 5LEJA 1ZARA 1FC3A 1G4DA 2YPRA 4M9SA 2ADUA 2D1VA 2A07F 2O61A 3ZMVA 1V4RA 1OYYA 1USTA 1R5HA 3J80K 5BPDA 4WXHA 4AWXB 2ZXJA 4Y13A 2NYXA 5J6XA 4YFNF 2CGPA 6PAXA 1G3YA 1CGPA 3MFKA 2L54A 3KZYA 5E1ZB 1AWCA 3LA2A 3TO9A 1YFHA 3PQJA 2H09A 3SHFA 1YTYA 3E5QA 1J7KA 1XGMA 4ASNA 1RI7A 4XSZF 3GXOA 4JBAA 2VONA 1S7AA 1Z7UA 2MH9A 3BROA 1W5TA 3LQQA 1UB9A 1RUOA 2DQLA 1XGSA 2VBZA 3ZMUA 5DD8A 2XRNA 1QZZA 1BM9A 2A5YB 2NAZA 4MHGA 1XSDA 3V7SA 5D8KB 2DK8A 4K2EA 1QQIA 1SFXA 3T8TA 3RDIA 3ZMSA 4G8XA 2DK5A 2CFXA 3BY6A 4BAYA 5FB2A 2ZFWA 3K0LA 4IXAA 2V1XA 5CYVA 2PQ8A 1B1BA 3FXQA 4BYYA 2W85A 2EFWA 2UWMA 2A6HF 2CG4A 2GIVA 5L3DA 2HDCA 5HS9A 2A6EF 3L9FA 1D5VA 3H3ZA 2VC1A 3RTRA 2M8EA 4Q4ZF 2XHKA 4RGRA 4A6EA 1ON1A 1T38A 2QYOA 1LB2A 3GZ5A 5IT9Z 2K4BA 4RGUA 4EGYA 4WXDA 3WE3A 3NEUA 3VOEA 4EM0B 1BN5A 1XDSA 2E1CA 1FT9A 3F8BA 3LQRA 2BBYA 2HYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP8 F;  4Q5S F;  3LFK A;  2VOD A;  3ZMT A;  3MEX A;  2FNA A;  2L01 A;  2EFP A;  5DEQ A;  3I0T A;  4P55 A;  1RZ4 A;  3GFJ A;  3QOP A;  4EQQ A;  1VTN C;  1MDM B;  3FZV A;  5ICG A;  4A12 A;  1P6R A;  5E1W A;  1SD4 A;  1R23 A;  2EV6 A;  2Z9O A;  2VE8 A;  3J81 Z;  2A61 A;  2P5V A;  1TW2 A;  2Y75 A;  3C3W A;  2EV5 A;  1FPQ A;  5D8L B;  3U9G A;  2P6S A;  4P5O A;  3ULQ B;  5FFZ A;  2YR2 A;  4L5J A;  4YIF A;  4HQM A;  1B9N A;  1CF7 B;  4U0Y A;  1F4K A;  3WTX C;  1ONV A;  4LG0 B;  3ERE D;  1IW7 F;  3O3K A;  1S29 A;  1K78 B;  5ILU A;  4ENM A;  4LD5 A;  5BMZ A;  2DPD A;  2K7L A;  2XVC A;  1XCB A;  1ZG3 A;  3L00 A;  2KIU A;  1SFU A;  3Q9S A;  2HGC A;  3DEU A;  5HOO A;  4NHJ A;  2EFQ A;  1QGP A;  2J5P A;  1XCV A;  1BC7 C;  3LAP A;  4HDV A;  1XD7 A;  1Q1H A;  1KU7 A;  3V4G A;  3REO A;  3KCC A;  4LLN A;  3LST A;  4RB1 A;  3QAH A;  3QP5 A;  4I98 B;  3KEO A;  4WK8 F;  4ENJ A;  3IKT A;  3SFZ A;  1TNT A;  4LMY A;  4OIP F;  3WE2 A;  5L3C A;  1IUY A;  1XSX A;  2QBY B;  1IRF A;  4G7H F;  3JSO A;  2EFN A;  4A2U A;  2QLZ A;  4HV5 A;  3MZY A;  5HDG A;  3ECO A;  1JHH A;  3C1D A;  3CUQ C;  3U1D A;  1ZHF A;  2FNP A;  4HF2 A;  2XAQ A;  4MEX F;  2UXX A;  3KZZ A;  1R36 A;  4I02 A;  3R6S A;  3H92 A;  1DPU A;  2FSW A;  2Q0O A;  1R1T A;  2EV0 A;  4I09 A;  2D45 A;  1W7P A;  2P7V B;  3I59 A;  4G94 A;  3GF2 A;  4O6J A;  5E20 A;  1FBU A;  4ETS A;  4S05 A;  4XRF A;  2M1B A;  5K5R A;  4UV8 A;  3KET A;  1F1Z A;  5D6F A;  4L9T A;  2ZCW A;  5HS8 A;  1T98 A;  3CTA A;  3E3V A;  4U7D A;  3KE2 A;  2OAZ A;  2P5K A;  2GXB A;  1E2X A;  4GGG A;  3TDU C;  4KYW A;  1IN7 A;  1WI9 A;  1Y0U A;  5CLS A;  3F8C A;  1W5S A;  3F3X A;  4EJU A;  1U3E M;  3ELK A;  2LF7 A;  2EFO A;  2W57 A;  3SQN A;  2D2W A;  5BOX A;  4M6Y A;  5ICF A;  5CVI A;  1HKT A;  4IHS A;  1IXR C;  1LNW A;  3EDP A;  5CVJ A;  1G3T A;  2C6Y A;  3KLN A;  2M30 A;  4YFX F;  3TQN A;  5JVT A;  1B59 A;  4KN4 X;  1USS A;  5D5V B;  3TO7 A;  2IA1 A;  2Z99 A;  3I5U A;  4DNC A;  4UUV A;  2E7X A;  3KEQ A;  3EYI A;  4ON0 A;  2F5F A;  4HX7 A;  4RAZ A;  2FBI A;  3E5U A;  1H9T A;  5F1R A;  2CSO A;  4BNC A;  4OIQ F;  3LWF A;  1P2F A;  4EVI A;  2PMH A;  3R0A A;  1IN6 A;  4QWQ A;  4UV9 A;  4U7B A;  1B9M A;  2LKP A;  3GYH X;  1DPR A;  3DPT A;  2FML A;  1BI0 A;  1GXQ A;  3I64 A;  1FNN A;  5TRD A;  1YS6 A;  1Z1D A;  3E6M A;  2CW0 F;  3U2R A;  3WTV C;  1T0F A;  4UXN A;  1LDD A;  3CDH A;  2MLK A;  1CF7 A;  2K02 A;  3JAM Z;  1J5Y A;  1ZYR F;  4LG0 A;  1R1V A;  1WSU A;  5D6E A;  2D1H A;  5DUI A;  3ZP5 A;  4GYI A;  4RGX A;  3VOD A;  5LGN A;  2DT5 A;  3BJO A;  3PFI A;  4G7Z F;  1HW2 A;  3I53 A;  4A6D A;  1AOY A;  1O7L A;  1FYM A;  2FXA A;  3HHH A;  2JSC A;  2RQP A;  1Z6R A;  3KP7 A;  1IN4 A;  4KT5 C;  3GFL A;  1WRJ A;  4IRG A;  3TO6 A;  4WCG A;  2A3S A;  3BDD A;  1ODD A;  3FM5 A;  2DPU A;  2AS5 F;  2XUB A;  3SZT A;  4BQA A;  4LK0 F;  1G6N A;  2XKP A;  1RNL A;  1YYV A;  2L02 A;  3V8L A;  2QQ9 A;  3HOS A;  4KMU X;  5D5U B;  4G7O F;  4Z2Y A;  5FLX Z;  1FYK A;  4OIO F;  3HUG A;  2F2E A;  4A5M A;  5DV5 A;  1PUE E;  2MC3 A;  3F21 A;  1OKR A;  1U5T A;  1ZAO A;  2M45 A;  2QEN A;  5FD6 A;  3GEZ A;  1STZ A;  4U0W A;  3WTZ A;  3K2Z A;  4LB6 B;  1ZH5 A;  1FOK A;  2OQG A;  4ESJ A;  5KK1 A;  5K1Y A;  1XMK A;  4M9Z A;  1DP7 P;  4WX9 A;  2WWY A;  4OIN F;  2O3F A;  2XIG A;  1YS7 A;  5AON A;  2VE9 A;  5DCM A;  3HTS B;  5CVR A;  2YX7 A;  4CDG A;  2OA4 A;  4G9Y A;  5HDN A;  2V6C A;  4FHT A;  1ZRF A;  1REP C;  1ZLK A;  3M8E A;  4IRH A;  1SMT A;  4D0P A;  2ZJ2 A;  4AIH A;  4GCV A;  2OZ6 A;  1S7O A;  2QM3 A;  2RKH A;  4UVC A;  4UNO A;  2RDP A;  3F8M A;  3K9T A;  5FGM A;  1T2K A;  4RB2 C;  2R7D A;  4F7Z A;  1K7A A;  2RN7 A;  2KIF A;  5L3G A;  2FMY A;  2IA2 A;  4BHC A;  4KN7 X;  2MA3 A;  2DU9 A;  2HTS A;  5HLG A;  3HIF A;  4L9J A;  4E70 A;  3HRU A;  2Z3Y A;  3FMQ A;  4CIC A;  2IW5 A;  3GO5 A;  4KA4 A;  3M1E A;  5DYM A;  2IRF G;  2HKO A;  2PLY A;  4KFC A;  4CO8 A;  3WG9 A;  4A5N A;  3CUO A;  4HOB A;  1P4A A;  5EEG A;  2NNN A;  2IJL A;  1GXP A;  1U78 A;  1TNS A;  4HLY A;  2ESH A;  1TBX A;  2E1N A;  2BV6 A;  2XAH A;  5E8G A;  2QUF A;  1BI1 A;  2RGV A;  1YW8 A;  1JXS A;  3ECH A;  5DDG A;  4IHT A;  3RPQ A;  4PGH A;  5IT3 A;  3BOQ A;  2MH2 A;  4ZYH A;  4MNU A;  1Z91 A;  4MGR A;  2FOK A;  1BI2 A;  2GXG A;  3J80 Z;  5BPI A;  3EET A;  1I6X A;  2E7W A;  1WWX A;  1IAW A;  2VT3 A;  1KQ9 A;  4HYE A;  2VT2 A;  4RB3 C;  3WGH A;  3LAJ A;  2VXZ A;  1JHF A;  3C7J A;  3HSE A;  2O03 A;  4HQE A;  1HBX G;  3L7W A;  1J59 A;  5L3B A;  5TJJ A;  4M73 A;  4LB5 A;  1MJ9 A;  2FA5 A;  1B4A A;  4AIJ A;  2F5D A;  4PGG A;  4CHU A;  1F5T A;  1Z9C A;  1BBY A;  2ETH A;  3T5X A;  2PG4 A;  3GFM A;  2IVM A;  1B6A A;  1FP2 A;  2EK5 A;  2ZME B;  2FBK A;  3D0S A;  3KLO A;  3NQO A;  3M9A A;  5JHU A;  1YO5 C;  3BPX A;  3ZN1 A;  3FX3 A;  2G7U A;  4N0B A;  4KMF A;  5LBQ A;  3KP5 A;  3HRS A;  3DV8 A;  2COM A;  4G6D A;  4HX8 A;  3B02 A;  3KP2 A;  4ZYD A;  4UHT A;  3GVA A;  2KJB A;  1K6O A;  4S04 A;  4HLX A;  1BJA A;  1FSE A;  4WF2 A;  2ISY A;  4BHP A;  2K4J A;  2GA2 A;  2V1U A;  3L09 A;  4MTE A;  1KGS A;  3DPL C;  2DQR A;  1IN5 A;  3F22 A;  3DP7 A;  1FWZ A;  4KDP A;  2P8T A;  1SD5 A;  2H6C A;  5HVQ C;  4BH9 A;  4KIC A;  4EJV A;  1ZN2 A;  4L18 B;  1QZY A;  5LRS A;  4HX4 A;  2EA2 A;  3LA3 A;  3KP6 A;  3TDZ C;  1F9N A;  1ON2 A;  1HKS A;  2DO7 A;  2H6B A;  2IP2 A;  1HXD A;  1OPC A;  1MJA A;  1L0O C;  2UXN A;  1TW3 A;  2B0L A;  2DI3 A;  3VB2 A;  1PDN C;  1XDU A;  5E17 F;  3WU1 B;  3GLX A;  3MAJ A;  1ZRD A;  4EJO A;  1PP7 U;  4RGS A;  4M71 A;  4M9X A;  2P6T A;  2DLL A;  5E1X A;  1T39 A;  1BI3 A;  3WTT C;  2G9W A;  3KP4 A;  1XSV A;  3S2W A;  2HOE A;  5D5W B;  4XBF A;  1IN8 A;  2A68 F;  2XAF A;  2K27 A;  4HBL A;  2KIM A;  2QQB A;  1OYW A;  3HYI A;  4HDU A;  1KU9 A;  4BHB A;  1IZ1 A;  5DUK A;  4GO1 A;  1RUN A;  1Z6T A;  1J75 A;  3V7R A;  4EM2 A;  2JT1 A;  4HW0 A;  2X0L A;  2NS0 A;  3CJN A;  2LF8 A;  4HA8 A;  2HYG D;  3ZQ7 A;  2RVC A;  5AIP A;  2XRO A;  5A2Q K;  1TQM A;  4QLC U;  4IRI A;  2NNY A;  3Q9V A;  1UFM A;  1MGT A;  1D8K A;  1I1G A;  4R1H A;  4GXO A;  1E17 A;  1YW9 A;  4LJZ F;  4R79 A;  3HOT A;  1QPM A;  3D5L A;  5FO5 A;  2OU2 A;  1U5T C;  2RV8 A;  3SXY A;  3V7C A;  3TOA A;  4OMY A;  1UHM A;  1BC8 C;  3P9I A;  1S6L A;  2F5E A;  4UVB A;  2V9V A;  4KUM A;  4N9H A;  3QU6 A;  2XV4 S;  4CYD A;  4EMS A;  5DCF A;  5H6R A;  1HKQ A;  2QVO A;  1DDN A;  3P9C A;  1ZGA A;  3K1N A;  4O5V A;  3QPT A;  1MZB A;  4I01 A;  5F64 A;  2LNB A;  1ZRC A;  1LEB A;  4ZZL A;  3WTU C;  3FMS A;  3ABU A;  1KA8 A;  3GUD A;  4JK1 X;  3GZ6 A;  1OR7 A;  1MDM A;  3FWE A;  1YW7 A;  4AIK A;  3DKW A;  1L3L A;  4H0E A;  2XAG A;  2CYY A;  1QNT A;  3M7G A;  3F6O A;  3RYP A;  3I71 A;  2M5W A;  3IRR A;  2FU4 A;  2RC4 A;  2F5C A;  2VBX A;  3IHU A;  2Y48 A;  2L4M A;  4ENK A;  3V8J A;  1EH6 A;  3HTU A;  3IWF A;  3EQL F;  2W25 A;  1FX7 A;  1P4X A;  2M87 A;  1K78 A;  4MQV A;  2EB7 A;  1TQP A;  1HW1 A;  2P7C B;  2P4W A;  3QRF F;  4NQW A;  1O3Q A;  1J2X A;  3ZPL A;  5LGU A;  2ZKZ A;  3K1P A;  4L0Z B;  5H6Q A;  3F6V A;  4L5I A;  1BIA A;  3OV8 A;  1R00 A;  4EM1 A;  1GHC A;  2J5O A;  1JE8 A;  2JTV A;  2BYV E;  4L0Y B;  1SFE A;  3IRQ A;  1R7J A;  4WWC A;  2P5L C;  5ILS A;  4U88 A;  2X4H A;  3HRM A;  4TV7 A;  2UZK A;  2ZBK A;  4XLN F;  3ROU A;  2VBW A;  1J0R A;  2L4A A;  1UHW A;  4EV0 A;  5IT9 K;  3V8K A;  5HS7 A;  2QBY A;  1KYW A;  2FRH A;  2Y0M A;  1LJ9 A;  5H20 A;  5LRR A;  3R4K A;  3J7A O;  1HSJ A;  3LA7 A;  4IPA A;  5E8I A;  2IT0 A;  4BXU A;  3P7N A;  3FXR A;  1U8R A;  5LLQ A;  2GAU A;  1RIO H;  5CVU A;  1R22 A;  3W6K B;  1G3W A;  2PFB A;  1W7P D;  3TGN A;  3BP8 A;  3WGG A;  4OMZ A;  2O8X A;  1EH7 A;  2CWE A;  3BWG A;  1H0M A;  1V3F A;  3BJA A;  1W4M A;  2QZ8 A;  5J8C A;  4RS8 A;  2HS5 A;  3F8F A;  2OQR A;  2OD5 A;  4I2O A;  3KP3 A;  4U0V A;  2O0Y A;  4EJW A;  3J81 K;  3F23 A;  1FBQ A;  5FD5 A;  3HRT A;  4OU0 A;  4P96 A;  3BZ6 A;  4HZF A;  1ZLJ A;  4I0A A;  4FX0 A;  3MQ0 A;  3NRV A;  2PBI A;  2BE5 F;  2VBY A;  3GW2 A;  1UCR A;  2IA0 A;  3RJP A;  1IF1 A;  3RKW A;  3K69 A;  3F8N A;  4ZYG A;  4A0Y A;  3T1B A;  4YG2 F;  1IXC A;  2ELH A;  3FHZ A;  1WQ2 A;  2GWR A;  1LQ1 A;  2FQ3 A;  4XLP F;  3T0Y A;  2HWV A;  2O6G E;  2DAO A;  4LK1 F;  3TKY A;  3WOD F;  3Q5F A;  4EJT A;  4NB5 A;  2K86 A;  2MD5 A;  1W7P B;  1ULY A;  1TLH B;  2HTJ A;  4L9N A;  1FSH A;  3I59 B;  3GFI A;  4PZJ A;  1KQ8 A;  2EJR A;  1SD7 A;  5D4S A;  1S3J A;  5ILV A;  5D5X B;  2LDU A;  3I4P A;  2DW4 A;  1EV7 A;  2CO5 A;  3F72 A;  1YLF A;  2STT A;  3JW4 A;  2PJP A;  2JPB A;  1QBJ A;  2G7H A;  4LFU A;  1T6S A;  2HQR A;  2XKO A;  5JR3 A;  1X3U A;  1O3T A;  2EWN A;  1D8J A;  4OIR F;  5BS6 A;  1R58 A;  2ESN A;  3E6C C;  2V1D A;  3RIR A;  4MEY F;  2YX4 A;  2FE3 A;  2LSO A;  3COA C;  3DF8 A;  3N97 A;  2W84 A;  3ISP A;  2VC0 A;  5HDK A;  2KRF A;  4N9I A;  3E97 A;  2CQK A;  3DQV C;  1SAX A;  1LEA A;  1D3Y A;  2STW A;  5LHG A;  4MQ9 F;  2YU3 A;  3I58 A;  1NHA A;  1TQI A;  5EEH A;  1XGN A;  1C0W A;  5CJ9 A;  2HR3 A;  1KYZ A;  4ESF A;  2DTR A;  1O3R A;  1K79 A;  5KVR A;  3E5X A;  3QP6 A;  1LDJ A;  3BPV A;  1I5Z A;  5AIQ A;  3FF5 A;  4HF1 A;  2VN2 A;  2WC2 A;  5CVV A;  3W6J B;  1BIB A;  4ZH4 F;  3EYY A;  2HFH A;  3L2C A;  1DUX C;  4O3M A;  1YG2 A;  3C18 A;  1MKM A;  3RKY A;  4I0B A;  5JI6 A;  5ICC A;  3G3Z A;  3MWM A;  4ESB A;  3IL2 A;  1J9I A;  3RKX A;  1U2W A;  1LVA A;  3JSP A;  4CXF A;  4RAY A;  1KU3 A;  3P9K A;  1I1S A;  2IPQ X;  4Y15 A;  4PCQ A;  1QO0 D;  2Z5U A;  4M6X A;  3VEP A;  2KKO A;  3RI4 A;  4HF0 A;  2R7F A;  4Y17 A;  3H3U A;  4EGZ A;  3CUQ B;  2Z33 A;  2HQN A;  1ZG5 A;  5DD4 A;  3IKV A;  1U6G A;  3QU3 A;  5LEK A;  1XGO A;  3DXJ F;  2QQA A;  2MLG A;  4OOI A;  3CLO A;  2TDX A;  5ED4 A;  2JRT A;  2YSR A;  4AVP A;  3HHG A;  3MCZ A;  1FY7 A;  3KFW X;  2JPC A;  4FT8 A;  2A69 F;  1MD0 A;  2Q8K A;  1ZG1 A;  3HSF A;  3ML6 A;  2GZW A;  3E6B A;  5HLI A;  4M72 A;  3ZMZ A;  1YIO A;  4A0X A;  1P92 A;  3RPU A;  3R61 A;  1HQC A;  4B09 A;  3WU0 A;  3CO6 C;  2PEX A;  3O6B B;  1O7F A;  3CO7 C;  3JAM K;  2Q2E A;  4UVA A;  3N4M A;  3TOB A;  4YFK F;  2BGC A;  1KU2 A;  1U5T B;  3ZMD A;  1BOA A;  2PN6 A;  5LHH A;  1A04 A;  4Q47 A;  1JGS A;  2FEZ A;  4GYG A;  3IWZ A;  3O2P E;  4MTD A;  2EA4 A;  2OBP A;  4P9U A;  2FBH A;  4AD9 A;  1XN7 A;  3SZP A;  2ISZ A;  2JZY A;  1SMY F;  5DCM B;  4G6Q A;  4RB0 A;  4ENN A;  3ABT A;  3WTY C;  2VOO A;  3HSR A;  1YQA A;  2W24 A;  2RNJ A;  2AXL A;  3R60 A;  4R8H A;  4KNY A;  3PQK A;  2VOP A;  2DFI A;  4B8X A;  4WXC A;  2V79 A;  5HLH A;  3IC7 A;  5J8F A;  1ZRE A;  1I27 A;  1IRG A;  5BQT A;  2ACJ A;  5L3F A;  5K5Q A;  5K5O A;  4ZZD A;  5FLX K;  2ZO4 A;  2GQQ A;  2R3S A;  3JTG A;  2OZU A;  1O57 A;  4KIB A;  3G73 A;  1WKM A;  3JTH A;  5F6F A;  4PDK A;  2ZNY A;  2NRA C;  3VFZ A;  3WTS C;  5FFX A;  1HW5 A;  2PI0 A;  3E6D A;  4I7H A;  4LLG F;  3WTW C;  1R1U A;  3R0J A;  5JFR A;  3T8R A;  1P4W A;  4DQ2 A;  2XAS A;  1XB4 A;  1XMA A;  4ZYE A;  4JQF A;  1SD6 A;  1S8N A;  2HZT A;  3I54 A;  5E18 F;  4IJA A;  1G3S A;  3B73 A;  3M8F A;  5L3E A;  2DBB A;  3MZH A;  1H9G A;  2BEO A;  3BJ6 A;  4KIG A;  2QWW A;  4Q48 A;  2XAJ A;  4A0Z A;  1FP1 D;  5D4R A;  4CGZ A;  3GX4 X;  1O3S A;  1OYI A;  3FXU A;  1MJB A;  2XGX A;  4CZZ A;  2L3D A;  1FYL A;  2ZME A;  1FLI A;  2PMU A;  4FX4 A;  2GA1 A;  4HAM A;  3DFG A;  1GVJ A;  3OOP A;  1OMI A;  1Z05 A;  5LGT A;  4KIF A;  1IXS B;  4IF4 A;  3WGI A;  3ZN0 A;  2WV0 A;  3EUH A;  3K1M A;  2HEO A;  1FZP B;  3AAF A;  3FM3 A;  4LGW A;  2ZNZ A;  2MBF A;  1HST A;  2H94 A;  4P9F A;  1KQ0 A;  4XSX F;  4HV6 A;  4L9V A;  3RYR A;  4M74 A;  2HKX A;  3CUQ A;  3FMR A;  1LDK B;  5A2Q Z;  1ZGJ A;  2KJC A;  2H27 A;  4LLL A;  4YII A;  1FBS A;  5ERI A;  2WTE A;  5ICE A;  3GWZ A;  1R5G A;  1TTY A;  5LHI A;  1EH8 A;  4IVN A;  3QPH A;  2FF4 A;  5LEJ A;  1ZAR A;  1FC3 A;  1G4D A;  2YPR A;  4M9S A;  2ADU A;  2D1V A;  2A07 F;  2O61 A;  3ZMV A;  1V4R A;  1OYY A;  1UST A;  1R5H A;  3J80 K;  5BPD A;  4WXH A;  4AWX B;  2ZXJ A;  4Y13 A;  2NYX A;  5J6X A;  4YFN F;  2CGP A;  6PAX A;  1G3Y A;  1CGP A;  3MFK A;  2L54 A;  3KZY A;  5E1Z B;  1AWC A;  3LA2 A;  3TO9 A;  1YFH A;  3PQJ A;  2H09 A;  3SHF A;  1YTY A;  3E5Q A;  1J7K A;  1XGM A;  4ASN A;  1RI7 A;  4XSZ F;  3GXO A;  4JBA A;  2VON A;  1S7A A;  1Z7U A;  2MH9 A;  3BRO A;  1W5T A;  3LQQ A;  1UB9 A;  1RUO A;  2DQL A;  1XGS A;  2VBZ A;  3ZMU A;  5DD8 A;  2XRN A;  1QZZ A;  1BM9 A;  2A5Y B;  2NAZ A;  4MHG A;  1XSD A;  3V7S A;  5D8K B;  2DK8 A;  4K2E A;  1QQI A;  1SFX A;  3T8T A;  3RDI A;  3ZMS A;  4G8X A;  2DK5 A;  2CFX A;  3BY6 A;  4BAY A;  5FB2 A;  2ZFW A;  3K0L A;  4IXA A;  2V1X A;  5CYV A;  2PQ8 A;  1B1B A;  3FXQ A;  4BYY A;  2W85 A;  2EFW A;  2UWM A;  2A6H F;  2CG4 A;  2GIV A;  5L3D A;  2HDC A;  5HS9 A;  2A6E F;  3L9F A;  1D5V A;  3H3Z A;  2VC1 A;  3RTR A;  2M8E A;  4Q4Z F;  2XHK A;  4RGR A;  4A6E A;  1ON1 A;  1T38 A;  2QYO A;  1LB2 A;  3GZ5 A;  5IT9 Z;  2K4B A;  4RGU A;  4EGY A;  4WXD A;  3WE3 A;  3NEU A;  3VOE A;  4EM0 B;  1BN5 A;  1XDS A;  2E1C A;  1FT9 A;  3F8B A;  3LQR A;  2BBY A;  2HYF A; 
#chains in the Genus database with same CATH topology
 2XPW A;  1PP8 F;  2ZXI A;  2GBY A;  3V42 A;  4Q5S F;  3LFK A;  2VOD A;  2IS2 A;  1ZQ3 P;  1ORK A;  3ZMT A;  3OYD A;  1POG A;  3MEX A;  2DTZ A;  2MAB A;  2IBD A;  2FNA A;  5F08 A;  1R5I D;  2L01 A;  2EFP A;  5DEQ A;  4XK4 A;  4ZC3 A;  4NC6 A;  1OIS A;  2OC6 A;  3I0T A;  4P55 A;  4X1E A;  1VQ6 I;  1RZ4 A;  3GFJ A;  3QOP A;  3QPS A;  3LSR A;  2EIL H;  4EQQ A;  1VTN C;  3HEF A;  1MDM B;  3FZV A;  2WBM A;  5ICG A;  1I50 J;  2M7A A;  2KDZ A;  4A12 A;  1JUS A;  3WHC A;  1P6R A;  1R4M B;  5CQE A;  2R0Q C;  5E1W A;  1A36 A;  1X19 A;  1SD4 A;  3HM5 A;  2O8K A;  4L5E A;  1R23 A;  1D0X A;  2EV6 A;  3NWS A;  2Z9O A;  3H0D A;  2LTP A;  1OCP A;  2VE8 A;  3J81 Z;  2A61 A;  2P5V A;  1TW2 A;  2Y75 A;  1OFC X;  3H1C A;  3C3W A;  2EV5 A;  3VYU B;  1FPQ A;  3ONQ A;  5D8L B;  3U9G A;  4XLE A;  4IOC F;  2P6S A;  4P5O A;  3ULQ B;  4XRM A;  5DS9 A;  1NH3 A;  5FFZ A;  1DQU A;  2YR2 A;  2WAF A;  1OQY A;  2R5Y A;  4L5J A;  1YJW I;  2DA4 A;  2DMT A;  1WZ2 A;  3L1P A;  2LLK A;  2N8G A;  4YIF A;  4HQM A;  3ZXS A;  1B9N A;  1CF7 B;  2X6W A;  4U0Y A;  1F4K A;  3WTX C;  1ONV A;  4CSW A;  4LG0 B;  3ERE D;  2EZL A;  4ANJ A;  1IW7 F;  3O3K A;  1S29 A;  1K78 B;  1JT6 A;  4PJM A;  5ILU A;  1VQ5 I;  4ENM A;  4XKC A;  5JVG F;  4LD5 A;  5BMZ A;  2P81 A;  2DPD A;  4DYR A;  2K7L A;  3IH4 A;  2V26 A;  3Q0V A;  2DA6 A;  1ZKG A;  3OYF A;  3BR1 A;  2XVC A;  4ABZ A;  4E7J A;  1O4X A;  2NVT J;  1XCB A;  2HDW A;  3ZCO A;  4XOR A;  1OCC H;  1ZG3 A;  3L00 A;  5EF6 A;  4XKV A;  4AC0 A;  1V5G A;  4B47 A;  2KIU A;  5GPA A;  1SFU A;  1PJR A;  2ECB A;  3Q9S A;  3G6E I;  2HGC A;  3DEU A;  5HOO A;  4NHJ A;  2EFQ A;  1QGP A;  2ZME C;  2P0W A;  3X2Q H;  1UEL B;  2J5P A;  4A3M J;  3HOV J;  2R5Z A;  1Y8Q B;  1XCV A;  2VPR A;  1QPI A;  3W3C A;  1BC7 C;  3W6V A;  3LAP A;  1I6H J;  4HDV A;  1XD7 A;  1Q1H A;  1RR7 A;  2EZH A;  4Y3O A;  1KU7 A;  1VI0 A;  3V4G A;  1HLV A;  4XRS G;  4CZC A;  3REO A;  3OYN A;  3KCC A;  3OS0 A;  3A03 A;  1ETX A;  1Z77 A;  3LST A;  4LLN A;  2V1N A;  4RB1 A;  3QAH A;  3QP5 A;  4I98 B;  3KEO A;  2NOJ B;  3EUH C;  4WK8 F;  4ENJ A;  3IKT A;  3SFZ A;  3QOD A;  1T33 A;  2KDO A;  1TNT A;  2L7M P;  4LMY A;  4OIP F;  3WE2 A;  3Q0U A;  5L3C A;  1IUY A;  2LR8 A;  1XSX A;  2JK3 A;  4P1W A;  4DZP A;  2QBY B;  4PJJ A;  3IAS 2;  1IRF A;  4G7H F;  4D5C A;  3JSO A;  4KIT B;  5J1Y A;  4W1U A;  2WA0 A;  4CCJ A;  2EFN A;  4NDL A;  4A2U A;  2QLZ A;  3A0B C;  3MZY A;  4HV5 A;  3HUG B;  3IUO A;  3OYA A;  5HDG A;  1R49 A;  3ECO A;  2R7R A;  2CJJ A;  1JHH A;  3C1D A;  3CUQ C;  3U1D A;  3MD2 A;  2FQ4 A;  1ZHF A;  2FNP A;  2CQX A;  2K3P A;  4HF2 A;  4EAT A;  2XAQ A;  4MEX F;  5J1R A;  2UXX A;  3EPZ A;  3BR3 A;  3KZZ A;  2JUC A;  1R36 A;  1LPQ A;  3LL7 A;  4I02 A;  3R6S A;  1IV6 A;  3A01 B;  1JTX A;  3H92 A;  1DPU A;  2FSW A;  3IV5 A;  2Q0O A;  1R1T A;  3EUA A;  1WPK A;  5C4X J;  2EV0 A;  3LSH A;  4I09 A;  2D45 A;  2E5Z A;  1IG7 A;  1W7P A;  2E60 A;  3CZ6 A;  1TT5 B;  1ENH A;  2P7V B;  3I59 A;  4G94 A;  3KYD B;  4E7K A;  3GF2 A;  4O6J A;  5E20 A;  1MBF A;  1HOM A;  1FBU A;  4ETS A;  4S05 A;  3RKQ A;  1GLN A;  3BR2 A;  4DJA A;  1ETY A;  2ZSH B;  2B63 J;  1SVM A;  3FXJ A;  4F55 A;  4XRF A;  2M1B A;  5K5R A;  4UV8 A;  2ZC2 A;  1EJ9 A;  5LFA A;  1F1Z A;  5D6F A;  3KET A;  4L9T A;  2ZCW A;  2EZI A;  5HS8 A;  1T98 A;  3CTA A;  3E3V A;  4U7D A;  3KE2 A;  4ZDL A;  2OAZ A;  2P5K A;  3ZQG A;  2GXB A;  1E2X A;  3RQI A;  4GGG A;  3CCY A;  2E2J J;  1MNE A;  3TDU C;  3WHB A;  4KYW A;  1IN7 A;  3A2K A;  2KRC A;  1WI9 A;  2DYS H;  1Y0U A;  5CLS A;  3F8C A;  3JRD A;  1W5S A;  3F3X A;  4EJU A;  1PUF A;  2EIN H;  3A4C A;  3ASN H;  5J40 A;  1Y56 A;  3JRE A;  2KT0 A;  3UR3 C;  1U3E M;  3ELK A;  3K4J A;  2HVS A;  2L5Q A;  2LF7 A;  4FIS A;  2EFO A;  2W57 A;  3I9V 2;  5TGT A;  3D1N I;  2DXI A;  3HZJ A;  3SQN A;  2HVQ A;  2QSG X;  2D2W A;  3E0J B;  5BOX A;  3TBI A;  4M6Y A;  5ICF A;  2R7X A;  2XSD C;  1H89 C;  2W1O A;  3FBN B;  3CDL A;  5CVI A;  1HKT A;  4IHS A;  1IXR C;  3O8G A;  5J4Y A;  4D7M A;  1LNW A;  3UKG A;  4RDU A;  2ZB9 A;  3EDP A;  5CVJ A;  1G3T A;  1WCM J;  4QPQ A;  2C6Y A;  3S2D J;  3KLN A;  3GTK J;  2ELJ A;  2M30 A;  3RQ4 A;  3LFU A;  3TQN A;  4YFX F;  3SDB A;  5JVT A;  1B59 A;  4KN4 X;  1USS A;  1IO2 A;  5D5V B;  4I76 A;  3OIO A;  3TO7 A;  2IA1 A;  3SEQ A;  2Z99 A;  2I10 A;  3I5U A;  2B9S A;  3CJT B;  5J3L A;  5IYD J;  4DNC A;  4UUV A;  2E7X A;  2DA1 A;  3PSF A;  3ESW B;  3J7Z I;  2JUG A;  2M0M A;  3KEQ A;  4FE4 A;  3DLA A;  5FRM A;  4BE0 A;  4ON0 A;  3G4S I;  3EYI A;  2F5F A;  4HX7 A;  4RAZ A;  2O5R A;  4ZYA A;  1N25 A;  2FBI A;  3E5U A;  4XLC A;  1H9T A;  5F1R A;  2CSO A;  2EQR A;  4BNC A;  3G2B A;  2W00 A;  4OIQ F;  1BL0 A;  3LWF A;  1FMV A;  1Z3X A;  1P2F A;  4EVI A;  2PMH A;  4BUP A;  1ZR4 A;  3R0A A;  1IN6 A;  4QWQ A;  2OPT A;  3SYT A;  4UV9 A;  4U7B A;  4A3B J;  1B9M A;  2LKP A;  3GYH X;  1QHG A;  3HGY A;  2HU9 A;  5BNG A;  1V55 H;  1DPR A;  2A05 A;  5FKN A;  2JVH A;  2NS7 A;  2CV1 A;  3DPT A;  2FML A;  1BI0 A;  4DZJ A;  3K4L A;  1GXQ A;  3I64 A;  3M8J A;  1A31 A;  4XNF A;  1FNN A;  2ME6 A;  3FKJ A;  2AQF A;  4RLF A;  5TRD A;  1YS6 A;  5DM6 F;  1Z1D A;  1TP4 A;  2Y69 H;  2CW0 F;  3E6M A;  1JI8 A;  3U2R A;  3IP4 B;  4CYC B;  1SFK A;  2JSP A;  3WTV C;  1HA8 A;  3OYL A;  2VJI A;  3BCA A;  1T0F A;  2HI3 A;  2V9K A;  4UXN A;  1LDD A;  3CDH A;  2MLK A;  1CF7 A;  2K02 A;  2V4J C;  1ZTR A;  3PO3 J;  1FOX A;  2LY2 A;  3MMY B;  3TP3 A;  3JAM Z;  1J5Y A;  1ETK A;  2BXZ A;  1K6Y A;  1ZYR F;  2WY8 Q;  4DIQ A;  5C4J J;  4LG0 A;  1R1V A;  3HJE A;  3BG9 A;  3D5S C;  1WSU A;  5D6E A;  2D1H A;  5DUI A;  3ZP5 A;  4GYI A;  4RGX A;  3VOD A;  2CW8 A;  3DKY A;  1OCT C;  2R7O A;  2G0E A;  5LGN A;  2DT5 A;  3BJO A;  3PFI A;  4IZZ A;  2OUM A;  4G7Z F;  1HW2 A;  3BTL A;  2CH0 A;  3GBG A;  2M4K A;  3I53 A;  5CKT A;  3ABM H;  4A6D A;  1VQK I;  3QYE A;  2IEK A;  1LE8 A;  1AOY A;  1O7L A;  1FYM A;  2FXA A;  3HHH A;  2JSC A;  1R4N B;  3BR0 A;  5HOD A;  2RQP A;  3G1O A;  1Z6R A;  3KP7 A;  1IN4 A;  3OYI A;  3DPU A;  2JA6 J;  4A3G J;  2X1E A;  4KT5 C;  3PM1 A;  4BBR J;  3GFL A;  1WRJ A;  4JOM A;  4IRG A;  3TO6 A;  5KNL A;  3CD6 I;  3BR5 A;  3M1C A;  4E6K G;  4WCG A;  2M8G X;  2MW8 A;  2A3S A;  3KEY A;  2K5C A;  2OTJ I;  3AKZ A;  3BDD A;  3LSG A;  4AID A;  1B72 B;  1ODD A;  3FM5 A;  2DPU A;  3SJM A;  2AS5 F;  2XUB A;  3SZT A;  2LG4 A;  4BQA A;  4LK0 F;  2TRT A;  2LYC A;  5EDN A;  2VAS A;  1G6N A;  2YU9 J;  1MND A;  2XKP A;  3C2G A;  4BQO A;  1RNL A;  3MKW B;  1YYV A;  4E7L A;  1YE9 A;  2L02 A;  3V8L A;  2QQ9 A;  3VYT B;  3C2B A;  4BXX J;  1DGR M;  3HOS A;  3K4N A;  4Y7N J;  2VQH A;  1I3Q J;  4B43 A;  2X51 A;  4KMU X;  3MKL A;  5FJ8 J;  1VQO I;  1IRZ A;  5D5U B;  4UUS A;  4C2M J;  1PVE A;  4G7O F;  3GCM A;  4Z2Y A;  2DOF A;  5FLX Z;  1X2N A;  2V9P A;  1FYK A;  1X4P A;  4OIO F;  1MMS A;  4M3E A;  1AHD P;  3HUG A;  2F2E A;  3J7A Y;  2ZSI B;  4NC7 A;  3TL4 X;  3CC2 I;  3DKX A;  4A5M A;  5DV5 A;  1KZH A;  1PUE E;  2MC3 A;  4MO7 A;  1TT0 A;  2M4G A;  1YJN I;  3F21 A;  1OKR A;  1U5T A;  1P7J A;  1Z67 A;  2IAI A;  5IOZ A;  1ZAO A;  2M45 A;  2QEN A;  2JA5 J;  5FD6 A;  3GEZ A;  2QKL B;  1STZ A;  2BW3 B;  4U0W A;  3WTZ A;  3K2Z A;  4LB6 B;  1ZH5 A;  1MMN A;  3U21 A;  2KZV A;  1FOK A;  1AKH B;  2OQG A;  1FOY A;  2GOM A;  4PFP A;  4ZDP A;  4ESJ A;  5KK1 A;  1W36 C;  1SVL A;  5K1Y A;  1FTZ A;  1XMK A;  4M9Z A;  1DP7 P;  4WX9 A;  3VYR B;  5E3M A;  2WWY A;  1ZEL A;  2CFO A;  4OIN F;  2O3F A;  2XIG A;  1YS7 A;  4DYQ A;  5AON A;  2L7K A;  2VE9 A;  2K3F A;  5DCM A;  1P9Q C;  1I39 A;  5IP9 J;  3HTS B;  1G59 A;  5CVR A;  2YX7 A;  3OSF A;  4CDG A;  3PIO F;  4G6T B;  3OWT A;  2D5V A;  1W0U A;  4IQJ A;  2OA4 A;  4G9Y A;  5HDN A;  1BA5 A;  2V6C A;  4FHT A;  4CCK A;  1ZRF A;  1REP C;  1ZLK A;  4A3I J;  3M8E A;  1TZL A;  4IRH A;  3OS1 A;  1SMT A;  2OV7 A;  2ZJ2 A;  4AIH A;  4GCV A;  4D0P A;  2OZ6 A;  2AHQ A;  3C2H A;  2QF7 A;  1S7O A;  4A3F J;  1HC8 A;  2VI6 A;  2QM3 A;  2RKH A;  2AO9 A;  4UVC A;  2LMD A;  2RDP A;  4UNO A;  3F8M A;  2DJI A;  1WJE A;  3K9T A;  5FGM A;  1K4T A;  3S14 J;  5F0H A;  1T2K A;  1MIJ A;  2RNG A;  4RB2 C;  2R7D A;  4F7Z A;  1Y6I A;  2MG4 A;  1FIP A;  1K7A A;  2Q2E B;  1TWA J;  2RN7 A;  2GLO A;  2KIF A;  5L3G A;  1YHQ I;  2FMY A;  2IA2 A;  4BHC A;  2XB5 A;  4KN7 X;  2MA3 A;  2DU9 A;  2HTS A;  2FOW A;  3HC7 A;  3HIF A;  4L9J A;  5B3S H;  5HLG A;  3TED A;  1U8B A;  4E70 A;  3HRU A;  2Z3Y A;  4JX6 A;  3FMQ A;  4CIC A;  1OJL A;  2IW5 A;  4II2 A;  3GO5 A;  2DA7 A;  4KA4 A;  3M1E A;  5DYM A;  2IRF G;  2HKO A;  2PLY A;  4KFC A;  1Y0N A;  1QA6 A;  3ABK H;  3WG9 A;  4CO8 A;  3AG3 H;  4A5N A;  4BQN A;  5EJC A;  3CUO A;  4HOB A;  3CCQ I;  4IKF A;  2VXD A;  3GLL A;  1TWF J;  4E4H A;  1P4A A;  5B5E C;  2CV0 A;  4PJN A;  5EEG A;  4QIW N;  2NNN A;  2IJL A;  1GXP A;  2Z16 A;  3HB9 A;  1E3H A;  1U78 A;  1H8A C;  1TNS A;  4HLY A;  2ESH A;  3FXL A;  1WJC A;  5JHF A;  1TBX A;  2HNH A;  2E1N A;  2DFE A;  2BV6 A;  2MSY A;  2XAH A;  3CCL I;  5E8G A;  1RRJ A;  2QUF A;  1BI1 A;  3K6G A;  2R7V A;  2RGV A;  5H2F C;  1YW8 A;  2BVL A;  1Z21 A;  3ECH A;  2PJR B;  1JXS A;  2K9Q A;  5DDG A;  4IHT A;  4M3D A;  2K9M A;  4PGH A;  3RPQ A;  5IT3 A;  3BOQ A;  1Y1V J;  2MH2 A;  4ZYH A;  4MNU A;  1LUJ B;  1Z91 A;  2R4G A;  5IOY A;  2DA5 A;  4MGR A;  4NC8 A;  4FE7 A;  1N75 A;  4B3X A;  4H4K C;  4RA2 A;  2FOK A;  1BI2 A;  2GXG A;  3J80 Z;  5FRN A;  5BPI A;  3EET A;  4LOC A;  2NVX J;  2LD5 A;  1SAU A;  1I6X A;  2E7W A;  4BDY A;  1B8I B;  2HYJ A;  4HSR A;  1WWX A;  3H5N A;  4F52 A;  1IAW A;  1X1C A;  3CES A;  3I56 I;  2JA7 J;  2VT3 A;  3CC4 I;  1KQ9 A;  4HYE A;  2E1M C;  2VT2 A;  5GAG J;  4CCO A;  4RB3 C;  2M3A A;  3TW6 A;  3WGH A;  3LAJ A;  2VXZ A;  1W1W E;  1HF0 A;  3RCO A;  1CQT A;  1JHF A;  3PNY A;  2K9L A;  3C7J A;  3HPG A;  1K4S A;  1LFB A;  3HSE A;  3WU2 C;  2O03 A;  4HQE A;  1HBX G;  2DMQ A;  4ZTJ A;  3P5J A;  3L7W A;  1J59 A;  5L3B A;  5TJJ A;  2IXS A;  1SEU A;  1JT0 A;  3CF2 A;  2H1K A;  4M73 A;  4LB5 A;  1V5F A;  1MJ9 A;  2H8W A;  2FA5 A;  3JRA A;  1B4A A;  4AIJ A;  3OSG A;  1IUF A;  3B6C A;  2F5D A;  3G71 I;  4PGG A;  4CHU A;  4RMN A;  4CCM A;  4FET A;  3L2U A;  2JWT A;  4BDZ A;  4BY1 J;  1F5T A;  1Z0X A;  4RLQ A;  4CA0 A;  1Z9C A;  3DWL E;  1BBY A;  4BL0 B;  3JCU C;  4JX4 A;  2MYS A;  1RPW A;  2DYR H;  1LFU P;  3GTQ J;  4V19 K;  2ETH A;  3T5X A;  2F4O B;  3S93 A;  2F48 A;  2PG4 A;  3GFM A;  2IVM A;  2FJ1 A;  1B6A A;  1FP2 A;  2WY7 Q;  2EK5 A;  4XOP A;  1ETQ A;  3PIP F;  2ZME B;  2FBK A;  1MNM C;  3D0S A;  2LRE A;  3KLO A;  4XKB A;  3NQO A;  3M9A A;  5JHU A;  1Y8R B;  4PSW A;  1YO5 C;  1U0J A;  1JKR C;  2B7E A;  3BPX A;  3ZN1 A;  1XPX A;  3FX3 A;  2G7U A;  4N0B A;  4KMF A;  5LBQ A;  4NQW B;  3KP5 A;  4B44 A;  3I4N J;  3HRS A;  3DV8 A;  1MSF C;  1S5L C;  3S3O A;  1T08 B;  2COM A;  4G6D A;  4HX8 A;  3B02 A;  3KP2 A;  4M3G A;  2L2O A;  2QCO A;  3G1L A;  4ZYD A;  1AU7 A;  2VJ5 A;  4UHT A;  3GVA A;  4BU2 A;  2O7O A;  2KJB A;  1K6O A;  4S04 A;  4HLX A;  1BJA A;  4ZTF A;  2NXN B;  1FSE A;  4WF2 A;  2ISY A;  1YRN A;  1WH7 A;  4BHP A;  2K4J A;  2GA2 A;  2R7U A;  2V1U A;  3L09 A;  4MTE A;  3H9Q A;  1KGS A;  4RAF A;  3OYG A;  1UAA A;  3DPL C;  2A6T A;  2DQR A;  3G1M A;  1IN5 A;  1HDD C;  5EEA A;  3F22 A;  2F4I A;  1ETW A;  3DP7 A;  1FWZ A;  2DFH A;  4KDP A;  2P8T A;  1SD5 A;  2H6C A;  1GVD A;  1LVK A;  1T0F C;  5HVQ C;  1NG6 A;  1Q1V A;  3DBH B;  4BH9 A;  4KIC A;  3I55 I;  4EJV A;  2PMZ A;  2TCT A;  2HPM A;  1ZN2 A;  4B4C A;  1QZY A;  5LRS A;  1AKH A;  4L18 B;  4HX4 A;  2JA8 J;  2EA2 A;  3LA3 A;  3KP6 A;  3TDZ C;  1F9N A;  1ON2 A;  1HKS A;  2DO7 A;  2H6B A;  5DTD A;  2IP2 A;  4C9Y A;  2BZT A;  1HXD A;  1OPC A;  1MJA A;  1DGW Y;  1L0O C;  2FUG 2;  2UXN A;  3PNT A;  1TW3 A;  2B0L A;  2DI3 A;  3VB2 A;  1PDN C;  1XDU A;  5E17 F;  3WU1 B;  1XS9 A;  3GLX A;  3MAJ A;  2VJJ A;  4X6A J;  3S1N J;  4E7I A;  1ZRD A;  5DM7 F;  3CCV I;  4YEJ A;  4EJO A;  1PP7 U;  4IHW A;  4RGS A;  4M71 A;  4M9X A;  3VSK A;  2P6T A;  2DLL A;  3H36 A;  5E1X A;  1T39 A;  3IH2 A;  4PSX A;  1BI3 A;  1G8X A;  3WTT C;  2G9W A;  3QPL A;  3KP4 A;  4IHV A;  2YS9 A;  1XSV A;  3S2W A;  2HOE A;  2DMP A;  1GT0 C;  3WG7 H;  5KCM A;  5D5W B;  1KON A;  4XBF A;  2ZJR F;  1IN8 A;  1JUP A;  4XKW A;  2A68 F;  5EZH A;  2XAF A;  2K27 A;  1SC7 A;  4HBL A;  4RBO A;  2KIM A;  2QQB A;  5EGO B;  1OYW A;  3HYI A;  4HDU A;  1D5Y A;  1KU9 A;  4BHB A;  4I6Z A;  1IZ1 A;  4YEL A;  5DUK A;  3FBI B;  1Y39 A;  4GO1 A;  1RUN A;  1Z6T A;  4BBS J;  4YIR X;  1J75 A;  1WJF A;  2CQQ A;  3V7R A;  4EM2 A;  4HG2 A;  2JT1 A;  2L9S A;  3BG5 A;  1X4O A;  3OIP A;  4HW0 A;  3L2W A;  2KIS A;  2X0L A;  3GZN B;  2NS0 A;  3CJN A;  2LF8 A;  5M5W J;  4HA8 A;  1T8I A;  3MVP A;  2HYG D;  3HOZ J;  3ZQ7 A;  2RVC A;  5AIP A;  2XRO A;  1YI2 I;  1X1B A;  5A2Q K;  1XC5 A;  1BOB A;  1TQM A;  3MN2 A;  3E1S A;  4QLC U;  4IRI A;  2NNY A;  3Q9V A;  3HL2 A;  2L7F P;  3L2V A;  3VDX A;  1UFM A;  1MGT A;  2ZJP F;  1D8K A;  1R9T J;  3OL4 A;  1I1G A;  1JUM A;  4GXO A;  1ETV A;  4R1H A;  4J01 A;  2CUJ A;  1E17 A;  1YW9 A;  4MLO A;  5E3N A;  2W7N A;  2IS4 A;  4LJZ F;  4R79 A;  3HOT A;  1QPM A;  1EKE A;  3QYF A;  3SDG A;  3D5L A;  5FO5 A;  3W2V A;  2OU2 A;  2VKE A;  1U5T C;  3LOC A;  2RV8 A;  3SXY A;  1DU6 A;  4CUG A;  1N77 A;  3V7C A;  1K83 J;  3TOA A;  4OMY A;  4UY8 I;  3QWL A;  1UHM A;  1BC8 C;  3P9I A;  1S6L A;  2F5E A;  4UVB A;  2V9V A;  1E3O C;  2DMN A;  4KUM A;  4N9H A;  2LKX A;  3QU6 A;  1ETO A;  4MFD A;  2VB6 A;  2XB0 X;  2XV4 S;  1D1A A;  4CYD A;  1HDP A;  1D1C A;  4EMS A;  1VQL I;  5DCF A;  5H6R A;  1HKQ A;  2QVO A;  3HXL A;  2VQL A;  1APL C;  4AU7 A;  2KP6 A;  3P9C A;  1DDN A;  2LBF B;  1ZGA A;  3K1N A;  4O5V A;  3QPT A;  1MZB A;  4I01 A;  1A35 A;  5F64 A;  2A5W A;  3VYS B;  2LNB A;  4PUS A;  1ZRC A;  1LEB A;  4ZZL A;  3WTU C;  2E2H J;  3CP2 A;  3FMS A;  3ABU A;  1KA8 A;  3I3L A;  3PNV A;  1XTA A;  5M5X J;  3RSN A;  1U9O A;  3GUD A;  1BJZ A;  2PMZ N;  4JK1 X;  2KFD A;  3GZ6 A;  3K7A J;  1OR7 A;  1UHS A;  3MKZ A;  4J00 A;  3HDD A;  3FXK A;  1MDM A;  4XLH A;  3FWE A;  5GAH J;  2WV1 A;  1OCR H;  1YW7 A;  4AIK A;  3DKW A;  5F0F A;  2JN6 A;  1GUU A;  2VUM J;  1L3L A;  2BY1 A;  4H0E A;  2HOS A;  4CH7 A;  4S0H B;  2XAG A;  2CYY A;  1QNT A;  3M7G A;  3H9J A;  3H3V K;  3F6O A;  4E7S A;  3S1M J;  3F9K A;  4ZDO A;  5E79 C;  3HOU J;  1JTY A;  3RYP A;  3I71 A;  2M5W A;  3IRR A;  3PFY A;  2QKM B;  2FU4 A;  2RC4 A;  2F5C A;  2VBX A;  2X1D A;  3AL0 C;  3IHU A;  2Y48 A;  5GTI C;  3S1R J;  2L4M A;  4ENK A;  4IO9 F;  3V8J A;  1EH6 A;  2L9N A;  3HTU A;  3IWF A;  3GTM J;  2FD5 A;  2Y30 A;  3EQL F;  3ZRG A;  1S9H A;  4DGW B;  3SFI A;  2W25 A;  1FX7 A;  1P4X A;  4UB8 C;  1YOV B;  3OOU A;  2M87 A;  3BG7 A;  5IPA A;  1K78 A;  4MQV A;  5LD2 C;  2KIQ A;  2EB7 A;  1TQP A;  1HW1 A;  2P7C B;  2P4W A;  3QRF F;  4NQW A;  2JMW A;  1O3Q A;  4XM3 A;  2LY9 A;  2KL4 A;  3E7L A;  2MC4 A;  1J2X A;  3ZPL A;  5LGU A;  2ZKZ A;  2Y31 A;  3K1P A;  4L0Z B;  5H6Q A;  1XG1 A;  3F6V A;  4L5I A;  1BIA A;  3OV8 A;  1ZGW A;  1R00 A;  4EM1 A;  2ID3 A;  1GHC A;  3H5R A;  4XN0 A;  3ZQF A;  2J5O A;  3BTC A;  1JE8 A;  2Z2S B;  2JTV A;  1FEX A;  2BYV E;  1RET A;  4M3F A;  4L0Y B;  1SFE A;  2Y9Z A;  5IY5 H;  1TWG J;  5B1A H;  3IRQ A;  3MKY B;  1R7J A;  3HBL A;  3JR9 A;  5B66 C;  3JRH A;  2Q1Z B;  1R71 A;  4WWC A;  2P5L C;  5ILS A;  4U88 A;  2X4H A;  1QU3 A;  3HRM A;  4TV7 A;  4LIT A;  4A3D J;  1F43 A;  3K4C A;  4Z6Y A;  2K40 A;  3BG6 A;  3NWT A;  2UZK A;  2ZBK A;  2L9R A;  4XLN F;  4PK4 A;  3ROU A;  2VBW A;  2LOO A;  1J0R A;  2F4M B;  2R5Y B;  4N4N B;  2L4A A;  3BQZ A;  2Y0S A;  5KAF C;  2ELK A;  1UHW A;  2ECC A;  4EV0 A;  5IT9 K;  5IYB J;  2HOA A;  3V8K A;  3RPU D;  5HS7 A;  2QBY A;  1RKT A;  1KYW A;  1VQP I;  2FRH A;  2Y0M A;  1YJ9 I;  1NK3 P;  1LJ9 A;  1XMX A;  3GTO J;  2BHZ A;  5H20 A;  3R4K A;  5LRR A;  3J7A O;  1HSJ A;  4NNJ A;  4C3I J;  3LA7 A;  4IPA A;  2CQN A;  5E8I A;  5J47 A;  2IT0 A;  1WH5 A;  2COB A;  4BXU A;  2R7Z J;  5K7F A;  5E3L A;  1IDY A;  1E0E A;  3PO2 J;  3P7N A;  4CCL A;  3FXR A;  1BR1 A;  1U8R A;  5LLQ A;  2GAU A;  1RIO H;  2DOA A;  5CVU A;  2EBI A;  2RAE A;  2UV1 A;  2L0K A;  1R22 A;  4A3E J;  4U87 A;  3W6K B;  3DBR B;  1G3W A;  3ABL H;  4UUT A;  1NG7 A;  3HKZ A;  2PFB A;  3OYK A;  4FCY A;  2BY3 A;  3ZQQ A;  3I4M J;  3A01 A;  1W7P D;  3TGN A;  3BP8 A;  2DN0 A;  3WGG A;  3HOW J;  2HVR A;  4IOA F;  4OMZ A;  1QZE A;  4QSH A;  1YX5 A;  2O8X A;  4E7Z A;  1VQ4 I;  1EH7 A;  4XLF A;  2CWE A;  3CCU I;  3BWG A;  3TMO A;  1H0M A;  1V3F A;  5E3O A;  3K70 C;  2LY1 A;  2LVS A;  1OLT A;  3BJA A;  3H0G J;  3OL3 A;  5M3M J;  1W4M A;  2QZ8 A;  3HPH A;  4C3H J;  1TL8 A;  5J8C A;  1MSE C;  1X1A A;  4RS8 A;  3K4K A;  2HS5 A;  3F8F A;  3DLL F;  2OQR A;  2OD5 A;  3IH3 A;  1MMD A;  4I2O A;  3KP3 A;  1MBH A;  4U0V A;  2O0Y A;  4EJW A;  3J81 K;  1H88 C;  3AG1 H;  1FBQ A;  3F23 A;  3S15 J;  4MFE A;  5FD5 A;  1WJD A;  3N05 A;  3RZD J;  3HRT A;  4OU0 A;  4P96 A;  3BZ6 A;  4HZF A;  1VF9 A;  1ZLJ A;  4I0A A;  2XGE A;  3BTI A;  2DDA A;  2EZK A;  3MQ0 A;  4FX0 A;  3NRV A;  2DFF A;  2PBI A;  2BE5 F;  2VBY A;  3GW2 A;  1UCR A;  2IA0 A;  3RJP A;  1IF1 A;  1BW5 A;  3RKW A;  3K69 A;  3F8N A;  2DT7 B;  4ZYG A;  2VQC A;  1RKW A;  4A0Y A;  3T1B A;  2ZXH A;  4YG2 F;  3ZQL A;  1IXC A;  1J09 A;  5J1U A;  4HEA 2;  2ELH A;  5GAD J;  2HPI A;  3FHZ A;  1WQ2 A;  2E19 A;  3OIQ A;  3CJQ B;  5EG0 B;  4GFB A;  2GWR A;  1LQ1 A;  2FQ3 A;  4RAG A;  3T0Y A;  2HWV A;  4XLP F;  2O6G E;  2DAO A;  3BZK A;  4BS9 A;  3RZO J;  2V7F A;  2X48 A;  2DDB A;  4BY7 J;  3EUK L;  4LK1 F;  1VQ7 I;  2JQ7 A;  4D9J A;  3TKY A;  1F36 A;  2JA2 A;  3WOD F;  3Q5F A;  4EJT A;  4NB5 A;  2K86 A;  2MD5 A;  2WAE A;  1W7P B;  1ULY A;  3LSJ A;  1TLH B;  2HTJ A;  4L9N A;  4IQ4 A;  1FSH A;  3I59 B;  3GFI A;  2EIK H;  2K85 A;  4PZJ A;  2EJR A;  1KQ8 A;  1GDT A;  1SD7 A;  2LBF A;  2XAU A;  5D4S A;  1S3J A;  4BE1 A;  5ILV A;  2VKH A;  5D5X B;  2LDU A;  1MBE A;  3I4P A;  2DW4 A;  3B6A A;  3ZQC A;  1IRX A;  1EV7 A;  2CO5 A;  3F72 A;  1YLF A;  2R93 J;  3NAU A;  2STT A;  3JW4 A;  2XGC A;  2PJP A;  2JPB A;  3OYC A;  1QBJ A;  1EF4 A;  2Y0S N;  2G7H A;  4LFU A;  3TW7 A;  3LSK A;  2E1M B;  5HNH A;  1LKX A;  1T6S A;  3DTE A;  1WI3 A;  2HQR A;  3H5A A;  2XKO A;  5JR3 A;  2VL8 A;  4J19 A;  1X3U A;  1O3T A;  5C44 J;  2EWN A;  4AUX A;  3FXO A;  1E3P A;  3ZGK A;  4XIC A;  1D8J A;  1PUF B;  4OIR F;  1HCR A;  2BHY A;  4JX5 A;  2GXA A;  5BS6 A;  1R58 A;  2ESN A;  3E6C C;  3LSM A;  5K7H A;  1VQM I;  2V1D A;  3RIR A;  4MEY F;  2LH9 A;  2FE3 A;  2LSO A;  2VKD A;  2YX4 A;  2Z1D A;  1TC3 C;  4A3C J;  1D0Y A;  3COA C;  3DF8 A;  5EYR A;  2KPM A;  3JRF A;  3N97 A;  2GIZ A;  2W84 A;  3HKZ N;  2W4S A;  3GTP J;  3ISP A;  4CYC A;  1BR2 A;  2VC0 A;  4IL6 C;  5HDK A;  3FK7 A;  2ZXW H;  2KRF A;  4N9I A;  3CME I;  3E97 A;  3GTG J;  1RES A;  2CQK A;  3OYJ A;  3DQV C;  1SAX A;  1LEA A;  5CQG A;  1D3Y A;  2CRG A;  2STW A;  3M3Y J;  2GOX B;  2Y9Y A;  5LHG A;  3IAM 2;  1VFC A;  2F6C A;  2O9L A;  3HGG A;  4MQ9 F;  2YU3 A;  3I58 A;  1S72 I;  1NHA A;  4I99 C;  1A6I A;  1TQI A;  2MFZ A;  5EEH A;  1XGN A;  1C0W A;  5CJ9 A;  1UMQ A;  2HR3 A;  2L9V A;  1VQ9 I;  1KYZ A;  4ESF A;  4B48 A;  2JRM A;  2HOT A;  5M3F J;  2DTR A;  1MW7 A;  1O3R A;  2DA3 A;  1K79 A;  5GAE J;  5KVR A;  3S1Q J;  2E34 A;  3E5X A;  3QP6 A;  1LDJ A;  3BPV A;  1I5Z A;  3BZC A;  5AIQ A;  1S7E A;  3FF5 A;  3FKI J;  4HF1 A;  1WFX A;  3SZG A;  4C3J J;  2VN2 A;  2WC2 A;  4RM2 A;  5CVV A;  3CLQ A;  2L7Z A;  3W6J B;  1BIB A;  4ZH4 F;  1TWH J;  3EYY A;  4XLA A;  3HOX J;  4C2T A;  2HFH A;  3L2C A;  1DUX C;  4O3M A;  1YG2 A;  2AQE A;  2M9H A;  2RQQ A;  4BJT A;  4HNV A;  5GP9 A;  4OWR B;  2E2I J;  3C18 A;  1MKM A;  3ZOB A;  1B72 A;  3RKY A;  1XX5 A;  4BEH B;  4I0B A;  3ZQI A;  3CP8 A;  4PJL A;  4OAZ A;  4C30 A;  1X3W B;  5JI6 A;  5ICC A;  2KMU A;  2X1C A;  3G3Z A;  3MWM A;  4F91 B;  4G12 A;  2FX0 A;  2X6X A;  4ESB A;  4Y33 A;  5CPR B;  3IL2 A;  1OR7 C;  1J9I A;  2XPV A;  3RKX A;  1U2W A;  1LVA A;  5KHD A;  3JSP A;  4CXF A;  4RAY A;  1KU3 A;  2BXY A;  1QVT A;  1I3A A;  5JLW A;  3P9K A;  2K9N A;  1VQ8 I;  1WVR A;  1BR4 A;  4B3A A;  4HRI A;  1I1S A;  2R7T A;  2IPQ X;  3KZI C;  4Y15 A;  4N4O B;  4PCQ A;  4HNT A;  2H8R A;  5FKK A;  1QO0 D;  2Z5U A;  3VSL A;  4W97 A;  2IS6 A;  1MBK A;  1IDZ A;  2HDD A;  4LIU A;  4M6X A;  3VEP A;  1LE8 B;  2QSH X;  2W48 A;  3CMY A;  2KKO A;  3RI4 A;  1ZR2 A;  4HF0 A;  2R7F A;  4Y17 A;  3H3U A;  4EGZ A;  1D1B A;  3BLY A;  3CUQ B;  2LC2 A;  2Z33 A;  3O8H A;  2HQN A;  2PX9 A;  5DD4 A;  3L2Q A;  1ZG5 A;  1BW6 A;  3IKV A;  1U6G A;  3QU3 A;  5LEK A;  4HST A;  3CCM I;  1XGO A;  3DXJ F;  2QQA A;  3HOY J;  4HPQ A;  2MLG A;  1SVO A;  2OJE D;  4F92 B;  2GM4 A;  2CUZ A;  2HXO A;  2BW3 A;  2E35 A;  4OOI A;  3CLO A;  2TDX A;  5ED4 A;  3CF5 F;  2DA2 A;  1DP3 A;  2JRT A;  4ITV A;  2YSR A;  3S3M A;  4AVP A;  3HHG A;  1Z3Y A;  1AA7 A;  3MCZ A;  1FY7 A;  3KFW X;  2JPC A;  4FT8 A;  3FK6 A;  2A69 F;  9ANT A;  1MD0 A;  1JJ8 C;  4AM3 A;  3CC7 I;  2Q8K A;  4M6V A;  1ZG1 A;  3DEE A;  3OYH A;  3HSF A;  3ML6 A;  3ERM A;  1MH4 A;  1X1D A;  1JKQ C;  4A3K J;  4D1Q A;  2GZW A;  3E6B A;  5HLI A;  2EIJ H;  4PFO A;  4M72 A;  3ZMZ A;  3DU6 A;  1YIO A;  3DEW A;  1K61 A;  1FTT A;  1P7I A;  1RC9 A;  1P92 A;  4IEJ A;  2QQ8 A;  4A0X A;  4Y4R A;  4UUS B;  3RPU A;  5C3E J;  3TP0 A;  2R7S A;  3R61 A;  2KZG A;  4BJ5 C;  1HQC A;  4BQQ A;  4FAS D;  4B09 A;  3BQY A;  3WU0 A;  3CO6 C;  4UB6 C;  5IP7 J;  1QHH D;  4BE2 A;  3OR1 C;  2PEX A;  3O6B B;  1GV5 A;  1O7F A;  1UZC A;  3CO7 C;  1EA3 A;  4E7H A;  4F3Q A;  3JAM K;  2BY2 A;  1ITY A;  2Q2E A;  4UVA A;  3N4M A;  3TOB A;  5EG0 A;  1T95 A;  4YFK F;  3OYM A;  2BGC A;  1V5E A;  1KU2 A;  2M34 A;  3L2R A;  1U5T B;  3ZMD A;  1BOA A;  1JJ6 C;  2PN6 A;  5LHH A;  1A04 A;  4Q47 A;  1JGS A;  3VWB A;  2VKV A;  3KX2 A;  3PL8 A;  4V2G A;  4XRS A;  2FEZ A;  4GYG A;  3IWZ A;  4AYB A;  3O2P E;  2X9D A;  1SAN A;  2XGD A;  4MTD A;  3CQZ J;  2EA4 A;  2OBP A;  4P9U A;  2FBH A;  2CUE A;  4AD9 A;  3KIO A;  2XPU A;  4II3 A;  1XN7 A;  1YX3 A;  3SZP A;  3PSI A;  2ISZ A;  3FXM A;  1NK2 P;  3LSP A;  2E36 A;  2XRL A;  4XOT A;  1X58 A;  2JZY A;  1SMY F;  2KHM A;  5DCM B;  3AFH A;  4G6Q A;  4B1R A;  4RB0 A;  2NOG A;  4ENN A;  2HQA A;  1WHU A;  2CV2 A;  2DT6 A;  3ABT A;  2CU7 A;  3WTY C;  2VOO A;  3HSR A;  3AG4 H;  2R92 J;  1YQA A;  3CCS I;  2W24 A;  2I5U A;  3BC8 A;  2OCE A;  2RNJ A;  3GME A;  2AXL A;  3R60 A;  4R8H A;  2NVQ J;  4A93 J;  5HLT A;  4KNY A;  3PQK A;  2VOP A;  2DFI A;  4B8X A;  4WXC A;  2F5V A;  2VPL A;  1WJA A;  2V79 A;  3DU5 A;  2PJR A;  5TIS C;  2XSJ C;  3DCF A;  3IC7 A;  5HLH A;  3M07 A;  5J8F A;  2WAQ A;  2NVU B;  4DYC A;  5IP6 A;  2IGK A;  2XF7 A;  4MIM A;  1JKP C;  1MBG A;  1ZRE A;  3MZ8 A;  1I27 A;  3QYB A;  2OTL I;  1IRG A;  2QEX I;  1GV2 A;  3K4M A;  5BQT A;  1FJL A;  1JKO C;  2XC7 A;  5JLX A;  5FLV A;  4BGD A;  2WAD A;  4EEF G;  2ACJ A;  2LKS A;  2QSF X;  5L3F A;  4DBR A;  3JRI A;  5K5Q A;  4M3B A;  5K5O A;  4ZZD A;  1B8I A;  3H9G A;  5FLX K;  4XID A;  2ZO4 A;  1UG2 A;  4ZJZ A;  4BJ6 C;  1ERD A;  2GQQ A;  2R3S A;  3JTG A;  2OZU A;  1UG0 A;  1O57 A;  3AL0 B;  4KIB A;  3G73 A;  1SFO J;  3OYB A;  1WKM A;  3JTH A;  2OCC H;  3BG3 A;  3FIW A;  5F6F A;  3Q3S A;  4PDK A;  2ZNY A;  2NRA C;  3VFZ A;  3FIS A;  5F1J A;  3FHN A;  4XR6 A;  5KAI C;  5FFX A;  1HW5 A;  3WTS C;  2PI0 A;  4PJ0 C;  3JRB A;  5M5Y J;  4KJZ A;  3E6D A;  2XF6 A;  4I7H A;  3JRG A;  4XN3 A;  4LLG F;  3WTW C;  2IS1 A;  1R1U A;  3R0J A;  5JFR A;  3T8R A;  1P4W A;  4DQ2 A;  3K4B A;  2IGN A;  2BOL A;  2XAS A;  1XB4 A;  1XMA A;  4ZYE A;  1UJ8 A;  1FOW A;  1SD6 A;  4JQF A;  1S8N A;  2HZT A;  3I54 A;  4NUB A;  3AG2 H;  5E18 F;  2DJN A;  4IJA A;  1G3S A;  2YUS A;  3B73 A;  3OS2 A;  2EPF A;  3M8F A;  3PUB A;  2DBB A;  5L3E A;  3MZH A;  1G2H A;  1H9G A;  3DTI A;  2CMP A;  3QOE A;  2BEO A;  3BJ6 A;  5B1B H;  3ZR8 X;  4KIG A;  3D5R C;  2QWW A;  4Q48 A;  1ACI A;  2XAJ A;  4A0Z A;  1FP1 D;  1R6R A;  4XON A;  1OCO H;  5D4R A;  2BVM A;  1WJB A;  4CGZ A;  3GX4 X;  1O3S A;  1OYI A;  2AXT C;  1MJB A;  2CUF A;  2XGX A;  3FXU A;  3SEZ A;  4CZZ A;  1YIT I;  1RR8 C;  2L3D A;  1FYL A;  2ZME A;  3K70 D;  3BCB A;  1MH3 A;  1W36 D;  4D5F A;  1VZ0 A;  4LIV A;  1TWC J;  2H1L A;  2MGQ A;  1FLI A;  2PMU A;  4FX4 A;  4BEH A;  1FIA A;  2GA1 A;  4HNU A;  1MMG A;  4DOZ A;  1T56 A;  3DFG A;  4HAM A;  5F04 A;  1X2M A;  1GVJ A;  3OOP A;  1U9N A;  1OMI A;  1Z05 A;  5LGT A;  4KIF A;  4X0G A;  3S3N A;  1IXS B;  4AYB N;  4IF4 A;  3LNQ A;  1Z7L A;  3ZN0 A;  3WGI A;  2WV0 A;  3S32 A;  3EUH A;  3K1M A;  4RM3 A;  1FZP B;  3AAF A;  2HEO A;  4IHY A;  3DBL B;  3FM3 A;  4LGW A;  3S16 J;  3OYE A;  1PYV A;  2ZNZ A;  1IV8 A;  2XF5 A;  4D7N A;  2MBF A;  2WB1 A;  1HST A;  2H94 A;  2LP0 A;  5GPC A;  1X1P A;  4OAY A;  5F0C A;  4P9F A;  3OR2 C;  1KQ0 A;  4XSX F;  4XQF A;  3ASO H;  4HV6 A;  4L9V A;  1MMA A;  3RYR A;  1A5J A;  3DTK A;  3CJR B;  4M74 A;  2HKX A;  3H35 A;  1N78 A;  2KQR A;  3CUQ A;  4AVZ A;  3FMR A;  2VJ4 A;  3VPR A;  1OCZ H;  1LDK B;  5A2Q Z;  1ZGJ A;  4DBQ A;  2W82 A;  5FKM A;  1W0T A;  2KJC A;  2H27 A;  2WAQ N;  4LLL A;  2XDV A;  4YII A;  2JVG A;  3S8P A;  1FBS A;  5ERI A;  3BT9 A;  2WTE A;  5ICE A;  2QA4 I;  5FKO A;  3GWZ A;  1R5G A;  1TTY A;  5LHI A;  1EH8 A;  1YIJ I;  4IVN A;  2RRE A;  1VQN I;  3QPH A;  2EIM H;  2FF4 A;  5GTH C;  3NAR A;  3QQA A;  3ZQH A;  3UNG C;  3PUF A;  5LEJ A;  4XMY A;  1ZAR A;  1W5C C;  2IGM A;  1FC3 A;  1G4D A;  3KYC B;  2YPR A;  4LG3 A;  4M9S A;  2ADU A;  2D1V A;  2A07 F;  2O61 A;  3ZMV A;  3PJR A;  1V4R A;  2QGU A;  1OYY A;  3GTL J;  1UST A;  2ZFU A;  3BTJ A;  1R5H A;  2DOE A;  5FRO A;  4CCN A;  3J80 K;  1D0Z A;  4FTH A;  5BPD A;  4WXH A;  4AWX B;  2EH3 A;  2ZXJ A;  4Y13 A;  2NYX A;  2KLO A;  2X6Y A;  5J6X A;  1V54 H;  4YFN F;  3CMA I;  2CGP A;  6PAX A;  1G3Y A;  4BXF A;  2NVY J;  1YRN B;  3K10 A;  2HXI A;  1CGP A;  3MFK A;  2V6E A;  2L54 A;  2R5Z B;  3KZY A;  4BKX A;  5E1Z B;  2M7B A;  5J4V A;  4F93 B;  2E5N A;  3A0H C;  2MD0 A;  1M1E B;  1AWC A;  3LA2 A;  5EGO A;  2CQ7 A;  3TO9 A;  1YFH A;  3CCJ I;  4GRI A;  3PQJ A;  2H09 A;  3SHF A;  1YTY A;  3E5Q A;  3M4O J;  2I8D A;  1WJ5 A;  1J7K A;  3KYL A;  1XGM A;  2LRD A;  4ASN A;  5K7Z A;  1RI7 A;  1IGN A;  2NS8 A;  4XSZ F;  3BR6 A;  3GXO A;  4JBA A;  2HQ5 A;  2VON A;  1S7A A;  1Z7U A;  3FDY A;  2MH9 A;  3BRO A;  1W5T A;  2ME0 A;  3LQQ A;  1UB9 A;  1RUO A;  4DW6 A;  2DQL A;  1XGS A;  2VBZ A;  3ZMU A;  2VQG A;  5DD8 A;  2LK2 A;  2XRN A;  3GTJ J;  1WGX A;  1QZZ A;  4GDF A;  1BM9 A;  3K2A A;  5F27 A;  4KIS A;  2X85 A;  3JRC A;  2DCE A;  2CS3 A;  2A5Y B;  2NAZ A;  1FMW A;  1LFP A;  5EZG A;  5FKL A;  4MHG A;  1XSD A;  3F0C A;  3V7S A;  5D8K B;  2DK8 A;  2JJ7 A;  2HZD A;  3HG9 A;  1QQI A;  4K2E A;  1SFX A;  3T8T A;  2IGO A;  3RDI A;  3OY9 A;  3ZMS A;  4G8X A;  2KRH A;  4BAC A;  2VLA A;  2E71 A;  3S17 J;  1A6Q A;  1MBJ A;  2CFX A;  2DK5 A;  3S2H J;  2WB1 N;  3BY6 A;  2CW7 A;  4QTR A;  4BAY A;  2VIX A;  3LSI A;  5FB2 A;  2ZFW A;  3K0L A;  2OF7 A;  4IXA A;  4KT6 A;  2LFB A;  1JGG A;  2V1X A;  4C2U A;  5CYV A;  1VND A;  2M2E A;  1Y1W J;  2PQ8 A;  1B1B A;  1NTC A;  3FXQ A;  4BYY A;  2ZJQ F;  2W85 A;  2EFW A;  2UWM A;  2A6H F;  2CG4 A;  3CMM A;  2R7Q A;  1QVU A;  2GIV A;  1ZK8 A;  3Q0W A;  3U1K A;  2DOD A;  5L3D A;  2BY0 A;  3KPH A;  2M0C A;  4QPO A;  4IX7 A;  2ICW G;  2ID6 A;  2R7W A;  4A3J J;  3CCE I;  1DU0 A;  2HDC A;  5HS9 A;  4YRV A;  2A6E F;  4A69 C;  3CCR I;  3L9F A;  4NBQ A;  1D5V A;  3CDI A;  3OMY A;  3H3Z A;  2DMU A;  3W2A A;  2UUZ A;  2VC1 A;  3RTR A;  2M8E A;  4Q4Z F;  4JP0 A;  2K9S A;  2XHK A;  1IC8 A;  3A1Y A;  2E1O A;  4RGR A;  4A6E A;  1ON1 A;  1T38 A;  2QYO A;  1LB2 A;  4V2F A;  2Y2Z A;  3GZ5 A;  4JYK A;  5IT9 Z;  3J7Y J;  4XL9 A;  1X3Z B;  4Y52 J;  2K4B A;  3W2W A;  3LMM A;  4RGU A;  4EGY A;  4WXD A;  5IYC J;  3WE3 A;  4IHX A;  3NEU A;  3VOE A;  4EM0 B;  2X6O A;  1IJW C;  1BN5 A;  4FQG A;  1XDS A;  1QRY A;  2E1C A;  3A02 A;  4A3L J;  5HNF A;  1FT9 A;  3F8B A;  3LQR A;  2BBY A;  2HYF A;  5FLM J; 
#chains in the Genus database with same CATH homology
 1PP8 F;  4Q5S F;  3LFK A;  2VOD A;  3ZMT A;  3MEX A;  2FNA A;  2L01 A;  2EFP A;  5DEQ A;  3I0T A;  4P55 A;  1RZ4 A;  3GFJ A;  3QOP A;  4EQQ A;  1VTN C;  1MDM B;  3FZV A;  5ICG A;  4A12 A;  1P6R A;  5E1W A;  1SD4 A;  1R23 A;  2EV6 A;  2Z9O A;  2VE8 A;  3J81 Z;  2A61 A;  2P5V A;  1TW2 A;  2Y75 A;  3C3W A;  2EV5 A;  1FPQ A;  5D8L B;  3U9G A;  2P6S A;  4P5O A;  3ULQ B;  5FFZ A;  2YR2 A;  4L5J A;  4YIF A;  4HQM A;  1B9N A;  1CF7 B;  4U0Y A;  1F4K A;  3WTX C;  1ONV A;  4LG0 B;  3ERE D;  1IW7 F;  3O3K A;  1S29 A;  1K78 B;  5ILU A;  4ENM A;  4LD5 A;  5BMZ A;  2DPD A;  2K7L A;  2XVC A;  1XCB A;  1ZG3 A;  3L00 A;  2KIU A;  1SFU A;  3Q9S A;  2HGC A;  3DEU A;  5HOO A;  4NHJ A;  2EFQ A;  1QGP A;  2J5P A;  1XCV A;  1BC7 C;  3LAP A;  4HDV A;  1XD7 A;  1Q1H A;  1KU7 A;  3V4G A;  3REO A;  3KCC A;  4LLN A;  3LST A;  4RB1 A;  3QAH A;  3QP5 A;  4I98 B;  3KEO A;  4WK8 F;  4ENJ A;  3IKT A;  3SFZ A;  1TNT A;  4LMY A;  4OIP F;  3WE2 A;  5L3C A;  1IUY A;  1XSX A;  2QBY B;  1IRF A;  4G7H F;  3JSO A;  2EFN A;  4A2U A;  2QLZ A;  4HV5 A;  3MZY A;  5HDG A;  3ECO A;  1JHH A;  3C1D A;  3CUQ C;  3U1D A;  1ZHF A;  2FNP A;  4HF2 A;  2XAQ A;  4MEX F;  2UXX A;  3KZZ A;  1R36 A;  4I02 A;  3R6S A;  3H92 A;  1DPU A;  2FSW A;  2Q0O A;  1R1T A;  2EV0 A;  4I09 A;  2D45 A;  1W7P A;  2P7V B;  3I59 A;  4G94 A;  3GF2 A;  4O6J A;  5E20 A;  1FBU A;  4ETS A;  4S05 A;  4XRF A;  2M1B A;  5K5R A;  4UV8 A;  3KET A;  1F1Z A;  5D6F A;  4L9T A;  2ZCW A;  5HS8 A;  1T98 A;  3CTA A;  3E3V A;  4U7D A;  3KE2 A;  2OAZ A;  2P5K A;  2GXB A;  1E2X A;  4GGG A;  3TDU C;  4KYW A;  1IN7 A;  1WI9 A;  1Y0U A;  5CLS A;  3F8C A;  1W5S A;  3F3X A;  4EJU A;  1U3E M;  3ELK A;  2LF7 A;  2EFO A;  2W57 A;  3SQN A;  2D2W A;  5BOX A;  4M6Y A;  5ICF A;  5CVI A;  1HKT A;  4IHS A;  1IXR C;  1LNW A;  3EDP A;  5CVJ A;  1G3T A;  2C6Y A;  3KLN A;  2M30 A;  4YFX F;  3TQN A;  5JVT A;  1B59 A;  4KN4 X;  1USS A;  5D5V B;  3TO7 A;  2IA1 A;  2Z99 A;  3I5U A;  4DNC A;  4UUV A;  2E7X A;  3KEQ A;  3EYI A;  4ON0 A;  2F5F A;  4HX7 A;  4RAZ A;  2FBI A;  3E5U A;  1H9T A;  5F1R A;  2CSO A;  4BNC A;  4OIQ F;  3LWF A;  1P2F A;  4EVI A;  2PMH A;  3R0A A;  1IN6 A;  4QWQ A;  4UV9 A;  4U7B A;  1B9M A;  2LKP A;  3GYH X;  1DPR A;  3DPT A;  2FML A;  1BI0 A;  1GXQ A;  3I64 A;  1FNN A;  5TRD A;  1YS6 A;  1Z1D A;  3E6M A;  2CW0 F;  3U2R A;  3WTV C;  1T0F A;  4UXN A;  1LDD A;  3CDH A;  2MLK A;  1CF7 A;  2K02 A;  3JAM Z;  1J5Y A;  1ZYR F;  4LG0 A;  1R1V A;  1WSU A;  5D6E A;  2D1H A;  5DUI A;  3ZP5 A;  4GYI A;  4RGX A;  3VOD A;  5LGN A;  2DT5 A;  3BJO A;  3PFI A;  4G7Z F;  1HW2 A;  3I53 A;  4A6D A;  1AOY A;  1O7L A;  1FYM A;  2FXA A;  3HHH A;  2JSC A;  2RQP A;  1Z6R A;  3KP7 A;  1IN4 A;  4KT5 C;  3GFL A;  1WRJ A;  4IRG A;  3TO6 A;  4WCG A;  2A3S A;  3BDD A;  1ODD A;  3FM5 A;  2DPU A;  2AS5 F;  2XUB A;  3SZT A;  4BQA A;  4LK0 F;  1G6N A;  2XKP A;  1RNL A;  1YYV A;  2L02 A;  3V8L A;  2QQ9 A;  3HOS A;  4KMU X;  5D5U B;  4G7O F;  4Z2Y A;  5FLX Z;  1FYK A;  4OIO F;  3HUG A;  2F2E A;  4A5M A;  5DV5 A;  1PUE E;  2MC3 A;  3F21 A;  1OKR A;  1U5T A;  1ZAO A;  2M45 A;  2QEN A;  5FD6 A;  3GEZ A;  1STZ A;  4U0W A;  3WTZ A;  3K2Z A;  4LB6 B;  1ZH5 A;  1FOK A;  2OQG A;  4ESJ A;  5KK1 A;  5K1Y A;  1XMK A;  4M9Z A;  1DP7 P;  4WX9 A;  2WWY A;  4OIN F;  2O3F A;  2XIG A;  1YS7 A;  5AON A;  2VE9 A;  5DCM A;  3HTS B;  5CVR A;  2YX7 A;  4CDG A;  2OA4 A;  4G9Y A;  5HDN A;  2V6C A;  4FHT A;  1ZRF A;  1REP C;  1ZLK A;  3M8E A;  4IRH A;  1SMT A;  4D0P A;  2ZJ2 A;  4AIH A;  4GCV A;  2OZ6 A;  1S7O A;  2QM3 A;  2RKH A;  4UVC A;  4UNO A;  2RDP A;  3F8M A;  3K9T A;  5FGM A;  1T2K A;  4RB2 C;  2R7D A;  4F7Z A;  1K7A A;  2RN7 A;  2KIF A;  5L3G A;  2FMY A;  2IA2 A;  4BHC A;  4KN7 X;  2MA3 A;  2DU9 A;  2HTS A;  5HLG A;  3HIF A;  4L9J A;  4E70 A;  3HRU A;  2Z3Y A;  3FMQ A;  4CIC A;  2IW5 A;  3GO5 A;  4KA4 A;  3M1E A;  5DYM A;  2IRF G;  2HKO A;  2PLY A;  4KFC A;  4CO8 A;  3WG9 A;  4A5N A;  3CUO A;  4HOB A;  1P4A A;  5EEG A;  2NNN A;  2IJL A;  1GXP A;  1U78 A;  1TNS A;  4HLY A;  2ESH A;  1TBX A;  2E1N A;  2BV6 A;  2XAH A;  5E8G A;  2QUF A;  1BI1 A;  2RGV A;  1YW8 A;  1JXS A;  3ECH A;  5DDG A;  4IHT A;  3RPQ A;  4PGH A;  5IT3 A;  3BOQ A;  2MH2 A;  4ZYH A;  4MNU A;  1Z91 A;  4MGR A;  2FOK A;  1BI2 A;  2GXG A;  3J80 Z;  5BPI A;  3EET A;  1I6X A;  2E7W A;  1WWX A;  1IAW A;  2VT3 A;  1KQ9 A;  4HYE A;  2VT2 A;  4RB3 C;  3WGH A;  3LAJ A;  2VXZ A;  1JHF A;  3C7J A;  3HSE A;  2O03 A;  4HQE A;  1HBX G;  3L7W A;  1J59 A;  5L3B A;  5TJJ A;  4M73 A;  4LB5 A;  1MJ9 A;  2FA5 A;  1B4A A;  4AIJ A;  2F5D A;  4PGG A;  4CHU A;  1F5T A;  1Z9C A;  1BBY A;  2ETH A;  3T5X A;  2PG4 A;  3GFM A;  2IVM A;  1B6A A;  1FP2 A;  2EK5 A;  2ZME B;  2FBK A;  3D0S A;  3KLO A;  3NQO A;  3M9A A;  5JHU A;  1YO5 C;  3BPX A;  3ZN1 A;  3FX3 A;  2G7U A;  4N0B A;  4KMF A;  5LBQ A;  3KP5 A;  3HRS A;  3DV8 A;  2COM A;  4G6D A;  4HX8 A;  3B02 A;  3KP2 A;  4ZYD A;  4UHT A;  3GVA A;  2KJB A;  1K6O A;  4S04 A;  4HLX A;  1BJA A;  1FSE A;  4WF2 A;  2ISY A;  4BHP A;  2K4J A;  2GA2 A;  2V1U A;  3L09 A;  4MTE A;  1KGS A;  3DPL C;  2DQR A;  1IN5 A;  3F22 A;  3DP7 A;  1FWZ A;  4KDP A;  2P8T A;  1SD5 A;  2H6C A;  5HVQ C;  4BH9 A;  4KIC A;  4EJV A;  1ZN2 A;  4L18 B;  1QZY A;  5LRS A;  4HX4 A;  2EA2 A;  3LA3 A;  3KP6 A;  3TDZ C;  1F9N A;  1ON2 A;  1HKS A;  2DO7 A;  2H6B A;  2IP2 A;  1HXD A;  1OPC A;  1MJA A;  1L0O C;  2UXN A;  1TW3 A;  2B0L A;  2DI3 A;  3VB2 A;  1PDN C;  1XDU A;  5E17 F;  3WU1 B;  3GLX A;  3MAJ A;  1ZRD A;  4EJO A;  1PP7 U;  4RGS A;  4M71 A;  4M9X A;  2P6T A;  2DLL A;  5E1X A;  1T39 A;  1BI3 A;  3WTT C;  2G9W A;  3KP4 A;  1XSV A;  3S2W A;  2HOE A;  5D5W B;  4XBF A;  1IN8 A;  2A68 F;  2XAF A;  2K27 A;  4HBL A;  2KIM A;  2QQB A;  1OYW A;  3HYI A;  4HDU A;  1KU9 A;  4BHB A;  1IZ1 A;  5DUK A;  4GO1 A;  1RUN A;  1Z6T A;  1J75 A;  3V7R A;  4EM2 A;  2JT1 A;  4HW0 A;  2X0L A;  2NS0 A;  3CJN A;  2LF8 A;  4HA8 A;  2HYG D;  3ZQ7 A;  2RVC A;  5AIP A;  2XRO A;  5A2Q K;  1TQM A;  4QLC U;  4IRI A;  2NNY A;  3Q9V A;  1UFM A;  1MGT A;  1D8K A;  1I1G A;  4R1H A;  4GXO A;  1E17 A;  1YW9 A;  4LJZ F;  4R79 A;  3HOT A;  1QPM A;  3D5L A;  5FO5 A;  2OU2 A;  1U5T C;  2RV8 A;  3SXY A;  3V7C A;  3TOA A;  4OMY A;  1UHM A;  1BC8 C;  3P9I A;  1S6L A;  2F5E A;  4UVB A;  2V9V A;  4KUM A;  4N9H A;  3QU6 A;  2XV4 S;  4CYD A;  4EMS A;  5DCF A;  5H6R A;  1HKQ A;  2QVO A;  1DDN A;  3P9C A;  1ZGA A;  3K1N A;  4O5V A;  3QPT A;  1MZB A;  4I01 A;  5F64 A;  2LNB A;  1ZRC A;  1LEB A;  4ZZL A;  3WTU C;  3FMS A;  3ABU A;  1KA8 A;  3GUD A;  4JK1 X;  3GZ6 A;  1OR7 A;  1MDM A;  3FWE A;  1YW7 A;  4AIK A;  3DKW A;  1L3L A;  4H0E A;  2XAG A;  2CYY A;  1QNT A;  3M7G A;  3F6O A;  3RYP A;  3I71 A;  2M5W A;  3IRR A;  2FU4 A;  2RC4 A;  2F5C A;  2VBX A;  3IHU A;  2Y48 A;  2L4M A;  4ENK A;  3V8J A;  1EH6 A;  3HTU A;  3IWF A;  3EQL F;  2W25 A;  1FX7 A;  1P4X A;  2M87 A;  1K78 A;  4MQV A;  2EB7 A;  1TQP A;  1HW1 A;  2P7C B;  2P4W A;  3QRF F;  4NQW A;  1O3Q A;  1J2X A;  3ZPL A;  5LGU A;  2ZKZ A;  3K1P A;  4L0Z B;  5H6Q A;  3F6V A;  4L5I A;  1BIA A;  3OV8 A;  1R00 A;  4EM1 A;  1GHC A;  2J5O A;  1JE8 A;  2JTV A;  2BYV E;  4L0Y B;  1SFE A;  3IRQ A;  1R7J A;  4WWC A;  2P5L C;  5ILS A;  4U88 A;  2X4H A;  3HRM A;  4TV7 A;  2UZK A;  2ZBK A;  4XLN F;  3ROU A;  2VBW A;  1J0R A;  2L4A A;  1UHW A;  4EV0 A;  5IT9 K;  3V8K A;  5HS7 A;  2QBY A;  1KYW A;  2FRH A;  2Y0M A;  1LJ9 A;  5H20 A;  5LRR A;  3R4K A;  3J7A O;  1HSJ A;  3LA7 A;  4IPA A;  5E8I A;  2IT0 A;  4BXU A;  3P7N A;  3FXR A;  1U8R A;  5LLQ A;  2GAU A;  1RIO H;  5CVU A;  1R22 A;  3W6K B;  1G3W A;  2PFB A;  1W7P D;  3TGN A;  3BP8 A;  3WGG A;  4OMZ A;  2O8X A;  1EH7 A;  2CWE A;  3BWG A;  1H0M A;  1V3F A;  3BJA A;  1W4M A;  2QZ8 A;  5J8C A;  4RS8 A;  2HS5 A;  3F8F A;  2OQR A;  2OD5 A;  4I2O A;  3KP3 A;  4U0V A;  2O0Y A;  4EJW A;  3J81 K;  3F23 A;  1FBQ A;  5FD5 A;  3HRT A;  4OU0 A;  4P96 A;  3BZ6 A;  4HZF A;  1ZLJ A;  4I0A A;  4FX0 A;  3MQ0 A;  3NRV A;  2PBI A;  2BE5 F;  2VBY A;  3GW2 A;  1UCR A;  2IA0 A;  3RJP A;  1IF1 A;  3RKW A;  3K69 A;  3F8N A;  4ZYG A;  4A0Y A;  3T1B A;  4YG2 F;  1IXC A;  2ELH A;  3FHZ A;  1WQ2 A;  2GWR A;  1LQ1 A;  2FQ3 A;  4XLP F;  3T0Y A;  2HWV A;  2O6G E;  2DAO A;  4LK1 F;  3TKY A;  3WOD F;  3Q5F A;  4EJT A;  4NB5 A;  2K86 A;  2MD5 A;  1W7P B;  1ULY A;  1TLH B;  2HTJ A;  4L9N A;  1FSH A;  3I59 B;  3GFI A;  4PZJ A;  1KQ8 A;  2EJR A;  1SD7 A;  5D4S A;  1S3J A;  5ILV A;  5D5X B;  2LDU A;  3I4P A;  2DW4 A;  1EV7 A;  2CO5 A;  3F72 A;  1YLF A;  2STT A;  3JW4 A;  2PJP A;  2JPB A;  1QBJ A;  2G7H A;  4LFU A;  1T6S A;  2HQR A;  2XKO A;  5JR3 A;  1X3U A;  1O3T A;  2EWN A;  1D8J A;  4OIR F;  5BS6 A;  1R58 A;  2ESN A;  3E6C C;  2V1D A;  3RIR A;  4MEY F;  2YX4 A;  2FE3 A;  2LSO A;  3COA C;  3DF8 A;  3N97 A;  2W84 A;  3ISP A;  2VC0 A;  5HDK A;  2KRF A;  4N9I A;  3E97 A;  2CQK A;  3DQV C;  1SAX A;  1LEA A;  1D3Y A;  2STW A;  5LHG A;  4MQ9 F;  2YU3 A;  3I58 A;  1NHA A;  1TQI A;  5EEH A;  1XGN A;  1C0W A;  5CJ9 A;  2HR3 A;  1KYZ A;  4ESF A;  2DTR A;  1O3R A;  1K79 A;  5KVR A;  3E5X A;  3QP6 A;  1LDJ A;  3BPV A;  1I5Z A;  5AIQ A;  3FF5 A;  4HF1 A;  2VN2 A;  2WC2 A;  5CVV A;  3W6J B;  1BIB A;  4ZH4 F;  3EYY A;  2HFH A;  3L2C A;  1DUX C;  4O3M A;  1YG2 A;  3C18 A;  1MKM A;  3RKY A;  4I0B A;  5JI6 A;  5ICC A;  3G3Z A;  3MWM A;  4ESB A;  3IL2 A;  1J9I A;  3RKX A;  1U2W A;  1LVA A;  3JSP A;  4CXF A;  4RAY A;  1KU3 A;  3P9K A;  1I1S A;  2IPQ X;  4Y15 A;  4PCQ A;  1QO0 D;  2Z5U A;  4M6X A;  3VEP A;  2KKO A;  3RI4 A;  4HF0 A;  2R7F A;  4Y17 A;  3H3U A;  4EGZ A;  3CUQ B;  2Z33 A;  2HQN A;  1ZG5 A;  5DD4 A;  3IKV A;  1U6G A;  3QU3 A;  5LEK A;  1XGO A;  3DXJ F;  2QQA A;  2MLG A;  4OOI A;  3CLO A;  2TDX A;  5ED4 A;  2JRT A;  2YSR A;  4AVP A;  3HHG A;  3MCZ A;  1FY7 A;  3KFW X;  2JPC A;  4FT8 A;  2A69 F;  1MD0 A;  2Q8K A;  1ZG1 A;  3HSF A;  3ML6 A;  2GZW A;  3E6B A;  5HLI A;  4M72 A;  3ZMZ A;  1YIO A;  4A0X A;  1P92 A;  3RPU A;  3R61 A;  1HQC A;  4B09 A;  3WU0 A;  3CO6 C;  2PEX A;  3O6B B;  1O7F A;  3CO7 C;  3JAM K;  2Q2E A;  4UVA A;  3N4M A;  3TOB A;  4YFK F;  2BGC A;  1KU2 A;  1U5T B;  3ZMD A;  1BOA A;  2PN6 A;  5LHH A;  1A04 A;  4Q47 A;  1JGS A;  2FEZ A;  4GYG A;  3IWZ A;  3O2P E;  4MTD A;  2EA4 A;  2OBP A;  4P9U A;  2FBH A;  4AD9 A;  1XN7 A;  3SZP A;  2ISZ A;  2JZY A;  1SMY F;  5DCM B;  4G6Q A;  4RB0 A;  4ENN A;  3ABT A;  3WTY C;  2VOO A;  3HSR A;  1YQA A;  2W24 A;  2RNJ A;  2AXL A;  3R60 A;  4R8H A;  4KNY A;  3PQK A;  2VOP A;  2DFI A;  4B8X A;  4WXC A;  2V79 A;  5HLH A;  3IC7 A;  5J8F A;  1ZRE A;  1I27 A;  1IRG A;  5BQT A;  2ACJ A;  5L3F A;  5K5Q A;  5K5O A;  4ZZD A;  5FLX K;  2ZO4 A;  2GQQ A;  2R3S A;  3JTG A;  2OZU A;  1O57 A;  4KIB A;  3G73 A;  1WKM A;  3JTH A;  5F6F A;  4PDK A;  2ZNY A;  2NRA C;  3VFZ A;  3WTS C;  5FFX A;  1HW5 A;  2PI0 A;  3E6D A;  4I7H A;  4LLG F;  3WTW C;  1R1U A;  3R0J A;  5JFR A;  3T8R A;  1P4W A;  4DQ2 A;  2XAS A;  1XB4 A;  1XMA A;  4ZYE A;  4JQF A;  1SD6 A;  1S8N A;  2HZT A;  3I54 A;  5E18 F;  4IJA A;  1G3S A;  3B73 A;  3M8F A;  5L3E A;  2DBB A;  3MZH A;  1H9G A;  2BEO A;  3BJ6 A;  4KIG A;  2QWW A;  4Q48 A;  2XAJ A;  4A0Z A;  1FP1 D;  5D4R A;  4CGZ A;  3GX4 X;  1O3S A;  1OYI A;  3FXU A;  1MJB A;  2XGX A;  4CZZ A;  2L3D A;  1FYL A;  2ZME A;  1FLI A;  2PMU A;  4FX4 A;  2GA1 A;  4HAM A;  3DFG A;  1GVJ A;  3OOP A;  1OMI A;  1Z05 A;  5LGT A;  4KIF A;  1IXS B;  4IF4 A;  3WGI A;  3ZN0 A;  2WV0 A;  3EUH A;  3K1M A;  2HEO A;  1FZP B;  3AAF A;  3FM3 A;  4LGW A;  2ZNZ A;  2MBF A;  1HST A;  2H94 A;  4P9F A;  1KQ0 A;  4XSX F;  4HV6 A;  4L9V A;  3RYR A;  4M74 A;  2HKX A;  3CUQ A;  3FMR A;  1LDK B;  5A2Q Z;  1ZGJ A;  2KJC A;  2H27 A;  4LLL A;  4YII A;  1FBS A;  5ERI A;  2WTE A;  5ICE A;  3GWZ A;  1R5G A;  1TTY A;  5LHI A;  1EH8 A;  4IVN A;  3QPH A;  2FF4 A;  5LEJ A;  1ZAR A;  1FC3 A;  1G4D A;  2YPR A;  4M9S A;  2ADU A;  2D1V A;  2A07 F;  2O61 A;  3ZMV A;  1V4R A;  1OYY A;  1UST A;  1R5H A;  3J80 K;  5BPD A;  4WXH A;  4AWX B;  2ZXJ A;  4Y13 A;  2NYX A;  5J6X A;  4YFN F;  2CGP A;  6PAX A;  1G3Y A;  1CGP A;  3MFK A;  2L54 A;  3KZY A;  5E1Z B;  1AWC A;  3LA2 A;  3TO9 A;  1YFH A;  3PQJ A;  2H09 A;  3SHF A;  1YTY A;  3E5Q A;  1J7K A;  1XGM A;  4ASN A;  1RI7 A;  4XSZ F;  3GXO A;  4JBA A;  2VON A;  1S7A A;  1Z7U A;  2MH9 A;  3BRO A;  1W5T A;  3LQQ A;  1UB9 A;  1RUO A;  2DQL A;  1XGS A;  2VBZ A;  3ZMU A;  5DD8 A;  2XRN A;  1QZZ A;  1BM9 A;  2A5Y B;  2NAZ A;  4MHG A;  1XSD A;  3V7S A;  5D8K B;  2DK8 A;  4K2E A;  1QQI A;  1SFX A;  3T8T A;  3RDI A;  3ZMS A;  4G8X A;  2DK5 A;  2CFX A;  3BY6 A;  4BAY A;  5FB2 A;  2ZFW A;  3K0L A;  4IXA A;  2V1X A;  5CYV A;  2PQ8 A;  1B1B A;  3FXQ A;  4BYY A;  2W85 A;  2EFW A;  2UWM A;  2A6H F;  2CG4 A;  2GIV A;  5L3D A;  2HDC A;  5HS9 A;  2A6E F;  3L9F A;  1D5V A;  3H3Z A;  2VC1 A;  3RTR A;  2M8E A;  4Q4Z F;  2XHK A;  4RGR A;  4A6E A;  1ON1 A;  1T38 A;  2QYO A;  1LB2 A;  3GZ5 A;  5IT9 Z;  2K4B A;  4RGU A;  4EGY A;  4WXD A;  3WE3 A;  3NEU A;  3VOE A;  4EM0 B;  1BN5 A;  1XDS A;  2E1C A;  1FT9 A;  3F8B A;  3LQR A;  2BBY A;  2HYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...