3HTUA

Crystal structure of the human vps25-vps20 subcomplex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
RRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and function of the ESCRT-II-III interface in multivesicular body biogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein-sorting-associated protein 25
total genus 21
structure length 75
sequence length 75
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3htuA00
1BOAA 2JSCA 2DQRA 2NAZA 3ULQB 4RB1A 1J5YA 3WGIA 3N97A 1SMYF 4YFKF 4D0PA 2EA4A 1OYYA 2H94A 1DP7P 3M8EA 5ICFA 1GXQA 4Z2YA 2CO5A 3HTUA 3J7AO 1YW8A 4BAYA 2PEXA 2V79A 2FXAA 4BYYA 5D6FA 3BROA 3F6VA 2UWMA 3AAFA 3R6SA 2KKOA 3V8KA 1G6NA 3J81K 3F8NA 4CICA 5E1WA 3SXYA 4PZJA 1T39A 1FBQA 3V4GA 5HS8A 4OU0A 4LG0A 2GXBA 1BIAA 4UVCA 1IF1A 2RV8A 5LLQA 4MNUA 3BOQA 1IN6A 5CYVA 1O3QA 1DDNA 1ZLJA 1PP8F 2XKPA 4KMUX 4I7HA 3I0TA 3H3ZA 1ON2A 2L3DA 1B6AA 1HXDA 2HEOA 3ZN0A 2F2EA 2D45A 3ZMTA 1F5TA 2Z99A 1B4AA 5FD5A 2IA2A 4CXFA 3RI4A 2ZKZA 3FMQA 3HTSB 4H0EA 2ADUA 1J2XA 1LQ1A 2FF4A 4A5MA 1GXPA 5A2QK 1CGPA 4BNCA 5J8CA 2PFBA 1D3YA 3IC7A 2DPDA 2R7FA 1QBJA 2ZNZA 2ACJA 3N4MA 2OU2A 2V1DA 5FGMA 2L54A 2DT5A 1F1ZA 2VOPA 1S7AA 1YYVA 3CO6C 3V8JA 1QQIA 2QUFA 1B1BA 3RKYA 4PCQA 4A6DA 2MA3A 2FU4A 4PGHA 2XAHA 4BHBA 1YW7A 3F21A 4EQQA 5D5XB 1U78A 2HWVA 1FWZA 4ZYGA 5D5VB 5IT3A 2NS0A 3SFZA 4LLNA 4NB5A 4UNOA 5CLSA 2MLKA 4WK8F 4JBAA 1W7PA 3W6KB 1LVAA 2L01A 4HF2A 3R4KA 1BC7C 1UHMA 5IT9Z 1KQ0A 4HF0A 3GEZA 5IT9K 1MD0A 4HZFA 1K6OA 4F7ZA 3GWZA 2W25A 2FBIA 2FSWA 3QRFF 2EFPA 4KDPA 1OMIA 3I64A 3GZ6A 4ENMA 4MQ9F 4EJWA 1C0WA 3EYYA 3I71A 1ZARA 2IRFG 3BJOA 1IRFA 4KT5C 3WU0A 2VN2A 3I5UA 5AIQA 2L4MA 1FSHA 3P9KA 2ELHA 2HFHA 4LK0F 2HS5A 3FXQA 4ZYEA 1YS6A 1KU9A 5FO5A 2VBZA 1O7LA 2HOEA 3WGHA 1YQAA 2YX4A 4NQWA 3F72A 3DPLC 1GVJA 1LB2A 3U2RA 1Z6RA 2V1UA 4UVAA 1LEBA 3EETA 3IL2A 2MD5A 3E6DA 4U7BA 4ENJA 2O61A 2H6BA 2BV6A 1WQ2A 4IRGA 5E1ZB 2QVOA 2DLLA 4HLXA 2CFXA 3ECOA 3BZ6A 4KYWA 4BHPA 1ZREA 4R79A 2KIFA 4M9ZA 3QPHA 5DCFA 1BN5A 3VFZA 2EJRA 5CVUA 1HKSA 1SD4A 1CF7A 1K79A 2P5LC 3ZMSA 1QZZA 2XAJA 3HYIA 5DD4A 1IRGA 3HIFA 1ZGJA 1BJAA 2MLGA 3L9FA 3K69A 3E6BA 1K78B 3HRTA 3HOTA 1J9IA 2BEOA 2EA2A 1BI3A 1FNNA 1HKQA 5JR3A 4NHJA 1ZGAA 4MTDA 4KICA 3E5QA 1R23A 5E1XA 4G7HF 2FNPA 1XSVA 1ZAOA 5JI6A 3I53A 2O3FA 2CG4A 2ZO4A 1UCRA 2YPRA 2K86A 3K0LA 3D5LA 1T38A 2XKOA 2XV4S 2D1VA 4QLCU 3K9TA 3DP7A 4N9IA 3VOEA 1TQIA 1MZBA 2O0YA 2ZNYA 2W57A 3LA7A 3ZQ7A 4IXAA 2DBBA 2IP2A 5CVRA 1TW3A 4I2OA 4AWXB 3Q9SA 4G8XA 1REPC 2DU9A 1XMKA 4U88A 3COAC 2XUBA 3HRUA 1FOKA 1FBSA 1U3EM 2DW4A 3E6MA 2M5WA 3J81Z 2EFOA 4OIRF 1G3YA 5FLXZ 1ODDA 4G6QA 3RKXA 3WG9A 1TLHB 3E6CC 2KJBA 5ICGA 1LDKB 5EEGA 5LHIA 2KJCA 1Q1HA 2Y75A 1MKMA 4Q48A 1EH6A 3WTXC 5E18F 5ILUA 2GA2A 1XD7A 2PN6A 3HRMA 4EGYA 2YU3A 5CVVA 4OMYA 1XMAA 3O3KA 1KYWA 5ERIA 3V7RA 3WTWC 3L2CA 4HLYA 1KGSA 4I02A 1BBYA 4RAYA 1XGOA 3DXJF 5KVRA 1PP7U 2K4BA 2P4WA 4WCGA 2EWNA 1SD5A 3KP3A 5K5RA 4KMFA 4AVPA 5ICCA 1AWCA 1HQCA 3JSPA 1L0OC 5L3FA 1IXCA 2OZ6A 2WWYA 2V1XA 1U5TB 4OOIA 2VC1A 2WC2A 5HS9A 1TBXA 3ELKA 4LG0B 4BQAA 3O6BB 3WTUC 1D8JA 4KIBA 5BS6A 4IHSA 4RGXA 2VT3A 2DQLA 4UUVA 2C6YA 1FYMA 1TW2A 3W6JB 3C3WA 3NEUA 1BC8C 3BDDA 2RVCA 1R5GA 2EV0A 2XAQA 2A3SA 3DF8A 2M8EA 5HLHA 4ZYDA 2HYGD 3BWGA 4S04A 1IW7F 1WSUA 1FBUA 2Z5UA 1S29A 1V4RA 3CLOA 3R61A 1Z7UA 2HQNA 4EMSA 1FC3A 3KETA 4LLLA 1DUXC 3CJNA 3O2PE 2BYVE 2L02A 2A69F 3JTGA 1U2WA 2JPCA 1QNTA 2ESHA 3SZPA 5LBQA 3IHUA 2QQ9A 4N9HA 5CJ9A 3R0JA 4L0ZB 1G3SA 4CO8A 1DPRA 4TV7A 4KIFA 2XVCA 1KU3A 1UB9A 3QU3A 2JT1A 4BHCA 3TQNA 4I0AA 1WI9A 5D8LB 2L4AA 2GQQA 2V6CA 3WE2A 3ISPA 1U5TA 3KP7A 4EJOA 3LSTA 2EV5A 1JE8A 4L9VA 3KLOA 1SAXA 2W24A 1V3FA 2G7HA 2M87A 4XSZF 1HSJA 3QPTA 3LWFA 1RZ4A 1R1UA 2ISZA 4L5IA 5KK1A 1FZPB 2X0LA 2QBYA 4YIIA 3RYRA 3MQ0A 2ZFWA 1HSTA 1LDJA 2IW5A 2O8XA 1JXSA 2A5YB 1OPCA 4WF2A 5DUKA 5FB2A 3ML6A 3HSRA 4XRFA 4HAMA 1MJ9A 1USTA 1HW5A 3KLNA 1ZG1A 4P5OA 5DYMA 2FMLA 5L3GA 1XN7A 1K7AA 4Q4ZF 4UV8A 4O3MA 5DUIA 3ROUA 3G73A 4S05A 3BY6A 1E2XA 1R1TA 2D1HA 2A61A 3MZHA 1QGPA 3GX4X 4MEXF 3IWFA 2STTA 4KN4X 4N0BA 2D2WA 1T6SA 4M73A 4PDKA 3E3VA 2VONA 5TRDA 3WTZA 4MTEA 5HDNA 4G7ZF 1G3TA 1FYLA 2VE9A 1R1VA 4KFCA 3LA3A 1SD7A 2IA0A 2XAGA 1IZ1A 3TO7A 2P5KA 1YIOA 3ABTA 4FX0A 2F5DA 1P4XA 1IN7A 5J6XA 4G7OF 3CUQA 1O3SA 4OMZA 2XGXA 2W85A 2NRAC 4KA4A 2PJPA 1T98A 4M6XA 3VODA 4K2EA 1OR7A 3TGNA 2QYOA 2GXGA 5H20A 2IPQX 3TOBA 2HGCA 3DFGA 2XIGA 1YLFA 3D0SA 2WTEA 3MEXA 3T1BA 5TJJA 4DNCA 1ZRFA 2ESNA 2GIVA 3KP5A 2HYFA 1R58A 1YW9A 4Y15A 1OYIA 2DK5A 4LFUA 1ONVA 5LGNA 3P7NA 4KN7X 1BI2A 3MZYA 3FHZA 2R7DA 5L3CA 4ESBA 1STZA 2FA5A 1SFUA 3RDIA 1FSEA 3ZP5A 5F1RA 1O7FA 1XSDA 3GFJA 4HOBA 2FBHA 4LD5A 1TQMA 1OKRA 3KCCA 2EFWA 5ED4A 4CDGA 2JTVA 3JSOA 3TDUC 1B9MA 3MAJA 3V7CA 2V9VA 1FP1D 1U8RA 3WE3A 4FHTA 2VE8A 2RNJA 5LRSA 3C1DA 1S6LA 4M74A 1MJAA 4RB0A 4UV9A 5HLIA 3I58A 2JPBA 4M72A 1J0RA 3J80Z 2LKPA 2HKXA 4EJUA 1ZRCA 3CUOA 2IA1A 1FP2A 3RTRA 3G3ZA 5AONA 4KIGA 4KUMA 4LMYA 4OINF 4WXDA 4Q5SF 2ZMEA 4EV0A 2W84A 1YTYA 2UXNA 5FFXA 3EYIA 1CF7B 2VBYA 2VBWA 4ETSA 1LDDA 3OOPA 4UVBA 3WTSC 4WXCA 3DPTA 5HS7A 4I0BA 3FF5A 3V8LA 4L18B 4B09A 2OAZA 3U1DA 2PI0A 2Y48A 1O3TA 1MDMA 2QZ8A 1X3UA 3WU1B 4L9NA 3L7WA 1FPQA 2OZUA 3QAHA 2PMUA 2RQPA 2Z33A 4P96A 1HW1A 4OIOF 2RKHA 1ZG3A 3LQRA 3SQNA 3Q5FA 3B73A 2M1BA 2RC4A 3IRRA 3GUDA 4RS8A 3VB2A 2LSOA 4EJVA 4HW0A 1FLIA 3KEOA 4ZZDA 4I98B 1MJBA 3HHHA 4HQMA 3GLXA 1ZHFA 2ZCWA 1J75A 2MC3A 1ON1A 5D5UB 1Y0UA 3T8RA 4EM0B 5LHGA 4LK1F 1R00A 1UFMA 3RKWA 4RAZA 3HHGA 4P9UA 2PQ8A 4GYGA 1U6GA 3GVAA 1WRJA 2J5OA 3DQVC 1I27A 4M9SA 1QZYA 2P8TA 4HX4A 2E1NA 1FY7A 1RIOH 4O5VA 5K1YA 1QPMA 2CW0F 4ESJA 4HX8A 3FXUA 1TQPA 1B9NA 3GFIA 2DO7A 2TDXA 4WWCA 4ESFA 4DQ2A 2ZMEB 2HR3A 3WTVC 3F8CA 1W5SA 2OBPA 2ZJ2A 2A07F 5HDKA 2Q0OA 1VTNC 2O6GE 3QP5A 3NQOA 3BJAA 1MGTA 1KYZA 3REOA 1RUOA 3P9IA 1S3JA 2FQ3A 1EH7A 1XGNA 3K1PA 3ZPLA 1FT9A 5DV5A 1EV7A 4YG2F 5BQTA 2PLYA 5H6QA 4A0ZA 2ISYA 2ZXJA 5JVTA 2UZKA 4RB2C 2E7WA 3IKVA 2HTSA 3M1EA 5F6FA 4EM1A 2EFNA 4XBFA 1I6XA 4ZYHA 4G94A 1JHFA 2K4JA 4EGZA 3Q9VA 2H6CA 3WTTC 1PDNC 1ZN2A 2NYXA 2OQGA 3T0YA 5ICEA 1XSXA 1D5VA 3C7JA 1HKTA 1IXRC 4LB5A 2BGCA 2FE3A 1L3LA 1D8KA 2PBIA 1KA8A 3QOPA 2Z3YA 3ABUA 5LGUA 3BPXA 2K7LA 3FMSA 3PFIA 4U7DA 2QWWA 4U0VA 3QP6A 2A6EF 1F4KA 4A2UA 4Y13A 4FT8A 3GFMA 3E5XA 5CVIA 2PMHA 4RB3C 1T2KA 1XGSA 2P6TA 3KP2A 4AIHA 5HLGA 2YR2A 3TO9A 5D4SA 1IAWA 2OQRA 4OIQF 3QU6A 2VC0A 4A5NA 5K5OA 1SFEA 5EEHA 3F8BA 4YFXF 2P7VB 4A0YA 1FX7A 5ILVA 1LJ9A 1P2FA 1O3RA 5BOXA 4B8XA 2NNNA 3LAJA 2IT0A 2YX7A 3CUQC 2JRTA 4HX7A 3CTAA 4RGSA 3V7SA 4YIFA 1G4DA 2MH9A 2FNAA 1JGSA 3BP8A 2KIMA 1XCBA 2RN7A 5BPDA 1Z6TA 5HOOA 4HV6A 4U0WA 5DCMB 2DAOA 1AOYA 1H9GA 1P92A 2VODA 1UHWA 3RPQA 2RDPA 4HQEA 2KIUA 3FZVA 2MBFA 1MDMB 4QWQA 3TKYA 3ZMUA 1RI7A 3EDPA 2Q8KA 4GGGA 3LAPA 3RYPA 2DTRA 1I1GA 1GHCA 4IRIA 1T0FA 3GW2A 3HSEA 4GO1A 3U9GA 1B59A 4JK1X 3RJPA 5ILSA 3F8FA 4EJTA 2DK8A 2CYYA 6PAXA 2LNBA 3MFKA 2F5CA 3IKTA 2P6SA 2BBYA 2XASA 3P9CA 3KE2A 3RIRA 2UXXA 4XLPF 1DPUA 3EUHA 2F5EA 4IHTA 3GZ5A 4YFNF 3CO7C 3NRVA 3KZYA 5J8FA 5LEJA 3JTHA 1P4WA 1IN5A 3TOAA 1H9TA 5E8IA 2FBKA 1IUYA 3FM5A 3RPUA 1H0MA 2VT2A 3OV8A 2XAFA 3M8FA 1XB4A 1NHAA 2H27A 1IN8A 1K78A 3FWEA 5LRRA 3FXRA 4LGWA 2IJLA 1W7PD 3K1MA 4RGUA 2DPUA 5LHHA 4G9YA 3TO6A 4IF4A 2E1CA 3T5XA 5L3BA 3LA2A 3R0AA 2HDCA 1XGMA 2F5FA 2CQKA 3H3UA 1QO0D 1XDUA 2P5VA 1HBXG 3MCZA 2J5PA 5JFRA 4WXHA 1RUNA 3HRSA 3GXOA 4ENNA 4JQFA 1SMTA 1I5ZA 5E20A 4IRHA 3DV8A 3KP4A 2H09A 2K02A 4O6JA 1TNSA 2R3SA 3J80K 4E70A 4A0XA 4L0YB 5LEKA 4ASNA 3DEUA 4EM2A 1SD6A 1W5TA 2Y0MA 3F23A 3FMRA 1S8NA 1W4MA 2M45A 2O03A 3E97A 3MWMA 4GYIA 3T8TA 1G3WA 2QQAA 4A12A 1BM9A 2QLZA 3K1NA 5F64A 5DD8A 3SHFA 3E5UA 2LDUA 2BE5F 4G6DA 4L9JA 1LEAA 1RNLA 4ON0A 3JAMZ 2HZTA 3WTYC 4HYEA 5JHUA 1ZYRF 5AIPA 3JW4A 2CGPA 3GF2A 1ZLKA 2G9WA 3I4PA 5FLXK 3BJ6A 5BMZA 1E17A 2GAUA 3KEQA 4XLNF 1XDSA 4BXUA 3ECHA 3PQJA 4HF1A 4LJZF 2M30A 2A6HF 1ULYA 2KRFA 2EFQA 2VOOA 3CUQB 5LGTA 5L3DA 4FX4A 2DI3A 4R1HA 4Y17A 3WGGA 4M71A 4AIJA 1USSA 1IXSB 1U5TC 4IJAA 2HQRA 2Q2EA 5BPIA 5FD6A 5E17F 3JAMK 3I54A 1R7JA 4ZH4F 5E8GA 3KZZA 3EQLF 2G7UA 1KU7A 1J59A 1R22A 2LF7A 3VEPA 1YS7A 4UHTA 5H6RA 3ZN1A 4MQVA 4OIPF 1KU2A 4LB6B 2X4HA 3IRQA 3F6OA 4ZZLA 1ZRDA 3L09A 2A68F 5A2QZ 4ENKA 4GCVA 4M9XA 4HA8A 3FM3A 2JZYA 3I59B 1FYKA 2EV6A 1SFXA 3I59A 3IWZA 2PG4A 4AD9A 2RGVA 3HSFA 3TDZC 3C18A 1Z9CA 1J7KA 2AXLA 5D8KB 3LFKA 3M9AA 1WKMA 5D6EA 3S2WA 3M7GA 1P4AA 2XRNA 2COMA 1XCVA 2QENA 1Z1DA 4CGZA 3PQKA 5D5WB 1KQ8A 4UXNA 4RGRA 2P7CB 2IVMA 2EB7A 2GA1A 2WV0A 1YG2A 2B0LA 1WWXA 1IN4A 3HOSA 1BI0A 2VBXA 3F3XA 1Z91A 3B02A 1JHHA 2OD5A 4CYDA 4IPAA 1EH8A 4GXOA 2K27A 2OA4A 1W7PB 4BH9A 3GYHX 4HBLA 4MEYF 1ZH5A 4U0YA 1Z05A 2EK5A 3K2ZA 1PUEE 2AS5F 3WODF 1F9NA 4KNYA 5DDGA 2GWRA 2E7XA 1BI1A 4L5JA 3H92A 3GO5A 5HDGA 1TTYA 3CDHA 4PGGA 2CSOA 5HVQC 1P6RA 2FMYA 3L00A 2MH2A 3LQQA 4R8HA 3ZMVA 1R36A 1I1SA 1O57A 5K5QA 2NNYA 1YFHA 2ETHA 3GFLA 2QBYB 2FRHA 4HDVA 5DCMA 2VXZA 2QM3A 1LNWA 1ZG5A 2HTJA 4CHUA 2XHKA 4WX9A 2XROA 4I01A 4HV5A 4MHGA 4MGRA 3KFWX 4M6YA 4EVIA 1OYWA 2QQBA 4XSXF 3FX3A 5DEQA 3ZMZA 1HW2A 2CWEA 2STWA 1BIBA 2DFIA 4I09A 3KP6A 2LF8A 2YSRA 5CVJA 4Q47A 4LLGF 4HDUA 3HUGA 4CZZA 4AIKA 2ZBKA 2FEZA 3BPVA 2HKOA 4P55A 1A04A 2GZWA 5FFZA 2Z9OA 3DKWA 1S7OA 5L3EA 4P9FA 5D4RA 1TNTA 1YO5C 3F8MA 4L9TA 1R5HA 3SZTA 3ERED 3R60A 3F22A 4IVNA 2FOKA 4A6EA 3ZMDA 1KQ9A
chains in the Genus database with same CATH superfamily
1BOAA 2JSCA 2DQRA 4F55A 3EUAA 4U87A 3OYIA 2ME6A 4PJLA 2NAZA 3DWLE 3ULQB 4RB1A 1J5YA 3WGIA 1AA7A 3ZQFA 3N97A 1N78A 1SMYF 4YFKF 4D0PA 3DPUA 2DN0A 3H1CA 1A36A 5EG0A 3CD6I 2EA4A 1OYYA 2H94A 3A03A 1LE8B 2WAFA 5B1AH 1DP7P 3PUBA 3CC2I 3M8EA 5ICFA 1Z0XA 4CCNA 1GXQA 4E6KG 2KISA 2VPRA 4Z2YA 1FTZA 1BW6A 2VJ4A 2CO5A 3HTUA 3HGYA 1WH5A 3J7AO 1YW8A 4BAYA 2LBFA 5JHFA 1YIJI 4IZZA 2R7WA 2PEXA 4FE4A 3BR6A 2R5YB 1U9NA 2V79A 2M0MA 4A3DJ 2FXAA 4BYYA 1WJCA 3AG2H 3LL7A 5D6FA 3BROA 4QIWN 3K70D 3F6VA 2UWMA 2IBDA 3AAFA 3R6SA 4D7MA 2KKOA 3V8KA 3PFYA 1G6NA 2HOAA 1I3QJ 3IH2A 3J81K 3F8NA 4CICA 1ETXA 3BG5A 5E1WA 1BW5A 4IHVA 2DODA 1SANA 1X1BA 3SXYA 2W82A 4PZJA 1T39A 1FBQA 1UHSA 3V4GA 1VQNI 5HS8A 4OU0A 1ETYA 4LG0A 5EF6A 2GXBA 1BIAA 2IGNA 4UVCA 3J7AY 2K5CA 4QPOA 1IF1A 2RV8A 5LLQA 4MNUA 4J19A 1YOVB 3BOQA 1IN6A 5CYVA 1O3QA 3AG4H 3UKGA 1DDNA 2JA5J 4PK4A 1GV2A 2W1OA 1ZLJA 3W2AA 1PP8F 3MN2A 2XKPA 4KMUX 4I7HA 3I0TA 3H3ZA 1FJLA 4RDUA 5IYCJ 1GT0C 3OIPA 1ON2A 2L3DA 1B6AA 4AM3A 1HXDA 4BQOA 2HEOA 3ZN0A 4XIDA 2L7MP 1WPKA 2F2EA 3JR9A 1ETQA 2D45A 2WY8Q 3ZMTA 1F5TA 2Z99A 3BTJA 1B4AA 2OCEA 1UG2A 4XKCA 3TW7A 2L9NA 3OR1C 5FD5A 2IA2A 4CXFA 2HNHA 1VQ4I 3RI4A 2G0EA 2IGMA 2ZKZA 3FMQA 3HTSB 2CJJA 4H0EA 2ADUA 1J2XA 1LFBA 1LQ1A 2FF4A 4A5MA 1GXPA 5FJ8J 5A2QK 1CGPA 2VIXA 3PUFA 3G71I 2CFOA 4PFOA 2NVUB 2XGDA 4XORA 4BNCA 5J8CA 4FASD 2R7OA 2PFBA 1D3YA 3IC7A 3K10A 2R7FA 1QBJA 2DPDA 2Y9ZA 4BBRJ 2ZNZA 2CQNA 2ACJA 4XKBA 3N4MA 1D5YA 2OU2A 3AG1H 1OCZH 2V1DA 5FGMA 2L54A 2LY2A 4XLFA 1HDDC 1YHQI 2DT5A 1F1ZA 2VOPA 1S7AA 3OMYA 1YYVA 3CO6C 1MBKA 3V8JA 1QQIA 2OJED 2HU9A 1VNDA 1MH4A 2QUFA 2LD5A 1B1BA 3RKYA 4PCQA 4A6DA 2MA3A 4DYRA 3TBIA 5EG0B 2ZXIA 5C4XJ 1VQ8I 2OV7A 2R5ZA 2K3FA 2FU4A 3TW6A 4PGHA 2XAHA 2E35A 1FOWA 1OQYA 4BHBA 4NQWB 1YW7A 2Q2EB 3WG7H 4XRSG 3F21A 4B4CA 4EQQA 3KYLA 3HGGA 1T33A 5D5XB 1U78A 1I39A 1SVLA 2HWVA 1FWZA 1VQPI 1B8IA 2HZDA 2Y2ZA 3VWBA 1V55H 3FXKA 4ZYGA 3LSKA 4I99C 4XLCA 3ZXSA 4UUTA 5D5VB 5IT3A 2NS0A 3G2BA 2E2HJ 3SFZA 2BOLA 4E7IA 1JTXA 4NB5A 4LLNA 1R9TJ 4MFEA 4UNOA 3MD2A 3PNTA 2MLKA 5CLSA 4WK8F 4JBAA 2H8RA 1W7PA 3BC8A 1IUFA 2E2JJ 2L2OA 3VYRB 3W6KB 4II3A 1LVAA 1WHUA 2L01A 4HF2A 3OYCA 3R4KA 4ZDLA 1BC7C 1UHMA 3S32A 1FMWA 2K85A 5IT9Z 1KQ0A 1I50J 2FJ1A 3J7ZI 4HF0A 4YEJA 3GEZA 2DA1A 4XRMA 2NOGA 5IT9K 3QODA 1AKHA 3ABKH 1MD0A 4HZFA 1K6OA 4F7ZA 3GWZA 2W25A 2FBIA 1FOYA 4ZYAA 3PSFA 4DIQA 2FSWA 2D5VA 3QRFF 2EFPA 2E5NA 4F92B 4KDPA 4IQJA 3SDGA 1OMIA 5DTDA 3I64A 3GZ6A 4ENMA 4MQ9F 4EJWA 1C0WA 1UELB 3EYYA 3DLLF 2R7UA 4XKVA 3PJRA 3I71A 1ZARA 2IRFG 3BJOA 1IRFA 4KT5C 3LNQA 3S3MA 3WU0A 4XLHA 3HL2A 4XN0A 2VN2A 2XGCA 3FXLA 3I5UA 3JRDA 5AIQA 1PVEA 2L4MA 4AC0A 4M3FA 1JUMA 2K9MA 3L1PA 1V54H 2WAQA 4CCOA 4E7LA 1FSHA 3P9KA 1MBFA 2ELHA 2HFHA 4LK0F 2HS5A 1BR1A 3FXQA 4CYCB 4ZYEA 4BACA 1YS6A 3AL0C 1FIPA 3K6GA 1SEUA 1KU9A 2RAEA 1WJAA 5FO5A 3OIOA 2VBZA 2JVHA 1X19A 2YU9J 1O7LA 9ANTA 2HOEA 4NC7A 3WGHA 1YQAA 2YX4A 1IDYA 4NQWA 3F72A 1MW7A 3DPLC 1GVJA 1ORKA 1R5ID 1LB2A 3U2RA 3MKZA 1Z6RA 2BHYA 2V1UA 4UVAA 1LEBA 3EETA 3IL2A 2ECCA 2R4GA 3C2GA 2MD5A 5FLVA 3E6DA 2BXZA 1VQ7I 4U7BA 4ENJA 2O61A 2H6BA 4CCMA 3H9JA 1MNDA 2DJIA 2BV6A 2LG4A 1WQ2A 2DDAA 4IRGA 5E79C 1OCPA 3I3LA 2QVOA 3CP2A 5E1ZB 4BUPA 2R5ZB 3JCUC 2DLLA 4HLXA 3K4JA 3ZQHA 2K40A 2DXIA 2CFXA 3ECOA 3BZ6A 3ZQGA 4KYWA 5F0CA 4BHPA 1ZREA 4R79A 2KIFA 4M9ZA 1LFPA 2V7FA 3QPHA 5DCFA 1BN5A 4IL6C 3VFZA 4BDYA 2EJRA 2QCOA 4UB8C 5CVUA 1HKSA 1SD4A 1CF7A 1K79A 2P5LC 3ZMSA 1RETA 1QZZA 2XAJA 3FKJA 4NDLA 2O8KA 3GTJJ 3SFIA 3HYIA 3RKQA 5DD4A 3A1YA 1IRGA 3HIFA 3IAS2 2XF5A 1Y39A 4W97A 2L7KA 4D5CA 1ZGJA 1BJAA 2MLGA 3LOCA 2XDVA 3L9FA 3FXJA 4IHYA 3K69A 3FK7A 2O7OA 2DFFA 3E6BA 1K78B 1TWAJ 3HRTA 1TL8A 3HOTA 3KEYA 1J9IA 2BEOA 2EA2A 1FNNA 1BI3A 2KMUA 4KT6A 1HKQA 5JR3A 1YI2I 4NHJA 1T8IA 1ZGAA 3B6CA 4MTDA 4KICA 3E5QA 4ZDPA 2CUJA 1R23A 1X3WB 5E1XA 3QYBA 4G7HF 2FNPA 1XSVA 2RREA 4CYCA 5IY5H 1ZAOA 5JI6A 2EZKA 3I53A 1X58A 2O3FA 1O4XA 5GPCA 2CG4A 2ZO4A 1UCRA 2YPRA 2K86A 5FKKA 3K0LA 1IG7A 1DGRM 3W2VA 3D5LA 5M5XJ 1T38A 5GTHC 2KPMA 2XKOA 2F6CA 2XV4S 2D1VA 4QLCU 3K9TA 1Q1VA 5M3MJ 2WV1A 3DP7A 4N9IA 3VOEA 1MSFC 1TQIA 1MZBA 1OCOH 2QGUA 2O0YA 2ZNYA 2W57A 3LA7A 3VPRA 3ZQ7A 3SEZA 2K9SA 1R4NB 4IXAA 3D5RC 4F91B 1QU3A 1ZKGA 2DBBA 2IP2A 5CVRA 1TW3A 1FOXA 2VI6A 4DBRA 4I2OA 4AWXB 3Q9SA 4C3JJ 3ZCOA 3FKIJ 4G8XA 1REPC 1IDZA 3KZIC 4MO7A 2DU9A 4JOMA 1XMKA 2V26A 3K4BA 4U88A 4NC8A 1ETKA 2XUBA 3HRUA 2L5QA 3COAC 1FOKA 3HOUJ 2DA3A 1FBSA 5IP9J 1U3EM 3E6MA 2DW4A 2OUMA 5GAEJ 1WVRA 2M5WA 3J81Z 1FEXA 3CZ6A 2EFOA 2KZVA 4OIRF 1G3YA 2ID3A 1ODDA 5FLXZ 2Q1ZB 2X1DA 2MD0A 2Z1DA 4G6QA 2L9VA 3RKXA 3CCEI 3WG9A 1TLHB 1OR7C 3H35A 3K7AJ 3E6CC 2KJBA 5ICGA 1LDKB 5EEGA 5LHIA 1NG6A 4LITA 2KJCA 1ETOA 1Q1HA 2Y75A 3K70C 1MKMA 4Q48A 1EH6A 3CF2A 5F0HA 3WTXC 5E18F 2KIQA 3PO3J 3EUHC 2HVRA 5ILUA 2M7AA 5K7ZA 1YRNB 2GA2A 3HEFA 5HODA 1XD7A 4JX4A 2PN6A 2MC4A 2N8GA 3HRMA 3L2VA 2HYJA 5F27A 2L9RA 4EGYA 4IX7A 2YU3A 5CVVA 2F5VA 1XMAA 3O3KA 4OMYA 1KYWA 1DQUA 3P5JA 2LLKA 5ERIA 3V7RA 4M6VA 1YX3A 4MLOA 2K3PA 3H5RA 3S1RJ 3BTCA 3WTWC 3L2CA 2M2EA 4E7KA 1TC3C 4HNUA 3AG3H 4HLYA 4BBSJ 1KGSA 4I02A 4XM3A 1BBYA 4RAYA 1XGOA 3DXJF 1EA3A 5KVRA 1PP7U 2OPTA 2WAEA 5J1RA 2K4BA 2P4WA 4WCGA 1VQLI 4EATA 2ZJPF 2EWNA 1SD5A 4XICA 1GLNA 3RSNA 3KP3A 4ABZA 5K5RA 2CUEA 5C4JJ 4KMFA 4AVPA 4DBQA 5ICCA 1AWCA 2CMPA 1HQCA 2X1EA 3JSPA 5IYBJ 4Y33A 3MKLA 1L0OC 3DTIA 3HZJA 5L3FA 2CH0A 3OR2C 1IXCA 1YJNI 3BG7A 3A0HC 2OZ6A 3M8JA 4N4NB 4XKWA 5E3OA 3VYUB 2WWYA 5KAFC 3E0JB 4J00A 1N77A 4KITB 1VF9A 2V1XA 1U5TB 4OOIA 2VC1A 4DW6A 2LP0A 3FBIB 2WC2A 5HS9A 2HVQA 2EH3A 1TBXA 3ELKA 4V19K 4LG0B 2JJ7A 2KRHA 5IOYA 3KIOA 4BQAA 5TGTA 3VYSB 3O6BB 4YRVA 3WTUC 1D8JA 2JUCA 4KIBA 4ZJZA 5M3FJ 5BS6A 4IHSA 2Z2SB 3OSFA 4RGXA 2VT3A 2DQLA 4UUVA 1H8AC 2XPWA 2C6YA 2XSDC 1FYMA 1B8IB 4JP0A 1TW2A 4KJZA 1ETVA 4DJAA 1Y8RB 3W6JB 2EINH 3C3WA 5J4YA 3NEUA 1WJEA 3D5SC 2WBMA 1BC8C 1S72I 1W5CC 2JA6J 2KT0A 1NTCA 3BDDA 2RVCA 5TISC 1R5GA 2EV0A 2XAQA 2A3SA 3DF8A 2M8EA 2WAQN 5HLHA 4ZYDA 2HYGD 5J40A 4PSXA 2NVQJ 3EUKL 3BWGA 3LMMA 4MIMA 4S04A 1IW7F 1WSUA 1FBUA 1E3OC 2E5ZA 2Z5UA 4PJNA 1S29A 1V4RA 3RPUD 3CLOA 3R61A 1WH7A 3PIOF 3BG3A 1Z7UA 2W48A 1ERDA 3IV5A 3QPSA 2HQNA 4BKXA 4EMSA 1FC3A 3M1CA 4BL0B 5FRNA 1B72A 2VUMJ 2DCEA 3KETA 3Q3SA 4LLLA 5J3LA 1DUXC 5M5WJ 3CJNA 3BQZA 3H9GA 4B43A 3O2PE 2VJ5A 2AO9A 2BYVE 2L02A 4B1RA 2A69F 3CCJI 1H89C 3A02A 3JTGA 1U2WA 2JPCA 1QNTA 3S2HJ 2ESHA 2LH9A 3HG9A 3SZPA 4XK4A 5LBQA 5E3MA 3IHUA 1Y6IA 2QQ9A 4N9HA 2IS2A 5CPRB 2ZB9A 2CW8A 3R0JA 5CJ9A 2R7ZJ 5LFAA 3DKYA 3PNYA 4C9YA 4L0ZB 1G3SA 1JT0A 4CO8A 1D0YA 1S7EA 1DPRA 4TV7A 4KIFA 4A3KJ 2XVCA 3I4NJ 1KU3A 1UB9A 3QU3A 2JT1A 4CUGA 4BHCA 3GBGA 2YS9A 1H88C 4V2FA 2BW3A 2QSFX 2CQ7A 2RNGA 2TCTA 3MKYB 3TQNA 2EIKH 4I0AA 1WI9A 5D8LB 2L4AA 2ZJRF 4XL9A 2R7VA 2E19A 1G8XA 2GQQA 3A01A 2HXOA 2DOEA 1X2NA 2V6CA 2CW7A 2JA2A 5K7FA 3BCBA 3WE2A 1R6RA 3ISPA 1U5TA 1G2HA 1U0JA 3KP7A 2M8GX 5FKNA 2WB1A 3HOVJ 5FKOA 4EJOA 5KNLA 3LSTA 2EV5A 1JE8A 2JN6A 4L9VA 3KLOA 1XC5A 5CQEA 4II2A 2HI3A 3LSHA 1SAXA 2W24A 2OTLI 1V3FA 2G7HA 2M87A 4XSZF 1HSJA 1JTYA 3QPTA 3LWFA 3HC7A 1QZEA 3LSIA 1RZ4A 1IRZA 3CC4I 1R1UA 1QPIA 2ISZA 4L5IA 5KK1A 1FZPB 2X0LA 4BEHB 2QBYA 4YIIA 3RYRA 5C44J 3MQ0A 4E7HA 2ZFWA 3QWLA 3GCMA 1HSTA 4D7NA 1LDJA 4HNVA 2Y31A 2IW5A 1JT6A 2O8XA 1U8BA 1JXSA 4J01A 2A5YB 5C3EJ 4GDFA 1VQMI 1OPCA 1POGA 4WF2A 5DUKA 5FB2A 2JRMA 3ML6A 3CCMI 1DU0A 3HSRA 4XRFA 2A6TA 4HAMA 1MJ9A 3CESA 1USTA 1HW5A 3KLNA 4RBOA 1ZG1A 4S0HB 3GTQJ 3K4NA 4P5OA 4BQNA 2JA7J 5DYMA 2FMLA 3CMAI 5IP7J 2KQRA 5L3GA 1XN7A 4X1EA 2BZTA 4XLAA 1K7AA 4Q4ZF 1J09A 4UV8A 4IOCF 4O3MA 5DUIA 5FKMA 3K2AA 3ROUA 3G73A 3OWTA 4S05A 1AU7A 3BY6A 1E2XA 3L2QA 1R1TA 2D1HA 4IOAF 3NWTA 2LYCA 5F08A 3OYDA 2A61A 1XTAA 3MZHA 4GFBA 1KZHA 1MMAA 2VQGA 4RLQA 3BR5A 1WFXA 1QGPA 3GX4X 1VQOI 2CUZA 4MEXF 3IWFA 2STTA 4KN4X 4N0BA 2D2WA 3OYBA 3M3YJ 1T6SA 1IC8A 4M73A 4PDKA 3E3VA 2VONA 5TRDA 3DTEA 3WTZA 4DYQA 2IEKA 4MTEA 1YRNA 4MFDA 2LKSA 4RM3A 5HDNA 3J7YJ 4G7ZF 3PO2J 1G3TA 2ZSIB 1FYLA 2VE9A 1R1VA 2X85A 3LA3A 4KFCA 1VZ0A 1SD7A 1T56A 4FETA 2IA0A 3G1MA 3TEDA 2XAGA 1IZ1A 3CMEI 3TO7A 4HEA2 2P5KA 1YIOA 4JX5A 2PJRB 2OC6A 3ABTA 4FX0A 2F5DA 4NNJA 1XS9A 3BG6A 3ZGKA 1P4XA 1IN7A 3A0BC 5J6XA 3LSRA 2E2IJ 3CUQA 1O3SA 4G7OF 3DLAA 4OMZA 1SVOA 2XGXA 2B9SA 2W85A 2NRAC 4KA4A 3RZOJ 4NUBA 1JUPA 2COBA 1CQTA 2PJPA 1T98A 4F52A 2QSGX 3S16J 3DEWA 4M6XA 2CS3A 3VODA 4M3EA 2IGOA 4K2EA 5F1JA 2R7TA 1OR7A 1Y0NA 3TGNA 2QYOA 2GXGA 4G6TB 2XRLA 5H20A 3SEQA 2IPQX 3TOBA 2BHZA 2HGCA 1ZR4A 3DFGA 2XIGA 2JA8J 3SYTA 2E34A 1YLFA 3D0SA 4BJTA 2WTEA 1X4PA 3MEXA 2NVYJ 3DBRB 3FXOA 3T1BA 4BS9A 5TJJA 3QPLA 2LKXA 4A3LJ 4DNCA 1MBGA 3G1OA 1UZCA 3K4KA 3I56I 1ZRFA 2CV2A 3OYNA 2ESNA 2GIVA 3KP5A 2HYFA 2CV0A 2V9KA 3QOEA 4LIUA 1R58A 1RESA 4LIVA 1YW9A 1WJDA 4Y15A 1IV6A 1OYIA 1IRXA 2DK5A 4E7SA 1P7IA 2XGEA 4LFUA 5IYDJ 1F36A 2Y69H 1ONVA 3U21A 1TT0A 5LGNA 3P7NA 2QSHX 4IEJA 4KN7X 1BI2A 3OYGA 3MZYA 3JRCA 3DEEA 3FHZA 1MMNA 2R7DA 5L3CA 4ESBA 1STZA 2FA5A 1SFUA 3RDIA 5KHDA 1FSEA 3PNVA 3ZP5A 3ABMH 2F4MB 4BY1J 5F1RA 5M5YJ 1O7FA 1XSDA 2RQQA 2MW8A 4I76A 3GFJA 4OWRB 4HOBA 2FBHA 3OS0A 2PX9A 4LD5A 1W36D 5F04A 2L0KA 1TQMA 4BE1A 1OKRA 3KCCA 2EFWA 5ED4A 2FOWA 4B47A 4CDGA 2JTVA 3JSOA 3TDUC 1B9MA 3MAJA 1IV8A 3V7CA 2V9VA 1FP1D 5IP6A 1U8RA 3WE3A 1K4TA 2L7FP 4FHTA 1SAUA 3OYMA 1E3PA 1GUUA 3IH4A 1QHGA 3ZQIA 3CCQI 2VE8A 2RNJA 5B1BH 3CJQB 5LRSA 3C1DA 1S6LA 3S1QJ 3LSMA 2MABA 3CMMA 4M74A 4A3FJ 2F4OB 1MJAA 4RB0A 4UV9A 3VDXA 2OTJI 2ELKA 5HLIA 2UUZA 3EPZA 4N4OB 2HOTA 3I58A 2JPBA 2HOSA 4M72A 3VSLA 2KP6A 1J0RA 3J80Z 2LKPA 2NS7A 1V5GA 4A3IJ 5CQGA 2HKXA 4EJUA 5EGOB 1ZRCA 2PMZA 4FCYA 2XB0X 3CUOA 2IA1A 1IO2A 2M0CA 1FP2A 4M3GA 3RTRA 3G3ZA 5GAHJ 3CP8A 3W6VA 4UB6C 4FQGA 5AONA 1DGWY 2W00A 4M3BA 1UJ8A 4KIGA 1OISA 3BR1A 1A6IA 2R93J 4PJJA 2GXAA 1P9QC 4KUMA 2KHMA 3BLYA 4HSTA 4XLEA 1AHDP 3AL0B 4LMYA 4OINF 2HPMA 4WXDA 3CC7I 4AIDA 3S17J 4Q5SF 4RLFA 2ZMEA 4EV0A 2AXTC 5JVGF 2W84A 5HNHA 1MMDA 2E60A 2XSJC 1YTYA 2UXNA 2M4KA 3DU5A 5FFXA 3EYIA 4BXXJ 1X1AA 3HBLA 2VBYA 1CF7B 3CCYA 5GADJ 2VBWA 2M4GA 3FK6A 4ETSA 5IOZA 1LDDA 1QVUA 2LREA 3OOPA 5DS9A 4C2TA 4UVBA 3WTSC 5J1UA 5EDNA 4WXCA 3DPTA 5HS7A 4I0BA 2R7QA 3FF5A 3V8LA 3E7LA 4L18B 4IHWA 1T08B 4B09A 2QA4I 2OAZA 3U1DA 2PI0A 3I9V2 2Y48A 1O3TA 4PFPA 1MDMA 2VQHA 2W7NA 2E1MC 2BY0A 2QZ8A 1X3UA 3WU1B 4BJ6C 3FBNB 4L9NA 4AUXA 4RAGA 3L7WA 1FPQA 3CCSI 2OZUA 3QAHA 2PMUA 4CSWA 3HPHA 2RQPA 2LBFB 2IGKA 2QKMB 2Z33A 4P96A 1HW1A 4OIOF 2GLOA 2RKHA 1ZG3A 3LQRA 3SQNA 3Q5FA 3B73A 2M1BA 2RC4A 4XOTA 3QYFA 3CJRB 3IRRA 2VKEA 3GUDA 4A3MJ 2P81A 4RS8A 3VB2A 2LSOA 2IS6A 2DJNA 4EJVA 4HW0A 4XQFA 3KEOA 1DU6A 3Q0WA 1FLIA 4ZZDA 1WZ2A 4I98B 3K4LA 1ETWA 1MJBA 3CDLA 3HHHA 3MZ8A 3TMOA 4UUSB 2GBYA 3ZOBA 4HQMA 3GLXA 1FIAA 1ZHFA 2ZCWA 1W0TA 1J75A 2MC3A 4F93B 1ON1A 5D5UB 1Y0UA 3BR3A 1Y1VJ 3T8RA 1X1DA 2H1LA 4EM0B 3W2WA 5LHGA 4LK1F 4DOZA 1R00A 2ZSHB 3N05A 1UFMA 3RKWA 4RAZA 3HHGA 3BQYA 2HVSA 4W1UA 4P9UA 4XRSA 2VL8A 2PQ8A 4GYGA 2XF6A 1U6GA 2VQCA 4LOCA 3GVAA 2VPLA 1WRJA 1Y8QB 3DQVC 1QRYA 2CQQA 2J5OA 1I27A 1VQ6I 4BQQA 3GTMJ 4M9SA 3S2DJ 4C2UA 1QZYA 1UG0A 1QA6A 2P8TA 4HX4A 1XX5A 4YIRX 1MSEC 2E1NA 1FY7A 1RIOH 4HG2A 1EKEA 5HLTA 4NBQA 4O5VA 1RR7A 1T95A 5K1YA 3MKWB 3M4OJ 1I3AA 3ZQLA 1GV5A 1QPMA 2MG4A 3RQ4A 2F48A 1ZTRA 3OSGA 2CW0F 1RPWA 1HC8A 4YELA 4ESJA 4HX8A 4AYBA 1HOMA 2BY2A 1HA8A 3FXUA 5K7HA 1TQPA 1B9NA 3GFIA 2LFBA 2DO7A 2TDXA 4WWCA 3S1MJ 2BW3B 2HDWA 4ESFA 1SC7A 4DQ2A 2ZMEB 4IKFA 2HR3A 1QVTA 3WTVC 3F8CA 3C2HA 1W5SA 1OJLA 2EIJH 2OBPA 2ZJ2A 2A07F 5HDKA 2Q0OA 1VTNC 2O6GE 2BY3A 3QP5A 3NQOA 3BJAA 1MGTA 1KYZA 2X48A 4BU2A 4ZTJA 3REOA 1GDTA 1RUOA 3TP0A 2XB5A 4CCKA 3ASOH 3P9IA 1S3JA 3I55I 2FQ3A 2NXNB 4E7JA 1EH7A 1XGNA 3K1PA 2VKHA 3WHBA 5JLWA 3ZPLA 1FT9A 2F4IA 3BCAA 5DV5A 1EV7A 2DMUA 5BQTA 3OOUA 4YG2F 5H6QA 2PLYA 5B3SH 4A0ZA 1G59A 2ISYA 2ZXJA 3GTGJ 5JVTA 2UZKA 2LC2A 4RB2C 2E7WA 1MNMC 3IKVA 1EJ9A 2HTSA 4DGWB 3BR0A 1N75A 1NK2P 2AHQA 3M1EA 2IS1A 2R7SA 5F6FA 4EM1A 3JRFA 3JRGA 3G1LA 3GMEA 2ZXHA 3DCFA 2EFNA 1D1CA 3GTOJ 3FXMA 3DBLB 4XBFA 1I6XA 2DA4A 4G94A 1JHFA 5EZGA 4ZYHA 4ITVA 2KL4A 2FD5A 2K4JA 4EGZA 3Q9VA 3OIQA 1TWCJ 2H6CA 3WTTC 1PDNC 1ZN2A 5BNGA 4XN3A 2NYXA 3U1KA 1R49A 5EYRA 3S3OA 1PUFB 2OQGA 3T0YA 5ICEA 1FTTA 1XSXA 1D5VA 3NARA 1JKOC 3C7JA 1HKTA 1IXRC 1XG1A 4LB5A 1ZQ3P 2BGCA 2FE3A 4BJ5C 1IGNA 1L3LA 1D8KA 5FROA 1WJFA 2EBIA 2PBIA 1KA8A 1OLTA 3HOXJ 3QOPA 2Z3YA 3ABUA 3CQZJ 5LGUA 3BPXA 3HKZN 2K7LA 3FMSA 1Z21A 3BZCA 3PFIA 4U7DA 2QWWA 4U0VA 3RQIA 3QP6A 2P0WA 1P7JA 2X51A 2A6EF 2WB1N 4B44A 1F4KA 4A2UA 4Y13A 2VQLA 1TP4A 2H1KA 2LMDA 4FT8A 3GFMA 1R71A 3M07A 4UY8I 1S9HA 3A2KA 3E5XA 4PSWA 2DOAA 2EQRA 5CVIA 1K4SA 4P1WA 1U9OA 1Z3XA 2VB6A 4HNTA 3OL3A 2LOOA 2B7EA 2PMHA 4RB3C 5FLMJ 2CRGA 1T2KA 1XGSA 3LSGA 4Y3OA 1JJ6C 2P6TA 3KP2A 1ZR2A 4AIHA 2R0QC 5DM7F 2ELJA 2VASA 5HLGA 2YR2A 2M3AA 4D1QA 4BY7J 1SFOJ 3TO9A 5D4SA 3UR3C 1IAWA 3BG9A 2OQRA 4OIQF 3QU6A 2KDOA 4RM2A 3S15J 2VJIA 3CF5F 2VC0A 1W1WE 5B5EC 4A5NA 1SVMA 3CCRI 2CV1A 3W3CA 1D1BA 2DT6A 3H9QA 4B3AA 2I8DA 4B48A 2GM4A 4CCLA 1BR4A 5K5OA 1SFEA 5EEHA 3F8BA 4YFXF 3K4MA 1X1PA 2P7VB 3SJMA 2W4SA 4A0YA 2DMPA 3ZRGA 1BA5A 1FX7A 5ILVA 1LJ9A 4ANJA 1P2FA 1O3RA 4HRIA 2M34A 4A3BJ 1A35A 2LY9A 3VSKA 1HLVA 3S1NJ 5BOXA 2ZMEC 4B8XA 2NNNA 3LAJA 2IT0A 2YX7A 3CUQC 3OYFA 2JRTA 4HX7A 3CTAA 4RGSA 3V7SA 4YIFA 3GLLA 4AVZA 2UV1A 3UNGC 1G4DA 2MH9A 2FNAA 1JGSA 3DBHB 3BP8A 2KIMA 1XCBA 2QEXI 3G4SI 2RN7A 5BPDA 4GRIA 2GOMA 3MVPA 2K9QA 1Z6TA 5HOOA 1N25A 4HV6A 4U0WA 5DCMB 1JI8A 2DAOA 1AOYA 1H9GA 1OCRH 5JLXA 4FISA 3IAM2 3OYKA 3QYEA 2BXYA 3DKXA 1P92A 2VODA 3VYTB 1UHWA 3RPQA 1PUFA 2RDPA 5J47A 2DTZA 3JREA 4HQEA 5EEAA 2KIUA 3S14J 3FZVA 2MBFA 1MDMB 3H5AA 3H0GJ 4QWQA 3TKYA 3ZMUA 1RI7A 4A93J 3EDPA 2VJJA 2X6OA 2Q8KA 4KISA 3ABLH 4GGGA 3LAPA 1I6HJ 4B3XA 3RYPA 2DTRA 1I1GA 5J4VA 2GOXB 4BE2A 1GHCA 4IRIA 2XPUA 1T0FA 4LG3A 3GW2A 1JKPC 3HSEA 1LPQA 4GO1A 3U9GA 3Q0VA 4Z6YA 1NG7A 4UUSA 1B59A 4C3IJ 3K4CA 4JK1X 3RCOA 2X1CA 2QQ8A 3RJPA 4A3JJ 5ILSA 3F8FA 4EJTA 2DK8A 3WU2C 1APLC 2HQ5A 4JX6A 2CYYA 6PAXA 3I4MJ 1MMSA 3HUGB 2LNBA 2KFDA 3OL4A 4V2GA 1KONA 3MFKA 2F5CA 3IKTA 2TRTA 2MFZA 1MIJA 5GAGJ 2P6SA 3OS1A 2O5RA 2BBYA 2XASA 3P9CA 2V6EA 1VQ5I 2HQAA 3KYDB 4OAZA 3KE2A 2KDZA 3RIRA 4HPQA 2UXXA 4XLPF 1DPUA 4XR6A 2BY1A 3EUHA 3QQAA 1HDPA 1X3ZB 2F5EA 4IHTA 3GZ5A 4YFNF 3CO7C 3IP4B 2HXIA 3NRVA 3KZYA 2E71A 5J8FA 2DFHA 1LKXA 4DZJA 5LEJA 1K61A 3JTHA 1UAAA 2YUSA 2X6XA 1P4WA 1IN5A 3AFHA 3B6AA 1PYVA 3TOAA 2XAUA 1H9TA 3V42A 4L5EA 2LK2A 5E8IA 1RR8C 2FBKA 1IUYA 3MMYB 2I10A 4QTRA 1K6YA 1DP3A 3FM5A 1XMXA 1Z3YA 3RPUA 3O8GA 1H0MA 2NVXJ 2VT2A 1Y1WJ 3OV8A 2DOFA 2XAFA 2LTPA 4HSRA 3ZR8X 2DA6A 3M8FA 4I6ZA 1XB4A 1NHAA 2H27A 1K83J 1IN8A 1WI3A 4M3DA 3A01B 1K78A 2ICWG 3FWEA 5LRRA 3WHCA 2BVMA 5IPAA 3FXRA 4X6AJ 4LGWA 1SFKA 4C30A 2IJLA 3H3VK 1W7PD 3K1MA 3RZDJ 4RGUA 1BR2A 2DPUA 5LHHA 4DZPA 4G9YA 3TO6A 4CZCA 4IF4A 2E1CA 3T5XA 5L3BA 3LA2A 3R0AA 2HDCA 2WADA 1XGMA 1MBJA 2F5FA 2DMNA 2CQKA 3H3UA 4AYBN 1QO0D 1XDUA 2E1OA 1LE8A 2P5VA 4RMNA 1HBXG 3HDDA 3MCZA 3ASNH 3FISA 2J5PA 5JFRA 3CCVI 2DYSH 4XONA 1LFUP 4WXHA 1RUNA 3HRSA 3GXOA 4ENNA 1JUSA 4JQFA 1SMTA 1I5ZA 5E20A 2Y9YA 4IRHA 3TL4X 2I5UA 5FRMA 3DV8A 4QPQA 2JSPA 2V4JC 3IUOA 3KP4A 2H09A 2R92J 2K02A 3CJTB 2KRCA 4O6JA 1TNSA 2R3SA 1BL0A 1OCCH 3J80K 4E70A 4A0XA 4L0YB 1OFCX 3LSJA 1WJ5A 4ASNA 5LEKA 2JVGA 3SDBA 1T0FC 2LY1A 3DEUA 4EM2A 1SD6A 1W36C 3H36A 2EPFA 1B72B 1W5TA 3F9KA 2Y0MA 5F0FA 3PIPF 3F23A 2IXSA 2M7BA 2MSYA 3ERMA 3FMRA 3OYHA 1D0ZA 5LD2C 1S8NA 1W4MA 2HPIA 2M45A 2NVTJ 1V5FA 3E97A 2O03A 3MWMA 5GTIC 4CA0A 4GYIA 1ENHA 1VFCA 3T8TA 1G3WA 2HDDA 2QQAA 3PSIA 3CLQA 4A12A 1NK3P 1BM9A 3HXLA 1Y56A 2QLZA 3FHNA 3K1NA 5HNFA 5F64A 3FDYA 4CH7A 1X1CA 1YJWI 2AQEA 3HOWJ 5DD8A 3L2RA 3LFUA 3OYJA 1RRJA 3SHFA 3E5UA 2LDUA 3DTKA 2BE5F 2E1MB 1MH3A 4G6DA 4L9JA 3ESWB 1LEAA 1RNLA 2ID6A 4ON0A 1HCRA 2DA5A 3JAMZ 1PJRA 2HZTA 4A69C 3WTYC 1OCTC 2XF7A 4HYEA 5JHUA 1ZYRF 2L9SA 2Y0SA 3KX2A 5AIPA 1TZLA 1A6QA 3JW4A 4Y4RA 1EF4A 2CGPA 3GF2A 1ZLKA 2Y0SN 2G9WA 1S5LC 3I4PA 3NAUA 2H8WA 5FLXK 3BTIA 2LRDA 3BJ6A 5BMZA 2WY7Q 4C2MJ 3KPHA 1E17A 2GAUA 3KEQA 4XLNF 1XDSA 4G12A 1YX5A 4BXUA 2CU7A 3ECHA 2V9PA 2EZHA 3PQJA 4HF1A 2ZXWH 4LJZF 4E7ZA 3OYAA 2M30A 3X2QH 4FE7A 2A6HF 1ULYA 2ZJQF 3CMYA 2KRFA 4EEFG 3S3NA 2EFQA 3PL8A 2VOOA 2WA0A 3CUQB 5LGTA 1AKHB 2KLOA 5L3DA 2NS8A 4D9JA 3E1SA 4FX4A 3GTPJ 3OS2A 2DI3A 1D1AA 2JK3A 4R1HA 1ACIA 4PJMA 4Y17A 3WGGA 2ZFUA 4M71A 4AIJA 2Y30A 5E3LA 4ZC3A 1USSA 1ZK8A 5GPAA 1JKQC 1IXSB 1U5TC 4IJAA 2HQRA 2MYSA 1VQKI 2Q2EA 4C3HJ 5BPIA 5FD6A 3C2BA 3HPGA 2B63J 5E17F 3JAMK 2A5WA 1HF0A 1ZELA 3I54A 4CCJA 1R7JA 4ZH4F 1V5EA 1YITI 5E8GA 3KZZA 2GIZA 3EQLF 2DT7B 3NWSA 3HOYJ 2L7ZA 1E3HA 2G7UA 1KU7A 1FMVA 1J59A 1GVDA 2VXDA 1R22A 2LF7A 2R7XA 1WGXA 4PUSA 4AU7A 1ZGWA 4BEHA 3BT9A 1Z77A 3VEPA 2JMWA 1YS7A 4UHTA 5H6RA 5FKLA 3BZKA 3ZN1A 3HM5A 4MQVA 3LSPA 4OIPF 1KU2A 4LB6B 5H2FC 2X6YA 2X4HA 3IRQA 3F6OA 4ZZLA 4Y52J 4Y7NJ 2FX0A 4BGDA 2R7RA 1ZRDA 4H4KC 4A3EJ 3FIWA 2A05A 3JRIA 3L09A 2A68F 3L2WA 3ZQCA 1TT5B 3A4CA 1UMQA 4IQ4A 5A2QZ 4ENKA 4IHXA 1BJZA 5KAIC 1YJ9I 3H5NA 1WJBA 2IAIA 4GCVA 1ITYA 1MNEA 4M9XA 1TWGJ 4HA8A 3JRBA 3FM3A 3DU6A 1X4OA 4ZTFA 1JJ8C 2ZC2A 3GTLJ 2JZYA 3I59B 3CDIA 4PJ0C 1FYKA 2EV6A 1Z67A 4QSHA 1SFXA 1TWFJ 2DA2A 2LR8A 3I59A 3JRAA 2IS4A 4BXFA 2O9LA 3ONQA 4D5FA 3TP3A 3IWZA 2PG4A 4AD9A 2RGVA 3HSFA 5EJCA 3TDZC 2NOJB 3IH3A 2V1NA 3C18A 2JUGA 2KZGA 1Z9CA 1VI0A 1J7KA 2AXLA 5D8KB 2EILH 4BE0A 1MBHA 2VKVA 4IO9F 3LFKA 1D0XA 3M9AA 1WKMA 5D6EA 5CKTA 3M7GA 3S2WA 1P4AA 2XRNA 2COMA 2OCCH 1XCVA 2QENA 1Z1DA 4CGZA 3L2UA 3PQKA 5D5WB 1KQ8A 4UXNA 4RGRA 4XNFA 2P7CB 2IVMA 1W0UA 2EB7A 2GA1A 2WV0A 5EGOA 1YG2A 2B0LA 1RKTA 1A31A 1E0EA 1WWXA 1RC9A 1IN4A 2XC7A 3HOSA 1BI0A 2VBXA 3F3XA 2QKLB 3CCUI 2XPVA 1Z91A 2R5YA 2EZLA 3F0CA 3B02A 1JHHA 2OD5A 4CYDA 4IPAA 1EH8A 4GXOA 2AQFA 2K27A 2OA4A 1IJWC 1W7PB 4BH9A 3GYHX 4HBLA 4MEYF 2DFEA 2CUFA 1ZH5A 4U0YA 1Z05A 2EK5A 3K2ZA 1PUEE 1MMGA 2ME0A 5KCMA 3AKZA 2AS5F 3WODF 1F9NA 2LVSA 4KNYA 2K9LA 5DDGA 2GWRA 2E7XA 3PM1A 5B66C 1BI1A 2Z16A 4L5JA 3H92A 3GO5A 5HDGA 3S8PA 1TTYA 3CDHA 4PGGA 2PMZN 2CSOA 1TWHJ 1NH3A 5DM6F 3HJEA 2OF7A 1YE9A 5HVQC 1P6RA 4E4HA 2FMYA 3L00A 2MH2A 1M1EB 3LQQA 4R8HA 1LUJB 1XPXA 3ZMVA 5GP9A 1R36A 4JYKA 1I1SA 1JKRC 1O57A 2EIMH 1Z7LA 3HOZJ 3KYCB 5K5QA 2NNYA 1MBEA 1YFHA 2ETHA 3GFLA 2QBYB 4XMYA 2FRHA 3D1NI 4X0GA 3G6EI 1RKWA 2E36A 4HDVA 1JGGA 3Q0UA 2VXZA 2DDBA 5DCMA 2QM3A 1LNWA 1ZG5A 2HTJA 4NC6A 5EZHA 3HKZA 3BTLA 3OYEA 1F43A 4RAFA 1BOBA 1X2MA 4CHUA 2XHKA 4WX9A 2XROA 4ZDOA 4I01A 4HV5A 4MHGA 4MGRA 3KFWX 3ZQQA 5J1YA 3O8HA 4M6YA 2CQXA 4DYCA 4EVIA 4F3QA 5E3NA 1OYWA 2QQBA 3JRHA 4XSXF 2ECBA 3FX3A 5DEQA 3SZGA 3GZNB 3ZMZA 1HW2A 2JWTA 3H0DA 2CWEA 2STWA 4BDZA 1BIBA 4A3CJ 2DFIA 4I09A 3KP6A 1WCMJ 2LF8A 1LVKA 2FQ4A 2QF7A 2YSRA 4XOPA 2VLAA 1R4MB 5CVJA 2DA7A 4Q47A 1A5JA 4LLGF 4HDUA 2M9HA 2MGQA 2EZIA 2PJRA 3HUGA 3OY9A 3HB9A 4CZZA 4AIKA 2ZBKA 2JQ7A 2X9DA 2K9NA 2FEZA 3BPVA 2HKOA 4P55A 1A04A 2BVLA 2GZWA 4A3GJ 2FUG2 5FFZA 2Z9OA 3BR2A 3DKWA 1S7OA 5L3EA 1QHHD 4P9FA 2DYRH 2DMQA 5D4RA 2VKDA 1TNTA 1YO5C 2X6WA 3F8MA 4RA2A 4L9TA 1VQ9I 3OYLA 1R5HA 3SZTA 3ERED 3CCLI 4FTHA 3R60A 3F22A 4IVNA 4OAYA 3S93A 3GTKJ 2FOKA 2DMTA 4A6EA 3ZMDA 1KQ9A
chains in the Genus database with same CATH topology
1BOAA 2JSCA 2DQRA 2NAZA 3ULQB 4RB1A 1J5YA 3WGIA 3N97A 1SMYF 4YFKF 4D0PA 2EA4A 1OYYA 2H94A 1DP7P 3M8EA 5ICFA 1GXQA 4Z2YA 2CO5A 3HTUA 3J7AO 1YW8A 4BAYA 2PEXA 2V79A 2FXAA 4BYYA 5D6FA 3BROA 3F6VA 2UWMA 3AAFA 3R6SA 2KKOA 3V8KA 1G6NA 3J81K 3F8NA 4CICA 5E1WA 3SXYA 4PZJA 1T39A 1FBQA 3V4GA 5HS8A 4OU0A 4LG0A 2GXBA 1BIAA 4UVCA 1IF1A 2RV8A 5LLQA 4MNUA 3BOQA 1IN6A 5CYVA 1O3QA 1DDNA 1ZLJA 1PP8F 2XKPA 4KMUX 4I7HA 3I0TA 3H3ZA 1ON2A 2L3DA 1B6AA 1HXDA 2HEOA 3ZN0A 2F2EA 2D45A 3ZMTA 1F5TA 2Z99A 1B4AA 5FD5A 2IA2A 4CXFA 3RI4A 2ZKZA 3FMQA 3HTSB 4H0EA 2ADUA 1J2XA 1LQ1A 2FF4A 4A5MA 1GXPA 5A2QK 1CGPA 4BNCA 5J8CA 2PFBA 1D3YA 3IC7A 2DPDA 2R7FA 1QBJA 2ZNZA 2ACJA 3N4MA 2OU2A 2V1DA 5FGMA 2L54A 2DT5A 1F1ZA 2VOPA 1S7AA 1YYVA 3CO6C 3V8JA 1QQIA 2QUFA 1B1BA 3RKYA 4PCQA 4A6DA 2MA3A 2FU4A 4PGHA 2XAHA 4BHBA 1YW7A 3F21A 4EQQA 5D5XB 1U78A 2HWVA 1FWZA 4ZYGA 5D5VB 5IT3A 2NS0A 3SFZA 4LLNA 4NB5A 4UNOA 5CLSA 2MLKA 4WK8F 4JBAA 1W7PA 3W6KB 1LVAA 2L01A 4HF2A 3R4KA 1BC7C 1UHMA 5IT9Z 1KQ0A 4HF0A 3GEZA 5IT9K 1MD0A 4HZFA 1K6OA 4F7ZA 3GWZA 2W25A 2FBIA 2FSWA 3QRFF 2EFPA 4KDPA 1OMIA 3I64A 3GZ6A 4ENMA 4MQ9F 4EJWA 1C0WA 3EYYA 3I71A 1ZARA 2IRFG 3BJOA 1IRFA 4KT5C 3WU0A 2VN2A 3I5UA 5AIQA 2L4MA 1FSHA 3P9KA 2ELHA 2HFHA 4LK0F 2HS5A 3FXQA 4ZYEA 1YS6A 1KU9A 5FO5A 2VBZA 1O7LA 2HOEA 3WGHA 1YQAA 2YX4A 4NQWA 3F72A 3DPLC 1GVJA 1LB2A 3U2RA 1Z6RA 2V1UA 4UVAA 1LEBA 3EETA 3IL2A 2MD5A 3E6DA 4U7BA 4ENJA 2O61A 2H6BA 2BV6A 1WQ2A 4IRGA 5E1ZB 2QVOA 2DLLA 4HLXA 2CFXA 3ECOA 3BZ6A 4KYWA 4BHPA 1ZREA 4R79A 2KIFA 4M9ZA 3QPHA 5DCFA 1BN5A 3VFZA 2EJRA 5CVUA 1HKSA 1SD4A 1CF7A 1K79A 2P5LC 3ZMSA 1QZZA 2XAJA 3HYIA 5DD4A 1IRGA 3HIFA 1ZGJA 1BJAA 2MLGA 3L9FA 3K69A 3E6BA 1K78B 3HRTA 3HOTA 1J9IA 2BEOA 2EA2A 1BI3A 1FNNA 1HKQA 5JR3A 4NHJA 1ZGAA 4MTDA 4KICA 3E5QA 1R23A 5E1XA 4G7HF 2FNPA 1XSVA 1ZAOA 5JI6A 3I53A 2O3FA 2CG4A 2ZO4A 1UCRA 2YPRA 2K86A 3K0LA 3D5LA 1T38A 2XKOA 2XV4S 2D1VA 4QLCU 3K9TA 3DP7A 4N9IA 3VOEA 1TQIA 1MZBA 2O0YA 2ZNYA 2W57A 3LA7A 3ZQ7A 4IXAA 2DBBA 2IP2A 5CVRA 1TW3A 4I2OA 4AWXB 3Q9SA 4G8XA 1REPC 2DU9A 1XMKA 4U88A 3COAC 2XUBA 3HRUA 1FOKA 1FBSA 1U3EM 2DW4A 3E6MA 2M5WA 3J81Z 2EFOA 4OIRF 1G3YA 5FLXZ 1ODDA 4G6QA 3RKXA 3WG9A 1TLHB 3E6CC 2KJBA 5ICGA 1LDKB 5EEGA 5LHIA 2KJCA 1Q1HA 2Y75A 1MKMA 4Q48A 1EH6A 3WTXC 5E18F 5ILUA 2GA2A 1XD7A 2PN6A 3HRMA 4EGYA 2YU3A 5CVVA 4OMYA 1XMAA 3O3KA 1KYWA 5ERIA 3V7RA 3WTWC 3L2CA 4HLYA 1KGSA 4I02A 1BBYA 4RAYA 1XGOA 3DXJF 5KVRA 1PP7U 2K4BA 2P4WA 4WCGA 2EWNA 1SD5A 3KP3A 5K5RA 4KMFA 4AVPA 5ICCA 1AWCA 1HQCA 3JSPA 1L0OC 5L3FA 1IXCA 2OZ6A 2WWYA 2V1XA 1U5TB 4OOIA 2VC1A 2WC2A 5HS9A 1TBXA 3ELKA 4LG0B 4BQAA 3O6BB 3WTUC 1D8JA 4KIBA 5BS6A 4IHSA 4RGXA 2VT3A 2DQLA 4UUVA 2C6YA 1FYMA 1TW2A 3W6JB 3C3WA 3NEUA 1BC8C 3BDDA 2RVCA 1R5GA 2EV0A 2XAQA 2A3SA 3DF8A 2M8EA 5HLHA 4ZYDA 2HYGD 3BWGA 4S04A 1IW7F 1WSUA 1FBUA 2Z5UA 1S29A 1V4RA 3CLOA 3R61A 1Z7UA 2HQNA 4EMSA 1FC3A 3KETA 4LLLA 1DUXC 3CJNA 3O2PE 2BYVE 2L02A 2A69F 3JTGA 1U2WA 2JPCA 1QNTA 2ESHA 3SZPA 5LBQA 3IHUA 2QQ9A 4N9HA 5CJ9A 3R0JA 4L0ZB 1G3SA 4CO8A 1DPRA 4TV7A 4KIFA 2XVCA 1KU3A 1UB9A 3QU3A 2JT1A 4BHCA 3TQNA 4I0AA 1WI9A 5D8LB 2L4AA 2GQQA 2V6CA 3WE2A 3ISPA 1U5TA 3KP7A 4EJOA 3LSTA 2EV5A 1JE8A 4L9VA 3KLOA 1SAXA 2W24A 1V3FA 2G7HA 2M87A 4XSZF 1HSJA 3QPTA 3LWFA 1RZ4A 1R1UA 2ISZA 4L5IA 5KK1A 1FZPB 2X0LA 2QBYA 4YIIA 3RYRA 3MQ0A 2ZFWA 1HSTA 1LDJA 2IW5A 2O8XA 1JXSA 2A5YB 1OPCA 4WF2A 5DUKA 5FB2A 3ML6A 3HSRA 4XRFA 4HAMA 1MJ9A 1USTA 1HW5A 3KLNA 1ZG1A 4P5OA 5DYMA 2FMLA 5L3GA 1XN7A 1K7AA 4Q4ZF 4UV8A 4O3MA 5DUIA 3ROUA 3G73A 4S05A 3BY6A 1E2XA 1R1TA 2D1HA 2A61A 3MZHA 1QGPA 3GX4X 4MEXF 3IWFA 2STTA 4KN4X 4N0BA 2D2WA 1T6SA 4M73A 4PDKA 3E3VA 2VONA 5TRDA 3WTZA 4MTEA 5HDNA 4G7ZF 1G3TA 1FYLA 2VE9A 1R1VA 4KFCA 3LA3A 1SD7A 2IA0A 2XAGA 1IZ1A 3TO7A 2P5KA 1YIOA 3ABTA 4FX0A 2F5DA 1P4XA 1IN7A 5J6XA 4G7OF 3CUQA 1O3SA 4OMZA 2XGXA 2W85A 2NRAC 4KA4A 2PJPA 1T98A 4M6XA 3VODA 4K2EA 1OR7A 3TGNA 2QYOA 2GXGA 5H20A 2IPQX 3TOBA 2HGCA 3DFGA 2XIGA 1YLFA 3D0SA 2WTEA 3MEXA 3T1BA 5TJJA 4DNCA 1ZRFA 2ESNA 2GIVA 3KP5A 2HYFA 1R58A 1YW9A 4Y15A 1OYIA 2DK5A 4LFUA 1ONVA 5LGNA 3P7NA 4KN7X 1BI2A 3MZYA 3FHZA 2R7DA 5L3CA 4ESBA 1STZA 2FA5A 1SFUA 3RDIA 1FSEA 3ZP5A 5F1RA 1O7FA 1XSDA 3GFJA 4HOBA 2FBHA 4LD5A 1TQMA 1OKRA 3KCCA 2EFWA 5ED4A 4CDGA 2JTVA 3JSOA 3TDUC 1B9MA 3MAJA 3V7CA 2V9VA 1FP1D 1U8RA 3WE3A 4FHTA 2VE8A 2RNJA 5LRSA 3C1DA 1S6LA 4M74A 1MJAA 4RB0A 4UV9A 5HLIA 3I58A 2JPBA 4M72A 1J0RA 3J80Z 2LKPA 2HKXA 4EJUA 1ZRCA 3CUOA 2IA1A 1FP2A 3RTRA 3G3ZA 5AONA 4KIGA 4KUMA 4LMYA 4OINF 4WXDA 4Q5SF 2ZMEA 4EV0A 2W84A 1YTYA 2UXNA 5FFXA 3EYIA 1CF7B 2VBYA 2VBWA 4ETSA 1LDDA 3OOPA 4UVBA 3WTSC 4WXCA 3DPTA 5HS7A 4I0BA 3FF5A 3V8LA 4L18B 4B09A 2OAZA 3U1DA 2PI0A 2Y48A 1O3TA 1MDMA 2QZ8A 1X3UA 3WU1B 4L9NA 3L7WA 1FPQA 2OZUA 3QAHA 2PMUA 2RQPA 2Z33A 4P96A 1HW1A 4OIOF 2RKHA 1ZG3A 3LQRA 3SQNA 3Q5FA 3B73A 2M1BA 2RC4A 3IRRA 3GUDA 4RS8A 3VB2A 2LSOA 4EJVA 4HW0A 1FLIA 3KEOA 4ZZDA 4I98B 1MJBA 3HHHA 4HQMA 3GLXA 1ZHFA 2ZCWA 1J75A 2MC3A 1ON1A 5D5UB 1Y0UA 3T8RA 4EM0B 5LHGA 4LK1F 1R00A 1UFMA 3RKWA 4RAZA 3HHGA 4P9UA 2PQ8A 4GYGA 1U6GA 3GVAA 1WRJA 2J5OA 3DQVC 1I27A 4M9SA 1QZYA 2P8TA 4HX4A 2E1NA 1FY7A 1RIOH 4O5VA 5K1YA 1QPMA 2CW0F 4ESJA 4HX8A 3FXUA 1TQPA 1B9NA 3GFIA 2DO7A 2TDXA 4WWCA 4ESFA 4DQ2A 2ZMEB 2HR3A 3WTVC 3F8CA 1W5SA 2OBPA 2ZJ2A 2A07F 5HDKA 2Q0OA 1VTNC 2O6GE 3QP5A 3NQOA 3BJAA 1MGTA 1KYZA 3REOA 1RUOA 3P9IA 1S3JA 2FQ3A 1EH7A 1XGNA 3K1PA 3ZPLA 1FT9A 5DV5A 1EV7A 4YG2F 5BQTA 2PLYA 5H6QA 4A0ZA 2ISYA 2ZXJA 5JVTA 2UZKA 4RB2C 2E7WA 3IKVA 2HTSA 3M1EA 5F6FA 4EM1A 2EFNA 4XBFA 1I6XA 4ZYHA 4G94A 1JHFA 2K4JA 4EGZA 3Q9VA 2H6CA 3WTTC 1PDNC 1ZN2A 2NYXA 2OQGA 3T0YA 5ICEA 1XSXA 1D5VA 3C7JA 1HKTA 1IXRC 4LB5A 2BGCA 2FE3A 1L3LA 1D8KA 2PBIA 1KA8A 3QOPA 2Z3YA 3ABUA 5LGUA 3BPXA 2K7LA 3FMSA 3PFIA 4U7DA 2QWWA 4U0VA 3QP6A 2A6EF 1F4KA 4A2UA 4Y13A 4FT8A 3GFMA 3E5XA 5CVIA 2PMHA 4RB3C 1T2KA 1XGSA 2P6TA 3KP2A 4AIHA 5HLGA 2YR2A 3TO9A 5D4SA 1IAWA 2OQRA 4OIQF 3QU6A 2VC0A 4A5NA 5K5OA 1SFEA 5EEHA 3F8BA 4YFXF 2P7VB 4A0YA 1FX7A 5ILVA 1LJ9A 1P2FA 1O3RA 5BOXA 4B8XA 2NNNA 3LAJA 2IT0A 2YX7A 3CUQC 2JRTA 4HX7A 3CTAA 4RGSA 3V7SA 4YIFA 1G4DA 2MH9A 2FNAA 1JGSA 3BP8A 2KIMA 1XCBA 2RN7A 5BPDA 1Z6TA 5HOOA 4HV6A 4U0WA 5DCMB 2DAOA 1AOYA 1H9GA 1P92A 2VODA 1UHWA 3RPQA 2RDPA 4HQEA 2KIUA 3FZVA 2MBFA 1MDMB 4QWQA 3TKYA 3ZMUA 1RI7A 3EDPA 2Q8KA 4GGGA 3LAPA 3RYPA 2DTRA 1I1GA 1GHCA 4IRIA 1T0FA 3GW2A 3HSEA 4GO1A 3U9GA 1B59A 4JK1X 3RJPA 5ILSA 3F8FA 4EJTA 2DK8A 2CYYA 6PAXA 2LNBA 3MFKA 2F5CA 3IKTA 2P6SA 2BBYA 2XASA 3P9CA 3KE2A 3RIRA 2UXXA 4XLPF 1DPUA 3EUHA 2F5EA 4IHTA 3GZ5A 4YFNF 3CO7C 3NRVA 3KZYA 5J8FA 5LEJA 3JTHA 1P4WA 1IN5A 3TOAA 1H9TA 5E8IA 2FBKA 1IUYA 3FM5A 3RPUA 1H0MA 2VT2A 3OV8A 2XAFA 3M8FA 1XB4A 1NHAA 2H27A 1IN8A 1K78A 3FWEA 5LRRA 3FXRA 4LGWA 2IJLA 1W7PD 3K1MA 4RGUA 2DPUA 5LHHA 4G9YA 3TO6A 4IF4A 2E1CA 3T5XA 5L3BA 3LA2A 3R0AA 2HDCA 1XGMA 2F5FA 2CQKA 3H3UA 1QO0D 1XDUA 2P5VA 1HBXG 3MCZA 2J5PA 5JFRA 4WXHA 1RUNA 3HRSA 3GXOA 4ENNA 4JQFA 1SMTA 1I5ZA 5E20A 4IRHA 3DV8A 3KP4A 2H09A 2K02A 4O6JA 1TNSA 2R3SA 3J80K 4E70A 4A0XA 4L0YB 5LEKA 4ASNA 3DEUA 4EM2A 1SD6A 1W5TA 2Y0MA 3F23A 3FMRA 1S8NA 1W4MA 2M45A 2O03A 3E97A 3MWMA 4GYIA 3T8TA 1G3WA 2QQAA 4A12A 1BM9A 2QLZA 3K1NA 5F64A 5DD8A 3SHFA 3E5UA 2LDUA 2BE5F 4G6DA 4L9JA 1LEAA 1RNLA 4ON0A 3JAMZ 2HZTA 3WTYC 4HYEA 5JHUA 1ZYRF 5AIPA 3JW4A 2CGPA 3GF2A 1ZLKA 2G9WA 3I4PA 5FLXK 3BJ6A 5BMZA 1E17A 2GAUA 3KEQA 4XLNF 1XDSA 4BXUA 3ECHA 3PQJA 4HF1A 4LJZF 2M30A 2A6HF 1ULYA 2KRFA 2EFQA 2VOOA 3CUQB 5LGTA 5L3DA 4FX4A 2DI3A 4R1HA 4Y17A 3WGGA 4M71A 4AIJA 1USSA 1IXSB 1U5TC 4IJAA 2HQRA 2Q2EA 5BPIA 5FD6A 5E17F 3JAMK 3I54A 1R7JA 4ZH4F 5E8GA 3KZZA 3EQLF 2G7UA 1KU7A 1J59A 1R22A 2LF7A 3VEPA 1YS7A 4UHTA 5H6RA 3ZN1A 4MQVA 4OIPF 1KU2A 4LB6B 2X4HA 3IRQA 3F6OA 4ZZLA 1ZRDA 3L09A 2A68F 5A2QZ 4ENKA 4GCVA 4M9XA 4HA8A 3FM3A 2JZYA 3I59B 1FYKA 2EV6A 1SFXA 3I59A 3IWZA 2PG4A 4AD9A 2RGVA 3HSFA 3TDZC 3C18A 1Z9CA 1J7KA 2AXLA 5D8KB 3LFKA 3M9AA 1WKMA 5D6EA 3S2WA 3M7GA 1P4AA 2XRNA 2COMA 1XCVA 2QENA 1Z1DA 4CGZA 3PQKA 5D5WB 1KQ8A 4UXNA 4RGRA 2P7CB 2IVMA 2EB7A 2GA1A 2WV0A 1YG2A 2B0LA 1WWXA 1IN4A 3HOSA 1BI0A 2VBXA 3F3XA 1Z91A 3B02A 1JHHA 2OD5A 4CYDA 4IPAA 1EH8A 4GXOA 2K27A 2OA4A 1W7PB 4BH9A 3GYHX 4HBLA 4MEYF 1ZH5A 4U0YA 1Z05A 2EK5A 3K2ZA 1PUEE 2AS5F 3WODF 1F9NA 4KNYA 5DDGA 2GWRA 2E7XA 1BI1A 4L5JA 3H92A 3GO5A 5HDGA 1TTYA 3CDHA 4PGGA 2CSOA 5HVQC 1P6RA 2FMYA 3L00A 2MH2A 3LQQA 4R8HA 3ZMVA 1R36A 1I1SA 1O57A 5K5QA 2NNYA 1YFHA 2ETHA 3GFLA 2QBYB 2FRHA 4HDVA 5DCMA 2VXZA 2QM3A 1LNWA 1ZG5A 2HTJA 4CHUA 2XHKA 4WX9A 2XROA 4I01A 4HV5A 4MHGA 4MGRA 3KFWX 4M6YA 4EVIA 1OYWA 2QQBA 4XSXF 3FX3A 5DEQA 3ZMZA 1HW2A 2CWEA 2STWA 1BIBA 2DFIA 4I09A 3KP6A 2LF8A 2YSRA 5CVJA 4Q47A 4LLGF 4HDUA 3HUGA 4CZZA 4AIKA 2ZBKA 2FEZA 3BPVA 2HKOA 4P55A 1A04A 2GZWA 5FFZA 2Z9OA 3DKWA 1S7OA 5L3EA 4P9FA 5D4RA 1TNTA 1YO5C 3F8MA 4L9TA 1R5HA 3SZTA 3ERED 3R60A 3F22A 4IVNA 2FOKA 4A6EA 3ZMDA 1KQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BOA A;  2JSC A;  2DQR A;  2NAZ A;  3ULQ B;  4RB1 A;  1J5Y A;  3WGI A;  3N97 A;  1SMY F;  4YFK F;  4D0P A;  2EA4 A;  1OYY A;  2H94 A;  1DP7 P;  3M8E A;  5ICF A;  1GXQ A;  4Z2Y A;  2CO5 A;  3HTU A;  3J7A O;  1YW8 A;  4BAY A;  2PEX A;  2V79 A;  2FXA A;  4BYY A;  5D6F A;  3BRO A;  3F6V A;  2UWM A;  3AAF A;  3R6S A;  2KKO A;  3V8K A;  1G6N A;  3J81 K;  3F8N A;  4CIC A;  5E1W A;  3SXY A;  4PZJ A;  1T39 A;  1FBQ A;  3V4G A;  5HS8 A;  4OU0 A;  4LG0 A;  2GXB A;  1BIA A;  4UVC A;  1IF1 A;  2RV8 A;  5LLQ A;  4MNU A;  3BOQ A;  1IN6 A;  5CYV A;  1O3Q A;  1DDN A;  1ZLJ A;  1PP8 F;  2XKP A;  4KMU X;  4I7H A;  3I0T A;  3H3Z A;  1ON2 A;  2L3D A;  1B6A A;  1HXD A;  2HEO A;  3ZN0 A;  2F2E A;  2D45 A;  3ZMT A;  1F5T A;  2Z99 A;  1B4A A;  5FD5 A;  2IA2 A;  4CXF A;  3RI4 A;  2ZKZ A;  3FMQ A;  3HTS B;  4H0E A;  2ADU A;  1J2X A;  1LQ1 A;  2FF4 A;  4A5M A;  1GXP A;  5A2Q K;  1CGP A;  4BNC A;  5J8C A;  2PFB A;  1D3Y A;  3IC7 A;  2DPD A;  2R7F A;  1QBJ A;  2ZNZ A;  2ACJ A;  3N4M A;  2OU2 A;  2V1D A;  5FGM A;  2L54 A;  2DT5 A;  1F1Z A;  2VOP A;  1S7A A;  1YYV A;  3CO6 C;  3V8J A;  1QQI A;  2QUF A;  1B1B A;  3RKY A;  4PCQ A;  4A6D A;  2MA3 A;  2FU4 A;  4PGH A;  2XAH A;  4BHB A;  1YW7 A;  3F21 A;  4EQQ A;  5D5X B;  1U78 A;  2HWV A;  1FWZ A;  4ZYG A;  5D5V B;  5IT3 A;  2NS0 A;  3SFZ A;  4LLN A;  4NB5 A;  4UNO A;  5CLS A;  2MLK A;  4WK8 F;  4JBA A;  1W7P A;  3W6K B;  1LVA A;  2L01 A;  4HF2 A;  3R4K A;  1BC7 C;  1UHM A;  5IT9 Z;  1KQ0 A;  4HF0 A;  3GEZ A;  5IT9 K;  1MD0 A;  4HZF A;  1K6O A;  4F7Z A;  3GWZ A;  2W25 A;  2FBI A;  2FSW A;  3QRF F;  2EFP A;  4KDP A;  1OMI A;  3I64 A;  3GZ6 A;  4ENM A;  4MQ9 F;  4EJW A;  1C0W A;  3EYY A;  3I71 A;  1ZAR A;  2IRF G;  3BJO A;  1IRF A;  4KT5 C;  3WU0 A;  2VN2 A;  3I5U A;  5AIQ A;  2L4M A;  1FSH A;  3P9K A;  2ELH A;  2HFH A;  4LK0 F;  2HS5 A;  3FXQ A;  4ZYE A;  1YS6 A;  1KU9 A;  5FO5 A;  2VBZ A;  1O7L A;  2HOE A;  3WGH A;  1YQA A;  2YX4 A;  4NQW A;  3F72 A;  3DPL C;  1GVJ A;  1LB2 A;  3U2R A;  1Z6R A;  2V1U A;  4UVA A;  1LEB A;  3EET A;  3IL2 A;  2MD5 A;  3E6D A;  4U7B A;  4ENJ A;  2O61 A;  2H6B A;  2BV6 A;  1WQ2 A;  4IRG A;  5E1Z B;  2QVO A;  2DLL A;  4HLX A;  2CFX A;  3ECO A;  3BZ6 A;  4KYW A;  4BHP A;  1ZRE A;  4R79 A;  2KIF A;  4M9Z A;  3QPH A;  5DCF A;  1BN5 A;  3VFZ A;  2EJR A;  5CVU A;  1HKS A;  1SD4 A;  1CF7 A;  1K79 A;  2P5L C;  3ZMS A;  1QZZ A;  2XAJ A;  3HYI A;  5DD4 A;  1IRG A;  3HIF A;  1ZGJ A;  1BJA A;  2MLG A;  3L9F A;  3K69 A;  3E6B A;  1K78 B;  3HRT A;  3HOT A;  1J9I A;  2BEO A;  2EA2 A;  1BI3 A;  1FNN A;  1HKQ A;  5JR3 A;  4NHJ A;  1ZGA A;  4MTD A;  4KIC A;  3E5Q A;  1R23 A;  5E1X A;  4G7H F;  2FNP A;  1XSV A;  1ZAO A;  5JI6 A;  3I53 A;  2O3F A;  2CG4 A;  2ZO4 A;  1UCR A;  2YPR A;  2K86 A;  3K0L A;  3D5L A;  1T38 A;  2XKO A;  2XV4 S;  2D1V A;  4QLC U;  3K9T A;  3DP7 A;  4N9I A;  3VOE A;  1TQI A;  1MZB A;  2O0Y A;  2ZNY A;  2W57 A;  3LA7 A;  3ZQ7 A;  4IXA A;  2DBB A;  2IP2 A;  5CVR A;  1TW3 A;  4I2O A;  4AWX B;  3Q9S A;  4G8X A;  1REP C;  2DU9 A;  1XMK A;  4U88 A;  3COA C;  2XUB A;  3HRU A;  1FOK A;  1FBS A;  1U3E M;  2DW4 A;  3E6M A;  2M5W A;  3J81 Z;  2EFO A;  4OIR F;  1G3Y A;  5FLX Z;  1ODD A;  4G6Q A;  3RKX A;  3WG9 A;  1TLH B;  3E6C C;  2KJB A;  5ICG A;  1LDK B;  5EEG A;  5LHI A;  2KJC A;  1Q1H A;  2Y75 A;  1MKM A;  4Q48 A;  1EH6 A;  3WTX C;  5E18 F;  5ILU A;  2GA2 A;  1XD7 A;  2PN6 A;  3HRM A;  4EGY A;  2YU3 A;  5CVV A;  4OMY A;  1XMA A;  3O3K A;  1KYW A;  5ERI A;  3V7R A;  3WTW C;  3L2C A;  4HLY A;  1KGS A;  4I02 A;  1BBY A;  4RAY A;  1XGO A;  3DXJ F;  5KVR A;  1PP7 U;  2K4B A;  2P4W A;  4WCG A;  2EWN A;  1SD5 A;  3KP3 A;  5K5R A;  4KMF A;  4AVP A;  5ICC A;  1AWC A;  1HQC A;  3JSP A;  1L0O C;  5L3F A;  1IXC A;  2OZ6 A;  2WWY A;  2V1X A;  1U5T B;  4OOI A;  2VC1 A;  2WC2 A;  5HS9 A;  1TBX A;  3ELK A;  4LG0 B;  4BQA A;  3O6B B;  3WTU C;  1D8J A;  4KIB A;  5BS6 A;  4IHS A;  4RGX A;  2VT3 A;  2DQL A;  4UUV A;  2C6Y A;  1FYM A;  1TW2 A;  3W6J B;  3C3W A;  3NEU A;  1BC8 C;  3BDD A;  2RVC A;  1R5G A;  2EV0 A;  2XAQ A;  2A3S A;  3DF8 A;  2M8E A;  5HLH A;  4ZYD A;  2HYG D;  3BWG A;  4S04 A;  1IW7 F;  1WSU A;  1FBU A;  2Z5U A;  1S29 A;  1V4R A;  3CLO A;  3R61 A;  1Z7U A;  2HQN A;  4EMS A;  1FC3 A;  3KET A;  4LLL A;  1DUX C;  3CJN A;  3O2P E;  2BYV E;  2L02 A;  2A69 F;  3JTG A;  1U2W A;  2JPC A;  1QNT A;  2ESH A;  3SZP A;  5LBQ A;  3IHU A;  2QQ9 A;  4N9H A;  5CJ9 A;  3R0J A;  4L0Z B;  1G3S A;  4CO8 A;  1DPR A;  4TV7 A;  4KIF A;  2XVC A;  1KU3 A;  1UB9 A;  3QU3 A;  2JT1 A;  4BHC A;  3TQN A;  4I0A A;  1WI9 A;  5D8L B;  2L4A A;  2GQQ A;  2V6C A;  3WE2 A;  3ISP A;  1U5T A;  3KP7 A;  4EJO A;  3LST A;  2EV5 A;  1JE8 A;  4L9V A;  3KLO A;  1SAX A;  2W24 A;  1V3F A;  2G7H A;  2M87 A;  4XSZ F;  1HSJ A;  3QPT A;  3LWF A;  1RZ4 A;  1R1U A;  2ISZ A;  4L5I A;  5KK1 A;  1FZP B;  2X0L A;  2QBY A;  4YII A;  3RYR A;  3MQ0 A;  2ZFW A;  1HST A;  1LDJ A;  2IW5 A;  2O8X A;  1JXS A;  2A5Y B;  1OPC A;  4WF2 A;  5DUK A;  5FB2 A;  3ML6 A;  3HSR A;  4XRF A;  4HAM A;  1MJ9 A;  1UST A;  1HW5 A;  3KLN A;  1ZG1 A;  4P5O A;  5DYM A;  2FML A;  5L3G A;  1XN7 A;  1K7A A;  4Q4Z F;  4UV8 A;  4O3M A;  5DUI A;  3ROU A;  3G73 A;  4S05 A;  3BY6 A;  1E2X A;  1R1T A;  2D1H A;  2A61 A;  3MZH A;  1QGP A;  3GX4 X;  4MEX F;  3IWF A;  2STT A;  4KN4 X;  4N0B A;  2D2W A;  1T6S A;  4M73 A;  4PDK A;  3E3V A;  2VON A;  5TRD A;  3WTZ A;  4MTE A;  5HDN A;  4G7Z F;  1G3T A;  1FYL A;  2VE9 A;  1R1V A;  4KFC A;  3LA3 A;  1SD7 A;  2IA0 A;  2XAG A;  1IZ1 A;  3TO7 A;  2P5K A;  1YIO A;  3ABT A;  4FX0 A;  2F5D A;  1P4X A;  1IN7 A;  5J6X A;  4G7O F;  3CUQ A;  1O3S A;  4OMZ A;  2XGX A;  2W85 A;  2NRA C;  4KA4 A;  2PJP A;  1T98 A;  4M6X A;  3VOD A;  4K2E A;  1OR7 A;  3TGN A;  2QYO A;  2GXG A;  5H20 A;  2IPQ X;  3TOB A;  2HGC A;  3DFG A;  2XIG A;  1YLF A;  3D0S A;  2WTE A;  3MEX A;  3T1B A;  5TJJ A;  4DNC A;  1ZRF A;  2ESN A;  2GIV A;  3KP5 A;  2HYF A;  1R58 A;  1YW9 A;  4Y15 A;  1OYI A;  2DK5 A;  4LFU A;  1ONV A;  5LGN A;  3P7N A;  4KN7 X;  1BI2 A;  3MZY A;  3FHZ A;  2R7D A;  5L3C A;  4ESB A;  1STZ A;  2FA5 A;  1SFU A;  3RDI A;  1FSE A;  3ZP5 A;  5F1R A;  1O7F A;  1XSD A;  3GFJ A;  4HOB A;  2FBH A;  4LD5 A;  1TQM A;  1OKR A;  3KCC A;  2EFW A;  5ED4 A;  4CDG A;  2JTV A;  3JSO A;  3TDU C;  1B9M A;  3MAJ A;  3V7C A;  2V9V A;  1FP1 D;  1U8R A;  3WE3 A;  4FHT A;  2VE8 A;  2RNJ A;  5LRS A;  3C1D A;  1S6L A;  4M74 A;  1MJA A;  4RB0 A;  4UV9 A;  5HLI A;  3I58 A;  2JPB A;  4M72 A;  1J0R A;  3J80 Z;  2LKP A;  2HKX A;  4EJU A;  1ZRC A;  3CUO A;  2IA1 A;  1FP2 A;  3RTR A;  3G3Z A;  5AON A;  4KIG A;  4KUM A;  4LMY A;  4OIN F;  4WXD A;  4Q5S F;  2ZME A;  4EV0 A;  2W84 A;  1YTY A;  2UXN A;  5FFX A;  3EYI A;  1CF7 B;  2VBY A;  2VBW A;  4ETS A;  1LDD A;  3OOP A;  4UVB A;  3WTS C;  4WXC A;  3DPT A;  5HS7 A;  4I0B A;  3FF5 A;  3V8L A;  4L18 B;  4B09 A;  2OAZ A;  3U1D A;  2PI0 A;  2Y48 A;  1O3T A;  1MDM A;  2QZ8 A;  1X3U A;  3WU1 B;  4L9N A;  3L7W A;  1FPQ A;  2OZU A;  3QAH A;  2PMU A;  2RQP A;  2Z33 A;  4P96 A;  1HW1 A;  4OIO F;  2RKH A;  1ZG3 A;  3LQR A;  3SQN A;  3Q5F A;  3B73 A;  2M1B A;  2RC4 A;  3IRR A;  3GUD A;  4RS8 A;  3VB2 A;  2LSO A;  4EJV A;  4HW0 A;  1FLI A;  3KEO A;  4ZZD A;  4I98 B;  1MJB A;  3HHH A;  4HQM A;  3GLX A;  1ZHF A;  2ZCW A;  1J75 A;  2MC3 A;  1ON1 A;  5D5U B;  1Y0U A;  3T8R A;  4EM0 B;  5LHG A;  4LK1 F;  1R00 A;  1UFM A;  3RKW A;  4RAZ A;  3HHG A;  4P9U A;  2PQ8 A;  4GYG A;  1U6G A;  3GVA A;  1WRJ A;  2J5O A;  3DQV C;  1I27 A;  4M9S A;  1QZY A;  2P8T A;  4HX4 A;  2E1N A;  1FY7 A;  1RIO H;  4O5V A;  5K1Y A;  1QPM A;  2CW0 F;  4ESJ A;  4HX8 A;  3FXU A;  1TQP A;  1B9N A;  3GFI A;  2DO7 A;  2TDX A;  4WWC A;  4ESF A;  4DQ2 A;  2ZME B;  2HR3 A;  3WTV C;  3F8C A;  1W5S A;  2OBP A;  2ZJ2 A;  2A07 F;  5HDK A;  2Q0O A;  1VTN C;  2O6G E;  3QP5 A;  3NQO A;  3BJA A;  1MGT A;  1KYZ A;  3REO A;  1RUO A;  3P9I A;  1S3J A;  2FQ3 A;  1EH7 A;  1XGN A;  3K1P A;  3ZPL A;  1FT9 A;  5DV5 A;  1EV7 A;  4YG2 F;  5BQT A;  2PLY A;  5H6Q A;  4A0Z A;  2ISY A;  2ZXJ A;  5JVT A;  2UZK A;  4RB2 C;  2E7W A;  3IKV A;  2HTS A;  3M1E A;  5F6F A;  4EM1 A;  2EFN A;  4XBF A;  1I6X A;  4ZYH A;  4G94 A;  1JHF A;  2K4J A;  4EGZ A;  3Q9V A;  2H6C A;  3WTT C;  1PDN C;  1ZN2 A;  2NYX A;  2OQG A;  3T0Y A;  5ICE A;  1XSX A;  1D5V A;  3C7J A;  1HKT A;  1IXR C;  4LB5 A;  2BGC A;  2FE3 A;  1L3L A;  1D8K A;  2PBI A;  1KA8 A;  3QOP A;  2Z3Y A;  3ABU A;  5LGU A;  3BPX A;  2K7L A;  3FMS A;  3PFI A;  4U7D A;  2QWW A;  4U0V A;  3QP6 A;  2A6E F;  1F4K A;  4A2U A;  4Y13 A;  4FT8 A;  3GFM A;  3E5X A;  5CVI A;  2PMH A;  4RB3 C;  1T2K A;  1XGS A;  2P6T A;  3KP2 A;  4AIH A;  5HLG A;  2YR2 A;  3TO9 A;  5D4S A;  1IAW A;  2OQR A;  4OIQ F;  3QU6 A;  2VC0 A;  4A5N A;  5K5O A;  1SFE A;  5EEH A;  3F8B A;  4YFX F;  2P7V B;  4A0Y A;  1FX7 A;  5ILV A;  1LJ9 A;  1P2F A;  1O3R A;  5BOX A;  4B8X A;  2NNN A;  3LAJ A;  2IT0 A;  2YX7 A;  3CUQ C;  2JRT A;  4HX7 A;  3CTA A;  4RGS A;  3V7S A;  4YIF A;  1G4D A;  2MH9 A;  2FNA A;  1JGS A;  3BP8 A;  2KIM A;  1XCB A;  2RN7 A;  5BPD A;  1Z6T A;  5HOO A;  4HV6 A;  4U0W A;  5DCM B;  2DAO A;  1AOY A;  1H9G A;  1P92 A;  2VOD A;  1UHW A;  3RPQ A;  2RDP A;  4HQE A;  2KIU A;  3FZV A;  2MBF A;  1MDM B;  4QWQ A;  3TKY A;  3ZMU A;  1RI7 A;  3EDP A;  2Q8K A;  4GGG A;  3LAP A;  3RYP A;  2DTR A;  1I1G A;  1GHC A;  4IRI A;  1T0F A;  3GW2 A;  3HSE A;  4GO1 A;  3U9G A;  1B59 A;  4JK1 X;  3RJP A;  5ILS A;  3F8F A;  4EJT A;  2DK8 A;  2CYY A;  6PAX A;  2LNB A;  3MFK A;  2F5C A;  3IKT A;  2P6S A;  2BBY A;  2XAS A;  3P9C A;  3KE2 A;  3RIR A;  2UXX A;  4XLP F;  1DPU A;  3EUH A;  2F5E A;  4IHT A;  3GZ5 A;  4YFN F;  3CO7 C;  3NRV A;  3KZY A;  5J8F A;  5LEJ A;  3JTH A;  1P4W A;  1IN5 A;  3TOA A;  1H9T A;  5E8I A;  2FBK A;  1IUY A;  3FM5 A;  3RPU A;  1H0M A;  2VT2 A;  3OV8 A;  2XAF A;  3M8F A;  1XB4 A;  1NHA A;  2H27 A;  1IN8 A;  1K78 A;  3FWE A;  5LRR A;  3FXR A;  4LGW A;  2IJL A;  1W7P D;  3K1M A;  4RGU A;  2DPU A;  5LHH A;  4G9Y A;  3TO6 A;  4IF4 A;  2E1C A;  3T5X A;  5L3B A;  3LA2 A;  3R0A A;  2HDC A;  1XGM A;  2F5F A;  2CQK A;  3H3U A;  1QO0 D;  1XDU A;  2P5V A;  1HBX G;  3MCZ A;  2J5P A;  5JFR A;  4WXH A;  1RUN A;  3HRS A;  3GXO A;  4ENN A;  4JQF A;  1SMT A;  1I5Z A;  5E20 A;  4IRH A;  3DV8 A;  3KP4 A;  2H09 A;  2K02 A;  4O6J A;  1TNS A;  2R3S A;  3J80 K;  4E70 A;  4A0X A;  4L0Y B;  5LEK A;  4ASN A;  3DEU A;  4EM2 A;  1SD6 A;  1W5T A;  2Y0M A;  3F23 A;  3FMR A;  1S8N A;  1W4M A;  2M45 A;  2O03 A;  3E97 A;  3MWM A;  4GYI A;  3T8T A;  1G3W A;  2QQA A;  4A12 A;  1BM9 A;  2QLZ A;  3K1N A;  5F64 A;  5DD8 A;  3SHF A;  3E5U A;  2LDU A;  2BE5 F;  4G6D A;  4L9J A;  1LEA A;  1RNL A;  4ON0 A;  3JAM Z;  2HZT A;  3WTY C;  4HYE A;  5JHU A;  1ZYR F;  5AIP A;  3JW4 A;  2CGP A;  3GF2 A;  1ZLK A;  2G9W A;  3I4P A;  5FLX K;  3BJ6 A;  5BMZ A;  1E17 A;  2GAU A;  3KEQ A;  4XLN F;  1XDS A;  4BXU A;  3ECH A;  3PQJ A;  4HF1 A;  4LJZ F;  2M30 A;  2A6H F;  1ULY A;  2KRF A;  2EFQ A;  2VOO A;  3CUQ B;  5LGT A;  5L3D A;  4FX4 A;  2DI3 A;  4R1H A;  4Y17 A;  3WGG A;  4M71 A;  4AIJ A;  1USS A;  1IXS B;  1U5T C;  4IJA A;  2HQR A;  2Q2E A;  5BPI A;  5FD6 A;  5E17 F;  3JAM K;  3I54 A;  1R7J A;  4ZH4 F;  5E8G A;  3KZZ A;  3EQL F;  2G7U A;  1KU7 A;  1J59 A;  1R22 A;  2LF7 A;  3VEP A;  1YS7 A;  4UHT A;  5H6R A;  3ZN1 A;  4MQV A;  4OIP F;  1KU2 A;  4LB6 B;  2X4H A;  3IRQ A;  3F6O A;  4ZZL A;  1ZRD A;  3L09 A;  2A68 F;  5A2Q Z;  4ENK A;  4GCV A;  4M9X A;  4HA8 A;  3FM3 A;  2JZY A;  3I59 B;  1FYK A;  2EV6 A;  1SFX A;  3I59 A;  3IWZ A;  2PG4 A;  4AD9 A;  2RGV A;  3HSF A;  3TDZ C;  3C18 A;  1Z9C A;  1J7K A;  2AXL A;  5D8K B;  3LFK A;  3M9A A;  1WKM A;  5D6E A;  3S2W A;  3M7G A;  1P4A A;  2XRN A;  2COM A;  1XCV A;  2QEN A;  1Z1D A;  4CGZ A;  3PQK A;  5D5W B;  1KQ8 A;  4UXN A;  4RGR A;  2P7C B;  2IVM A;  2EB7 A;  2GA1 A;  2WV0 A;  1YG2 A;  2B0L A;  1WWX A;  1IN4 A;  3HOS A;  1BI0 A;  2VBX A;  3F3X A;  1Z91 A;  3B02 A;  1JHH A;  2OD5 A;  4CYD A;  4IPA A;  1EH8 A;  4GXO A;  2K27 A;  2OA4 A;  1W7P B;  4BH9 A;  3GYH X;  4HBL A;  4MEY F;  1ZH5 A;  4U0Y A;  1Z05 A;  2EK5 A;  3K2Z A;  1PUE E;  2AS5 F;  3WOD F;  1F9N A;  4KNY A;  5DDG A;  2GWR A;  2E7X A;  1BI1 A;  4L5J A;  3H92 A;  3GO5 A;  5HDG A;  1TTY A;  3CDH A;  4PGG A;  2CSO A;  5HVQ C;  1P6R A;  2FMY A;  3L00 A;  2MH2 A;  3LQQ A;  4R8H A;  3ZMV A;  1R36 A;  1I1S A;  1O57 A;  5K5Q A;  2NNY A;  1YFH A;  2ETH A;  3GFL A;  2QBY B;  2FRH A;  4HDV A;  5DCM A;  2VXZ A;  2QM3 A;  1LNW A;  1ZG5 A;  2HTJ A;  4CHU A;  2XHK A;  4WX9 A;  2XRO A;  4I01 A;  4HV5 A;  4MHG A;  4MGR A;  3KFW X;  4M6Y A;  4EVI A;  1OYW A;  2QQB A;  4XSX F;  3FX3 A;  5DEQ A;  3ZMZ A;  1HW2 A;  2CWE A;  2STW A;  1BIB A;  2DFI A;  4I09 A;  3KP6 A;  2LF8 A;  2YSR A;  5CVJ A;  4Q47 A;  4LLG F;  4HDU A;  3HUG A;  4CZZ A;  4AIK A;  2ZBK A;  2FEZ A;  3BPV A;  2HKO A;  4P55 A;  1A04 A;  2GZW A;  5FFZ A;  2Z9O A;  3DKW A;  1S7O A;  5L3E A;  4P9F A;  5D4R A;  1TNT A;  1YO5 C;  3F8M A;  4L9T A;  1R5H A;  3SZT A;  3ERE D;  3R60 A;  3F22 A;  4IVN A;  2FOK A;  4A6E A;  3ZMD A;  1KQ9 A; 
#chains in the Genus database with same CATH topology
 1BOA A;  2JSC A;  2DQR A;  4F55 A;  3EUA A;  4U87 A;  3OYI A;  2ME6 A;  4PJL A;  2NAZ A;  3DWL E;  3ULQ B;  4RB1 A;  1J5Y A;  3WGI A;  1AA7 A;  3ZQF A;  3N97 A;  1N78 A;  1SMY F;  4YFK F;  4D0P A;  3DPU A;  2DN0 A;  3H1C A;  1A36 A;  5EG0 A;  3CD6 I;  2EA4 A;  1OYY A;  2H94 A;  3A03 A;  1LE8 B;  2WAF A;  5B1A H;  1DP7 P;  3PUB A;  3CC2 I;  3M8E A;  5ICF A;  1Z0X A;  4CCN A;  1GXQ A;  4E6K G;  2KIS A;  2VPR A;  4Z2Y A;  1FTZ A;  1BW6 A;  2VJ4 A;  2CO5 A;  3HTU A;  3HGY A;  1WH5 A;  3J7A O;  1YW8 A;  4BAY A;  2LBF A;  5JHF A;  1YIJ I;  4IZZ A;  2R7W A;  2PEX A;  4FE4 A;  3BR6 A;  2R5Y B;  1U9N A;  2V79 A;  2M0M A;  4A3D J;  2FXA A;  4BYY A;  1WJC A;  3AG2 H;  3LL7 A;  5D6F A;  3BRO A;  4QIW N;  3K70 D;  3F6V A;  2UWM A;  2IBD A;  3AAF A;  3R6S A;  4D7M A;  2KKO A;  3V8K A;  3PFY A;  1G6N A;  2HOA A;  1I3Q J;  3IH2 A;  3J81 K;  3F8N A;  4CIC A;  1ETX A;  3BG5 A;  5E1W A;  1BW5 A;  4IHV A;  2DOD A;  1SAN A;  1X1B A;  3SXY A;  2W82 A;  4PZJ A;  1T39 A;  1FBQ A;  1UHS A;  3V4G A;  1VQN I;  5HS8 A;  4OU0 A;  1ETY A;  4LG0 A;  5EF6 A;  2GXB A;  1BIA A;  2IGN A;  4UVC A;  3J7A Y;  2K5C A;  4QPO A;  1IF1 A;  2RV8 A;  5LLQ A;  4MNU A;  4J19 A;  1YOV B;  3BOQ A;  1IN6 A;  5CYV A;  1O3Q A;  3AG4 H;  3UKG A;  1DDN A;  2JA5 J;  4PK4 A;  1GV2 A;  2W1O A;  1ZLJ A;  3W2A A;  1PP8 F;  3MN2 A;  2XKP A;  4KMU X;  4I7H A;  3I0T A;  3H3Z A;  1FJL A;  4RDU A;  5IYC J;  1GT0 C;  3OIP A;  1ON2 A;  2L3D A;  1B6A A;  4AM3 A;  1HXD A;  4BQO A;  2HEO A;  3ZN0 A;  4XID A;  2L7M P;  1WPK A;  2F2E A;  3JR9 A;  1ETQ A;  2D45 A;  2WY8 Q;  3ZMT A;  1F5T A;  2Z99 A;  3BTJ A;  1B4A A;  2OCE A;  1UG2 A;  4XKC A;  3TW7 A;  2L9N A;  3OR1 C;  5FD5 A;  2IA2 A;  4CXF A;  2HNH A;  1VQ4 I;  3RI4 A;  2G0E A;  2IGM A;  2ZKZ A;  3FMQ A;  3HTS B;  2CJJ A;  4H0E A;  2ADU A;  1J2X A;  1LFB A;  1LQ1 A;  2FF4 A;  4A5M A;  1GXP A;  5FJ8 J;  5A2Q K;  1CGP A;  2VIX A;  3PUF A;  3G71 I;  2CFO A;  4PFO A;  2NVU B;  2XGD A;  4XOR A;  4BNC A;  5J8C A;  4FAS D;  2R7O A;  2PFB A;  1D3Y A;  3IC7 A;  3K10 A;  2R7F A;  1QBJ A;  2DPD A;  2Y9Z A;  4BBR J;  2ZNZ A;  2CQN A;  2ACJ A;  4XKB A;  3N4M A;  1D5Y A;  2OU2 A;  3AG1 H;  1OCZ H;  2V1D A;  5FGM A;  2L54 A;  2LY2 A;  4XLF A;  1HDD C;  1YHQ I;  2DT5 A;  1F1Z A;  2VOP A;  1S7A A;  3OMY A;  1YYV A;  3CO6 C;  1MBK A;  3V8J A;  1QQI A;  2OJE D;  2HU9 A;  1VND A;  1MH4 A;  2QUF A;  2LD5 A;  1B1B A;  3RKY A;  4PCQ A;  4A6D A;  2MA3 A;  4DYR A;  3TBI A;  5EG0 B;  2ZXI A;  5C4X J;  1VQ8 I;  2OV7 A;  2R5Z A;  2K3F A;  2FU4 A;  3TW6 A;  4PGH A;  2XAH A;  2E35 A;  1FOW A;  1OQY A;  4BHB A;  4NQW B;  1YW7 A;  2Q2E B;  3WG7 H;  4XRS G;  3F21 A;  4B4C A;  4EQQ A;  3KYL A;  3HGG A;  1T33 A;  5D5X B;  1U78 A;  1I39 A;  1SVL A;  2HWV A;  1FWZ A;  1VQP I;  1B8I A;  2HZD A;  2Y2Z A;  3VWB A;  1V55 H;  3FXK A;  4ZYG A;  3LSK A;  4I99 C;  4XLC A;  3ZXS A;  4UUT A;  5D5V B;  5IT3 A;  2NS0 A;  3G2B A;  2E2H J;  3SFZ A;  2BOL A;  4E7I A;  1JTX A;  4NB5 A;  4LLN A;  1R9T J;  4MFE A;  4UNO A;  3MD2 A;  3PNT A;  2MLK A;  5CLS A;  4WK8 F;  4JBA A;  2H8R A;  1W7P A;  3BC8 A;  1IUF A;  2E2J J;  2L2O A;  3VYR B;  3W6K B;  4II3 A;  1LVA A;  1WHU A;  2L01 A;  4HF2 A;  3OYC A;  3R4K A;  4ZDL A;  1BC7 C;  1UHM A;  3S32 A;  1FMW A;  2K85 A;  5IT9 Z;  1KQ0 A;  1I50 J;  2FJ1 A;  3J7Z I;  4HF0 A;  4YEJ A;  3GEZ A;  2DA1 A;  4XRM A;  2NOG A;  5IT9 K;  3QOD A;  1AKH A;  3ABK H;  1MD0 A;  4HZF A;  1K6O A;  4F7Z A;  3GWZ A;  2W25 A;  2FBI A;  1FOY A;  4ZYA A;  3PSF A;  4DIQ A;  2FSW A;  2D5V A;  3QRF F;  2EFP A;  2E5N A;  4F92 B;  4KDP A;  4IQJ A;  3SDG A;  1OMI A;  5DTD A;  3I64 A;  3GZ6 A;  4ENM A;  4MQ9 F;  4EJW A;  1C0W A;  1UEL B;  3EYY A;  3DLL F;  2R7U A;  4XKV A;  3PJR A;  3I71 A;  1ZAR A;  2IRF G;  3BJO A;  1IRF A;  4KT5 C;  3LNQ A;  3S3M A;  3WU0 A;  4XLH A;  3HL2 A;  4XN0 A;  2VN2 A;  2XGC A;  3FXL A;  3I5U A;  3JRD A;  5AIQ A;  1PVE A;  2L4M A;  4AC0 A;  4M3F A;  1JUM A;  2K9M A;  3L1P A;  1V54 H;  2WAQ A;  4CCO A;  4E7L A;  1FSH A;  3P9K A;  1MBF A;  2ELH A;  2HFH A;  4LK0 F;  2HS5 A;  1BR1 A;  3FXQ A;  4CYC B;  4ZYE A;  4BAC A;  1YS6 A;  3AL0 C;  1FIP A;  3K6G A;  1SEU A;  1KU9 A;  2RAE A;  1WJA A;  5FO5 A;  3OIO A;  2VBZ A;  2JVH A;  1X19 A;  2YU9 J;  1O7L A;  9ANT A;  2HOE A;  4NC7 A;  3WGH A;  1YQA A;  2YX4 A;  1IDY A;  4NQW A;  3F72 A;  1MW7 A;  3DPL C;  1GVJ A;  1ORK A;  1R5I D;  1LB2 A;  3U2R A;  3MKZ A;  1Z6R A;  2BHY A;  2V1U A;  4UVA A;  1LEB A;  3EET A;  3IL2 A;  2ECC A;  2R4G A;  3C2G A;  2MD5 A;  5FLV A;  3E6D A;  2BXZ A;  1VQ7 I;  4U7B A;  4ENJ A;  2O61 A;  2H6B A;  4CCM A;  3H9J A;  1MND A;  2DJI A;  2BV6 A;  2LG4 A;  1WQ2 A;  2DDA A;  4IRG A;  5E79 C;  1OCP A;  3I3L A;  2QVO A;  3CP2 A;  5E1Z B;  4BUP A;  2R5Z B;  3JCU C;  2DLL A;  4HLX A;  3K4J A;  3ZQH A;  2K40 A;  2DXI A;  2CFX A;  3ECO A;  3BZ6 A;  3ZQG A;  4KYW A;  5F0C A;  4BHP A;  1ZRE A;  4R79 A;  2KIF A;  4M9Z A;  1LFP A;  2V7F A;  3QPH A;  5DCF A;  1BN5 A;  4IL6 C;  3VFZ A;  4BDY A;  2EJR A;  2QCO A;  4UB8 C;  5CVU A;  1HKS A;  1SD4 A;  1CF7 A;  1K79 A;  2P5L C;  3ZMS A;  1RET A;  1QZZ A;  2XAJ A;  3FKJ A;  4NDL A;  2O8K A;  3GTJ J;  3SFI A;  3HYI A;  3RKQ A;  5DD4 A;  3A1Y A;  1IRG A;  3HIF A;  3IAS 2;  2XF5 A;  1Y39 A;  4W97 A;  2L7K A;  4D5C A;  1ZGJ A;  1BJA A;  2MLG A;  3LOC A;  2XDV A;  3L9F A;  3FXJ A;  4IHY A;  3K69 A;  3FK7 A;  2O7O A;  2DFF A;  3E6B A;  1K78 B;  1TWA J;  3HRT A;  1TL8 A;  3HOT A;  3KEY A;  1J9I A;  2BEO A;  2EA2 A;  1FNN A;  1BI3 A;  2KMU A;  4KT6 A;  1HKQ A;  5JR3 A;  1YI2 I;  4NHJ A;  1T8I A;  1ZGA A;  3B6C A;  4MTD A;  4KIC A;  3E5Q A;  4ZDP A;  2CUJ A;  1R23 A;  1X3W B;  5E1X A;  3QYB A;  4G7H F;  2FNP A;  1XSV A;  2RRE A;  4CYC A;  5IY5 H;  1ZAO A;  5JI6 A;  2EZK A;  3I53 A;  1X58 A;  2O3F A;  1O4X A;  5GPC A;  2CG4 A;  2ZO4 A;  1UCR A;  2YPR A;  2K86 A;  5FKK A;  3K0L A;  1IG7 A;  1DGR M;  3W2V A;  3D5L A;  5M5X J;  1T38 A;  5GTH C;  2KPM A;  2XKO A;  2F6C A;  2XV4 S;  2D1V A;  4QLC U;  3K9T A;  1Q1V A;  5M3M J;  2WV1 A;  3DP7 A;  4N9I A;  3VOE A;  1MSF C;  1TQI A;  1MZB A;  1OCO H;  2QGU A;  2O0Y A;  2ZNY A;  2W57 A;  3LA7 A;  3VPR A;  3ZQ7 A;  3SEZ A;  2K9S A;  1R4N B;  4IXA A;  3D5R C;  4F91 B;  1QU3 A;  1ZKG A;  2DBB A;  2IP2 A;  5CVR A;  1TW3 A;  1FOX A;  2VI6 A;  4DBR A;  4I2O A;  4AWX B;  3Q9S A;  4C3J J;  3ZCO A;  3FKI J;  4G8X A;  1REP C;  1IDZ A;  3KZI C;  4MO7 A;  2DU9 A;  4JOM A;  1XMK A;  2V26 A;  3K4B A;  4U88 A;  4NC8 A;  1ETK A;  2XUB A;  3HRU A;  2L5Q A;  3COA C;  1FOK A;  3HOU J;  2DA3 A;  1FBS A;  5IP9 J;  1U3E M;  3E6M A;  2DW4 A;  2OUM A;  5GAE J;  1WVR A;  2M5W A;  3J81 Z;  1FEX A;  3CZ6 A;  2EFO A;  2KZV A;  4OIR F;  1G3Y A;  2ID3 A;  1ODD A;  5FLX Z;  2Q1Z B;  2X1D A;  2MD0 A;  2Z1D A;  4G6Q A;  2L9V A;  3RKX A;  3CCE I;  3WG9 A;  1TLH B;  1OR7 C;  3H35 A;  3K7A J;  3E6C C;  2KJB A;  5ICG A;  1LDK B;  5EEG A;  5LHI A;  1NG6 A;  4LIT A;  2KJC A;  1ETO A;  1Q1H A;  2Y75 A;  3K70 C;  1MKM A;  4Q48 A;  1EH6 A;  3CF2 A;  5F0H A;  3WTX C;  5E18 F;  2KIQ A;  3PO3 J;  3EUH C;  2HVR A;  5ILU A;  2M7A A;  5K7Z A;  1YRN B;  2GA2 A;  3HEF A;  5HOD A;  1XD7 A;  4JX4 A;  2PN6 A;  2MC4 A;  2N8G A;  3HRM A;  3L2V A;  2HYJ A;  5F27 A;  2L9R A;  4EGY A;  4IX7 A;  2YU3 A;  5CVV A;  2F5V A;  1XMA A;  3O3K A;  4OMY A;  1KYW A;  1DQU A;  3P5J A;  2LLK A;  5ERI A;  3V7R A;  4M6V A;  1YX3 A;  4MLO A;  2K3P A;  3H5R A;  3S1R J;  3BTC A;  3WTW C;  3L2C A;  2M2E A;  4E7K A;  1TC3 C;  4HNU A;  3AG3 H;  4HLY A;  4BBS J;  1KGS A;  4I02 A;  4XM3 A;  1BBY A;  4RAY A;  1XGO A;  3DXJ F;  1EA3 A;  5KVR A;  1PP7 U;  2OPT A;  2WAE A;  5J1R A;  2K4B A;  2P4W A;  4WCG A;  1VQL I;  4EAT A;  2ZJP F;  2EWN A;  1SD5 A;  4XIC A;  1GLN A;  3RSN A;  3KP3 A;  4ABZ A;  5K5R A;  2CUE A;  5C4J J;  4KMF A;  4AVP A;  4DBQ A;  5ICC A;  1AWC A;  2CMP A;  1HQC A;  2X1E A;  3JSP A;  5IYB J;  4Y33 A;  3MKL A;  1L0O C;  3DTI A;  3HZJ A;  5L3F A;  2CH0 A;  3OR2 C;  1IXC A;  1YJN I;  3BG7 A;  3A0H C;  2OZ6 A;  3M8J A;  4N4N B;  4XKW A;  5E3O A;  3VYU B;  2WWY A;  5KAF C;  3E0J B;  4J00 A;  1N77 A;  4KIT B;  1VF9 A;  2V1X A;  1U5T B;  4OOI A;  2VC1 A;  4DW6 A;  2LP0 A;  3FBI B;  2WC2 A;  5HS9 A;  2HVQ A;  2EH3 A;  1TBX A;  3ELK A;  4V19 K;  4LG0 B;  2JJ7 A;  2KRH A;  5IOY A;  3KIO A;  4BQA A;  5TGT A;  3VYS B;  3O6B B;  4YRV A;  3WTU C;  1D8J A;  2JUC A;  4KIB A;  4ZJZ A;  5M3F J;  5BS6 A;  4IHS A;  2Z2S B;  3OSF A;  4RGX A;  2VT3 A;  2DQL A;  4UUV A;  1H8A C;  2XPW A;  2C6Y A;  2XSD C;  1FYM A;  1B8I B;  4JP0 A;  1TW2 A;  4KJZ A;  1ETV A;  4DJA A;  1Y8R B;  3W6J B;  2EIN H;  3C3W A;  5J4Y A;  3NEU A;  1WJE A;  3D5S C;  2WBM A;  1BC8 C;  1S72 I;  1W5C C;  2JA6 J;  2KT0 A;  1NTC A;  3BDD A;  2RVC A;  5TIS C;  1R5G A;  2EV0 A;  2XAQ A;  2A3S A;  3DF8 A;  2M8E A;  2WAQ N;  5HLH A;  4ZYD A;  2HYG D;  5J40 A;  4PSX A;  2NVQ J;  3EUK L;  3BWG A;  3LMM A;  4MIM A;  4S04 A;  1IW7 F;  1WSU A;  1FBU A;  1E3O C;  2E5Z A;  2Z5U A;  4PJN A;  1S29 A;  1V4R A;  3RPU D;  3CLO A;  3R61 A;  1WH7 A;  3PIO F;  3BG3 A;  1Z7U A;  2W48 A;  1ERD A;  3IV5 A;  3QPS A;  2HQN A;  4BKX A;  4EMS A;  1FC3 A;  3M1C A;  4BL0 B;  5FRN A;  1B72 A;  2VUM J;  2DCE A;  3KET A;  3Q3S A;  4LLL A;  5J3L A;  1DUX C;  5M5W J;  3CJN A;  3BQZ A;  3H9G A;  4B43 A;  3O2P E;  2VJ5 A;  2AO9 A;  2BYV E;  2L02 A;  4B1R A;  2A69 F;  3CCJ I;  1H89 C;  3A02 A;  3JTG A;  1U2W A;  2JPC A;  1QNT A;  3S2H J;  2ESH A;  2LH9 A;  3HG9 A;  3SZP A;  4XK4 A;  5LBQ A;  5E3M A;  3IHU A;  1Y6I A;  2QQ9 A;  4N9H A;  2IS2 A;  5CPR B;  2ZB9 A;  2CW8 A;  3R0J A;  5CJ9 A;  2R7Z J;  5LFA A;  3DKY A;  3PNY A;  4C9Y A;  4L0Z B;  1G3S A;  1JT0 A;  4CO8 A;  1D0Y A;  1S7E A;  1DPR A;  4TV7 A;  4KIF A;  4A3K J;  2XVC A;  3I4N J;  1KU3 A;  1UB9 A;  3QU3 A;  2JT1 A;  4CUG A;  4BHC A;  3GBG A;  2YS9 A;  1H88 C;  4V2F A;  2BW3 A;  2QSF X;  2CQ7 A;  2RNG A;  2TCT A;  3MKY B;  3TQN A;  2EIK H;  4I0A A;  1WI9 A;  5D8L B;  2L4A A;  2ZJR F;  4XL9 A;  2R7V A;  2E19 A;  1G8X A;  2GQQ A;  3A01 A;  2HXO A;  2DOE A;  1X2N A;  2V6C A;  2CW7 A;  2JA2 A;  5K7F A;  3BCB A;  3WE2 A;  1R6R A;  3ISP A;  1U5T A;  1G2H A;  1U0J A;  3KP7 A;  2M8G X;  5FKN A;  2WB1 A;  3HOV J;  5FKO A;  4EJO A;  5KNL A;  3LST A;  2EV5 A;  1JE8 A;  2JN6 A;  4L9V A;  3KLO A;  1XC5 A;  5CQE A;  4II2 A;  2HI3 A;  3LSH A;  1SAX A;  2W24 A;  2OTL I;  1V3F A;  2G7H A;  2M87 A;  4XSZ F;  1HSJ A;  1JTY A;  3QPT A;  3LWF A;  3HC7 A;  1QZE A;  3LSI A;  1RZ4 A;  1IRZ A;  3CC4 I;  1R1U A;  1QPI A;  2ISZ A;  4L5I A;  5KK1 A;  1FZP B;  2X0L A;  4BEH B;  2QBY A;  4YII A;  3RYR A;  5C44 J;  3MQ0 A;  4E7H A;  2ZFW A;  3QWL A;  3GCM A;  1HST A;  4D7N A;  1LDJ A;  4HNV A;  2Y31 A;  2IW5 A;  1JT6 A;  2O8X A;  1U8B A;  1JXS A;  4J01 A;  2A5Y B;  5C3E J;  4GDF A;  1VQM I;  1OPC A;  1POG A;  4WF2 A;  5DUK A;  5FB2 A;  2JRM A;  3ML6 A;  3CCM I;  1DU0 A;  3HSR A;  4XRF A;  2A6T A;  4HAM A;  1MJ9 A;  3CES A;  1UST A;  1HW5 A;  3KLN A;  4RBO A;  1ZG1 A;  4S0H B;  3GTQ J;  3K4N A;  4P5O A;  4BQN A;  2JA7 J;  5DYM A;  2FML A;  3CMA I;  5IP7 J;  2KQR A;  5L3G A;  1XN7 A;  4X1E A;  2BZT A;  4XLA A;  1K7A A;  4Q4Z F;  1J09 A;  4UV8 A;  4IOC F;  4O3M A;  5DUI A;  5FKM A;  3K2A A;  3ROU A;  3G73 A;  3OWT A;  4S05 A;  1AU7 A;  3BY6 A;  1E2X A;  3L2Q A;  1R1T A;  2D1H A;  4IOA F;  3NWT A;  2LYC A;  5F08 A;  3OYD A;  2A61 A;  1XTA A;  3MZH A;  4GFB A;  1KZH A;  1MMA A;  2VQG A;  4RLQ A;  3BR5 A;  1WFX A;  1QGP A;  3GX4 X;  1VQO I;  2CUZ A;  4MEX F;  3IWF A;  2STT A;  4KN4 X;  4N0B A;  2D2W A;  3OYB A;  3M3Y J;  1T6S A;  1IC8 A;  4M73 A;  4PDK A;  3E3V A;  2VON A;  5TRD A;  3DTE A;  3WTZ A;  4DYQ A;  2IEK A;  4MTE A;  1YRN A;  4MFD A;  2LKS A;  4RM3 A;  5HDN A;  3J7Y J;  4G7Z F;  3PO2 J;  1G3T A;  2ZSI B;  1FYL A;  2VE9 A;  1R1V A;  2X85 A;  3LA3 A;  4KFC A;  1VZ0 A;  1SD7 A;  1T56 A;  4FET A;  2IA0 A;  3G1M A;  3TED A;  2XAG A;  1IZ1 A;  3CME I;  3TO7 A;  4HEA 2;  2P5K A;  1YIO A;  4JX5 A;  2PJR B;  2OC6 A;  3ABT A;  4FX0 A;  2F5D A;  4NNJ A;  1XS9 A;  3BG6 A;  3ZGK A;  1P4X A;  1IN7 A;  3A0B C;  5J6X A;  3LSR A;  2E2I J;  3CUQ A;  1O3S A;  4G7O F;  3DLA A;  4OMZ A;  1SVO A;  2XGX A;  2B9S A;  2W85 A;  2NRA C;  4KA4 A;  3RZO J;  4NUB A;  1JUP A;  2COB A;  1CQT A;  2PJP A;  1T98 A;  4F52 A;  2QSG X;  3S16 J;  3DEW A;  4M6X A;  2CS3 A;  3VOD A;  4M3E A;  2IGO A;  4K2E A;  5F1J A;  2R7T A;  1OR7 A;  1Y0N A;  3TGN A;  2QYO A;  2GXG A;  4G6T B;  2XRL A;  5H20 A;  3SEQ A;  2IPQ X;  3TOB A;  2BHZ A;  2HGC A;  1ZR4 A;  3DFG A;  2XIG A;  2JA8 J;  3SYT A;  2E34 A;  1YLF A;  3D0S A;  4BJT A;  2WTE A;  1X4P A;  3MEX A;  2NVY J;  3DBR B;  3FXO A;  3T1B A;  4BS9 A;  5TJJ A;  3QPL A;  2LKX A;  4A3L J;  4DNC A;  1MBG A;  3G1O A;  1UZC A;  3K4K A;  3I56 I;  1ZRF A;  2CV2 A;  3OYN A;  2ESN A;  2GIV A;  3KP5 A;  2HYF A;  2CV0 A;  2V9K A;  3QOE A;  4LIU A;  1R58 A;  1RES A;  4LIV A;  1YW9 A;  1WJD A;  4Y15 A;  1IV6 A;  1OYI A;  1IRX A;  2DK5 A;  4E7S A;  1P7I A;  2XGE A;  4LFU A;  5IYD J;  1F36 A;  2Y69 H;  1ONV A;  3U21 A;  1TT0 A;  5LGN A;  3P7N A;  2QSH X;  4IEJ A;  4KN7 X;  1BI2 A;  3OYG A;  3MZY A;  3JRC A;  3DEE A;  3FHZ A;  1MMN A;  2R7D A;  5L3C A;  4ESB A;  1STZ A;  2FA5 A;  1SFU A;  3RDI A;  5KHD A;  1FSE A;  3PNV A;  3ZP5 A;  3ABM H;  2F4M B;  4BY1 J;  5F1R A;  5M5Y J;  1O7F A;  1XSD A;  2RQQ A;  2MW8 A;  4I76 A;  3GFJ A;  4OWR B;  4HOB A;  2FBH A;  3OS0 A;  2PX9 A;  4LD5 A;  1W36 D;  5F04 A;  2L0K A;  1TQM A;  4BE1 A;  1OKR A;  3KCC A;  2EFW A;  5ED4 A;  2FOW A;  4B47 A;  4CDG A;  2JTV A;  3JSO A;  3TDU C;  1B9M A;  3MAJ A;  1IV8 A;  3V7C A;  2V9V A;  1FP1 D;  5IP6 A;  1U8R A;  3WE3 A;  1K4T A;  2L7F P;  4FHT A;  1SAU A;  3OYM A;  1E3P A;  1GUU A;  3IH4 A;  1QHG A;  3ZQI A;  3CCQ I;  2VE8 A;  2RNJ A;  5B1B H;  3CJQ B;  5LRS A;  3C1D A;  1S6L A;  3S1Q J;  3LSM A;  2MAB A;  3CMM A;  4M74 A;  4A3F J;  2F4O B;  1MJA A;  4RB0 A;  4UV9 A;  3VDX A;  2OTJ I;  2ELK A;  5HLI A;  2UUZ A;  3EPZ A;  4N4O B;  2HOT A;  3I58 A;  2JPB A;  2HOS A;  4M72 A;  3VSL A;  2KP6 A;  1J0R A;  3J80 Z;  2LKP A;  2NS7 A;  1V5G A;  4A3I J;  5CQG A;  2HKX A;  4EJU A;  5EGO B;  1ZRC A;  2PMZ A;  4FCY A;  2XB0 X;  3CUO A;  2IA1 A;  1IO2 A;  2M0C A;  1FP2 A;  4M3G A;  3RTR A;  3G3Z A;  5GAH J;  3CP8 A;  3W6V A;  4UB6 C;  4FQG A;  5AON A;  1DGW Y;  2W00 A;  4M3B A;  1UJ8 A;  4KIG A;  1OIS A;  3BR1 A;  1A6I A;  2R93 J;  4PJJ A;  2GXA A;  1P9Q C;  4KUM A;  2KHM A;  3BLY A;  4HST A;  4XLE A;  1AHD P;  3AL0 B;  4LMY A;  4OIN F;  2HPM A;  4WXD A;  3CC7 I;  4AID A;  3S17 J;  4Q5S F;  4RLF A;  2ZME A;  4EV0 A;  2AXT C;  5JVG F;  2W84 A;  5HNH A;  1MMD A;  2E60 A;  2XSJ C;  1YTY A;  2UXN A;  2M4K A;  3DU5 A;  5FFX A;  3EYI A;  4BXX J;  1X1A A;  3HBL A;  2VBY A;  1CF7 B;  3CCY A;  5GAD J;  2VBW A;  2M4G A;  3FK6 A;  4ETS A;  5IOZ A;  1LDD A;  1QVU A;  2LRE A;  3OOP A;  5DS9 A;  4C2T A;  4UVB A;  3WTS C;  5J1U A;  5EDN A;  4WXC A;  3DPT A;  5HS7 A;  4I0B A;  2R7Q A;  3FF5 A;  3V8L A;  3E7L A;  4L18 B;  4IHW A;  1T08 B;  4B09 A;  2QA4 I;  2OAZ A;  3U1D A;  2PI0 A;  3I9V 2;  2Y48 A;  1O3T A;  4PFP A;  1MDM A;  2VQH A;  2W7N A;  2E1M C;  2BY0 A;  2QZ8 A;  1X3U A;  3WU1 B;  4BJ6 C;  3FBN B;  4L9N A;  4AUX A;  4RAG A;  3L7W A;  1FPQ A;  3CCS I;  2OZU A;  3QAH A;  2PMU A;  4CSW A;  3HPH A;  2RQP A;  2LBF B;  2IGK A;  2QKM B;  2Z33 A;  4P96 A;  1HW1 A;  4OIO F;  2GLO A;  2RKH A;  1ZG3 A;  3LQR A;  3SQN A;  3Q5F A;  3B73 A;  2M1B A;  2RC4 A;  4XOT A;  3QYF A;  3CJR B;  3IRR A;  2VKE A;  3GUD A;  4A3M J;  2P81 A;  4RS8 A;  3VB2 A;  2LSO A;  2IS6 A;  2DJN A;  4EJV A;  4HW0 A;  4XQF A;  3KEO A;  1DU6 A;  3Q0W A;  1FLI A;  4ZZD A;  1WZ2 A;  4I98 B;  3K4L A;  1ETW A;  1MJB A;  3CDL A;  3HHH A;  3MZ8 A;  3TMO A;  4UUS B;  2GBY A;  3ZOB A;  4HQM A;  3GLX A;  1FIA A;  1ZHF A;  2ZCW A;  1W0T A;  1J75 A;  2MC3 A;  4F93 B;  1ON1 A;  5D5U B;  1Y0U A;  3BR3 A;  1Y1V J;  3T8R A;  1X1D A;  2H1L A;  4EM0 B;  3W2W A;  5LHG A;  4LK1 F;  4DOZ A;  1R00 A;  2ZSH B;  3N05 A;  1UFM A;  3RKW A;  4RAZ A;  3HHG A;  3BQY A;  2HVS A;  4W1U A;  4P9U A;  4XRS A;  2VL8 A;  2PQ8 A;  4GYG A;  2XF6 A;  1U6G A;  2VQC A;  4LOC A;  3GVA A;  2VPL A;  1WRJ A;  1Y8Q B;  3DQV C;  1QRY A;  2CQQ A;  2J5O A;  1I27 A;  1VQ6 I;  4BQQ A;  3GTM J;  4M9S A;  3S2D J;  4C2U A;  1QZY A;  1UG0 A;  1QA6 A;  2P8T A;  4HX4 A;  1XX5 A;  4YIR X;  1MSE C;  2E1N A;  1FY7 A;  1RIO H;  4HG2 A;  1EKE A;  5HLT A;  4NBQ A;  4O5V A;  1RR7 A;  1T95 A;  5K1Y A;  3MKW B;  3M4O J;  1I3A A;  3ZQL A;  1GV5 A;  1QPM A;  2MG4 A;  3RQ4 A;  2F48 A;  1ZTR A;  3OSG A;  2CW0 F;  1RPW A;  1HC8 A;  4YEL A;  4ESJ A;  4HX8 A;  4AYB A;  1HOM A;  2BY2 A;  1HA8 A;  3FXU A;  5K7H A;  1TQP A;  1B9N A;  3GFI A;  2LFB A;  2DO7 A;  2TDX A;  4WWC A;  3S1M J;  2BW3 B;  2HDW A;  4ESF A;  1SC7 A;  4DQ2 A;  2ZME B;  4IKF A;  2HR3 A;  1QVT A;  3WTV C;  3F8C A;  3C2H A;  1W5S A;  1OJL A;  2EIJ H;  2OBP A;  2ZJ2 A;  2A07 F;  5HDK A;  2Q0O A;  1VTN C;  2O6G E;  2BY3 A;  3QP5 A;  3NQO A;  3BJA A;  1MGT A;  1KYZ A;  2X48 A;  4BU2 A;  4ZTJ A;  3REO A;  1GDT A;  1RUO A;  3TP0 A;  2XB5 A;  4CCK A;  3ASO H;  3P9I A;  1S3J A;  3I55 I;  2FQ3 A;  2NXN B;  4E7J A;  1EH7 A;  1XGN A;  3K1P A;  2VKH A;  3WHB A;  5JLW A;  3ZPL A;  1FT9 A;  2F4I A;  3BCA A;  5DV5 A;  1EV7 A;  2DMU A;  5BQT A;  3OOU A;  4YG2 F;  5H6Q A;  2PLY A;  5B3S H;  4A0Z A;  1G59 A;  2ISY A;  2ZXJ A;  3GTG J;  5JVT A;  2UZK A;  2LC2 A;  4RB2 C;  2E7W A;  1MNM C;  3IKV A;  1EJ9 A;  2HTS A;  4DGW B;  3BR0 A;  1N75 A;  1NK2 P;  2AHQ A;  3M1E A;  2IS1 A;  2R7S A;  5F6F A;  4EM1 A;  3JRF A;  3JRG A;  3G1L A;  3GME A;  2ZXH A;  3DCF A;  2EFN A;  1D1C A;  3GTO J;  3FXM A;  3DBL B;  4XBF A;  1I6X A;  2DA4 A;  4G94 A;  1JHF A;  5EZG A;  4ZYH A;  4ITV A;  2KL4 A;  2FD5 A;  2K4J A;  4EGZ A;  3Q9V A;  3OIQ A;  1TWC J;  2H6C A;  3WTT C;  1PDN C;  1ZN2 A;  5BNG A;  4XN3 A;  2NYX A;  3U1K A;  1R49 A;  5EYR A;  3S3O A;  1PUF B;  2OQG A;  3T0Y A;  5ICE A;  1FTT A;  1XSX A;  1D5V A;  3NAR A;  1JKO C;  3C7J A;  1HKT A;  1IXR C;  1XG1 A;  4LB5 A;  1ZQ3 P;  2BGC A;  2FE3 A;  4BJ5 C;  1IGN A;  1L3L A;  1D8K A;  5FRO A;  1WJF A;  2EBI A;  2PBI A;  1KA8 A;  1OLT A;  3HOX J;  3QOP A;  2Z3Y A;  3ABU A;  3CQZ J;  5LGU A;  3BPX A;  3HKZ N;  2K7L A;  3FMS A;  1Z21 A;  3BZC A;  3PFI A;  4U7D A;  2QWW A;  4U0V A;  3RQI A;  3QP6 A;  2P0W A;  1P7J A;  2X51 A;  2A6E F;  2WB1 N;  4B44 A;  1F4K A;  4A2U A;  4Y13 A;  2VQL A;  1TP4 A;  2H1K A;  2LMD A;  4FT8 A;  3GFM A;  1R71 A;  3M07 A;  4UY8 I;  1S9H A;  3A2K A;  3E5X A;  4PSW A;  2DOA A;  2EQR A;  5CVI A;  1K4S A;  4P1W A;  1U9O A;  1Z3X A;  2VB6 A;  4HNT A;  3OL3 A;  2LOO A;  2B7E A;  2PMH A;  4RB3 C;  5FLM J;  2CRG A;  1T2K A;  1XGS A;  3LSG A;  4Y3O A;  1JJ6 C;  2P6T A;  3KP2 A;  1ZR2 A;  4AIH A;  2R0Q C;  5DM7 F;  2ELJ A;  2VAS A;  5HLG A;  2YR2 A;  2M3A A;  4D1Q A;  4BY7 J;  1SFO J;  3TO9 A;  5D4S A;  3UR3 C;  1IAW A;  3BG9 A;  2OQR A;  4OIQ F;  3QU6 A;  2KDO A;  4RM2 A;  3S15 J;  2VJI A;  3CF5 F;  2VC0 A;  1W1W E;  5B5E C;  4A5N A;  1SVM A;  3CCR I;  2CV1 A;  3W3C A;  1D1B A;  2DT6 A;  3H9Q A;  4B3A A;  2I8D A;  4B48 A;  2GM4 A;  4CCL A;  1BR4 A;  5K5O A;  1SFE A;  5EEH A;  3F8B A;  4YFX F;  3K4M A;  1X1P A;  2P7V B;  3SJM A;  2W4S A;  4A0Y A;  2DMP A;  3ZRG A;  1BA5 A;  1FX7 A;  5ILV A;  1LJ9 A;  4ANJ A;  1P2F A;  1O3R A;  4HRI A;  2M34 A;  4A3B J;  1A35 A;  2LY9 A;  3VSK A;  1HLV A;  3S1N J;  5BOX A;  2ZME C;  4B8X A;  2NNN A;  3LAJ A;  2IT0 A;  2YX7 A;  3CUQ C;  3OYF A;  2JRT A;  4HX7 A;  3CTA A;  4RGS A;  3V7S A;  4YIF A;  3GLL A;  4AVZ A;  2UV1 A;  3UNG C;  1G4D A;  2MH9 A;  2FNA A;  1JGS A;  3DBH B;  3BP8 A;  2KIM A;  1XCB A;  2QEX I;  3G4S I;  2RN7 A;  5BPD A;  4GRI A;  2GOM A;  3MVP A;  2K9Q A;  1Z6T A;  5HOO A;  1N25 A;  4HV6 A;  4U0W A;  5DCM B;  1JI8 A;  2DAO A;  1AOY A;  1H9G A;  1OCR H;  5JLX A;  4FIS A;  3IAM 2;  3OYK A;  3QYE A;  2BXY A;  3DKX A;  1P92 A;  2VOD A;  3VYT B;  1UHW A;  3RPQ A;  1PUF A;  2RDP A;  5J47 A;  2DTZ A;  3JRE A;  4HQE A;  5EEA A;  2KIU A;  3S14 J;  3FZV A;  2MBF A;  1MDM B;  3H5A A;  3H0G J;  4QWQ A;  3TKY A;  3ZMU A;  1RI7 A;  4A93 J;  3EDP A;  2VJJ A;  2X6O A;  2Q8K A;  4KIS A;  3ABL H;  4GGG A;  3LAP A;  1I6H J;  4B3X A;  3RYP A;  2DTR A;  1I1G A;  5J4V A;  2GOX B;  4BE2 A;  1GHC A;  4IRI A;  2XPU A;  1T0F A;  4LG3 A;  3GW2 A;  1JKP C;  3HSE A;  1LPQ A;  4GO1 A;  3U9G A;  3Q0V A;  4Z6Y A;  1NG7 A;  4UUS A;  1B59 A;  4C3I J;  3K4C A;  4JK1 X;  3RCO A;  2X1C A;  2QQ8 A;  3RJP A;  4A3J J;  5ILS A;  3F8F A;  4EJT A;  2DK8 A;  3WU2 C;  1APL C;  2HQ5 A;  4JX6 A;  2CYY A;  6PAX A;  3I4M J;  1MMS A;  3HUG B;  2LNB A;  2KFD A;  3OL4 A;  4V2G A;  1KON A;  3MFK A;  2F5C A;  3IKT A;  2TRT A;  2MFZ A;  1MIJ A;  5GAG J;  2P6S A;  3OS1 A;  2O5R A;  2BBY A;  2XAS A;  3P9C A;  2V6E A;  1VQ5 I;  2HQA A;  3KYD B;  4OAZ A;  3KE2 A;  2KDZ A;  3RIR A;  4HPQ A;  2UXX A;  4XLP F;  1DPU A;  4XR6 A;  2BY1 A;  3EUH A;  3QQA A;  1HDP A;  1X3Z B;  2F5E A;  4IHT A;  3GZ5 A;  4YFN F;  3CO7 C;  3IP4 B;  2HXI A;  3NRV A;  3KZY A;  2E71 A;  5J8F A;  2DFH A;  1LKX A;  4DZJ A;  5LEJ A;  1K61 A;  3JTH A;  1UAA A;  2YUS A;  2X6X A;  1P4W A;  1IN5 A;  3AFH A;  3B6A A;  1PYV A;  3TOA A;  2XAU A;  1H9T A;  3V42 A;  4L5E A;  2LK2 A;  5E8I A;  1RR8 C;  2FBK A;  1IUY A;  3MMY B;  2I10 A;  4QTR A;  1K6Y A;  1DP3 A;  3FM5 A;  1XMX A;  1Z3Y A;  3RPU A;  3O8G A;  1H0M A;  2NVX J;  2VT2 A;  1Y1W J;  3OV8 A;  2DOF A;  2XAF A;  2LTP A;  4HSR A;  3ZR8 X;  2DA6 A;  3M8F A;  4I6Z A;  1XB4 A;  1NHA A;  2H27 A;  1K83 J;  1IN8 A;  1WI3 A;  4M3D A;  3A01 B;  1K78 A;  2ICW G;  3FWE A;  5LRR A;  3WHC A;  2BVM A;  5IPA A;  3FXR A;  4X6A J;  4LGW A;  1SFK A;  4C30 A;  2IJL A;  3H3V K;  1W7P D;  3K1M A;  3RZD J;  4RGU A;  1BR2 A;  2DPU A;  5LHH A;  4DZP A;  4G9Y A;  3TO6 A;  4CZC A;  4IF4 A;  2E1C A;  3T5X A;  5L3B A;  3LA2 A;  3R0A A;  2HDC A;  2WAD A;  1XGM A;  1MBJ A;  2F5F A;  2DMN A;  2CQK A;  3H3U A;  4AYB N;  1QO0 D;  1XDU A;  2E1O A;  1LE8 A;  2P5V A;  4RMN A;  1HBX G;  3HDD A;  3MCZ A;  3ASN H;  3FIS A;  2J5P A;  5JFR A;  3CCV I;  2DYS H;  4XON A;  1LFU P;  4WXH A;  1RUN A;  3HRS A;  3GXO A;  4ENN A;  1JUS A;  4JQF A;  1SMT A;  1I5Z A;  5E20 A;  2Y9Y A;  4IRH A;  3TL4 X;  2I5U A;  5FRM A;  3DV8 A;  4QPQ A;  2JSP A;  2V4J C;  3IUO A;  3KP4 A;  2H09 A;  2R92 J;  2K02 A;  3CJT B;  2KRC A;  4O6J A;  1TNS A;  2R3S A;  1BL0 A;  1OCC H;  3J80 K;  4E70 A;  4A0X A;  4L0Y B;  1OFC X;  3LSJ A;  1WJ5 A;  4ASN A;  5LEK A;  2JVG A;  3SDB A;  1T0F C;  2LY1 A;  3DEU A;  4EM2 A;  1SD6 A;  1W36 C;  3H36 A;  2EPF A;  1B72 B;  1W5T A;  3F9K A;  2Y0M A;  5F0F A;  3PIP F;  3F23 A;  2IXS A;  2M7B A;  2MSY A;  3ERM A;  3FMR A;  3OYH A;  1D0Z A;  5LD2 C;  1S8N A;  1W4M A;  2HPI A;  2M45 A;  2NVT J;  1V5F A;  3E97 A;  2O03 A;  3MWM A;  5GTI C;  4CA0 A;  4GYI A;  1ENH A;  1VFC A;  3T8T A;  1G3W A;  2HDD A;  2QQA A;  3PSI A;  3CLQ A;  4A12 A;  1NK3 P;  1BM9 A;  3HXL A;  1Y56 A;  2QLZ A;  3FHN A;  3K1N A;  5HNF A;  5F64 A;  3FDY A;  4CH7 A;  1X1C A;  1YJW I;  2AQE A;  3HOW J;  5DD8 A;  3L2R A;  3LFU A;  3OYJ A;  1RRJ A;  3SHF A;  3E5U A;  2LDU A;  3DTK A;  2BE5 F;  2E1M B;  1MH3 A;  4G6D A;  4L9J A;  3ESW B;  1LEA A;  1RNL A;  2ID6 A;  4ON0 A;  1HCR A;  2DA5 A;  3JAM Z;  1PJR A;  2HZT A;  4A69 C;  3WTY C;  1OCT C;  2XF7 A;  4HYE A;  5JHU A;  1ZYR F;  2L9S A;  2Y0S A;  3KX2 A;  5AIP A;  1TZL A;  1A6Q A;  3JW4 A;  4Y4R A;  1EF4 A;  2CGP A;  3GF2 A;  1ZLK A;  2Y0S N;  2G9W A;  1S5L C;  3I4P A;  3NAU A;  2H8W A;  5FLX K;  3BTI A;  2LRD A;  3BJ6 A;  5BMZ A;  2WY7 Q;  4C2M J;  3KPH A;  1E17 A;  2GAU A;  3KEQ A;  4XLN F;  1XDS A;  4G12 A;  1YX5 A;  4BXU A;  2CU7 A;  3ECH A;  2V9P A;  2EZH A;  3PQJ A;  4HF1 A;  2ZXW H;  4LJZ F;  4E7Z A;  3OYA A;  2M30 A;  3X2Q H;  4FE7 A;  2A6H F;  1ULY A;  2ZJQ F;  3CMY A;  2KRF A;  4EEF G;  3S3N A;  2EFQ A;  3PL8 A;  2VOO A;  2WA0 A;  3CUQ B;  5LGT A;  1AKH B;  2KLO A;  5L3D A;  2NS8 A;  4D9J A;  3E1S A;  4FX4 A;  3GTP J;  3OS2 A;  2DI3 A;  1D1A A;  2JK3 A;  4R1H A;  1ACI A;  4PJM A;  4Y17 A;  3WGG A;  2ZFU A;  4M71 A;  4AIJ A;  2Y30 A;  5E3L A;  4ZC3 A;  1USS A;  1ZK8 A;  5GPA A;  1JKQ C;  1IXS B;  1U5T C;  4IJA A;  2HQR A;  2MYS A;  1VQK I;  2Q2E A;  4C3H J;  5BPI A;  5FD6 A;  3C2B A;  3HPG A;  2B63 J;  5E17 F;  3JAM K;  2A5W A;  1HF0 A;  1ZEL A;  3I54 A;  4CCJ A;  1R7J A;  4ZH4 F;  1V5E A;  1YIT I;  5E8G A;  3KZZ A;  2GIZ A;  3EQL F;  2DT7 B;  3NWS A;  3HOY J;  2L7Z A;  1E3H A;  2G7U A;  1KU7 A;  1FMV A;  1J59 A;  1GVD A;  2VXD A;  1R22 A;  2LF7 A;  2R7X A;  1WGX A;  4PUS A;  4AU7 A;  1ZGW A;  4BEH A;  3BT9 A;  1Z77 A;  3VEP A;  2JMW A;  1YS7 A;  4UHT A;  5H6R A;  5FKL A;  3BZK A;  3ZN1 A;  3HM5 A;  4MQV A;  3LSP A;  4OIP F;  1KU2 A;  4LB6 B;  5H2F C;  2X6Y A;  2X4H A;  3IRQ A;  3F6O A;  4ZZL A;  4Y52 J;  4Y7N J;  2FX0 A;  4BGD A;  2R7R A;  1ZRD A;  4H4K C;  4A3E J;  3FIW A;  2A05 A;  3JRI A;  3L09 A;  2A68 F;  3L2W A;  3ZQC A;  1TT5 B;  3A4C A;  1UMQ A;  4IQ4 A;  5A2Q Z;  4ENK A;  4IHX A;  1BJZ A;  5KAI C;  1YJ9 I;  3H5N A;  1WJB A;  2IAI A;  4GCV A;  1ITY A;  1MNE A;  4M9X A;  1TWG J;  4HA8 A;  3JRB A;  3FM3 A;  3DU6 A;  1X4O A;  4ZTF A;  1JJ8 C;  2ZC2 A;  3GTL J;  2JZY A;  3I59 B;  3CDI A;  4PJ0 C;  1FYK A;  2EV6 A;  1Z67 A;  4QSH A;  1SFX A;  1TWF J;  2DA2 A;  2LR8 A;  3I59 A;  3JRA A;  2IS4 A;  4BXF A;  2O9L A;  3ONQ A;  4D5F A;  3TP3 A;  3IWZ A;  2PG4 A;  4AD9 A;  2RGV A;  3HSF A;  5EJC A;  3TDZ C;  2NOJ B;  3IH3 A;  2V1N A;  3C18 A;  2JUG A;  2KZG A;  1Z9C A;  1VI0 A;  1J7K A;  2AXL A;  5D8K B;  2EIL H;  4BE0 A;  1MBH A;  2VKV A;  4IO9 F;  3LFK A;  1D0X A;  3M9A A;  1WKM A;  5D6E A;  5CKT A;  3M7G A;  3S2W A;  1P4A A;  2XRN A;  2COM A;  2OCC H;  1XCV A;  2QEN A;  1Z1D A;  4CGZ A;  3L2U A;  3PQK A;  5D5W B;  1KQ8 A;  4UXN A;  4RGR A;  4XNF A;  2P7C B;  2IVM A;  1W0U A;  2EB7 A;  2GA1 A;  2WV0 A;  5EGO A;  1YG2 A;  2B0L A;  1RKT A;  1A31 A;  1E0E A;  1WWX A;  1RC9 A;  1IN4 A;  2XC7 A;  3HOS A;  1BI0 A;  2VBX A;  3F3X A;  2QKL B;  3CCU I;  2XPV A;  1Z91 A;  2R5Y A;  2EZL A;  3F0C A;  3B02 A;  1JHH A;  2OD5 A;  4CYD A;  4IPA A;  1EH8 A;  4GXO A;  2AQF A;  2K27 A;  2OA4 A;  1IJW C;  1W7P B;  4BH9 A;  3GYH X;  4HBL A;  4MEY F;  2DFE A;  2CUF A;  1ZH5 A;  4U0Y A;  1Z05 A;  2EK5 A;  3K2Z A;  1PUE E;  1MMG A;  2ME0 A;  5KCM A;  3AKZ A;  2AS5 F;  3WOD F;  1F9N A;  2LVS A;  4KNY A;  2K9L A;  5DDG A;  2GWR A;  2E7X A;  3PM1 A;  5B66 C;  1BI1 A;  2Z16 A;  4L5J A;  3H92 A;  3GO5 A;  5HDG A;  3S8P A;  1TTY A;  3CDH A;  4PGG A;  2PMZ N;  2CSO A;  1TWH J;  1NH3 A;  5DM6 F;  3HJE A;  2OF7 A;  1YE9 A;  5HVQ C;  1P6R A;  4E4H A;  2FMY A;  3L00 A;  2MH2 A;  1M1E B;  3LQQ A;  4R8H A;  1LUJ B;  1XPX A;  3ZMV A;  5GP9 A;  1R36 A;  4JYK A;  1I1S A;  1JKR C;  1O57 A;  2EIM H;  1Z7L A;  3HOZ J;  3KYC B;  5K5Q A;  2NNY A;  1MBE A;  1YFH A;  2ETH A;  3GFL A;  2QBY B;  4XMY A;  2FRH A;  3D1N I;  4X0G A;  3G6E I;  1RKW A;  2E36 A;  4HDV A;  1JGG A;  3Q0U A;  2VXZ A;  2DDB A;  5DCM A;  2QM3 A;  1LNW A;  1ZG5 A;  2HTJ A;  4NC6 A;  5EZH A;  3HKZ A;  3BTL A;  3OYE A;  1F43 A;  4RAF A;  1BOB A;  1X2M A;  4CHU A;  2XHK A;  4WX9 A;  2XRO A;  4ZDO A;  4I01 A;  4HV5 A;  4MHG A;  4MGR A;  3KFW X;  3ZQQ A;  5J1Y A;  3O8H A;  4M6Y A;  2CQX A;  4DYC A;  4EVI A;  4F3Q A;  5E3N A;  1OYW A;  2QQB A;  3JRH A;  4XSX F;  2ECB A;  3FX3 A;  5DEQ A;  3SZG A;  3GZN B;  3ZMZ A;  1HW2 A;  2JWT A;  3H0D A;  2CWE A;  2STW A;  4BDZ A;  1BIB A;  4A3C J;  2DFI A;  4I09 A;  3KP6 A;  1WCM J;  2LF8 A;  1LVK A;  2FQ4 A;  2QF7 A;  2YSR A;  4XOP A;  2VLA A;  1R4M B;  5CVJ A;  2DA7 A;  4Q47 A;  1A5J A;  4LLG F;  4HDU A;  2M9H A;  2MGQ A;  2EZI A;  2PJR A;  3HUG A;  3OY9 A;  3HB9 A;  4CZZ A;  4AIK A;  2ZBK A;  2JQ7 A;  2X9D A;  2K9N A;  2FEZ A;  3BPV A;  2HKO A;  4P55 A;  1A04 A;  2BVL A;  2GZW A;  4A3G J;  2FUG 2;  5FFZ A;  2Z9O A;  3BR2 A;  3DKW A;  1S7O A;  5L3E A;  1QHH D;  4P9F A;  2DYR H;  2DMQ A;  5D4R A;  2VKD A;  1TNT A;  1YO5 C;  2X6W A;  3F8M A;  4RA2 A;  4L9T A;  1VQ9 I;  3OYL A;  1R5H A;  3SZT A;  3ERE D;  3CCL I;  4FTH A;  3R60 A;  3F22 A;  4IVN A;  4OAY A;  3S93 A;  3GTK J;  2FOK A;  2DMT A;  4A6E A;  3ZMD A;  1KQ9 A; 
#chains in the Genus database with same CATH homology
 1BOA A;  2JSC A;  2DQR A;  2NAZ A;  3ULQ B;  4RB1 A;  1J5Y A;  3WGI A;  3N97 A;  1SMY F;  4YFK F;  4D0P A;  2EA4 A;  1OYY A;  2H94 A;  1DP7 P;  3M8E A;  5ICF A;  1GXQ A;  4Z2Y A;  2CO5 A;  3HTU A;  3J7A O;  1YW8 A;  4BAY A;  2PEX A;  2V79 A;  2FXA A;  4BYY A;  5D6F A;  3BRO A;  3F6V A;  2UWM A;  3AAF A;  3R6S A;  2KKO A;  3V8K A;  1G6N A;  3J81 K;  3F8N A;  4CIC A;  5E1W A;  3SXY A;  4PZJ A;  1T39 A;  1FBQ A;  3V4G A;  5HS8 A;  4OU0 A;  4LG0 A;  2GXB A;  1BIA A;  4UVC A;  1IF1 A;  2RV8 A;  5LLQ A;  4MNU A;  3BOQ A;  1IN6 A;  5CYV A;  1O3Q A;  1DDN A;  1ZLJ A;  1PP8 F;  2XKP A;  4KMU X;  4I7H A;  3I0T A;  3H3Z A;  1ON2 A;  2L3D A;  1B6A A;  1HXD A;  2HEO A;  3ZN0 A;  2F2E A;  2D45 A;  3ZMT A;  1F5T A;  2Z99 A;  1B4A A;  5FD5 A;  2IA2 A;  4CXF A;  3RI4 A;  2ZKZ A;  3FMQ A;  3HTS B;  4H0E A;  2ADU A;  1J2X A;  1LQ1 A;  2FF4 A;  4A5M A;  1GXP A;  5A2Q K;  1CGP A;  4BNC A;  5J8C A;  2PFB A;  1D3Y A;  3IC7 A;  2DPD A;  2R7F A;  1QBJ A;  2ZNZ A;  2ACJ A;  3N4M A;  2OU2 A;  2V1D A;  5FGM A;  2L54 A;  2DT5 A;  1F1Z A;  2VOP A;  1S7A A;  1YYV A;  3CO6 C;  3V8J A;  1QQI A;  2QUF A;  1B1B A;  3RKY A;  4PCQ A;  4A6D A;  2MA3 A;  2FU4 A;  4PGH A;  2XAH A;  4BHB A;  1YW7 A;  3F21 A;  4EQQ A;  5D5X B;  1U78 A;  2HWV A;  1FWZ A;  4ZYG A;  5D5V B;  5IT3 A;  2NS0 A;  3SFZ A;  4LLN A;  4NB5 A;  4UNO A;  5CLS A;  2MLK A;  4WK8 F;  4JBA A;  1W7P A;  3W6K B;  1LVA A;  2L01 A;  4HF2 A;  3R4K A;  1BC7 C;  1UHM A;  5IT9 Z;  1KQ0 A;  4HF0 A;  3GEZ A;  5IT9 K;  1MD0 A;  4HZF A;  1K6O A;  4F7Z A;  3GWZ A;  2W25 A;  2FBI A;  2FSW A;  3QRF F;  2EFP A;  4KDP A;  1OMI A;  3I64 A;  3GZ6 A;  4ENM A;  4MQ9 F;  4EJW A;  1C0W A;  3EYY A;  3I71 A;  1ZAR A;  2IRF G;  3BJO A;  1IRF A;  4KT5 C;  3WU0 A;  2VN2 A;  3I5U A;  5AIQ A;  2L4M A;  1FSH A;  3P9K A;  2ELH A;  2HFH A;  4LK0 F;  2HS5 A;  3FXQ A;  4ZYE A;  1YS6 A;  1KU9 A;  5FO5 A;  2VBZ A;  1O7L A;  2HOE A;  3WGH A;  1YQA A;  2YX4 A;  4NQW A;  3F72 A;  3DPL C;  1GVJ A;  1LB2 A;  3U2R A;  1Z6R A;  2V1U A;  4UVA A;  1LEB A;  3EET A;  3IL2 A;  2MD5 A;  3E6D A;  4U7B A;  4ENJ A;  2O61 A;  2H6B A;  2BV6 A;  1WQ2 A;  4IRG A;  5E1Z B;  2QVO A;  2DLL A;  4HLX A;  2CFX A;  3ECO A;  3BZ6 A;  4KYW A;  4BHP A;  1ZRE A;  4R79 A;  2KIF A;  4M9Z A;  3QPH A;  5DCF A;  1BN5 A;  3VFZ A;  2EJR A;  5CVU A;  1HKS A;  1SD4 A;  1CF7 A;  1K79 A;  2P5L C;  3ZMS A;  1QZZ A;  2XAJ A;  3HYI A;  5DD4 A;  1IRG A;  3HIF A;  1ZGJ A;  1BJA A;  2MLG A;  3L9F A;  3K69 A;  3E6B A;  1K78 B;  3HRT A;  3HOT A;  1J9I A;  2BEO A;  2EA2 A;  1BI3 A;  1FNN A;  1HKQ A;  5JR3 A;  4NHJ A;  1ZGA A;  4MTD A;  4KIC A;  3E5Q A;  1R23 A;  5E1X A;  4G7H F;  2FNP A;  1XSV A;  1ZAO A;  5JI6 A;  3I53 A;  2O3F A;  2CG4 A;  2ZO4 A;  1UCR A;  2YPR A;  2K86 A;  3K0L A;  3D5L A;  1T38 A;  2XKO A;  2XV4 S;  2D1V A;  4QLC U;  3K9T A;  3DP7 A;  4N9I A;  3VOE A;  1TQI A;  1MZB A;  2O0Y A;  2ZNY A;  2W57 A;  3LA7 A;  3ZQ7 A;  4IXA A;  2DBB A;  2IP2 A;  5CVR A;  1TW3 A;  4I2O A;  4AWX B;  3Q9S A;  4G8X A;  1REP C;  2DU9 A;  1XMK A;  4U88 A;  3COA C;  2XUB A;  3HRU A;  1FOK A;  1FBS A;  1U3E M;  2DW4 A;  3E6M A;  2M5W A;  3J81 Z;  2EFO A;  4OIR F;  1G3Y A;  5FLX Z;  1ODD A;  4G6Q A;  3RKX A;  3WG9 A;  1TLH B;  3E6C C;  2KJB A;  5ICG A;  1LDK B;  5EEG A;  5LHI A;  2KJC A;  1Q1H A;  2Y75 A;  1MKM A;  4Q48 A;  1EH6 A;  3WTX C;  5E18 F;  5ILU A;  2GA2 A;  1XD7 A;  2PN6 A;  3HRM A;  4EGY A;  2YU3 A;  5CVV A;  4OMY A;  1XMA A;  3O3K A;  1KYW A;  5ERI A;  3V7R A;  3WTW C;  3L2C A;  4HLY A;  1KGS A;  4I02 A;  1BBY A;  4RAY A;  1XGO A;  3DXJ F;  5KVR A;  1PP7 U;  2K4B A;  2P4W A;  4WCG A;  2EWN A;  1SD5 A;  3KP3 A;  5K5R A;  4KMF A;  4AVP A;  5ICC A;  1AWC A;  1HQC A;  3JSP A;  1L0O C;  5L3F A;  1IXC A;  2OZ6 A;  2WWY A;  2V1X A;  1U5T B;  4OOI A;  2VC1 A;  2WC2 A;  5HS9 A;  1TBX A;  3ELK A;  4LG0 B;  4BQA A;  3O6B B;  3WTU C;  1D8J A;  4KIB A;  5BS6 A;  4IHS A;  4RGX A;  2VT3 A;  2DQL A;  4UUV A;  2C6Y A;  1FYM A;  1TW2 A;  3W6J B;  3C3W A;  3NEU A;  1BC8 C;  3BDD A;  2RVC A;  1R5G A;  2EV0 A;  2XAQ A;  2A3S A;  3DF8 A;  2M8E A;  5HLH A;  4ZYD A;  2HYG D;  3BWG A;  4S04 A;  1IW7 F;  1WSU A;  1FBU A;  2Z5U A;  1S29 A;  1V4R A;  3CLO A;  3R61 A;  1Z7U A;  2HQN A;  4EMS A;  1FC3 A;  3KET A;  4LLL A;  1DUX C;  3CJN A;  3O2P E;  2BYV E;  2L02 A;  2A69 F;  3JTG A;  1U2W A;  2JPC A;  1QNT A;  2ESH A;  3SZP A;  5LBQ A;  3IHU A;  2QQ9 A;  4N9H A;  5CJ9 A;  3R0J A;  4L0Z B;  1G3S A;  4CO8 A;  1DPR A;  4TV7 A;  4KIF A;  2XVC A;  1KU3 A;  1UB9 A;  3QU3 A;  2JT1 A;  4BHC A;  3TQN A;  4I0A A;  1WI9 A;  5D8L B;  2L4A A;  2GQQ A;  2V6C A;  3WE2 A;  3ISP A;  1U5T A;  3KP7 A;  4EJO A;  3LST A;  2EV5 A;  1JE8 A;  4L9V A;  3KLO A;  1SAX A;  2W24 A;  1V3F A;  2G7H A;  2M87 A;  4XSZ F;  1HSJ A;  3QPT A;  3LWF A;  1RZ4 A;  1R1U A;  2ISZ A;  4L5I A;  5KK1 A;  1FZP B;  2X0L A;  2QBY A;  4YII A;  3RYR A;  3MQ0 A;  2ZFW A;  1HST A;  1LDJ A;  2IW5 A;  2O8X A;  1JXS A;  2A5Y B;  1OPC A;  4WF2 A;  5DUK A;  5FB2 A;  3ML6 A;  3HSR A;  4XRF A;  4HAM A;  1MJ9 A;  1UST A;  1HW5 A;  3KLN A;  1ZG1 A;  4P5O A;  5DYM A;  2FML A;  5L3G A;  1XN7 A;  1K7A A;  4Q4Z F;  4UV8 A;  4O3M A;  5DUI A;  3ROU A;  3G73 A;  4S05 A;  3BY6 A;  1E2X A;  1R1T A;  2D1H A;  2A61 A;  3MZH A;  1QGP A;  3GX4 X;  4MEX F;  3IWF A;  2STT A;  4KN4 X;  4N0B A;  2D2W A;  1T6S A;  4M73 A;  4PDK A;  3E3V A;  2VON A;  5TRD A;  3WTZ A;  4MTE A;  5HDN A;  4G7Z F;  1G3T A;  1FYL A;  2VE9 A;  1R1V A;  4KFC A;  3LA3 A;  1SD7 A;  2IA0 A;  2XAG A;  1IZ1 A;  3TO7 A;  2P5K A;  1YIO A;  3ABT A;  4FX0 A;  2F5D A;  1P4X A;  1IN7 A;  5J6X A;  4G7O F;  3CUQ A;  1O3S A;  4OMZ A;  2XGX A;  2W85 A;  2NRA C;  4KA4 A;  2PJP A;  1T98 A;  4M6X A;  3VOD A;  4K2E A;  1OR7 A;  3TGN A;  2QYO A;  2GXG A;  5H20 A;  2IPQ X;  3TOB A;  2HGC A;  3DFG A;  2XIG A;  1YLF A;  3D0S A;  2WTE A;  3MEX A;  3T1B A;  5TJJ A;  4DNC A;  1ZRF A;  2ESN A;  2GIV A;  3KP5 A;  2HYF A;  1R58 A;  1YW9 A;  4Y15 A;  1OYI A;  2DK5 A;  4LFU A;  1ONV A;  5LGN A;  3P7N A;  4KN7 X;  1BI2 A;  3MZY A;  3FHZ A;  2R7D A;  5L3C A;  4ESB A;  1STZ A;  2FA5 A;  1SFU A;  3RDI A;  1FSE A;  3ZP5 A;  5F1R A;  1O7F A;  1XSD A;  3GFJ A;  4HOB A;  2FBH A;  4LD5 A;  1TQM A;  1OKR A;  3KCC A;  2EFW A;  5ED4 A;  4CDG A;  2JTV A;  3JSO A;  3TDU C;  1B9M A;  3MAJ A;  3V7C A;  2V9V A;  1FP1 D;  1U8R A;  3WE3 A;  4FHT A;  2VE8 A;  2RNJ A;  5LRS A;  3C1D A;  1S6L A;  4M74 A;  1MJA A;  4RB0 A;  4UV9 A;  5HLI A;  3I58 A;  2JPB A;  4M72 A;  1J0R A;  3J80 Z;  2LKP A;  2HKX A;  4EJU A;  1ZRC A;  3CUO A;  2IA1 A;  1FP2 A;  3RTR A;  3G3Z A;  5AON A;  4KIG A;  4KUM A;  4LMY A;  4OIN F;  4WXD A;  4Q5S F;  2ZME A;  4EV0 A;  2W84 A;  1YTY A;  2UXN A;  5FFX A;  3EYI A;  1CF7 B;  2VBY A;  2VBW A;  4ETS A;  1LDD A;  3OOP A;  4UVB A;  3WTS C;  4WXC A;  3DPT A;  5HS7 A;  4I0B A;  3FF5 A;  3V8L A;  4L18 B;  4B09 A;  2OAZ A;  3U1D A;  2PI0 A;  2Y48 A;  1O3T A;  1MDM A;  2QZ8 A;  1X3U A;  3WU1 B;  4L9N A;  3L7W A;  1FPQ A;  2OZU A;  3QAH A;  2PMU A;  2RQP A;  2Z33 A;  4P96 A;  1HW1 A;  4OIO F;  2RKH A;  1ZG3 A;  3LQR A;  3SQN A;  3Q5F A;  3B73 A;  2M1B A;  2RC4 A;  3IRR A;  3GUD A;  4RS8 A;  3VB2 A;  2LSO A;  4EJV A;  4HW0 A;  1FLI A;  3KEO A;  4ZZD A;  4I98 B;  1MJB A;  3HHH A;  4HQM A;  3GLX A;  1ZHF A;  2ZCW A;  1J75 A;  2MC3 A;  1ON1 A;  5D5U B;  1Y0U A;  3T8R A;  4EM0 B;  5LHG A;  4LK1 F;  1R00 A;  1UFM A;  3RKW A;  4RAZ A;  3HHG A;  4P9U A;  2PQ8 A;  4GYG A;  1U6G A;  3GVA A;  1WRJ A;  2J5O A;  3DQV C;  1I27 A;  4M9S A;  1QZY A;  2P8T A;  4HX4 A;  2E1N A;  1FY7 A;  1RIO H;  4O5V A;  5K1Y A;  1QPM A;  2CW0 F;  4ESJ A;  4HX8 A;  3FXU A;  1TQP A;  1B9N A;  3GFI A;  2DO7 A;  2TDX A;  4WWC A;  4ESF A;  4DQ2 A;  2ZME B;  2HR3 A;  3WTV C;  3F8C A;  1W5S A;  2OBP A;  2ZJ2 A;  2A07 F;  5HDK A;  2Q0O A;  1VTN C;  2O6G E;  3QP5 A;  3NQO A;  3BJA A;  1MGT A;  1KYZ A;  3REO A;  1RUO A;  3P9I A;  1S3J A;  2FQ3 A;  1EH7 A;  1XGN A;  3K1P A;  3ZPL A;  1FT9 A;  5DV5 A;  1EV7 A;  4YG2 F;  5BQT A;  2PLY A;  5H6Q A;  4A0Z A;  2ISY A;  2ZXJ A;  5JVT A;  2UZK A;  4RB2 C;  2E7W A;  3IKV A;  2HTS A;  3M1E A;  5F6F A;  4EM1 A;  2EFN A;  4XBF A;  1I6X A;  4ZYH A;  4G94 A;  1JHF A;  2K4J A;  4EGZ A;  3Q9V A;  2H6C A;  3WTT C;  1PDN C;  1ZN2 A;  2NYX A;  2OQG A;  3T0Y A;  5ICE A;  1XSX A;  1D5V A;  3C7J A;  1HKT A;  1IXR C;  4LB5 A;  2BGC A;  2FE3 A;  1L3L A;  1D8K A;  2PBI A;  1KA8 A;  3QOP A;  2Z3Y A;  3ABU A;  5LGU A;  3BPX A;  2K7L A;  3FMS A;  3PFI A;  4U7D A;  2QWW A;  4U0V A;  3QP6 A;  2A6E F;  1F4K A;  4A2U A;  4Y13 A;  4FT8 A;  3GFM A;  3E5X A;  5CVI A;  2PMH A;  4RB3 C;  1T2K A;  1XGS A;  2P6T A;  3KP2 A;  4AIH A;  5HLG A;  2YR2 A;  3TO9 A;  5D4S A;  1IAW A;  2OQR A;  4OIQ F;  3QU6 A;  2VC0 A;  4A5N A;  5K5O A;  1SFE A;  5EEH A;  3F8B A;  4YFX F;  2P7V B;  4A0Y A;  1FX7 A;  5ILV A;  1LJ9 A;  1P2F A;  1O3R A;  5BOX A;  4B8X A;  2NNN A;  3LAJ A;  2IT0 A;  2YX7 A;  3CUQ C;  2JRT A;  4HX7 A;  3CTA A;  4RGS A;  3V7S A;  4YIF A;  1G4D A;  2MH9 A;  2FNA A;  1JGS A;  3BP8 A;  2KIM A;  1XCB A;  2RN7 A;  5BPD A;  1Z6T A;  5HOO A;  4HV6 A;  4U0W A;  5DCM B;  2DAO A;  1AOY A;  1H9G A;  1P92 A;  2VOD A;  1UHW A;  3RPQ A;  2RDP A;  4HQE A;  2KIU A;  3FZV A;  2MBF A;  1MDM B;  4QWQ A;  3TKY A;  3ZMU A;  1RI7 A;  3EDP A;  2Q8K A;  4GGG A;  3LAP A;  3RYP A;  2DTR A;  1I1G A;  1GHC A;  4IRI A;  1T0F A;  3GW2 A;  3HSE A;  4GO1 A;  3U9G A;  1B59 A;  4JK1 X;  3RJP A;  5ILS A;  3F8F A;  4EJT A;  2DK8 A;  2CYY A;  6PAX A;  2LNB A;  3MFK A;  2F5C A;  3IKT A;  2P6S A;  2BBY A;  2XAS A;  3P9C A;  3KE2 A;  3RIR A;  2UXX A;  4XLP F;  1DPU A;  3EUH A;  2F5E A;  4IHT A;  3GZ5 A;  4YFN F;  3CO7 C;  3NRV A;  3KZY A;  5J8F A;  5LEJ A;  3JTH A;  1P4W A;  1IN5 A;  3TOA A;  1H9T A;  5E8I A;  2FBK A;  1IUY A;  3FM5 A;  3RPU A;  1H0M A;  2VT2 A;  3OV8 A;  2XAF A;  3M8F A;  1XB4 A;  1NHA A;  2H27 A;  1IN8 A;  1K78 A;  3FWE A;  5LRR A;  3FXR A;  4LGW A;  2IJL A;  1W7P D;  3K1M A;  4RGU A;  2DPU A;  5LHH A;  4G9Y A;  3TO6 A;  4IF4 A;  2E1C A;  3T5X A;  5L3B A;  3LA2 A;  3R0A A;  2HDC A;  1XGM A;  2F5F A;  2CQK A;  3H3U A;  1QO0 D;  1XDU A;  2P5V A;  1HBX G;  3MCZ A;  2J5P A;  5JFR A;  4WXH A;  1RUN A;  3HRS A;  3GXO A;  4ENN A;  4JQF A;  1SMT A;  1I5Z A;  5E20 A;  4IRH A;  3DV8 A;  3KP4 A;  2H09 A;  2K02 A;  4O6J A;  1TNS A;  2R3S A;  3J80 K;  4E70 A;  4A0X A;  4L0Y B;  5LEK A;  4ASN A;  3DEU A;  4EM2 A;  1SD6 A;  1W5T A;  2Y0M A;  3F23 A;  3FMR A;  1S8N A;  1W4M A;  2M45 A;  2O03 A;  3E97 A;  3MWM A;  4GYI A;  3T8T A;  1G3W A;  2QQA A;  4A12 A;  1BM9 A;  2QLZ A;  3K1N A;  5F64 A;  5DD8 A;  3SHF A;  3E5U A;  2LDU A;  2BE5 F;  4G6D A;  4L9J A;  1LEA A;  1RNL A;  4ON0 A;  3JAM Z;  2HZT A;  3WTY C;  4HYE A;  5JHU A;  1ZYR F;  5AIP A;  3JW4 A;  2CGP A;  3GF2 A;  1ZLK A;  2G9W A;  3I4P A;  5FLX K;  3BJ6 A;  5BMZ A;  1E17 A;  2GAU A;  3KEQ A;  4XLN F;  1XDS A;  4BXU A;  3ECH A;  3PQJ A;  4HF1 A;  4LJZ F;  2M30 A;  2A6H F;  1ULY A;  2KRF A;  2EFQ A;  2VOO A;  3CUQ B;  5LGT A;  5L3D A;  4FX4 A;  2DI3 A;  4R1H A;  4Y17 A;  3WGG A;  4M71 A;  4AIJ A;  1USS A;  1IXS B;  1U5T C;  4IJA A;  2HQR A;  2Q2E A;  5BPI A;  5FD6 A;  5E17 F;  3JAM K;  3I54 A;  1R7J A;  4ZH4 F;  5E8G A;  3KZZ A;  3EQL F;  2G7U A;  1KU7 A;  1J59 A;  1R22 A;  2LF7 A;  3VEP A;  1YS7 A;  4UHT A;  5H6R A;  3ZN1 A;  4MQV A;  4OIP F;  1KU2 A;  4LB6 B;  2X4H A;  3IRQ A;  3F6O A;  4ZZL A;  1ZRD A;  3L09 A;  2A68 F;  5A2Q Z;  4ENK A;  4GCV A;  4M9X A;  4HA8 A;  3FM3 A;  2JZY A;  3I59 B;  1FYK A;  2EV6 A;  1SFX A;  3I59 A;  3IWZ A;  2PG4 A;  4AD9 A;  2RGV A;  3HSF A;  3TDZ C;  3C18 A;  1Z9C A;  1J7K A;  2AXL A;  5D8K B;  3LFK A;  3M9A A;  1WKM A;  5D6E A;  3S2W A;  3M7G A;  1P4A A;  2XRN A;  2COM A;  1XCV A;  2QEN A;  1Z1D A;  4CGZ A;  3PQK A;  5D5W B;  1KQ8 A;  4UXN A;  4RGR A;  2P7C B;  2IVM A;  2EB7 A;  2GA1 A;  2WV0 A;  1YG2 A;  2B0L A;  1WWX A;  1IN4 A;  3HOS A;  1BI0 A;  2VBX A;  3F3X A;  1Z91 A;  3B02 A;  1JHH A;  2OD5 A;  4CYD A;  4IPA A;  1EH8 A;  4GXO A;  2K27 A;  2OA4 A;  1W7P B;  4BH9 A;  3GYH X;  4HBL A;  4MEY F;  1ZH5 A;  4U0Y A;  1Z05 A;  2EK5 A;  3K2Z A;  1PUE E;  2AS5 F;  3WOD F;  1F9N A;  4KNY A;  5DDG A;  2GWR A;  2E7X A;  1BI1 A;  4L5J A;  3H92 A;  3GO5 A;  5HDG A;  1TTY A;  3CDH A;  4PGG A;  2CSO A;  5HVQ C;  1P6R A;  2FMY A;  3L00 A;  2MH2 A;  3LQQ A;  4R8H A;  3ZMV A;  1R36 A;  1I1S A;  1O57 A;  5K5Q A;  2NNY A;  1YFH A;  2ETH A;  3GFL A;  2QBY B;  2FRH A;  4HDV A;  5DCM A;  2VXZ A;  2QM3 A;  1LNW A;  1ZG5 A;  2HTJ A;  4CHU A;  2XHK A;  4WX9 A;  2XRO A;  4I01 A;  4HV5 A;  4MHG A;  4MGR A;  3KFW X;  4M6Y A;  4EVI A;  1OYW A;  2QQB A;  4XSX F;  3FX3 A;  5DEQ A;  3ZMZ A;  1HW2 A;  2CWE A;  2STW A;  1BIB A;  2DFI A;  4I09 A;  3KP6 A;  2LF8 A;  2YSR A;  5CVJ A;  4Q47 A;  4LLG F;  4HDU A;  3HUG A;  4CZZ A;  4AIK A;  2ZBK A;  2FEZ A;  3BPV A;  2HKO A;  4P55 A;  1A04 A;  2GZW A;  5FFZ A;  2Z9O A;  3DKW A;  1S7O A;  5L3E A;  4P9F A;  5D4R A;  1TNT A;  1YO5 C;  3F8M A;  4L9T A;  1R5H A;  3SZT A;  3ERE D;  3R60 A;  3F22 A;  4IVN A;  2FOK A;  4A6E A;  3ZMD A;  1KQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...