3HTUA

Crystal structure of the human vps25-vps20 subcomplex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
75
structure length
75
Chain Sequence
b'RRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vacuolar protein-sorting-associated protein 25
molecule tags Protein transport
source organism Homo sapiens
publication title Structure and function of the ESCRT-II-III interface in multivesicular body biogenesis.
pubmed doi rcsb
total genus 21
structure length 75
sequence length 75
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2009-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3htuA00
2HOEA 5ICGA 2WWYA 3BROA 1YIOA 5AIPA 3R61A 3V4GA 3SZTA 1YQAA 1IN7A 3FXQA 2XIGA 3TQNA 4A0XA 4G7OF 2HTSA 3SZPA 2CGPA 1ZARA 4B8XA 4HX4A 3TO7A 3ULQB 3LQRA 4LB6B 2NNNA 1V4RA 3GLXA 3KP5A 4L9VA 2CG4A 2E1NA 4EM0B 2VT2A 2W84A 3K9TA 1R7JA 3AAFA 4HW0A 2ZMEB 1I6XA 2JZYA 5DCFA 3BDDA 3L2CA 1XMAA 3WE3A 2GA2A 1FBUA 1P4WA 1ZGJA 5D5WB 1F1ZA 5L3CA 1DDNA 1KQ8A 1LDKB 2PQ8A 1R36A 3B02A 4G94A 3CLOA 3FMQA 3TDZC 5H6QA 3O6BB 2HWVA 1ZRFA 2A5YB 2QVOA 1YS6A 5D8LB 2GZWA 4HV5A 1GVJA 2K7LA 3D5LA 4MEYF 4LJZF 3KCCA 4OOIA 1RUOA 4L9TA 3P9KA 3CO7C 4WX9A 2L4MA 1LEAA 1BIAA 4CGZA 5IT9K 3I59A 2V1UA 1XD7A 4RGRA 4YFNF 3FWEA 3EYIA 3QAHA 1FP1D 4K2EA 5FFZA 2OQGA 2FBIA 2VN2A 5LGTA 1EH6A 4EJOA 2ELHA 2EV5A 1QQIA 5FD5A 2PMUA 2HYGD 1LDDA 2JTVA 3FZVA 2IW5A 2RKHA 3WE2A 1SD5A 1HSTA 1BC7C 1G3WA 2FBKA 3GVAA 3COAC 3RYPA 1XSXA 3NRVA 3SHFA 3GZ5A 3FMRA 5ICCA 1H0MA 1XB4A 2NRAC 1FT9A 3IL2A 5H6RA 1R1TA 4GXOA 2E1CA 1QZZA 5CVRA 4IRIA 4R1HA 3WGGA 4JQFA 2BE5F 1Z05A 5JI6A 4WXHA 5FO5A 4CZZA 4BH9A 1HKSA 1KU7A 5ILUA 2HTJA 3ZPLA 2Y75A 1XSVA 4EJVA 5BS6A 2BYVE 3T8TA 4WK8F 2EJRA 1GXPA 4HDUA 1LJ9A 1F5TA 3WTYC 5K5OA 3IHUA 2IP2A 2RN7A 2K4BA 2FMYA 5HLHA 5EEHA 2O61A 1R1UA 5LHGA 4GYIA 4KT5C 4A0ZA 3FMSA 3R60A 3RPQA 2BV6A 4N0BA 4A0YA 4EV0A 3DPTA 1IN4A 5IT9Z 5HVQC 1R00A 2FE3A 3EETA 5FD6A 2FNAA 4BYYA 3T0YA 2DQLA 2AS5F 3T5XA 2NNYA 1T2KA 2L54A 3E5QA 1YW7A 3I58A 2QLZA 4YFXF 1IUYA 3J80K 5DYMA 2XVCA 2C6YA 5ICEA 3K2ZA 3F6VA 2PMHA 1R5HA 2P5KA 4XRFA 3MAJA 4EJWA 1L0OC 4LD5A 3P9IA 4IVNA 2Q8KA 1DPRA 5CVUA 1ZLJA 4CO8A 1LDJA 2Q0OA 3KP7A 1FOKA 2RVCA 2DPDA 2HYFA 2FBHA 4ESBA 3FHZA 4L5IA 5CVVA 3RDIA 4OIOF 4AIHA 2PI0A 3V7CA 1J0RA 1OMIA 1SAXA 4MQ9F 3ELKA 4AIKA 5DEQA 4RB0A 4FT8A 3WU1B 2MBFA 4MGRA 1FZPB 1FYKA 3GZ6A 3BP8A 4EJUA 1KU3A 3JTGA 3S2WA 3E5XA 5DD8A 1TW3A 1D5VA 2M45A 3F23A 4L9NA 2OAZA 1BM9A 1KU9A 2K86A 1H9GA 5LEKA 1MZBA 4CICA 3L09A 3ZN0A 1QZYA 5BPIA 3LWFA 4WXDA 2A69F 4HLXA 1L3LA 5KK1A 2GA1A 5FB2A 4KYWA 1YLFA 3IKTA 3HIFA 2O3FA 2DO7A 4B09A 3HRUA 1SMYF 5A2QK 1BI3A 2FQ3A 2G9WA 3CTAA 2QM3A 3BWGA 3WG9A 4HBLA 1UFMA 4AD9A 1CF7A 5TRDA 4OMZA 2LF7A 2DLLA 1UB9A 1U5TA 2PN6A 4RB2C 1U5TB 3LA3A 2W24A 3BJOA 2ZKZA 1R22A 3HRTA 3VOEA 2MH2A 1G3YA 3KE2A 1DUXC 3LA7A 3GFIA 2QZ8A 3M7GA 1WI9A 1S29A 1ZAOA 2H94A 1J59A 4PZJA 4XSZF 5J8CA 3GFMA 2QQAA 3BY6A 2R7DA 2DAOA 3KEQA 1BIBA 4OIRF 4L18B 1TLHB 5E8IA 4L5JA 1EH7A 1AOYA 2JPCA 3GO5A 1ZN2A 1DPUA 2JPBA 4P9FA 2IA2A 4BHPA 1R58A 2H6BA 1FX7A 4EQQA 5CVIA 1MJAA 3K1NA 3JTHA 3MFKA 1KA8A 3KZZA 4PDKA 3GXOA 2E7XA 3HHGA 2J5PA 2V79A 4IF4A 2CYYA 2F5DA 1G3SA 3DQVC 2LNBA 2IPQX 4LG0A 4FX0A 4OU0A 1MJBA 3LA2A 1Z91A 4HZFA 2PBIA 3ML6A 2RDPA 1Z6TA 5LGNA 4YIIA 4Q4ZF 2QWWA 4BQAA 4LLLA 2VBZA 4U0YA 5FFXA 2NAZA 1O7LA 2QUFA 3WTZA 4WCGA 1OKRA 4HA8A 1ZHFA 5E1XA 4LGWA 4P55A 4EGZA 4NB5A 5J6XA 1PP7U 1ZG3A 3FM3A 1F9NA 3G73A 5HLIA 2RQPA 3M9AA 1STZA 5E18F 2JRTA 2STWA 3WGHA 4ZZLA 1ZG5A 1TQPA 2A6EF 4I7HA 4YIFA 3W6KB 3Q9VA 3ZMVA 5L3EA 1R5GA 4ESFA 2ZBKA 3E5UA 1K79A 3E6BA 2DW4A 2B0LA 1G3TA 4O3MA 3JSOA 3TKYA 1X3UA 1R23A 2Z99A 1WSUA 1O7FA 1LVAA 5DUKA 4RGUA 3I71A 1RUNA 1XGOA 4NHJA 4GYGA 2M8EA 4ENKA 1XGNA 1O57A 4A6EA 3DV8A 2GIVA 4ZYDA 4HX8A 5HDKA 4DQ2A 2ZXJA 5D8KB 4U0WA 3HRMA 4BAYA 1OYIA 5LGUA 4ZH4F 2E7WA 2DPUA 2HZTA 1KYWA 4G9YA 2IA0A 2QYOA 2D1VA 3TDUC 2FA5A 3M1EA 3GWZA 1FLIA 2FEZA 1W7PA 1BI1A 2A68F 1XGMA 4U0VA 1QO0D 2O0YA 4Q48A 2P4WA 3VFZA 1MDMA 1ZREA 4LFUA 4ENNA 2L4AA 2P5VA 4Y17A 2ESHA 2ZJ2A 3ZN1A 5FGMA 2COMA 5F1RA 4U7DA 1HKQA 5BMZA 1OYWA 2VOPA 2DT5A 1B9MA 2XAQA 4N9IA 1IXRC 3F8CA 3TGNA 2Z33A 4RB1A 3MCZA 3O3KA 1S6LA 1FSHA 4KN7X 5JR3A 1U3EM 3GFJA 3K1MA 2BGCA 4KIBA 4KFCA 1SFXA 2K27A 4AWXB 1BJAA 5ERIA 4RS8A 1YS7A 2XGXA 3TO9A 4EM1A 4S05A 3KLNA 3RKYA 4Y13A 4XBFA 3I53A 3E97A 4A5MA 2Y48A 3K0LA 1R1VA 3DXJF 1BN5A 2M30A 2CQKA 2RV8A 4PGGA 1T0FA 3G3ZA 2FU4A 3KETA 2FOKA 1TW2A 1QPMA 1OPCA 1P4XA 3WTTC 3MEXA 1TNTA 5D4SA 2EFPA 3D0SA 3DEUA 4P5OA 2CW0F 3QU6A 3L7WA 3W6JB 2X4HA 3DKWA 3T8RA 2YU3A 4EVIA 1ZYRF 1OYYA 1NHAA 1O3RA 2PJPA 1YYVA 5JVTA 3GYHX 2DQRA 1MKMA 2F5FA 1IN8A 4D0PA 3HSEA 2EA4A 5LRSA 1QGPA 3QPTA 3J81Z 3KP3A 4CDGA 4KA4A 4E70A 1FC3A 2HGCA 4Q47A 3CUOA 2GXBA 2O8XA 2FRHA 5KVRA 1B4AA 1YG2A 3DFGA 2IA1A 2VBXA 3HOSA 3FXRA 2FNPA 5IT3A 2M87A 1MGTA 3BJ6A 4R79A 1W4MA 3GF2A 4UVBA 3V8LA 4UHTA 3V7RA 1XCBA 3L9FA 3IRRA 1JHHA 1U8RA 4MHGA 3HTUA 5HDNA 3CUQA 3I59B 3V8KA 4CYDA 2EFNA 4IXAA 1U5TC 4P9UA 2YSRA 3KZYA 3IWZA 1Z1DA 2WV0A 3ZMUA 1IRFA 1HKTA 4HF2A 3HHHA 2W85A 5DUIA 4UVAA 4XSXF 2ISZA 2LDUA 3MWMA 3TOBA 2WTEA 1IAWA 1XMKA 3KEOA 2Z5UA 4G6DA 2Z9OA 4I01A 3C18A 1B1BA 4LMYA 2JSCA 1A04A 2XAHA 1ODDA 5ICFA 1MJ9A 3FF5A 4EMSA 4KICA 4M9ZA 2EFQA 4GCVA 3TOAA 2FSWA 1I5ZA 2ZNZA 4KIGA 2W57A 1SMTA 4JK1X 1I1SA 4PCQA 5F64A 1S7OA 4QLCU 2DBBA 1ZRDA 4BHCA 1EV7A 1MDMB 4HF1A 3GX4X 1T38A 2YX4A 2ZMEA 4KIFA 2VE9A 2HKXA 3DF8A 2XROA 5HS8A 3CO6C 4A6DA 3SFZA 2W25A 2MH9A 4H0EA 3BJAA 5K5RA 5L3DA 4OIPF 2LSOA 4HQMA 4OIQF 1KQ0A 2LKPA 1LNWA 3R0AA 3HTSB 2XAGA 5E17F 2R3SA 3QOPA 1Z6RA 1T39A 1BI0A 3I4PA 3SQNA 3F8BA 2P5LC 2HFHA 3IWFA 3HOTA 3N4MA 1LB2A 1O3TA 2AXLA 3E6CC 4I0AA 2VONA 3JW4A 4RAYA 1C0WA 2DTRA 2F5EA 1DP7P 4HYEA 4FHTA 4U7BA 5BPDA 2V6CA 4IRHA 4HX7A 4M73A 1ON1A 2G7HA 2IRFG 3ZP5A 3QPHA 3WTSC 4MEXF 1FSEA 1J7KA 3WU0A 4U88A 3WTUC 3I54A 3ECHA 1YW8A 2GXGA 1S7AA 3ZQ7A 2HQRA 2NS0A 5CVJA 1XCVA 5L3BA 6PAXA 1U2WA 2CFXA 3GW2A 3RIRA 2P7VB 2F5CA 3H3ZA 2O6GE 3CUQB 5LEJA 1W5TA 2OA4A 4LLNA 2PEXA 4QWQA 3QU3A 2TDXA 1IXSB 4XLNF 3C3WA 1HQCA 5BOXA 4BXUA 4G6QA 2VODA 2V9VA 3IC7A 5DCMB 1ZRCA 2QENA 4UVCA 4NQWA 4I09A 4XLPF 3FX3A 5J8FA 4R8HA 2Q2EA 4EM2A 3F72A 3EDPA 2GQQA 1IXCA 2DK5A 3EYYA 5EEGA 5DD4A 1ZH5A 3E3VA 4G8XA 2ZCWA 4UUVA 3F8MA 3RKXA 5JFRA 1XSDA 2PFBA 1PUEE 2A07F 5D6FA 2RGVA 4UNOA 5HS7A 2D45A 1G6NA 3QRFF 2UWMA 2MLKA 2KIUA 2YX7A 1YW9A 1ON2A 1P6RA 5D5VB 2XKPA 5D4RA 3VODA 5ILSA 2L01A 3ZMSA 5ED4A 3WTXC 1ZLKA 4BNCA 1CGPA 4WXCA 3IRQA 2IVMA 2MA3A 2OBPA 3M8EA 4RAZA 2VOOA 1SD6A 1FYLA 3GUDA 4UV9A 4LG0B 4MTDA 4WWCA 2D1HA 3RPUA 3E6MA 1B9NA 3BPXA 2YPRA 3P7NA 4RGSA 2FMLA 2ZNYA 1REPC 4PGHA 3J81K 4S04A 1D8JA 2PLYA 2BEOA 3GFLA 3HYIA 4GGGA 1RIOH 3ABUA 3MZYA 5HDGA 4LLGF 2IJLA 1W5SA 1ULYA 4M6XA 5AONA 3R6SA 1WRJA 3B73A 3KLOA 1USTA 1G4DA 3WTVC 4L0ZB 3RTRA 3Q5FA 3JAMZ 2DU9A 2O03A 2HKOA 3JSPA 4IRGA 4HOBA 2V1XA 1FBQA 4UV8A 4HAMA 3RI4A 1J9IA 2ISYA 4N9HA 3EUHA 4LK1F 4ZYGA 1BI2A 2K02A 3ZMZA 2QBYB 1EH8A 2DFIA 1TBXA 1HW1A 4EGYA 2P7CB 2M5WA 2NYXA 4G7ZF 2XASA 2VBYA 2ZFWA 3CDHA 2KKOA 2QQBA 2HR3A 3HUGA 5CLSA 3N97A 1W7PB 4O5VA 3CJNA 1J2XA 2KJCA 1UHMA 1FPQA 4RGXA 2A3SA 4LB5A 1KYZA 4IPAA 1QBJA 3ZMDA 1WKMA 3GEZA 1B59A 4M71A 4UXNA 3H92A 5H20A 3WODF 2XAFA 2EK5A 2VXZA 2UXNA 3F22A 1GHCA 4AVPA 4ETSA 5CJ9A 5DCMA 1IW7F 1JGSA 4ESJA 3E6DA 1QNTA 4I98B 1HW5A 1WWXA 2MD5A 3R0JA 2L02A 4F7ZA 2EB7A 4A2UA 2GAUA 2VT3A 2LF8A 1MD0A 1XDUA 4ZYHA 3FXUA 2VE8A 5HS9A 1SD4A 3PQKA 4KUMA 2VC0A 4L0YB 4KDPA 2UXXA 3KP6A 3CUQC 5FLXZ 3KFWX 4TV7A 3MZHA 3F6OA 2D2WA 5D6EA 2IT0A 4I2OA 4IHTA 3KP4A 1XN7A 1P2FA 1ZG1A 2OZ6A 4CXFA 4CHUA 5LHIA 1IN5A 3BOQA 2ADUA 1KU2A 1S8NA 2QQ9A 1U6GA 1Q1HA 3L00A 4KMUX 5A2QZ 1FNNA 3J80Z 3LAJA 2KJBA 3R4KA 3T1BA 2M1BA 2VBWA 2K4JA 2L3DA 1GXQA 2CWEA 2OQRA 4RB3C 4I02A 2EV6A 1FBSA 3VB2A 2DI3A 4M72A 4HV6A 3FM5A 1JE8A 2F2EA 1TQMA 3RJPA 5HLGA 5CYVA 4M9XA 1K78B 5AIQA 3MQ0A 1OR7A 3NQOA 4EJTA 5TJJA 4KNYA 1T6SA 2OU2A 3ROUA 2HDCA 3LFKA 1HW2A 5LRRA 1UHWA 1HBXG 4MTEA 1HXDA 2FF4A 2Y0MA 1TQIA 3OOPA 5D5XB 2HEOA 1SFUA 1P4AA 2QBYA 4YFKF 3JAMK 3M8FA 3LQQA 1PP8F 1W7PD 2XRNA 5K5QA 2P6TA 2YR2A 4HLYA 2PG4A 2UZKA 1FP2A 1F4KA 4ON0A 2EWNA 1ONVA 4DNCA 3C7JA 1CF7B 3BPVA 3P9CA 2GWRA 3QP6A 2EA2A 1Z7UA 2CSOA 2RNJA 5E1ZB 1T98A 2OZUA 1E17A 2H6CA 4M9SA 1J75A 4MNUA 5K1YA 4I0BA 2XKOA 4WF2A 1IN6A 2OD5A 2WC2A 5DDGA 3WGIA 2EFOA 3I64A 2ESNA 3H3UA 3ECOA 5ILVA 4HF0A 3Q9SA 1V3FA 4FX4A 1TNSA 3V7SA 4M74A 1D3YA 1YTYA 5LHHA 3F3XA 2XAJA 5L3GA 1H9TA 1E2XA 5F6FA 1I27A 1HSJA 1RI7A 4ZYEA 1J5YA 1WQ2A 4P96A 3TO6A 1XDSA 2P8TA 1LQ1A 5D5UB 1SFEA 1U78A 4A5NA 2CO5A 2FXAA 4BHBA 3WTWC 2H09A 1BOAA 3PQJA 5HOOA 4HDVA 3OV8A 4JBAA 1K7AA 3LSTA 2A6HF 5DV5A 2ETHA 1AWCA 1P92A 4Z2YA 2G7UA 1KQ9A 3HRSA 4MQVA 1UCRA 2V1DA 2ZO4A 1I1GA 1FYMA 3IKVA 5FLXK 3BZ6A 3VEPA 2DK8A 2Z3YA 1D8KA 3K69A 2JT1A 5E20A 1SD7A 1RZ4A 4A12A 2HS5A 3NEUA 3ERED 5E8GA 1IZ1A 2H27A 1XGSA 1Z9CA 4IHSA 1S3JA 2HQNA 1ZGAA 3HSRA 5JHUA 4KMFA 4HQEA 3RKWA 3U2RA 1B6AA 3ISPA 2J5OA 1O3SA 4Q5SF 4YG2F 4L9JA 1JXSA 3DPLC 3QP5A 2A61A 3ABTA 2XV4S 1K6OA 2XUBA 1BC8C 1FY7A 3C1DA 4OINF 4O6JA 4ENMA 2EFWA 3HSFA 2MC3A 3F21A 1FWZA 2EV0A 1IF1A 1RNLA 1KGSA 4GO1A 5LBQA 3DP7A 3LAPA 3J7AO 4IJAA 3F8NA 4KN4X 3U1DA 1JHFA 4AIJA 1K78A 3I5UA 2ACJA 1BBYA 2KRFA 2R7FA 5L3FA 5E1WA 1YFHA 1YO5C 3KP2A 4Y15A 3RYRA 1USSA 2STTA 2BBYA 2KIMA 1VTNC 4LK0F 3REOA 2P6SA 1TTYA 2MLGA 1Y0UA 4G7HF 3V8JA 3K1PA 3I0TA 3PFIA 4ASNA 1LEBA 1O3QA 1PDNC 2XHKA 4ZZDA 3U9GA 5BQTA 2RC4A 3F8FA 2VC1A 4OMYA 2KIFA 4M6YA 3ZMTA 1IRGA 3EQLF 5LLQA 3O2PE 2X0LA 4ENJA 3SXYA
chains in the Genus database with same CATH superfamily
2ID3A 2DA3A 2ELKA 2HOEA 3NWSA 3W6VA 2X6WA 1OQYA 2WAQA 5F1JA 1WVRA 2XDVA 5ICGA 1ZR2A 1GUUA 2WWYA 3BROA 4ZYAA 1YIOA 5AIPA 3R61A 5FKMA 3V4GA 3SZTA 3HOXJ 3FKJA 4PJNA 1YQAA 1IN7A 3FXQA 2XIGA 3TQNA 4A0XA 4G7OF 2HTSA 3SZPA 2CGPA 3OR1C 3M07A 1VQ7I 1U0JA 1VFCA 4RAFA 1UZCA 1E3PA 1ZARA 2CW8A 4B8XA 2JA6J 2LBFB 4CCLA 4CCNA 4HX4A 3TO7A 1MBKA 5CQEA 3ULQB 3V42A 2JA8J 3LQRA 2WV1A 3ERMA 1WJAA 4LB6B 2NNNA 3FXMA 1V4RA 3GLXA 3KP5A 4L9VA 2CG4A 2E1NA 4IQJA 4LOCA 4EM0B 2VT2A 2W84A 1SVOA 3K9TA 1R7JA 3SYTA 3AAFA 4A3LJ 4HW0A 2ZMEB 5EGOA 3L2RA 1I6XA 2JZYA 5DCFA 2Q2EB 4XKWA 3BDDA 3L2CA 2M7BA 1XMAA 3WE3A 2GA2A 3QPLA 1FBUA 1P4WA 2KRHA 2O8KA 1ZGJA 2HQAA 5D5WB 1F1ZA 2R5ZA 3PNVA 4XLHA 5L3CA 1IDYA 1DDNA 3RSNA 1LDKB 2KQRA 3LFUA 1KQ8A 2PQ8A 5GPCA 2WY8Q 4F91B 1R36A 3B6AA 1Y0NA 2Z2SB 4J19A 3B02A 4G94A 2XSJC 2L2OA 3JRGA 4XICA 3CLOA 3SZGA 3FMQA 3TDZC 5H6QA 3O6BB 4PUSA 2VB6A 1MNEA 2HWVA 1ZRFA 2A5YB 1Y39A 2QVOA 1YS6A 5D8LB 4E7SA 1Z3XA 2GZWA 4HV5A 4C3HJ 2JMWA 1GVJA 1JKQC 2K7LA 3D5LA 2F4OB 4MEYF 3DBRB 2LOOA 4LJZF 2Y31A 1Q1VA 3KCCA 4OOIA 1RUOA 1I6HJ 3ZQGA 2L9RA 4FETA 4L9TA 3P9KA 2BY1A 3CCRI 1KZHA 4X0GA 3CO7C 4WX9A 3DEEA 2L4MA 1LEAA 4ZTJA 1BIAA 4CGZA 5IT9K 3GTOJ 3I59A 2V1UA 2OPTA 1XD7A 2X1CA 4XKBA 4UB8C 4A3IJ 4RGRA 4YFNF 4CSWA 2LBFA 3FWEA 2Z16A 1X1CA 3EYIA 3QAHA 4BE2A 3I3LA 1VQPI 1FP1D 4K2EA 1XS9A 2L9NA 5FFZA 1HOMA 2OQGA 1UAAA 2FBIA 2VN2A 5LGTA 1EH6A 3DTEA 2K3FA 4IOAF 1TWHJ 2CUFA 2E35A 2ELHA 3OR2C 2EV5A 1QQIA 4EJOA 1FEXA 1FOXA 5FD5A 2PMUA 1ZR4A 2HYGD 2WAEA 1LDDA 4II3A 1K4TA 2B9SA 2COBA 1OISA 3FBNB 2JTVA 3GZNB 4CYCA 2ZJRF 3EPZA 2G0EA 3HL2A 4IHYA 3FZVA 2NOGA 1A35A 2IW5A 2RKHA 2VJJA 4NC7A 1B8IA 1W0UA 3PIPF 3WE2A 1SD5A 1YE9A 4A3KJ 3OYHA 1HSTA 1QVUA 4UB6C 1BC7C 2VLAA 1G3WA 2FBKA 3ABMH 1R4MB 3GVAA 3COAC 2V1NA 3RYPA 1XSXA 2FQ4A 3ZGKA 3NRVA 4QSHA 3SHFA 3GZ5A 3FMRA 3LSGA 5ICCA 1H0MA 4HEA2 5F0CA 1XB4A 2WA0A 4CA0A 2A5WA 2NRAC 1MBJA 1FT9A 3MKLA 3IL2A 5H6RA 1R1TA 4GXOA 2Y9ZA 1WJ5A 2E1CA 1QZZA 3FXKA 4FCYA 5CVRA 4IRIA 4C3JJ 4DYQA 4R1HA 3WGGA 4A3EJ 1UELB 4JQFA 2BE5F 1Z05A 5JI6A 4WXHA 4JX6A 1IO2A 2ZMEC 5FO5A 4CZZA 3PSFA 4BH9A 1HKSA 3QYFA 3OSGA 2HVSA 1Z21A 3SJMA 1KU7A 3AL0C 1WFXA 5ILUA 2HTJA 3ZPLA 2OUMA 2Y75A 1YJ9I 1XSVA 3CLQA 2Y69H 4Z6YA 4EJVA 4BKXA 4XOTA 3VWBA 5BS6A 2BYVE 3T8TA 3OYLA 1BL0A 4WK8F 2EJRA 1GXPA 4HDUA 3K7AJ 4W97A 1LJ9A 3F9KA 3P5JA 4XK4A 1F5TA 3IAM2 3GCMA 4B48A 3WTYC 5K5OA 2LY2A 3RZDJ 3IHUA 2IP2A 4RA2A 5FRMA 2RN7A 1A6IA 2NVTJ 2R7XA 2K4BA 3VPRA 2FMYA 2CV2A 1VQOI 5M3FJ 3RQ4A 2R7WA 5HLHA 5EEHA 3DU5A 2O61A 1R1UA 5LHGA 1NG6A 1Z77A 1JUMA 4GYIA 1ETXA 4KT5C 2JA5J 1G8XA 4NUBA 3UR3C 3FMSA 4A0ZA 3R60A 3RPQA 1FMWA 4HSTA 2BV6A 4N0BA 4A0YA 4EV0A 3DPTA 1IN4A 5IT9Z 5HVQC 1R00A 2FE3A 3EETA 5FD6A 2FNAA 4BYYA 5B1AH 3PFYA 1K6YA 3T0YA 2DQLA 2AS5F 3T5XA 3VYSB 2PMZA 2NNYA 2L54A 1T2KA 3E5QA 2XC7A 3AKZA 5CKTA 1YW7A 1MMNA 3FXLA 3I58A 2QLZA 4YFXF 3OYBA 1IUYA 1LUJB 3J80K 5DYMA 3LSRA 2XVCA 2C6YA 5ICEA 3K2ZA 3TL4X 2IBDA 3JRAA 1VZ0A 5J4YA 3F6VA 4E7HA 1RETA 4N4NB 2PMHA 1R5HA 1VQ6I 2P5KA 3A01A 4XRFA 3I4MJ 2Q1ZB 3HB9A 3MAJA 1YITI 4EJWA 1L0OC 3DWLE 4LD5A 3P9IA 3OY9A 4IVNA 2Q8KA 1DPRA 5CVUA 2L5QA 4EEFG 3LOCA 4XQFA 1ZLJA 4CCOA 4CO8A 1LDJA 2KDOA 2Q0OA 3KP7A 5FKKA 1IGNA 5B5EC 1FOKA 2RVCA 2K9MA 2KLOA 2DPDA 1S5LC 2GBYA 2QCOA 1FMVA 1NTCA 2HYFA 3HPHA 2FBHA 4HNVA 1U8BA 3TW6A 4C2MJ 4ESBA 4L5IA 5CVVA 3RDIA 2V4JC 3FHZA 2QSHX 4OIOF 4AIHA 2HOSA 2PI0A 3V7CA 2BXYA 1ZKGA 1J0RA 1D1CA 1OMIA 3H9QA 2M4KA 1SAXA 4MQ9F 5E79C 4CYCB 1LFPA 3ELKA 4AIKA 2V6EA 1WZ2A 2Y9YA 5DEQA 4RB0A 1AU7A 3CC2I 4FT8A 3K4NA 3WU1B 2IGNA 2MBFA 2VI6A 2W48A 4MGRA 3VYRB 2EINH 3I56I 1VQ5I 1FZPB 1KONA 3E1SA 4MFEA 2F4IA 1LKXA 3BP8A 3GZ6A 1FYKA 5GAGJ 2VQLA 4EJUA 2DA5A 5IYCJ 1KU3A 5EDNA 3JTGA 3S2WA 2JA7J 3E5XA 1FIAA 2L0KA 5DD8A 1TW3A 1D5VA 2M45A 2XF7A 4I6ZA 3F23A 2M0MA 4L9NA 4BE1A 3ZXSA 3FIWA 2OAZA 1TWFJ 3HOUJ 1BM9A 1KU9A 4HSRA 2K86A 4NNJA 1H9GA 5GAHJ 3JRHA 5LEKA 1MZBA 4CICA 3KYDB 3L09A 3ZN0A 2K9LA 4CZCA 1QZYA 3FBIB 4IX7A 3LWFA 5BPIA 2A69F 4WXDA 4HLXA 2X1DA 1L3LA 1ETVA 5KK1A 2GA1A 5FB2A 1RR8C 4KYWA 4CCMA 1YLFA 4FQGA 3IKTA 3HIFA 2O3FA 4GRIA 2MD0A 5FRNA 2DO7A 2ECCA 4B09A 3HRUA 1SMYF 5A2QK 1BI3A 3AFHA 1UJ8A 2DFFA 2JUGA 1X19A 2FQ3A 2G9WA 2W7NA 3CTAA 3BWGA 2QM3A 3WG9A 3AG2H 4HBLA 1UFMA 4AD9A 1CF7A 5TRDA 4OMZA 3BG5A 2LF7A 2DLLA 1UB9A 1U5TA 1PVEA 2PN6A 4RB2C 2BZTA 2H8WA 3ZQFA 3ESWB 1U5TB 3LA3A 5F27A 2VQGA 2W24A 3BJOA 5J1YA 2ZKZA 3JR9A 1R22A 4LIVA 3HRTA 1JT6A 1S9HA 1IRZA 3VOEA 2MH2A 5HNFA 5EGOB 1G3YA 2DA4A 3KE2A 1DUXC 3AG3H 3LA7A 3Q0UA 2QZ8A 3GFIA 3JREA 2KPMA 3M7GA 1WI9A 1S29A 4XORA 1ZAOA 1RR7A 2W82A 5J47A 3S16J 2H94A 1I3AA 1K61A 1J59A 4PZJA 4XSZF 2VJ5A 5J8CA 3GTMJ 1ERDA 2QSFX 3GFMA 2QQAA 3BY6A 2R7DA 1DU6A 2DAOA 1EF4A 3KEQA 1BIBA 4OIRF 4L18B 4UUTA 2ZJPF 1TT5B 1ORKA 1TLHB 5E8IA 2BW3B 1X1BA 4L5JA 1EH7A 1AOYA 3ONQA 2RNGA 2JPCA 3HGGA 1ZN2A 3GO5A 1DPUA 2JPBA 5EJCA 2EZIA 3GTLJ 4AU7A 4P9FA 2IA2A 4II2A 4BHPA 2O7OA 1R58A 2H6BA 1R49A 1FX7A 4EQQA 1ZQ3P 1MBGA 1B72B 2EPFA 5CVIA 1MJAA 3K1NA 3JTHA 3MFKA 4AM3A 3W2AA 1KA8A 3KZZA 4PDKA 3GXOA 2E7XA 3HHGA 2J5PA 2OJED 2DT7B 4Y33A 1T33A 1X4OA 2V79A 4IF4A 1BOBA 2CYYA 1G3SA 2F5DA 4AYBN 3DQVC 2R7OA 3CD6I 2LNBA 2IPQX 4LG0A 4FX0A 1OCCH 3BLYA 4OU0A 2WB1A 1MJBA 1D1AA 3DU6A 3LA2A 1Z91A 4HZFA 5JLXA 2PBIA 3WG7H 1R71A 3K4KA 3ML6A 3L2VA 2RDPA 1Z6TA 5LGNA 3LNQA 1Y6IA 4YIIA 1OCTC 1Z7LA 4Q4ZF 2L7KA 2QWWA 4BQAA 4PK4A 5EF6A 4LLLA 3AG1H 2FX0A 2R7UA 3C2HA 2HPMA 5IP6A 2TRTA 4G12A 5E3NA 2VBZA 4U0YA 1LPQA 2IGKA 2DMTA 2NAZA 5FFXA 1O7LA 1V5GA 2QUFA 3UNGC 3WTZA 3TP3A 3SFIA 4WCGA 1OKRA 4HA8A 1ZHFA 5E1XA 2LTPA 4LGWA 4P55A 4EGZA 3OWTA 3DTKA 4NB5A 1H88C 2VQHA 3QQAA 3S14J 3MKWB 1S72I 5J6XA 1MBEA 1PP7U 1ZG3A 2LVSA 3FM3A 2GIZA 1F9NA 3G73A 1N77A 5HLIA 2BOLA 2VASA 2MSYA 2RQPA 3M9AA 1STZA 2CU7A 5E18F 2E2HJ 1HDDC 3K4BA 4HNTA 2JRTA 4D5CA 2STWA 3K4JA 2AQFA 3WGHA 4RAGA 3DBLB 1YRNB 4ZZLA 1ZG5A 1TQPA 4A3CJ 3MMYB 1J09A 2A6EF 2YUSA 4I7HA 4YIFA 5K7HA 3W6KB 1TWCJ 3Q9VA 3ZMVA 5K7ZA 5L3EA 1R5GA 4ESFA 3UKGA 4A3BJ 3W2VA 2ZBKA 4CUGA 3KYCB 3HKZA 3E5UA 3FK6A 2BVMA 1K79A 3E6BA 1AKHB 5F0FA 2K5CA 4H4KC 4U87A 2DW4A 4BE0A 2B0LA 1G3TA 4O3MA 5FKNA 3JSOA 4S0HB 3KEYA 3TKYA 1AKHA 1X3UA 1R23A 2Z99A 1WSUA 3CCEI 3LSPA 1O7FA 1LVAA 4QPQA 5DUKA 4RGUA 2AO9A 2KDZA 3BR6A 3I71A 2BXZA 1RUNA 4RDUA 1XGOA 4NHJA 1WJEA 4GYGA 5J3LA 2M8EA 4ENKA 2K9SA 2EZHA 1XGNA 2MW8A 1O57A 2E1MB 3H36A 3DV8A 4A6EA 3CMEI 2GIVA 3PUFA 4ZYDA 4HX8A 5HDKA 5EG0A 5IYBJ 4DYRA 2RQQA 4DQ2A 3L2WA 1V54H 2ZXJA 4OAYA 1JJ6C 1FOYA 5D8KB 4M6VA 3HGYA 4U0WA 2DXIA 3HRMA 2DA2A 2CMPA 3CMYA 1JTXA 4BAYA 2F48A 4E4HA 1OYIA 3X2QH 5IP9J 5LGUA 4ZH4F 2E7WA 2VPRA 2DPUA 3OSFA 1UG2A 1VQ8I 2HZTA 1KYWA 3HEFA 1Z0XA 2HI3A 4G9YA 2IA0A 1CQTA 1WGXA 2QYOA 2D1VA 5EZHA 3TDUC 3IV5A 2FA5A 3M1EA 3GWZA 1FLIA 2FEZA 3HUGB 1JUSA 5FROA 5FKLA 1W7PA 4BBSJ 4QIWN 1BI1A 2A68F 1XGMA 1SVLA 4U0VA 1QO0D 4ZC3A 1Y1WJ 1E3HA 1VF9A 1X1PA 3QODA 1ZTRA 3S2HJ 2O0YA 4RM2A 4Q48A 3C2BA 1YOVB 2P4WA 1VQ4I 4Y3OA 1WJCA 1MMAA 3VFZA 1T08B 2P0WA 1MDMA 1ZREA 3J7ZI 1T95A 1N75A 2H1KA 4LFUA 3LL7A 4ENNA 5M3MJ 3DKYA 2L4AA 1WJFA 2P5VA 3GBGA 4Y17A 2VXDA 5B1BH 3M4OJ 2ESHA 4Y4RA 2DJIA 2WY7Q 2ZJ2A 4XLCA 4DOZA 3ZN1A 4QTRA 1D1BA 5FGMA 2COMA 4XM3A 1HCRA 5F1RA 1R4NB 4U7DA 1HKQA 2CW7A 2LKXA 2IS1A 5BMZA 2M7AA 1TT0A 1OYWA 2VOPA 2CV1A 4EATA 2DT5A 3OOUA 5GPAA 1B9MA 1MMGA 1SEUA 3ZR8X 3W2WA 2XAQA 4N9IA 2EH3A 1IXRC 3F8CA 3TGNA 3E7LA 2Z33A 2Y30A 4RB1A 2VJIA 1WH5A 4IO9F 3IP4B 1YRNA 3MCZA 3QWLA 3O3KA 4IZZA 1S6LA 5K7FA 5KAFC 2X48A 1FSHA 4KN7X 4XRMA 5JR3A 1WJDA 1U3EM 3GFJA 3K1MA 2N8GA 2BGCA 4KIBA 4KFCA 1SFXA 1XTAA 1MMSA 1VQ9I 2NVYJ 2K27A 3OYJA 4D7NA 4AWXB 1BJAA 1V5EA 4UUSA 5ERIA 2CRGA 3VSKA 4RS8A 1YS7A 2KP6A 3PJRA 2FUG2 2XGXA 3TO9A 4E7JA 5BNGA 4EM1A 3MVPA 3JCUC 5B3SH 1MH4A 4S05A 2LK2A 3KLNA 3OYDA 3RKYA 2HOAA 4Y13A 4XIDA 3HDDA 4XBFA 3I53A 2OTJI 3E97A 1X2NA 4A5MA 3OYNA 1SFOJ 4ZDPA 2Y48A 3BR2A 3OYAA 1Y56A 3K0LA 4IHXA 3PNYA 4F52A 2IS2A 1R1VA 3DXJF 1BN5A 5HNHA 3JRCA 4M3BA 2M30A 2CQKA 2RV8A 3BR3A 4PGGA 1T0FA 2A6TA 3G3ZA 2F5VA 3H9GA 4AYBA 2FU4A 2DA6A 3K4LA 3KETA 1IJWC 3SDGA 2FOKA 1TW2A 2E71A 1QPMA 1OPCA 4B43A 1P4XA 3WTTC 2W00A 3MEXA 1TNTA 5D4SA 1A5JA 2EFPA 3D0SA 3DEUA 4P5OA 2CW0F 4J01A 1X4PA 3QU6A 4BACA 1MMDA 3CCJI 3L7WA 3W6JB 5EZGA 3GTQJ 2X4HA 3DKWA 2NS7A 4FE4A 5HLTA 4ZDLA 3T8RA 3VYUB 4PJ0C 2YU3A 2ECBA 1G2HA 2DFEA 4EVIA 1ZYRF 1JKPC 1OYYA 3KYLA 1NHAA 1O3RA 2PJPA 3G71I 1YYVA 3J7AY 3QPSA 2EZKA 2XGCA 5JVTA 1XG1A 5M5YJ 3JRFA 3GYHX 3OYIA 2DQRA 1MKMA 5FJ8J 2F5FA 2F6CA 3D1NI 1IN8A 4D0PA 1LE8A 3HSEA 2EA4A 5LRSA 1H89C 1QGPA 3I55I 4BS9A 1MW7A 1LE8B 3QPTA 3J81Z 3KP3A 1VQNI 2I10A 2E2IJ 4BQQA 4C2UA 5IOZA 4CDGA 3BTCA 4KA4A 3AL0B 4E70A 1FC3A 2HGCA 3BCAA 2E5NA 1VI0A 1P9QC 1X3ZB 4PJMA 4FE7A 4Q47A 1I3QJ 3CUOA 2GXBA 3ZQCA 2LD5A 2O8XA 1JTYA 2FRHA 5KVRA 3BTLA 4A93J 1B4AA 1YG2A 3DFGA 3ASOH 1P7JA 2IA1A 2VBXA 4YRVA 1UMQA 2L7FP 3HOSA 2ICWG 4OWRB 1IV6A 3FXRA 2FNPA 5IT3A 4JX5A 2M87A 4HRIA 4BUPA 1E3OC 3AG4H 2I5UA 1U9NA 1MGTA 3BJ6A 4R79A 1W4MA 3GF2A 4UVBA 2R7ZJ 2XPWA 1GDTA 3V8LA 3ZCOA 2XGDA 2WAFA 2BVLA 4UHTA 4M3FA 3V7RA 2IAIA 2V7FA 1GVDA 1XCBA 2VKDA 2R0QC 2KMUA 3G1OA 4RM3A 2IS6A 3L9FA 4YIRX 1G59A 4XN0A 1MIJA 1JHHA 3IRRA 4XOPA 4NQWB 2VPLA 1ETOA 2X6OA 3N05A 4MHGA 1U8RA 4IHWA 4DGWB 3HTUA 2GOXB 5HDNA 1HA8A 3CUQA 3I59B 3V8KA 2L9SA 4CYDA 3I4NJ 1U9OA 1PYVA 2EFNA 1OCRH 1ETWA 4IXAA 3A2KA 4DZJA 2LP0A 1U5TC 1DU0A 2DDAA 4P9UA 5GAEJ 2OCCH 2YSRA 2OV7A 3KZYA 3IWZA 1Z1DA 2WV0A 3CJRB 3ZMUA 2ZXIA 2HVRA 3H5NA 3IH2A 1HF0A 1IRFA 4FASD 4ZTFA 1HKTA 2XF6A 3BQZA 2NS8A 1R9TJ 1BR4A 4HF2A 3HHHA 2W85A 4IL6C 5DUIA 2L7ZA 4UVAA 3H35A 4XSXF 2ISZA 2LDUA 3MWMA 4IEJA 3TOBA 2WTEA 1IAWA 1DP3A 1XMKA 5LFAA 2JK3A 1W1WE 2EIMH 3KEOA 2Z5UA 2E34A 4Y7NJ 4BXXJ 1GLNA 4G6DA 2Z9OA 4I01A 3C18A 2R7SA 1B1BA 4A3DJ 4LMYA 2JSCA 1Z3YA 1A04A 2XAHA 1X58A 1ODDA 4FTHA 2HXIA 4XRSA 5ICFA 4A3MJ 1MJ9A 2DCEA 3FF5A 3BG3A 5C4JJ 4EMSA 3CC4I 2E36A 4KICA 4M9ZA 2EFQA 4GCVA 3K10A 3TOAA 1ZELA 2FSWA 1POGA 1E0EA 1I5ZA 2ZNZA 4IKFA 2NVXJ 4KIGA 2W57A 1SMTA 4JK1X 2L7MP 1V5FA 1I1SA 4PCQA 2ZFUA 5F64A 1S7OA 3HOZJ 4QLCU 3I9V2 2DBBA 4BHCA 1ZRDA 4F92B 1EV7A 2ZSHB 3PSIA 1MDMB 3DKXA 2GXAA 1Y8RB 2OC6A 3K2AA 4HF1A 3HOVJ 3GX4X 1RPWA 1T38A 3BZKA 2YX4A 3HPGA 2JVGA 3HBLA 4KT6A 2ZMEA 4KIFA 2VE9A 2MABA 4G6TB 2HKXA 1PUFB 2O5RA 4RMNA 2X6YA 3ABLH 1BJZA 4RLFA 3DF8A 1OCOH 1OLTA 2XROA 5HS8A 5E3LA 3CO6C 4A6DA 2X6XA 2W25A 2ZXWH 3SFZA 5IOYA 2MH9A 1WPKA 4H0EA 3BJAA 5M5WJ 2LREA 5K5RA 5L3DA 4F3QA 4OIPF 2LSOA 4HQMA 1SVMA 1EKEA 3LSJA 4OIQF 1IC8A 2KISA 4E7LA 2HYJA 1KQ0A 4E6KG 2LKPA 1LNWA 2MGQA 2X9DA 3R0AA 3HTSB 1VNDA 2XAGA 5E17F 2R3SA 3QOPA 3HJEA 3EUHC 3LMMA 3S3MA 1Z6RA 1T39A 1BI0A 3I4PA 3SQNA 1RC9A 2QQ8A 3F8BA 4C3IJ 2P5LC 2HFHA 3IWFA 3Q0VA 3HOTA 3N4MA 5IY5H 4B47A 1LB2A 1VQKI 1O3TA 2E2JJ 2AXLA 3E6CC 4I0AA 4KITB 2VONA 2AHQA 3EUAA 3G1MA 1T56A 2EBIA 3JW4A 5J40A 4RAYA 1C0WA 2PX9A 3OIPA 2DTRA 2F5EA 3D5SC 1DP7P 3OS1A 4HYEA 4DJAA 4FHTA 2K9NA 3CC7I 4U7BA 3BR1A 5BPDA 2V6CA 4M3GA 4IRHA 4HX7A 4M73A 3S3OA 1ON1A 3PL8A 2G7HA 2IRFG 3CESA 1WH7A 3LSIA 3QPHA 3ZP5A 5GP9A 3WTSC 4MEXF 3S15J 1FSEA 1J7KA 3WU0A 2CS3A 2CQNA 3G6EI 4U88A 1JI8A 3WTUC 5M5XJ 3I54A 1IUFA 2M2EA 4PJJA 4XL9A 5E3MA 1QPIA 3ECHA 2E60A 1YW8A 3S1QJ 2LMDA 2GXGA 1S7AA 2WADA 3ZQ7A 2HQRA 3A0HC 4XLFA 2NS0A 4FISA 5CVJA 1DGWY 1XCVA 2R92J 5L3BA 6PAXA 1BA5A 1SFKA 2CQXA 1WI3A 2PJRB 3IH4A 1U2WA 2XF5A 2BW3A 1HC8A 2CFXA 4A69C 3GW2A 3RIRA 1MBFA 3FXOA 2P7VB 2F5CA 3H3ZA 4XR6A 2O6GE 3CUQB 4F93B 2R7TA 5LEJA 3L2QA 1W5TA 2OA4A 4LLNA 2PEXA 4QWQA 3GTJJ 2HQ5A 3QU3A 2TDXA 4BQOA 1IXSB 4PSWA 4XLNF 3C3WA 1HQCA 3S1NJ 1ETKA 5BOXA 4BXUA 4G6QA 2VODA 4JYKA 4KJZA 2V9VA 2GLOA 2DA1A 3IC7A 5DCMB 2XSDC 5CPRB 2QENA 1ZRCA 4UVCA 4NQWA 1O4XA 4I09A 2XPUA 4XLPF 3FX3A 5CQGA 5J8FA 4R8HA 2Q2EA 4EM2A 3F72A 3EDPA 4XKCA 2GQQA 4RBOA 1IXCA 2DK5A 3EYYA 5EEGA 3NARA 3ZQHA 3HC7A 5DD4A 4DBQA 2P81A 1ZH5A 5JLWA 3CCMI 3E3VA 4G8XA 1R6RA 2YU9J 4XONA 4GFBA 2ZCWA 2BY3A 4UUVA 3F8MA 3RKXA 5JFRA 1XSDA 2PFBA 3CMAI 1PUEE 3K4CA 2R5YA 2A07F 1GV2A 3MZ8A 1D0XA 5D6FA 2RGVA 3Q0WA 3MN2A 4MIMA 2B63J 4PJLA 4D5FA 1RKTA 5GTIC 1HDPA 4LIUA 1NG7A 3FISA 4MO7A 4UNOA 5HS7A 2EZLA 1Y1VJ 2NVUB 3OL3A 2H1LA 2D45A 1A31A 1VQLI 1G6NA 3QRFF 2UWMA 2ZSIB 2MLKA 3Q3SA 2KIUA 2YX7A 1YW9A 2FD5A 1ON2A 1P6RA 5D5VB 1FJLA 1MSFC 2E5ZA 2XKPA 1W5CC 3IH3A 4KISA 1N78A 5D4RA 2XRLA 3VODA 2TCTA 2HDDA 5ILSA 2L01A 3TBIA 1W36D 2KZGA 1VQMI 2R7VA 3ZMSA 4NC8A 5ED4A 2QKMB 3WTXC 4BXFA 1ZLKA 4BNCA 3KZIC 2LH9A 5DTDA 4V19K 1CGPA 2WAQN 4WXCA 1I39A 2K9QA 2DFHA 3IRQA 2IVMA 3RPUD 2MA3A 2OBPA 3M8EA 1I50J 2CJJA 2HVQA 4RAZA 4GDFA 4YEJA 3MD2A 3WHCA 2R7QA 4BGDA 2VOOA 3U21A 1Y8QB 1SD6A 2DYSH 1FYLA 3GUDA 4UV9A 4LG0B 3HKZN 4MTDA 4BJ6C 4WWCA 2D1HA 3RPUA 2XB5A 3E6MA 1B9NA 3BZCA 2R5ZB 4RLQA 3BPXA 2YPRA 3P7NA 4RGSA 4F55A 2FMLA 2LC2A 2ZNYA 1FOWA 1REPC 2BY2A 1F43A 5GTHC 4PGHA 3J81K 4D1QA 4S04A 1D8JA 4BY1J 5DM6F 4XNFA 2PLYA 3OS0A 2BEOA 4ZJZA 3RZOJ 3GFLA 2LY1A 3HYIA 3L1PA 1YJWI 1PJRA 1T0FC 4GGGA 1RIOH 1YX3A 1AHDP 2EILH 4XRSG 4XMYA 2XGEA 1QU3A 3OYGA 3ABUA 3MZYA 1ETYA 5HDGA 3RKQA 4LLGF 2IJLA 1W5SA 4HG2A 1ULYA 3GMEA 3LSHA 2RREA 4M6XA 1YX5A 5AONA 1MSEC 3R6SA 1WRJA 3CCLI 3B73A 3KLOA 1USTA 2Y2ZA 1G4DA 3W3CA 3HG9A 3M8JA 4C9YA 2KIQA 3WTVC 3CCVI 4L0ZB 2KL4A 3RTRA 3Q5FA 3JAMZ 2DU9A 1FIPA 3BTJA 2O03A 2HKOA 4NDLA 4IRGA 3JSPA 4HOBA 2CH0A 2V1XA 1FBQA 4UV8A 4M3DA 4HAMA 3RI4A 1J9IA 2ISYA 3H0GJ 2EIKH 1GT0C 1RESA 1NK3P 4N9HA 3EUHA 4LK1F 4W1UA 5IP7J 4ZYGA 4B4CA 1MH3A 4L5EA 1BI2A 3PO2J 5C4XJ 1SC7A 4DW6A 4P1WA 4UUSB 1LFBA 2K02A 3OIQA 2R5YB 3ZMZA 2W4SA 2QBYB 1EH8A 2W1OA 1JKOC 2XAUA 2DFIA 1TBXA 4AUXA 2F4MB 1HW1A 4AVZA 4EGYA 2VKVA 2M5WA 2X1EA 2P7CB 4PFOA 2NYXA 4ANJA 4G7ZF 1DQUA 2XASA 3KPHA 1X2MA 1RRJA 2M9HA 2DODA 2VBYA 2ZFWA 1QVTA 2M0CA 2M4GA 3CDHA 4ZDOA 2KKOA 2JJ7A 2QQBA 5J4VA 2HR3A 2I8DA 3BC8A 2KZVA 3HUGA 5CLSA 3N97A 2ZJQF 1TC3C 1W7PB 4O5VA 3RCOA 4D9JA 3CJNA 1J2XA 2KHMA 3BR0A 1ACIA 4B3AA 2BHZA 2KJCA 4B1RA 1UHMA 3GTKJ 1FPQA 4B44A 4RGXA 3S3NA 1TWGJ 2A3SA 2VJ4A 1KYZA 2X51A 4IPAA 3OYCA 1QBJA 4LB5A 3NWTA 3ZMDA 1WKMA 3GEZA 1B59A 4M71A 1YI2I 4UXNA 3J7YJ 4X6AJ 2M3AA 3H92A 4N4OB 4ABZA 5H20A 3WODF 2DOAA 4QPOA 2XAFA 4BL0B 2EK5A 5IYDJ 3FDYA 3H0DA 2M8GX 2VXZA 4XKVA 2ZB9A 2ID6A 2UXNA 2PJRA 5IPAA 3F22A 4BDZA 5F0HA 1GHCA 1QRYA 3CMMA 4CCKA 1WHUA 3CF2A 4NBQA 4AVPA 4ETSA 1WJBA 5CJ9A 5DCMA 2DDBA 1IW7F 1JGSA 3FKIJ 4ESJA 1UG0A 3E6DA 1QNTA 3IAS2 1P7IA 5B66C 3LSMA 3GTGJ 3PUBA 4I98B 1HW5A 1WWXA 4A3GJ 2LRDA 4IQ4A 2MD5A 3R0JA 4E7ZA 2L02A 2JN6A 2K85A 1A36A 2ZXHA 2JRMA 4F7ZA 1FTZA 2EB7A 4A2UA 2GAUA 3OYMA 2VT3A 2LF8A 5JVGF 2DMUA 1MD0A 4J00A 1XDUA 4ZYHA 3A01B 2GM4A 3S2DJ 3FXUA 4E7KA 2VE8A 5HS9A 1ZK8A 2MC4A 1SD4A 2LLKA 1BR1A 3PQKA 4KUMA 2VC0A 4L0YB 3DLLF 2ELJA 4DIQA 3KX2A 2UXXA 3KP6A 4KDPA 2DMNA 4A3JJ 3CUQC 5FLXZ 3OYEA 3KFWX 1TP4A 4TV7A 3D5RC 3MZHA 3O8HA 3F6OA 2LFBA 2D2WA 5D6EA 2IT0A 2UUZA 4I2OA 4IHTA 2DT6A 3CZ6A 3KP4A 3A1YA 4HPQA 1XN7A 2H8RA 2R93J 1EJ9A 1P2FA 2HZDA 2XB0X 5JHFA 1ZG1A 5TGTA 3SEQA 1D0ZA 1MNDA 2OZ6A 4CXFA 4CHUA 3ABKH 1IN5A 5LHIA 3BOQA 2M34A 3A4CA 3OL4A 2ADUA 2Z1DA 1KU2A 2ME6A 1GV5A 1S8NA 4V2FA 3CCQI 3DPUA 2QQ9A 1U6GA 5GADJ 1Q1HA 3L00A 2WBMA 4KMUX 3H5AA 5A2QZ 1FNNA 3J80Z 2VKEA 3LAJA 1X1DA 2AQEA 2KJBA 3WHBA 3CCUI 1YIJI 2R4GA 2DN0A 2CUZA 3R4KA 2DOFA 3HXLA 3PM1A 3T1BA 2M1BA 2VBWA 5FLMJ 5FLVA 1BW5A 5EYRA 1R5ID 3IUOA 3LSKA 1K83J 3BG6A 2K4JA 2L3DA 3E0JB 1GXQA 3JRDA 1A6QA 2CWEA 2X85A 3F0CA 2OQRA 4RB3C 2IXSA 3G1LA 2A05A 4I02A 3A02A 2EV6A 1LVKA 1FBSA 2V26A 3VYTB 4IHVA 1D5YA 2BY0A 2QKLB 4Y52J 1QA6A 3VB2A 2DA7A 2DI3A 4M72A 3KIOA 4HV6A 3FM5A 4D7MA 3DCFA 1JE8A 1BR2A 2IS4A 3CJQB 1WCMJ 2F2EA 2UV1A 1TQMA 2DYRH 4XN3A 4CCJA 3RJPA 5HLGA 3ZQIA 3DEWA 5CYVA 4M9XA 4B3XA 5AIQA 1K78B 1FTTA 3MQ0A 3QOEA 3H5RA 1OR7A 3NQOA 4EJTA 5TJJA 4X1EA 4KNYA 3CP8A 3M3YJ 1QZEA 1B72A 1T6SA 2OU2A 3DLAA 3ROUA 2HDCA 3LFKA 2MG4A 3CF5F 1HW2A 2KT0A 2CUJA 5LRRA 2DMQA 1ETQA 1UHWA 1V55H 2PMZN 4BJTA 1HBXG 4MTEA 1IG7A 1HXDA 2FF4A 1QHGA 3M1CA 2NVQJ 1Z67A 3HZJA 2EQRA 2Y0MA 3OMYA 1TQIA 4JP0A 3BR5A 3H1CA 1EA3A 1M1EB 3OOPA 3CQZJ 5D5XB 2HEOA 1SFUA 2DJNA 3HOWJ 3S17J 1P4AA 4BY7J 1OFCX 2QBYA 4YFKF 1T8IA 3JAMK 3PO3J 5C3EJ 3M8FA 3LQQA 1IDZA 1PP8F 3HM5A 1W7PD 1MBHA 2XRNA 5K5QA 1BW6A 2QA4I 2HXOA 2P6TA 2YR2A 3BTIA 4HLYA 2PG4A 5F08A 2UZKA 1FP2A 1JT0A 1F4KA 3CCYA 2K3PA 2HOTA 3S1MJ 4ON0A 2EWNA 1ONVA 4DNCA 2MYSA 3C7JA 1CF7B 1QHHD 3VDXA 3BPVA 3P9CA 2GWRA 3TP0A 3QP6A 3G4SI 2EA2A 3HOYJ 1Z7UA 2CSOA 2RNJA 5E1ZB 2KRCA 2HU9A 2E1MC 3OYKA 3S93A 3BCBA 1T98A 5H2FC 4IOCF 2QGUA 3C2GA 3G2BA 2OZUA 1E17A 2DOEA 2H6CA 4M9SA 1J75A 2E1OA 4MNUA 4I0BA 5K1YA 1XC5A 1D0YA 2XKOA 4WF2A 3CP2A 4LG3A 3SEZA 1IN6A 2OD5A 2WC2A 5DDGA 3WGIA 2EFOA 2GOMA 2HPIA 3I64A 2ESNA 3EUKL 3H3UA 3BQYA 3A0BC 3ECOA 1MNMC 4BDYA 5ILVA 4HF0A 5EEAA 3Q9SA 3S8PA 3K70D 1V3FA 4FX4A 4BBRJ 1K4SA 1W0TA 1TNSA 2CQQA 3V7SA 4M74A 1D3YA 3FK7A 1YTYA 5LHHA 2L9VA 4I99C 3F3XA 2D5VA 2XAJA 5KNLA 5L3GA 4PSXA 1TWAJ 1OR7C 2O9LA 1H9TA 2LY9A 3TMOA 1E2XA 1S7EA 4BEHA 5F6FA 2XPVA 4DBRA 1I27A 1HSJA 4MLOA 1RI7A 4ZYEA 1J5YA 2E19A 1WQ2A 5TISC 1JJ8C 3FXJA 1SANA 2QF7A 2K40A 5E3OA 4P96A 9ANTA 3TO6A 1XDSA 2IGMA 2JUCA 2P8TA 2VKHA 4DZPA 4BQNA 1LQ1A 5D5UB 1SFEA 3H9JA 5DS9A 1U78A 4XLEA 3JRBA 2KFDA 2MFZA 3PNTA 4A5NA 2CO5A 3PIOF 2FXAA 4JOMA 4BHBA 1X3WB 3WTWC 2H09A 1BOAA 3PQJA 5HOOA 2LKSA 5J1RA 2OTLI 4HDVA 3OV8A 1HLVA 4JBAA 1K7AA 5EG0B 3OIOA 3LSTA 2R7RA 4V2GA 2A6HF 5DV5A 2ETHA 2DMPA 1AWCA 2JVHA 1P92A 4Z2YA 2G7UA 1KQ9A 4AIDA 4LITA 3DTIA 1RKWA 2LR8A 1YJNI 3HRSA 4MQVA 1TZLA 3DBHB 3CCSI 1UCRA 2V1DA 5F04A 2ZO4A 1I1GA 1X1AA 1FYMA 3IKVA 1IRXA 1YHQI 5FLXK 1NK2P 2CQ7A 3BZ6A 2NOJB 3VEPA 2DK8A 4PFPA 2Z3YA 1D8KA 2JA2A 1TL8A 4M3EA 3K4MA 3CJTB 3K69A 2JT1A 5E20A 1SD7A 1RZ4A 2QSGX 4A12A 4BU2A 4C30A 2HS5A 3NEUA 2IGOA 3NAUA 3ZQQA 3ERED 1XPXA 3GLLA 5E8GA 1IZ1A 2EIJH 2H27A 2HDWA 1XGSA 1Z9CA 4E7IA 2WB1N 1LFUP 4IHSA 2Y0SN 5KHDA 1PUFA 1S3JA 2BHYA 2HQNA 2VUMJ 1SAUA 1ZGAA 1IV8A 3GTPJ 1OCZH 3HSRA 4OAZA 5KCMA 1H8AC 5JHUA 4KMFA 2FJ1A 4HQEA 3RKWA 2VQCA 1N25A 3O8GA 3MKZA 3U2RA 1OJLA 3CDIA 2FOWA 2YS9A 1W36C 2LYCA 1B6AA 2VIXA 1JGGA 3ISPA 1ITYA 4HNUA 2J5OA 1O3SA 2QEXI 4Q5SF 3MKYB 4YG2F 3OS2A 4L9JA 3BG9A 3RQIA 3S32A 1JXSA 3CDLA 3DPLC 2NXNB 2CFOA 2ME0A 3BG7A 2CUEA 3QP5A 1APLC 2A61A 4A3FJ 3ASNH 3ABTA 3TEDA 2XV4S 4YELA 1K6OA 3VSLA 1ZGWA 2DTZA 3FHNA 2XUBA 4BEHB 1BC8C 1OCPA 3WU2C 1FY7A 3C1DA 4OINF 1ENHA 4O6JA 2B7EA 4ENMA 2EFWA 2IEKA 3JRIA 3HSFA 2ZC2A 2OF7A 2MC3A 1FWZA 3F21A 2EV0A 1IF1A 1RNLA 5LD2C 1KGSA 4DYCA 2LG4A 4GO1A 5LBQA 3DP7A 3LAPA 5DM7F 1DGRM 3U1KA 5FKOA 4UY8I 3J7AO 4IJAA 3F8NA 3K70C 4KN4X 5KAIC 3U1DA 1JHFA 5J1UA 4NC6A 4AIJA 1K78A 2CV0A 3H3VK 3I5UA 4C2TA 2AXTC 2ACJA 1AA7A 1BBYA 2KRFA 2R7FA 5L3FA 5E1WA 1F36A 3K6GA 1YFHA 1YO5C 2V9KA 3KP2A 4MFDA 4Y15A 3RYRA 1USSA 2STTA 2BBYA 2KIMA 1VTNC 4LK0F 3REOA 2P6SA 3SDBA 1TTYA 1UHSA 2MLGA 4JX4A 1XX5A 1Y0UA 2Y0SA 4CH7A 5C44J 4I76A 4G7HF 3V8JA 4XLAA 1JKRC 1B8IB 3K1PA 3I0TA 3PFIA 4ASNA 3B6CA 1LEBA 1O3QA 3BT9A 1PDNC 3OYFA 2XHKA 2V9PA 4ZZDA 2JSPA 3TW7A 3U9GA 4AC0A 2HNHA 5BQTA 3L2UA 2RC4A 3F8FA 2VC1A 2VL8A 2KIFA 4OMYA 1NH3A 2JWTA 2RAEA 4M6YA 3ZMTA 2JQ7A 1XMXA 3ZRGA 3A03A 1JUPA 1IRGA 2OCEA 4ITVA 3EQLF 3QYEA 3ZOBA 3ZQLA 3S1RJ 5LLQA 5HODA 3O2PE 2X0LA 3QYBA 4ENJA 4BJ5C 3SXYA
chains in the Genus database with same CATH topology
2HOEA 5ICGA 2WWYA 3BROA 1YIOA 5AIPA 3R61A 3V4GA 3SZTA 1YQAA 1IN7A 3FXQA 2XIGA 3TQNA 4A0XA 4G7OF 2HTSA 3SZPA 2CGPA 1ZARA 4B8XA 4HX4A 3TO7A 3ULQB 3LQRA 4LB6B 2NNNA 1V4RA 3GLXA 3KP5A 4L9VA 2CG4A 2E1NA 4EM0B 2VT2A 2W84A 3K9TA 1R7JA 3AAFA 4HW0A 2ZMEB 1I6XA 2JZYA 5DCFA 3BDDA 3L2CA 1XMAA 3WE3A 2GA2A 1FBUA 1P4WA 1ZGJA 5D5WB 1F1ZA 5L3CA 1DDNA 1KQ8A 1LDKB 2PQ8A 1R36A 3B02A 4G94A 3CLOA 3FMQA 3TDZC 5H6QA 3O6BB 2HWVA 1ZRFA 2A5YB 2QVOA 1YS6A 5D8LB 2GZWA 4HV5A 1GVJA 2K7LA 3D5LA 4MEYF 4LJZF 3KCCA 4OOIA 1RUOA 4L9TA 3P9KA 3CO7C 4WX9A 2L4MA 1LEAA 1BIAA 4CGZA 5IT9K 3I59A 2V1UA 1XD7A 4RGRA 4YFNF 3FWEA 3EYIA 3QAHA 1FP1D 4K2EA 5FFZA 2OQGA 2FBIA 2VN2A 5LGTA 1EH6A 4EJOA 2ELHA 2EV5A 1QQIA 5FD5A 2PMUA 2HYGD 1LDDA 2JTVA 3FZVA 2IW5A 2RKHA 3WE2A 1SD5A 1HSTA 1BC7C 1G3WA 2FBKA 3GVAA 3COAC 3RYPA 1XSXA 3NRVA 3SHFA 3GZ5A 3FMRA 5ICCA 1H0MA 1XB4A 2NRAC 1FT9A 3IL2A 5H6RA 1R1TA 4GXOA 2E1CA 1QZZA 5CVRA 4IRIA 4R1HA 3WGGA 4JQFA 2BE5F 1Z05A 5JI6A 4WXHA 5FO5A 4CZZA 4BH9A 1HKSA 1KU7A 5ILUA 2HTJA 3ZPLA 2Y75A 1XSVA 4EJVA 5BS6A 2BYVE 3T8TA 4WK8F 2EJRA 1GXPA 4HDUA 1LJ9A 1F5TA 3WTYC 5K5OA 3IHUA 2IP2A 2RN7A 2K4BA 2FMYA 5HLHA 5EEHA 2O61A 1R1UA 5LHGA 4GYIA 4KT5C 4A0ZA 3FMSA 3R60A 3RPQA 2BV6A 4N0BA 4A0YA 4EV0A 3DPTA 1IN4A 5IT9Z 5HVQC 1R00A 2FE3A 3EETA 5FD6A 2FNAA 4BYYA 3T0YA 2DQLA 2AS5F 3T5XA 2NNYA 1T2KA 2L54A 3E5QA 1YW7A 3I58A 2QLZA 4YFXF 1IUYA 3J80K 5DYMA 2XVCA 2C6YA 5ICEA 3K2ZA 3F6VA 2PMHA 1R5HA 2P5KA 4XRFA 3MAJA 4EJWA 1L0OC 4LD5A 3P9IA 4IVNA 2Q8KA 1DPRA 5CVUA 1ZLJA 4CO8A 1LDJA 2Q0OA 3KP7A 1FOKA 2RVCA 2DPDA 2HYFA 2FBHA 4ESBA 3FHZA 4L5IA 5CVVA 3RDIA 4OIOF 4AIHA 2PI0A 3V7CA 1J0RA 1OMIA 1SAXA 4MQ9F 3ELKA 4AIKA 5DEQA 4RB0A 4FT8A 3WU1B 2MBFA 4MGRA 1FZPB 1FYKA 3GZ6A 3BP8A 4EJUA 1KU3A 3JTGA 3S2WA 3E5XA 5DD8A 1TW3A 1D5VA 2M45A 3F23A 4L9NA 2OAZA 1BM9A 1KU9A 2K86A 1H9GA 5LEKA 1MZBA 4CICA 3L09A 3ZN0A 1QZYA 5BPIA 3LWFA 4WXDA 2A69F 4HLXA 1L3LA 5KK1A 2GA1A 5FB2A 4KYWA 1YLFA 3IKTA 3HIFA 2O3FA 2DO7A 4B09A 3HRUA 1SMYF 5A2QK 1BI3A 2FQ3A 2G9WA 3CTAA 2QM3A 3BWGA 3WG9A 4HBLA 1UFMA 4AD9A 1CF7A 5TRDA 4OMZA 2LF7A 2DLLA 1UB9A 1U5TA 2PN6A 4RB2C 1U5TB 3LA3A 2W24A 3BJOA 2ZKZA 1R22A 3HRTA 3VOEA 2MH2A 1G3YA 3KE2A 1DUXC 3LA7A 3GFIA 2QZ8A 3M7GA 1WI9A 1S29A 1ZAOA 2H94A 1J59A 4PZJA 4XSZF 5J8CA 3GFMA 2QQAA 3BY6A 2R7DA 2DAOA 3KEQA 1BIBA 4OIRF 4L18B 1TLHB 5E8IA 4L5JA 1EH7A 1AOYA 2JPCA 3GO5A 1ZN2A 1DPUA 2JPBA 4P9FA 2IA2A 4BHPA 1R58A 2H6BA 1FX7A 4EQQA 5CVIA 1MJAA 3K1NA 3JTHA 3MFKA 1KA8A 3KZZA 4PDKA 3GXOA 2E7XA 3HHGA 2J5PA 2V79A 4IF4A 2CYYA 2F5DA 1G3SA 3DQVC 2LNBA 2IPQX 4LG0A 4FX0A 4OU0A 1MJBA 3LA2A 1Z91A 4HZFA 2PBIA 3ML6A 2RDPA 1Z6TA 5LGNA 4YIIA 4Q4ZF 2QWWA 4BQAA 4LLLA 2VBZA 4U0YA 5FFXA 2NAZA 1O7LA 2QUFA 3WTZA 4WCGA 1OKRA 4HA8A 1ZHFA 5E1XA 4LGWA 4P55A 4EGZA 4NB5A 5J6XA 1PP7U 1ZG3A 3FM3A 1F9NA 3G73A 5HLIA 2RQPA 3M9AA 1STZA 5E18F 2JRTA 2STWA 3WGHA 4ZZLA 1ZG5A 1TQPA 2A6EF 4I7HA 4YIFA 3W6KB 3Q9VA 3ZMVA 5L3EA 1R5GA 4ESFA 2ZBKA 3E5UA 1K79A 3E6BA 2DW4A 2B0LA 1G3TA 4O3MA 3JSOA 3TKYA 1X3UA 1R23A 2Z99A 1WSUA 1O7FA 1LVAA 5DUKA 4RGUA 3I71A 1RUNA 1XGOA 4NHJA 4GYGA 2M8EA 4ENKA 1XGNA 1O57A 4A6EA 3DV8A 2GIVA 4ZYDA 4HX8A 5HDKA 4DQ2A 2ZXJA 5D8KB 4U0WA 3HRMA 4BAYA 1OYIA 5LGUA 4ZH4F 2E7WA 2DPUA 2HZTA 1KYWA 4G9YA 2IA0A 2QYOA 2D1VA 3TDUC 2FA5A 3M1EA 3GWZA 1FLIA 2FEZA 1W7PA 1BI1A 2A68F 1XGMA 4U0VA 1QO0D 2O0YA 4Q48A 2P4WA 3VFZA 1MDMA 1ZREA 4LFUA 4ENNA 2L4AA 2P5VA 4Y17A 2ESHA 2ZJ2A 3ZN1A 5FGMA 2COMA 5F1RA 4U7DA 1HKQA 5BMZA 1OYWA 2VOPA 2DT5A 1B9MA 2XAQA 4N9IA 1IXRC 3F8CA 3TGNA 2Z33A 4RB1A 3MCZA 3O3KA 1S6LA 1FSHA 4KN7X 5JR3A 1U3EM 3GFJA 3K1MA 2BGCA 4KIBA 4KFCA 1SFXA 2K27A 4AWXB 1BJAA 5ERIA 4RS8A 1YS7A 2XGXA 3TO9A 4EM1A 4S05A 3KLNA 3RKYA 4Y13A 4XBFA 3I53A 3E97A 4A5MA 2Y48A 3K0LA 1R1VA 3DXJF 1BN5A 2M30A 2CQKA 2RV8A 4PGGA 1T0FA 3G3ZA 2FU4A 3KETA 2FOKA 1TW2A 1QPMA 1OPCA 1P4XA 3WTTC 3MEXA 1TNTA 5D4SA 2EFPA 3D0SA 3DEUA 4P5OA 2CW0F 3QU6A 3L7WA 3W6JB 2X4HA 3DKWA 3T8RA 2YU3A 4EVIA 1ZYRF 1OYYA 1NHAA 1O3RA 2PJPA 1YYVA 5JVTA 3GYHX 2DQRA 1MKMA 2F5FA 1IN8A 4D0PA 3HSEA 2EA4A 5LRSA 1QGPA 3QPTA 3J81Z 3KP3A 4CDGA 4KA4A 4E70A 1FC3A 2HGCA 4Q47A 3CUOA 2GXBA 2O8XA 2FRHA 5KVRA 1B4AA 1YG2A 3DFGA 2IA1A 2VBXA 3HOSA 3FXRA 2FNPA 5IT3A 2M87A 1MGTA 3BJ6A 4R79A 1W4MA 3GF2A 4UVBA 3V8LA 4UHTA 3V7RA 1XCBA 3L9FA 3IRRA 1JHHA 1U8RA 4MHGA 3HTUA 5HDNA 3CUQA 3I59B 3V8KA 4CYDA 2EFNA 4IXAA 1U5TC 4P9UA 2YSRA 3KZYA 3IWZA 1Z1DA 2WV0A 3ZMUA 1IRFA 1HKTA 4HF2A 3HHHA 2W85A 5DUIA 4UVAA 4XSXF 2ISZA 2LDUA 3MWMA 3TOBA 2WTEA 1IAWA 1XMKA 3KEOA 2Z5UA 4G6DA 2Z9OA 4I01A 3C18A 1B1BA 4LMYA 2JSCA 1A04A 2XAHA 1ODDA 5ICFA 1MJ9A 3FF5A 4EMSA 4KICA 4M9ZA 2EFQA 4GCVA 3TOAA 2FSWA 1I5ZA 2ZNZA 4KIGA 2W57A 1SMTA 4JK1X 1I1SA 4PCQA 5F64A 1S7OA 4QLCU 2DBBA 1ZRDA 4BHCA 1EV7A 1MDMB 4HF1A 3GX4X 1T38A 2YX4A 2ZMEA 4KIFA 2VE9A 2HKXA 3DF8A 2XROA 5HS8A 3CO6C 4A6DA 3SFZA 2W25A 2MH9A 4H0EA 3BJAA 5K5RA 5L3DA 4OIPF 2LSOA 4HQMA 4OIQF 1KQ0A 2LKPA 1LNWA 3R0AA 3HTSB 2XAGA 5E17F 2R3SA 3QOPA 1Z6RA 1T39A 1BI0A 3I4PA 3SQNA 3F8BA 2P5LC 2HFHA 3IWFA 3HOTA 3N4MA 1LB2A 1O3TA 2AXLA 3E6CC 4I0AA 2VONA 3JW4A 4RAYA 1C0WA 2DTRA 2F5EA 1DP7P 4HYEA 4FHTA 4U7BA 5BPDA 2V6CA 4IRHA 4HX7A 4M73A 1ON1A 2G7HA 2IRFG 3ZP5A 3QPHA 3WTSC 4MEXF 1FSEA 1J7KA 3WU0A 4U88A 3WTUC 3I54A 3ECHA 1YW8A 2GXGA 1S7AA 3ZQ7A 2HQRA 2NS0A 5CVJA 1XCVA 5L3BA 6PAXA 1U2WA 2CFXA 3GW2A 3RIRA 2P7VB 2F5CA 3H3ZA 2O6GE 3CUQB 5LEJA 1W5TA 2OA4A 4LLNA 2PEXA 4QWQA 3QU3A 2TDXA 1IXSB 4XLNF 3C3WA 1HQCA 5BOXA 4BXUA 4G6QA 2VODA 2V9VA 3IC7A 5DCMB 1ZRCA 2QENA 4UVCA 4NQWA 4I09A 4XLPF 3FX3A 5J8FA 4R8HA 2Q2EA 4EM2A 3F72A 3EDPA 2GQQA 1IXCA 2DK5A 3EYYA 5EEGA 5DD4A 1ZH5A 3E3VA 4G8XA 2ZCWA 4UUVA 3F8MA 3RKXA 5JFRA 1XSDA 2PFBA 1PUEE 2A07F 5D6FA 2RGVA 4UNOA 5HS7A 2D45A 1G6NA 3QRFF 2UWMA 2MLKA 2KIUA 2YX7A 1YW9A 1ON2A 1P6RA 5D5VB 2XKPA 5D4RA 3VODA 5ILSA 2L01A 3ZMSA 5ED4A 3WTXC 1ZLKA 4BNCA 1CGPA 4WXCA 3IRQA 2IVMA 2MA3A 2OBPA 3M8EA 4RAZA 2VOOA 1SD6A 1FYLA 3GUDA 4UV9A 4LG0B 4MTDA 4WWCA 2D1HA 3RPUA 3E6MA 1B9NA 3BPXA 2YPRA 3P7NA 4RGSA 2FMLA 2ZNYA 1REPC 4PGHA 3J81K 4S04A 1D8JA 2PLYA 2BEOA 3GFLA 3HYIA 4GGGA 1RIOH 3ABUA 3MZYA 5HDGA 4LLGF 2IJLA 1W5SA 1ULYA 4M6XA 5AONA 3R6SA 1WRJA 3B73A 3KLOA 1USTA 1G4DA 3WTVC 4L0ZB 3RTRA 3Q5FA 3JAMZ 2DU9A 2O03A 2HKOA 3JSPA 4IRGA 4HOBA 2V1XA 1FBQA 4UV8A 4HAMA 3RI4A 1J9IA 2ISYA 4N9HA 3EUHA 4LK1F 4ZYGA 1BI2A 2K02A 3ZMZA 2QBYB 1EH8A 2DFIA 1TBXA 1HW1A 4EGYA 2P7CB 2M5WA 2NYXA 4G7ZF 2XASA 2VBYA 2ZFWA 3CDHA 2KKOA 2QQBA 2HR3A 3HUGA 5CLSA 3N97A 1W7PB 4O5VA 3CJNA 1J2XA 2KJCA 1UHMA 1FPQA 4RGXA 2A3SA 4LB5A 1KYZA 4IPAA 1QBJA 3ZMDA 1WKMA 3GEZA 1B59A 4M71A 4UXNA 3H92A 5H20A 3WODF 2XAFA 2EK5A 2VXZA 2UXNA 3F22A 1GHCA 4AVPA 4ETSA 5CJ9A 5DCMA 1IW7F 1JGSA 4ESJA 3E6DA 1QNTA 4I98B 1HW5A 1WWXA 2MD5A 3R0JA 2L02A 4F7ZA 2EB7A 4A2UA 2GAUA 2VT3A 2LF8A 1MD0A 1XDUA 4ZYHA 3FXUA 2VE8A 5HS9A 1SD4A 3PQKA 4KUMA 2VC0A 4L0YB 4KDPA 2UXXA 3KP6A 3CUQC 5FLXZ 3KFWX 4TV7A 3MZHA 3F6OA 2D2WA 5D6EA 2IT0A 4I2OA 4IHTA 3KP4A 1XN7A 1P2FA 1ZG1A 2OZ6A 4CXFA 4CHUA 5LHIA 1IN5A 3BOQA 2ADUA 1KU2A 1S8NA 2QQ9A 1U6GA 1Q1HA 3L00A 4KMUX 5A2QZ 1FNNA 3J80Z 3LAJA 2KJBA 3R4KA 3T1BA 2M1BA 2VBWA 2K4JA 2L3DA 1GXQA 2CWEA 2OQRA 4RB3C 4I02A 2EV6A 1FBSA 3VB2A 2DI3A 4M72A 4HV6A 3FM5A 1JE8A 2F2EA 1TQMA 3RJPA 5HLGA 5CYVA 4M9XA 1K78B 5AIQA 3MQ0A 1OR7A 3NQOA 4EJTA 5TJJA 4KNYA 1T6SA 2OU2A 3ROUA 2HDCA 3LFKA 1HW2A 5LRRA 1UHWA 1HBXG 4MTEA 1HXDA 2FF4A 2Y0MA 1TQIA 3OOPA 5D5XB 2HEOA 1SFUA 1P4AA 2QBYA 4YFKF 3JAMK 3M8FA 3LQQA 1PP8F 1W7PD 2XRNA 5K5QA 2P6TA 2YR2A 4HLYA 2PG4A 2UZKA 1FP2A 1F4KA 4ON0A 2EWNA 1ONVA 4DNCA 3C7JA 1CF7B 3BPVA 3P9CA 2GWRA 3QP6A 2EA2A 1Z7UA 2CSOA 2RNJA 5E1ZB 1T98A 2OZUA 1E17A 2H6CA 4M9SA 1J75A 4MNUA 5K1YA 4I0BA 2XKOA 4WF2A 1IN6A 2OD5A 2WC2A 5DDGA 3WGIA 2EFOA 3I64A 2ESNA 3H3UA 3ECOA 5ILVA 4HF0A 3Q9SA 1V3FA 4FX4A 1TNSA 3V7SA 4M74A 1D3YA 1YTYA 5LHHA 3F3XA 2XAJA 5L3GA 1H9TA 1E2XA 5F6FA 1I27A 1HSJA 1RI7A 4ZYEA 1J5YA 1WQ2A 4P96A 3TO6A 1XDSA 2P8TA 1LQ1A 5D5UB 1SFEA 1U78A 4A5NA 2CO5A 2FXAA 4BHBA 3WTWC 2H09A 1BOAA 3PQJA 5HOOA 4HDVA 3OV8A 4JBAA 1K7AA 3LSTA 2A6HF 5DV5A 2ETHA 1AWCA 1P92A 4Z2YA 2G7UA 1KQ9A 3HRSA 4MQVA 1UCRA 2V1DA 2ZO4A 1I1GA 1FYMA 3IKVA 5FLXK 3BZ6A 3VEPA 2DK8A 2Z3YA 1D8KA 3K69A 2JT1A 5E20A 1SD7A 1RZ4A 4A12A 2HS5A 3NEUA 3ERED 5E8GA 1IZ1A 2H27A 1XGSA 1Z9CA 4IHSA 1S3JA 2HQNA 1ZGAA 3HSRA 5JHUA 4KMFA 4HQEA 3RKWA 3U2RA 1B6AA 3ISPA 2J5OA 1O3SA 4Q5SF 4YG2F 4L9JA 1JXSA 3DPLC 3QP5A 2A61A 3ABTA 2XV4S 1K6OA 2XUBA 1BC8C 1FY7A 3C1DA 4OINF 4O6JA 4ENMA 2EFWA 3HSFA 2MC3A 3F21A 1FWZA 2EV0A 1IF1A 1RNLA 1KGSA 4GO1A 5LBQA 3DP7A 3LAPA 3J7AO 4IJAA 3F8NA 4KN4X 3U1DA 1JHFA 4AIJA 1K78A 3I5UA 2ACJA 1BBYA 2KRFA 2R7FA 5L3FA 5E1WA 1YFHA 1YO5C 3KP2A 4Y15A 3RYRA 1USSA 2STTA 2BBYA 2KIMA 1VTNC 4LK0F 3REOA 2P6SA 1TTYA 2MLGA 1Y0UA 4G7HF 3V8JA 3K1PA 3I0TA 3PFIA 4ASNA 1LEBA 1O3QA 1PDNC 2XHKA 4ZZDA 3U9GA 5BQTA 2RC4A 3F8FA 2VC1A 4OMYA 2KIFA 4M6YA 3ZMTA 1IRGA 3EQLF 5LLQA 3O2PE 2X0LA 4ENJA 3SXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HOE A;  5ICG A;  2WWY A;  3BRO A;  1YIO A;  5AIP A;  3R61 A;  3V4G A;  3SZT A;  1YQA A;  1IN7 A;  3FXQ A;  2XIG A;  3TQN A;  4A0X A;  4G7O F;  2HTS A;  3SZP A;  2CGP A;  1ZAR A;  4B8X A;  4HX4 A;  3TO7 A;  3ULQ B;  3LQR A;  4LB6 B;  2NNN A;  1V4R A;  3GLX A;  3KP5 A;  4L9V A;  2CG4 A;  2E1N A;  4EM0 B;  2VT2 A;  2W84 A;  3K9T A;  1R7J A;  3AAF A;  4HW0 A;  2ZME B;  1I6X A;  2JZY A;  5DCF A;  3BDD A;  3L2C A;  1XMA A;  3WE3 A;  2GA2 A;  1FBU A;  1P4W A;  1ZGJ A;  5D5W B;  1F1Z A;  5L3C A;  1DDN A;  1KQ8 A;  1LDK B;  2PQ8 A;  1R36 A;  3B02 A;  4G94 A;  3CLO A;  3FMQ A;  3TDZ C;  5H6Q A;  3O6B B;  2HWV A;  1ZRF A;  2A5Y B;  2QVO A;  1YS6 A;  5D8L B;  2GZW A;  4HV5 A;  1GVJ A;  2K7L A;  3D5L A;  4MEY F;  4LJZ F;  3KCC A;  4OOI A;  1RUO A;  4L9T A;  3P9K A;  3CO7 C;  4WX9 A;  2L4M A;  1LEA A;  1BIA A;  4CGZ A;  5IT9 K;  3I59 A;  2V1U A;  1XD7 A;  4RGR A;  4YFN F;  3FWE A;  3EYI A;  3QAH A;  1FP1 D;  4K2E A;  5FFZ A;  2OQG A;  2FBI A;  2VN2 A;  5LGT A;  1EH6 A;  4EJO A;  2ELH A;  2EV5 A;  1QQI A;  5FD5 A;  2PMU A;  2HYG D;  1LDD A;  2JTV A;  3FZV A;  2IW5 A;  2RKH A;  3WE2 A;  1SD5 A;  1HST A;  1BC7 C;  1G3W A;  2FBK A;  3GVA A;  3COA C;  3RYP A;  1XSX A;  3NRV A;  3SHF A;  3GZ5 A;  3FMR A;  5ICC A;  1H0M A;  1XB4 A;  2NRA C;  1FT9 A;  3IL2 A;  5H6R A;  1R1T A;  4GXO A;  2E1C A;  1QZZ A;  5CVR A;  4IRI A;  4R1H A;  3WGG A;  4JQF A;  2BE5 F;  1Z05 A;  5JI6 A;  4WXH A;  5FO5 A;  4CZZ A;  4BH9 A;  1HKS A;  1KU7 A;  5ILU A;  2HTJ A;  3ZPL A;  2Y75 A;  1XSV A;  4EJV A;  5BS6 A;  2BYV E;  3T8T A;  4WK8 F;  2EJR A;  1GXP A;  4HDU A;  1LJ9 A;  1F5T A;  3WTY C;  5K5O A;  3IHU A;  2IP2 A;  2RN7 A;  2K4B A;  2FMY A;  5HLH A;  5EEH A;  2O61 A;  1R1U A;  5LHG A;  4GYI A;  4KT5 C;  4A0Z A;  3FMS A;  3R60 A;  3RPQ A;  2BV6 A;  4N0B A;  4A0Y A;  4EV0 A;  3DPT A;  1IN4 A;  5IT9 Z;  5HVQ C;  1R00 A;  2FE3 A;  3EET A;  5FD6 A;  2FNA A;  4BYY A;  3T0Y A;  2DQL A;  2AS5 F;  3T5X A;  2NNY A;  1T2K A;  2L54 A;  3E5Q A;  1YW7 A;  3I58 A;  2QLZ A;  4YFX F;  1IUY A;  3J80 K;  5DYM A;  2XVC A;  2C6Y A;  5ICE A;  3K2Z A;  3F6V A;  2PMH A;  1R5H A;  2P5K A;  4XRF A;  3MAJ A;  4EJW A;  1L0O C;  4LD5 A;  3P9I A;  4IVN A;  2Q8K A;  1DPR A;  5CVU A;  1ZLJ A;  4CO8 A;  1LDJ A;  2Q0O A;  3KP7 A;  1FOK A;  2RVC A;  2DPD A;  2HYF A;  2FBH A;  4ESB A;  3FHZ A;  4L5I A;  5CVV A;  3RDI A;  4OIO F;  4AIH A;  2PI0 A;  3V7C A;  1J0R A;  1OMI A;  1SAX A;  4MQ9 F;  3ELK A;  4AIK A;  5DEQ A;  4RB0 A;  4FT8 A;  3WU1 B;  2MBF A;  4MGR A;  1FZP B;  1FYK A;  3GZ6 A;  3BP8 A;  4EJU A;  1KU3 A;  3JTG A;  3S2W A;  3E5X A;  5DD8 A;  1TW3 A;  1D5V A;  2M45 A;  3F23 A;  4L9N A;  2OAZ A;  1BM9 A;  1KU9 A;  2K86 A;  1H9G A;  5LEK A;  1MZB A;  4CIC A;  3L09 A;  3ZN0 A;  1QZY A;  5BPI A;  3LWF A;  4WXD A;  2A69 F;  4HLX A;  1L3L A;  5KK1 A;  2GA1 A;  5FB2 A;  4KYW A;  1YLF A;  3IKT A;  3HIF A;  2O3F A;  2DO7 A;  4B09 A;  3HRU A;  1SMY F;  5A2Q K;  1BI3 A;  2FQ3 A;  2G9W A;  3CTA A;  2QM3 A;  3BWG A;  3WG9 A;  4HBL A;  1UFM A;  4AD9 A;  1CF7 A;  5TRD A;  4OMZ A;  2LF7 A;  2DLL A;  1UB9 A;  1U5T A;  2PN6 A;  4RB2 C;  1U5T B;  3LA3 A;  2W24 A;  3BJO A;  2ZKZ A;  1R22 A;  3HRT A;  3VOE A;  2MH2 A;  1G3Y A;  3KE2 A;  1DUX C;  3LA7 A;  3GFI A;  2QZ8 A;  3M7G A;  1WI9 A;  1S29 A;  1ZAO A;  2H94 A;  1J59 A;  4PZJ A;  4XSZ F;  5J8C A;  3GFM A;  2QQA A;  3BY6 A;  2R7D A;  2DAO A;  3KEQ A;  1BIB A;  4OIR F;  4L18 B;  1TLH B;  5E8I A;  4L5J A;  1EH7 A;  1AOY A;  2JPC A;  3GO5 A;  1ZN2 A;  1DPU A;  2JPB A;  4P9F A;  2IA2 A;  4BHP A;  1R58 A;  2H6B A;  1FX7 A;  4EQQ A;  5CVI A;  1MJA A;  3K1N A;  3JTH A;  3MFK A;  1KA8 A;  3KZZ A;  4PDK A;  3GXO A;  2E7X A;  3HHG A;  2J5P A;  2V79 A;  4IF4 A;  2CYY A;  2F5D A;  1G3S A;  3DQV C;  2LNB A;  2IPQ X;  4LG0 A;  4FX0 A;  4OU0 A;  1MJB A;  3LA2 A;  1Z91 A;  4HZF A;  2PBI A;  3ML6 A;  2RDP A;  1Z6T A;  5LGN A;  4YII A;  4Q4Z F;  2QWW A;  4BQA A;  4LLL A;  2VBZ A;  4U0Y A;  5FFX A;  2NAZ A;  1O7L A;  2QUF A;  3WTZ A;  4WCG A;  1OKR A;  4HA8 A;  1ZHF A;  5E1X A;  4LGW A;  4P55 A;  4EGZ A;  4NB5 A;  5J6X A;  1PP7 U;  1ZG3 A;  3FM3 A;  1F9N A;  3G73 A;  5HLI A;  2RQP A;  3M9A A;  1STZ A;  5E18 F;  2JRT A;  2STW A;  3WGH A;  4ZZL A;  1ZG5 A;  1TQP A;  2A6E F;  4I7H A;  4YIF A;  3W6K B;  3Q9V A;  3ZMV A;  5L3E A;  1R5G A;  4ESF A;  2ZBK A;  3E5U A;  1K79 A;  3E6B A;  2DW4 A;  2B0L A;  1G3T A;  4O3M A;  3JSO A;  3TKY A;  1X3U A;  1R23 A;  2Z99 A;  1WSU A;  1O7F A;  1LVA A;  5DUK A;  4RGU A;  3I71 A;  1RUN A;  1XGO A;  4NHJ A;  4GYG A;  2M8E A;  4ENK A;  1XGN A;  1O57 A;  4A6E A;  3DV8 A;  2GIV A;  4ZYD A;  4HX8 A;  5HDK A;  4DQ2 A;  2ZXJ A;  5D8K B;  4U0W A;  3HRM A;  4BAY A;  1OYI A;  5LGU A;  4ZH4 F;  2E7W A;  2DPU A;  2HZT A;  1KYW A;  4G9Y A;  2IA0 A;  2QYO A;  2D1V A;  3TDU C;  2FA5 A;  3M1E A;  3GWZ A;  1FLI A;  2FEZ A;  1W7P A;  1BI1 A;  2A68 F;  1XGM A;  4U0V A;  1QO0 D;  2O0Y A;  4Q48 A;  2P4W A;  3VFZ A;  1MDM A;  1ZRE A;  4LFU A;  4ENN A;  2L4A A;  2P5V A;  4Y17 A;  2ESH A;  2ZJ2 A;  3ZN1 A;  5FGM A;  2COM A;  5F1R A;  4U7D A;  1HKQ A;  5BMZ A;  1OYW A;  2VOP A;  2DT5 A;  1B9M A;  2XAQ A;  4N9I A;  1IXR C;  3F8C A;  3TGN A;  2Z33 A;  4RB1 A;  3MCZ A;  3O3K A;  1S6L A;  1FSH A;  4KN7 X;  5JR3 A;  1U3E M;  3GFJ A;  3K1M A;  2BGC A;  4KIB A;  4KFC A;  1SFX A;  2K27 A;  4AWX B;  1BJA A;  5ERI A;  4RS8 A;  1YS7 A;  2XGX A;  3TO9 A;  4EM1 A;  4S05 A;  3KLN A;  3RKY A;  4Y13 A;  4XBF A;  3I53 A;  3E97 A;  4A5M A;  2Y48 A;  3K0L A;  1R1V A;  3DXJ F;  1BN5 A;  2M30 A;  2CQK A;  2RV8 A;  4PGG A;  1T0F A;  3G3Z A;  2FU4 A;  3KET A;  2FOK A;  1TW2 A;  1QPM A;  1OPC A;  1P4X A;  3WTT C;  3MEX A;  1TNT A;  5D4S A;  2EFP A;  3D0S A;  3DEU A;  4P5O A;  2CW0 F;  3QU6 A;  3L7W A;  3W6J B;  2X4H A;  3DKW A;  3T8R A;  2YU3 A;  4EVI A;  1ZYR F;  1OYY A;  1NHA A;  1O3R A;  2PJP A;  1YYV A;  5JVT A;  3GYH X;  2DQR A;  1MKM A;  2F5F A;  1IN8 A;  4D0P A;  3HSE A;  2EA4 A;  5LRS A;  1QGP A;  3QPT A;  3J81 Z;  3KP3 A;  4CDG A;  4KA4 A;  4E70 A;  1FC3 A;  2HGC A;  4Q47 A;  3CUO A;  2GXB A;  2O8X A;  2FRH A;  5KVR A;  1B4A A;  1YG2 A;  3DFG A;  2IA1 A;  2VBX A;  3HOS A;  3FXR A;  2FNP A;  5IT3 A;  2M87 A;  1MGT A;  3BJ6 A;  4R79 A;  1W4M A;  3GF2 A;  4UVB A;  3V8L A;  4UHT A;  3V7R A;  1XCB A;  3L9F A;  3IRR A;  1JHH A;  1U8R A;  4MHG A;  3HTU A;  5HDN A;  3CUQ A;  3I59 B;  3V8K A;  4CYD A;  2EFN A;  4IXA A;  1U5T C;  4P9U A;  2YSR A;  3KZY A;  3IWZ A;  1Z1D A;  2WV0 A;  3ZMU A;  1IRF A;  1HKT A;  4HF2 A;  3HHH A;  2W85 A;  5DUI A;  4UVA A;  4XSX F;  2ISZ A;  2LDU A;  3MWM A;  3TOB A;  2WTE A;  1IAW A;  1XMK A;  3KEO A;  2Z5U A;  4G6D A;  2Z9O A;  4I01 A;  3C18 A;  1B1B A;  4LMY A;  2JSC A;  1A04 A;  2XAH A;  1ODD A;  5ICF A;  1MJ9 A;  3FF5 A;  4EMS A;  4KIC A;  4M9Z A;  2EFQ A;  4GCV A;  3TOA A;  2FSW A;  1I5Z A;  2ZNZ A;  4KIG A;  2W57 A;  1SMT A;  4JK1 X;  1I1S A;  4PCQ A;  5F64 A;  1S7O A;  4QLC U;  2DBB A;  1ZRD A;  4BHC A;  1EV7 A;  1MDM B;  4HF1 A;  3GX4 X;  1T38 A;  2YX4 A;  2ZME A;  4KIF A;  2VE9 A;  2HKX A;  3DF8 A;  2XRO A;  5HS8 A;  3CO6 C;  4A6D A;  3SFZ A;  2W25 A;  2MH9 A;  4H0E A;  3BJA A;  5K5R A;  5L3D A;  4OIP F;  2LSO A;  4HQM A;  4OIQ F;  1KQ0 A;  2LKP A;  1LNW A;  3R0A A;  3HTS B;  2XAG A;  5E17 F;  2R3S A;  3QOP A;  1Z6R A;  1T39 A;  1BI0 A;  3I4P A;  3SQN A;  3F8B A;  2P5L C;  2HFH A;  3IWF A;  3HOT A;  3N4M A;  1LB2 A;  1O3T A;  2AXL A;  3E6C C;  4I0A A;  2VON A;  3JW4 A;  4RAY A;  1C0W A;  2DTR A;  2F5E A;  1DP7 P;  4HYE A;  4FHT A;  4U7B A;  5BPD A;  2V6C A;  4IRH A;  4HX7 A;  4M73 A;  1ON1 A;  2G7H A;  2IRF G;  3ZP5 A;  3QPH A;  3WTS C;  4MEX F;  1FSE A;  1J7K A;  3WU0 A;  4U88 A;  3WTU C;  3I54 A;  3ECH A;  1YW8 A;  2GXG A;  1S7A A;  3ZQ7 A;  2HQR A;  2NS0 A;  5CVJ A;  1XCV A;  5L3B A;  6PAX A;  1U2W A;  2CFX A;  3GW2 A;  3RIR A;  2P7V B;  2F5C A;  3H3Z A;  2O6G E;  3CUQ B;  5LEJ A;  1W5T A;  2OA4 A;  4LLN A;  2PEX A;  4QWQ A;  3QU3 A;  2TDX A;  1IXS B;  4XLN F;  3C3W A;  1HQC A;  5BOX A;  4BXU A;  4G6Q A;  2VOD A;  2V9V A;  3IC7 A;  5DCM B;  1ZRC A;  2QEN A;  4UVC A;  4NQW A;  4I09 A;  4XLP F;  3FX3 A;  5J8F A;  4R8H A;  2Q2E A;  4EM2 A;  3F72 A;  3EDP A;  2GQQ A;  1IXC A;  2DK5 A;  3EYY A;  5EEG A;  5DD4 A;  1ZH5 A;  3E3V A;  4G8X A;  2ZCW A;  4UUV A;  3F8M A;  3RKX A;  5JFR A;  1XSD A;  2PFB A;  1PUE E;  2A07 F;  5D6F A;  2RGV A;  4UNO A;  5HS7 A;  2D45 A;  1G6N A;  3QRF F;  2UWM A;  2MLK A;  2KIU A;  2YX7 A;  1YW9 A;  1ON2 A;  1P6R A;  5D5V B;  2XKP A;  5D4R A;  3VOD A;  5ILS A;  2L01 A;  3ZMS A;  5ED4 A;  3WTX C;  1ZLK A;  4BNC A;  1CGP A;  4WXC A;  3IRQ A;  2IVM A;  2MA3 A;  2OBP A;  3M8E A;  4RAZ A;  2VOO A;  1SD6 A;  1FYL A;  3GUD A;  4UV9 A;  4LG0 B;  4MTD A;  4WWC A;  2D1H A;  3RPU A;  3E6M A;  1B9N A;  3BPX A;  2YPR A;  3P7N A;  4RGS A;  2FML A;  2ZNY A;  1REP C;  4PGH A;  3J81 K;  4S04 A;  1D8J A;  2PLY A;  2BEO A;  3GFL A;  3HYI A;  4GGG A;  1RIO H;  3ABU A;  3MZY A;  5HDG A;  4LLG F;  2IJL A;  1W5S A;  1ULY A;  4M6X A;  5AON A;  3R6S A;  1WRJ A;  3B73 A;  3KLO A;  1UST A;  1G4D A;  3WTV C;  4L0Z B;  3RTR A;  3Q5F A;  3JAM Z;  2DU9 A;  2O03 A;  2HKO A;  3JSP A;  4IRG A;  4HOB A;  2V1X A;  1FBQ A;  4UV8 A;  4HAM A;  3RI4 A;  1J9I A;  2ISY A;  4N9H A;  3EUH A;  4LK1 F;  4ZYG A;  1BI2 A;  2K02 A;  3ZMZ A;  2QBY B;  1EH8 A;  2DFI A;  1TBX A;  1HW1 A;  4EGY A;  2P7C B;  2M5W A;  2NYX A;  4G7Z F;  2XAS A;  2VBY A;  2ZFW A;  3CDH A;  2KKO A;  2QQB A;  2HR3 A;  3HUG A;  5CLS A;  3N97 A;  1W7P B;  4O5V A;  3CJN A;  1J2X A;  2KJC A;  1UHM A;  1FPQ A;  4RGX A;  2A3S A;  4LB5 A;  1KYZ A;  4IPA A;  1QBJ A;  3ZMD A;  1WKM A;  3GEZ A;  1B59 A;  4M71 A;  4UXN A;  3H92 A;  5H20 A;  3WOD F;  2XAF A;  2EK5 A;  2VXZ A;  2UXN A;  3F22 A;  1GHC A;  4AVP A;  4ETS A;  5CJ9 A;  5DCM A;  1IW7 F;  1JGS A;  4ESJ A;  3E6D A;  1QNT A;  4I98 B;  1HW5 A;  1WWX A;  2MD5 A;  3R0J A;  2L02 A;  4F7Z A;  2EB7 A;  4A2U A;  2GAU A;  2VT3 A;  2LF8 A;  1MD0 A;  1XDU A;  4ZYH A;  3FXU A;  2VE8 A;  5HS9 A;  1SD4 A;  3PQK A;  4KUM A;  2VC0 A;  4L0Y B;  4KDP A;  2UXX A;  3KP6 A;  3CUQ C;  5FLX Z;  3KFW X;  4TV7 A;  3MZH A;  3F6O A;  2D2W A;  5D6E A;  2IT0 A;  4I2O A;  4IHT A;  3KP4 A;  1XN7 A;  1P2F A;  1ZG1 A;  2OZ6 A;  4CXF A;  4CHU A;  5LHI A;  1IN5 A;  3BOQ A;  2ADU A;  1KU2 A;  1S8N A;  2QQ9 A;  1U6G A;  1Q1H A;  3L00 A;  4KMU X;  5A2Q Z;  1FNN A;  3J80 Z;  3LAJ A;  2KJB A;  3R4K A;  3T1B A;  2M1B A;  2VBW A;  2K4J A;  2L3D A;  1GXQ A;  2CWE A;  2OQR A;  4RB3 C;  4I02 A;  2EV6 A;  1FBS A;  3VB2 A;  2DI3 A;  4M72 A;  4HV6 A;  3FM5 A;  1JE8 A;  2F2E A;  1TQM A;  3RJP A;  5HLG A;  5CYV A;  4M9X A;  1K78 B;  5AIQ A;  3MQ0 A;  1OR7 A;  3NQO A;  4EJT A;  5TJJ A;  4KNY A;  1T6S A;  2OU2 A;  3ROU A;  2HDC A;  3LFK A;  1HW2 A;  5LRR A;  1UHW A;  1HBX G;  4MTE A;  1HXD A;  2FF4 A;  2Y0M A;  1TQI A;  3OOP A;  5D5X B;  2HEO A;  1SFU A;  1P4A A;  2QBY A;  4YFK F;  3JAM K;  3M8F A;  3LQQ A;  1PP8 F;  1W7P D;  2XRN A;  5K5Q A;  2P6T A;  2YR2 A;  4HLY A;  2PG4 A;  2UZK A;  1FP2 A;  1F4K A;  4ON0 A;  2EWN A;  1ONV A;  4DNC A;  3C7J A;  1CF7 B;  3BPV A;  3P9C A;  2GWR A;  3QP6 A;  2EA2 A;  1Z7U A;  2CSO A;  2RNJ A;  5E1Z B;  1T98 A;  2OZU A;  1E17 A;  2H6C A;  4M9S A;  1J75 A;  4MNU A;  5K1Y A;  4I0B A;  2XKO A;  4WF2 A;  1IN6 A;  2OD5 A;  2WC2 A;  5DDG A;  3WGI A;  2EFO A;  3I64 A;  2ESN A;  3H3U A;  3ECO A;  5ILV A;  4HF0 A;  3Q9S A;  1V3F A;  4FX4 A;  1TNS A;  3V7S A;  4M74 A;  1D3Y A;  1YTY A;  5LHH A;  3F3X A;  2XAJ A;  5L3G A;  1H9T A;  1E2X A;  5F6F A;  1I27 A;  1HSJ A;  1RI7 A;  4ZYE A;  1J5Y A;  1WQ2 A;  4P96 A;  3TO6 A;  1XDS A;  2P8T A;  1LQ1 A;  5D5U B;  1SFE A;  1U78 A;  4A5N A;  2CO5 A;  2FXA A;  4BHB A;  3WTW C;  2H09 A;  1BOA A;  3PQJ A;  5HOO A;  4HDV A;  3OV8 A;  4JBA A;  1K7A A;  3LST A;  2A6H F;  5DV5 A;  2ETH A;  1AWC A;  1P92 A;  4Z2Y A;  2G7U A;  1KQ9 A;  3HRS A;  4MQV A;  1UCR A;  2V1D A;  2ZO4 A;  1I1G A;  1FYM A;  3IKV A;  5FLX K;  3BZ6 A;  3VEP A;  2DK8 A;  2Z3Y A;  1D8K A;  3K69 A;  2JT1 A;  5E20 A;  1SD7 A;  1RZ4 A;  4A12 A;  2HS5 A;  3NEU A;  3ERE D;  5E8G A;  1IZ1 A;  2H27 A;  1XGS A;  1Z9C A;  4IHS A;  1S3J A;  2HQN A;  1ZGA A;  3HSR A;  5JHU A;  4KMF A;  4HQE A;  3RKW A;  3U2R A;  1B6A A;  3ISP A;  2J5O A;  1O3S A;  4Q5S F;  4YG2 F;  4L9J A;  1JXS A;  3DPL C;  3QP5 A;  2A61 A;  3ABT A;  2XV4 S;  1K6O A;  2XUB A;  1BC8 C;  1FY7 A;  3C1D A;  4OIN F;  4O6J A;  4ENM A;  2EFW A;  3HSF A;  2MC3 A;  3F21 A;  1FWZ A;  2EV0 A;  1IF1 A;  1RNL A;  1KGS A;  4GO1 A;  5LBQ A;  3DP7 A;  3LAP A;  3J7A O;  4IJA A;  3F8N A;  4KN4 X;  3U1D A;  1JHF A;  4AIJ A;  1K78 A;  3I5U A;  2ACJ A;  1BBY A;  2KRF A;  2R7F A;  5L3F A;  5E1W A;  1YFH A;  1YO5 C;  3KP2 A;  4Y15 A;  3RYR A;  1USS A;  2STT A;  2BBY A;  2KIM A;  1VTN C;  4LK0 F;  3REO A;  2P6S A;  1TTY A;  2MLG A;  1Y0U A;  4G7H F;  3V8J A;  3K1P A;  3I0T A;  3PFI A;  4ASN A;  1LEB A;  1O3Q A;  1PDN C;  2XHK A;  4ZZD A;  3U9G A;  5BQT A;  2RC4 A;  3F8F A;  2VC1 A;  4OMY A;  2KIF A;  4M6Y A;  3ZMT A;  1IRG A;  3EQL F;  5LLQ A;  3O2P E;  2X0L A;  4ENJ A;  3SXY A; 
#chains in the Genus database with same CATH topology
 2ID3 A;  2DA3 A;  2ELK A;  2HOE A;  3NWS A;  3W6V A;  2X6W A;  1OQY A;  2WAQ A;  5F1J A;  1WVR A;  2XDV A;  5ICG A;  1ZR2 A;  1GUU A;  2WWY A;  3BRO A;  4ZYA A;  1YIO A;  5AIP A;  3R61 A;  5FKM A;  3V4G A;  3SZT A;  3HOX J;  3FKJ A;  4PJN A;  1YQA A;  1IN7 A;  3FXQ A;  2XIG A;  3TQN A;  4A0X A;  4G7O F;  2HTS A;  3SZP A;  2CGP A;  3OR1 C;  3M07 A;  1VQ7 I;  1U0J A;  1VFC A;  4RAF A;  1UZC A;  1E3P A;  1ZAR A;  2CW8 A;  4B8X A;  2JA6 J;  2LBF B;  4CCL A;  4CCN A;  4HX4 A;  3TO7 A;  1MBK A;  5CQE A;  3ULQ B;  3V42 A;  2JA8 J;  3LQR A;  2WV1 A;  3ERM A;  1WJA A;  4LB6 B;  2NNN A;  3FXM A;  1V4R A;  3GLX A;  3KP5 A;  4L9V A;  2CG4 A;  2E1N A;  4IQJ A;  4LOC A;  4EM0 B;  2VT2 A;  2W84 A;  1SVO A;  3K9T A;  1R7J A;  3SYT A;  3AAF A;  4A3L J;  4HW0 A;  2ZME B;  5EGO A;  3L2R A;  1I6X A;  2JZY A;  5DCF A;  2Q2E B;  4XKW A;  3BDD A;  3L2C A;  2M7B A;  1XMA A;  3WE3 A;  2GA2 A;  3QPL A;  1FBU A;  1P4W A;  2KRH A;  2O8K A;  1ZGJ A;  2HQA A;  5D5W B;  1F1Z A;  2R5Z A;  3PNV A;  4XLH A;  5L3C A;  1IDY A;  1DDN A;  3RSN A;  1LDK B;  2KQR A;  3LFU A;  1KQ8 A;  2PQ8 A;  5GPC A;  2WY8 Q;  4F91 B;  1R36 A;  3B6A A;  1Y0N A;  2Z2S B;  4J19 A;  3B02 A;  4G94 A;  2XSJ C;  2L2O A;  3JRG A;  4XIC A;  3CLO A;  3SZG A;  3FMQ A;  3TDZ C;  5H6Q A;  3O6B B;  4PUS A;  2VB6 A;  1MNE A;  2HWV A;  1ZRF A;  2A5Y B;  1Y39 A;  2QVO A;  1YS6 A;  5D8L B;  4E7S A;  1Z3X A;  2GZW A;  4HV5 A;  4C3H J;  2JMW A;  1GVJ A;  1JKQ C;  2K7L A;  3D5L A;  2F4O B;  4MEY F;  3DBR B;  2LOO A;  4LJZ F;  2Y31 A;  1Q1V A;  3KCC A;  4OOI A;  1RUO A;  1I6H J;  3ZQG A;  2L9R A;  4FET A;  4L9T A;  3P9K A;  2BY1 A;  3CCR I;  1KZH A;  4X0G A;  3CO7 C;  4WX9 A;  3DEE A;  2L4M A;  1LEA A;  4ZTJ A;  1BIA A;  4CGZ A;  5IT9 K;  3GTO J;  3I59 A;  2V1U A;  2OPT A;  1XD7 A;  2X1C A;  4XKB A;  4UB8 C;  4A3I J;  4RGR A;  4YFN F;  4CSW A;  2LBF A;  3FWE A;  2Z16 A;  1X1C A;  3EYI A;  3QAH A;  4BE2 A;  3I3L A;  1VQP I;  1FP1 D;  4K2E A;  1XS9 A;  2L9N A;  5FFZ A;  1HOM A;  2OQG A;  1UAA A;  2FBI A;  2VN2 A;  5LGT A;  1EH6 A;  3DTE A;  2K3F A;  4IOA F;  1TWH J;  2CUF A;  2E35 A;  2ELH A;  3OR2 C;  2EV5 A;  1QQI A;  4EJO A;  1FEX A;  1FOX A;  5FD5 A;  2PMU A;  1ZR4 A;  2HYG D;  2WAE A;  1LDD A;  4II3 A;  1K4T A;  2B9S A;  2COB A;  1OIS A;  3FBN B;  2JTV A;  3GZN B;  4CYC A;  2ZJR F;  3EPZ A;  2G0E A;  3HL2 A;  4IHY A;  3FZV A;  2NOG A;  1A35 A;  2IW5 A;  2RKH A;  2VJJ A;  4NC7 A;  1B8I A;  1W0U A;  3PIP F;  3WE2 A;  1SD5 A;  1YE9 A;  4A3K J;  3OYH A;  1HST A;  1QVU A;  4UB6 C;  1BC7 C;  2VLA A;  1G3W A;  2FBK A;  3ABM H;  1R4M B;  3GVA A;  3COA C;  2V1N A;  3RYP A;  1XSX A;  2FQ4 A;  3ZGK A;  3NRV A;  4QSH A;  3SHF A;  3GZ5 A;  3FMR A;  3LSG A;  5ICC A;  1H0M A;  4HEA 2;  5F0C A;  1XB4 A;  2WA0 A;  4CA0 A;  2A5W A;  2NRA C;  1MBJ A;  1FT9 A;  3MKL A;  3IL2 A;  5H6R A;  1R1T A;  4GXO A;  2Y9Z A;  1WJ5 A;  2E1C A;  1QZZ A;  3FXK A;  4FCY A;  5CVR A;  4IRI A;  4C3J J;  4DYQ A;  4R1H A;  3WGG A;  4A3E J;  1UEL B;  4JQF A;  2BE5 F;  1Z05 A;  5JI6 A;  4WXH A;  4JX6 A;  1IO2 A;  2ZME C;  5FO5 A;  4CZZ A;  3PSF A;  4BH9 A;  1HKS A;  3QYF A;  3OSG A;  2HVS A;  1Z21 A;  3SJM A;  1KU7 A;  3AL0 C;  1WFX A;  5ILU A;  2HTJ A;  3ZPL A;  2OUM A;  2Y75 A;  1YJ9 I;  1XSV A;  3CLQ A;  2Y69 H;  4Z6Y A;  4EJV A;  4BKX A;  4XOT A;  3VWB A;  5BS6 A;  2BYV E;  3T8T A;  3OYL A;  1BL0 A;  4WK8 F;  2EJR A;  1GXP A;  4HDU A;  3K7A J;  4W97 A;  1LJ9 A;  3F9K A;  3P5J A;  4XK4 A;  1F5T A;  3IAM 2;  3GCM A;  4B48 A;  3WTY C;  5K5O A;  2LY2 A;  3RZD J;  3IHU A;  2IP2 A;  4RA2 A;  5FRM A;  2RN7 A;  1A6I A;  2NVT J;  2R7X A;  2K4B A;  3VPR A;  2FMY A;  2CV2 A;  1VQO I;  5M3F J;  3RQ4 A;  2R7W A;  5HLH A;  5EEH A;  3DU5 A;  2O61 A;  1R1U A;  5LHG A;  1NG6 A;  1Z77 A;  1JUM A;  4GYI A;  1ETX A;  4KT5 C;  2JA5 J;  1G8X A;  4NUB A;  3UR3 C;  3FMS A;  4A0Z A;  3R60 A;  3RPQ A;  1FMW A;  4HST A;  2BV6 A;  4N0B A;  4A0Y A;  4EV0 A;  3DPT A;  1IN4 A;  5IT9 Z;  5HVQ C;  1R00 A;  2FE3 A;  3EET A;  5FD6 A;  2FNA A;  4BYY A;  5B1A H;  3PFY A;  1K6Y A;  3T0Y A;  2DQL A;  2AS5 F;  3T5X A;  3VYS B;  2PMZ A;  2NNY A;  2L54 A;  1T2K A;  3E5Q A;  2XC7 A;  3AKZ A;  5CKT A;  1YW7 A;  1MMN A;  3FXL A;  3I58 A;  2QLZ A;  4YFX F;  3OYB A;  1IUY A;  1LUJ B;  3J80 K;  5DYM A;  3LSR A;  2XVC A;  2C6Y A;  5ICE A;  3K2Z A;  3TL4 X;  2IBD A;  3JRA A;  1VZ0 A;  5J4Y A;  3F6V A;  4E7H A;  1RET A;  4N4N B;  2PMH A;  1R5H A;  1VQ6 I;  2P5K A;  3A01 A;  4XRF A;  3I4M J;  2Q1Z B;  3HB9 A;  3MAJ A;  1YIT I;  4EJW A;  1L0O C;  3DWL E;  4LD5 A;  3P9I A;  3OY9 A;  4IVN A;  2Q8K A;  1DPR A;  5CVU A;  2L5Q A;  4EEF G;  3LOC A;  4XQF A;  1ZLJ A;  4CCO A;  4CO8 A;  1LDJ A;  2KDO A;  2Q0O A;  3KP7 A;  5FKK A;  1IGN A;  5B5E C;  1FOK A;  2RVC A;  2K9M A;  2KLO A;  2DPD A;  1S5L C;  2GBY A;  2QCO A;  1FMV A;  1NTC A;  2HYF A;  3HPH A;  2FBH A;  4HNV A;  1U8B A;  3TW6 A;  4C2M J;  4ESB A;  4L5I A;  5CVV A;  3RDI A;  2V4J C;  3FHZ A;  2QSH X;  4OIO F;  4AIH A;  2HOS A;  2PI0 A;  3V7C A;  2BXY A;  1ZKG A;  1J0R A;  1D1C A;  1OMI A;  3H9Q A;  2M4K A;  1SAX A;  4MQ9 F;  5E79 C;  4CYC B;  1LFP A;  3ELK A;  4AIK A;  2V6E A;  1WZ2 A;  2Y9Y A;  5DEQ A;  4RB0 A;  1AU7 A;  3CC2 I;  4FT8 A;  3K4N A;  3WU1 B;  2IGN A;  2MBF A;  2VI6 A;  2W48 A;  4MGR A;  3VYR B;  2EIN H;  3I56 I;  1VQ5 I;  1FZP B;  1KON A;  3E1S A;  4MFE A;  2F4I A;  1LKX A;  3BP8 A;  3GZ6 A;  1FYK A;  5GAG J;  2VQL A;  4EJU A;  2DA5 A;  5IYC J;  1KU3 A;  5EDN A;  3JTG A;  3S2W A;  2JA7 J;  3E5X A;  1FIA A;  2L0K A;  5DD8 A;  1TW3 A;  1D5V A;  2M45 A;  2XF7 A;  4I6Z A;  3F23 A;  2M0M A;  4L9N A;  4BE1 A;  3ZXS A;  3FIW A;  2OAZ A;  1TWF J;  3HOU J;  1BM9 A;  1KU9 A;  4HSR A;  2K86 A;  4NNJ A;  1H9G A;  5GAH J;  3JRH A;  5LEK A;  1MZB A;  4CIC A;  3KYD B;  3L09 A;  3ZN0 A;  2K9L A;  4CZC A;  1QZY A;  3FBI B;  4IX7 A;  3LWF A;  5BPI A;  2A69 F;  4WXD A;  4HLX A;  2X1D A;  1L3L A;  1ETV A;  5KK1 A;  2GA1 A;  5FB2 A;  1RR8 C;  4KYW A;  4CCM A;  1YLF A;  4FQG A;  3IKT A;  3HIF A;  2O3F A;  4GRI A;  2MD0 A;  5FRN A;  2DO7 A;  2ECC A;  4B09 A;  3HRU A;  1SMY F;  5A2Q K;  1BI3 A;  3AFH A;  1UJ8 A;  2DFF A;  2JUG A;  1X19 A;  2FQ3 A;  2G9W A;  2W7N A;  3CTA A;  3BWG A;  2QM3 A;  3WG9 A;  3AG2 H;  4HBL A;  1UFM A;  4AD9 A;  1CF7 A;  5TRD A;  4OMZ A;  3BG5 A;  2LF7 A;  2DLL A;  1UB9 A;  1U5T A;  1PVE A;  2PN6 A;  4RB2 C;  2BZT A;  2H8W A;  3ZQF A;  3ESW B;  1U5T B;  3LA3 A;  5F27 A;  2VQG A;  2W24 A;  3BJO A;  5J1Y A;  2ZKZ A;  3JR9 A;  1R22 A;  4LIV A;  3HRT A;  1JT6 A;  1S9H A;  1IRZ A;  3VOE A;  2MH2 A;  5HNF A;  5EGO B;  1G3Y A;  2DA4 A;  3KE2 A;  1DUX C;  3AG3 H;  3LA7 A;  3Q0U A;  2QZ8 A;  3GFI A;  3JRE A;  2KPM A;  3M7G A;  1WI9 A;  1S29 A;  4XOR A;  1ZAO A;  1RR7 A;  2W82 A;  5J47 A;  3S16 J;  2H94 A;  1I3A A;  1K61 A;  1J59 A;  4PZJ A;  4XSZ F;  2VJ5 A;  5J8C A;  3GTM J;  1ERD A;  2QSF X;  3GFM A;  2QQA A;  3BY6 A;  2R7D A;  1DU6 A;  2DAO A;  1EF4 A;  3KEQ A;  1BIB A;  4OIR F;  4L18 B;  4UUT A;  2ZJP F;  1TT5 B;  1ORK A;  1TLH B;  5E8I A;  2BW3 B;  1X1B A;  4L5J A;  1EH7 A;  1AOY A;  3ONQ A;  2RNG A;  2JPC A;  3HGG A;  1ZN2 A;  3GO5 A;  1DPU A;  2JPB A;  5EJC A;  2EZI A;  3GTL J;  4AU7 A;  4P9F A;  2IA2 A;  4II2 A;  4BHP A;  2O7O A;  1R58 A;  2H6B A;  1R49 A;  1FX7 A;  4EQQ A;  1ZQ3 P;  1MBG A;  1B72 B;  2EPF A;  5CVI A;  1MJA A;  3K1N A;  3JTH A;  3MFK A;  4AM3 A;  3W2A A;  1KA8 A;  3KZZ A;  4PDK A;  3GXO A;  2E7X A;  3HHG A;  2J5P A;  2OJE D;  2DT7 B;  4Y33 A;  1T33 A;  1X4O A;  2V79 A;  4IF4 A;  1BOB A;  2CYY A;  1G3S A;  2F5D A;  4AYB N;  3DQV C;  2R7O A;  3CD6 I;  2LNB A;  2IPQ X;  4LG0 A;  4FX0 A;  1OCC H;  3BLY A;  4OU0 A;  2WB1 A;  1MJB A;  1D1A A;  3DU6 A;  3LA2 A;  1Z91 A;  4HZF A;  5JLX A;  2PBI A;  3WG7 H;  1R71 A;  3K4K A;  3ML6 A;  3L2V A;  2RDP A;  1Z6T A;  5LGN A;  3LNQ A;  1Y6I A;  4YII A;  1OCT C;  1Z7L A;  4Q4Z F;  2L7K A;  2QWW A;  4BQA A;  4PK4 A;  5EF6 A;  4LLL A;  3AG1 H;  2FX0 A;  2R7U A;  3C2H A;  2HPM A;  5IP6 A;  2TRT A;  4G12 A;  5E3N A;  2VBZ A;  4U0Y A;  1LPQ A;  2IGK A;  2DMT A;  2NAZ A;  5FFX A;  1O7L A;  1V5G A;  2QUF A;  3UNG C;  3WTZ A;  3TP3 A;  3SFI A;  4WCG A;  1OKR A;  4HA8 A;  1ZHF A;  5E1X A;  2LTP A;  4LGW A;  4P55 A;  4EGZ A;  3OWT A;  3DTK A;  4NB5 A;  1H88 C;  2VQH A;  3QQA A;  3S14 J;  3MKW B;  1S72 I;  5J6X A;  1MBE A;  1PP7 U;  1ZG3 A;  2LVS A;  3FM3 A;  2GIZ A;  1F9N A;  3G73 A;  1N77 A;  5HLI A;  2BOL A;  2VAS A;  2MSY A;  2RQP A;  3M9A A;  1STZ A;  2CU7 A;  5E18 F;  2E2H J;  1HDD C;  3K4B A;  4HNT A;  2JRT A;  4D5C A;  2STW A;  3K4J A;  2AQF A;  3WGH A;  4RAG A;  3DBL B;  1YRN B;  4ZZL A;  1ZG5 A;  1TQP A;  4A3C J;  3MMY B;  1J09 A;  2A6E F;  2YUS A;  4I7H A;  4YIF A;  5K7H A;  3W6K B;  1TWC J;  3Q9V A;  3ZMV A;  5K7Z A;  5L3E A;  1R5G A;  4ESF A;  3UKG A;  4A3B J;  3W2V A;  2ZBK A;  4CUG A;  3KYC B;  3HKZ A;  3E5U A;  3FK6 A;  2BVM A;  1K79 A;  3E6B A;  1AKH B;  5F0F A;  2K5C A;  4H4K C;  4U87 A;  2DW4 A;  4BE0 A;  2B0L A;  1G3T A;  4O3M A;  5FKN A;  3JSO A;  4S0H B;  3KEY A;  3TKY A;  1AKH A;  1X3U A;  1R23 A;  2Z99 A;  1WSU A;  3CCE I;  3LSP A;  1O7F A;  1LVA A;  4QPQ A;  5DUK A;  4RGU A;  2AO9 A;  2KDZ A;  3BR6 A;  3I71 A;  2BXZ A;  1RUN A;  4RDU A;  1XGO A;  4NHJ A;  1WJE A;  4GYG A;  5J3L A;  2M8E A;  4ENK A;  2K9S A;  2EZH A;  1XGN A;  2MW8 A;  1O57 A;  2E1M B;  3H36 A;  3DV8 A;  4A6E A;  3CME I;  2GIV A;  3PUF A;  4ZYD A;  4HX8 A;  5HDK A;  5EG0 A;  5IYB J;  4DYR A;  2RQQ A;  4DQ2 A;  3L2W A;  1V54 H;  2ZXJ A;  4OAY A;  1JJ6 C;  1FOY A;  5D8K B;  4M6V A;  3HGY A;  4U0W A;  2DXI A;  3HRM A;  2DA2 A;  2CMP A;  3CMY A;  1JTX A;  4BAY A;  2F48 A;  4E4H A;  1OYI A;  3X2Q H;  5IP9 J;  5LGU A;  4ZH4 F;  2E7W A;  2VPR A;  2DPU A;  3OSF A;  1UG2 A;  1VQ8 I;  2HZT A;  1KYW A;  3HEF A;  1Z0X A;  2HI3 A;  4G9Y A;  2IA0 A;  1CQT A;  1WGX A;  2QYO A;  2D1V A;  5EZH A;  3TDU C;  3IV5 A;  2FA5 A;  3M1E A;  3GWZ A;  1FLI A;  2FEZ A;  3HUG B;  1JUS A;  5FRO A;  5FKL A;  1W7P A;  4BBS J;  4QIW N;  1BI1 A;  2A68 F;  1XGM A;  1SVL A;  4U0V A;  1QO0 D;  4ZC3 A;  1Y1W J;  1E3H A;  1VF9 A;  1X1P A;  3QOD A;  1ZTR A;  3S2H J;  2O0Y A;  4RM2 A;  4Q48 A;  3C2B A;  1YOV B;  2P4W A;  1VQ4 I;  4Y3O A;  1WJC A;  1MMA A;  3VFZ A;  1T08 B;  2P0W A;  1MDM A;  1ZRE A;  3J7Z I;  1T95 A;  1N75 A;  2H1K A;  4LFU A;  3LL7 A;  4ENN A;  5M3M J;  3DKY A;  2L4A A;  1WJF A;  2P5V A;  3GBG A;  4Y17 A;  2VXD A;  5B1B H;  3M4O J;  2ESH A;  4Y4R A;  2DJI A;  2WY7 Q;  2ZJ2 A;  4XLC A;  4DOZ A;  3ZN1 A;  4QTR A;  1D1B A;  5FGM A;  2COM A;  4XM3 A;  1HCR A;  5F1R A;  1R4N B;  4U7D A;  1HKQ A;  2CW7 A;  2LKX A;  2IS1 A;  5BMZ A;  2M7A A;  1TT0 A;  1OYW A;  2VOP A;  2CV1 A;  4EAT A;  2DT5 A;  3OOU A;  5GPA A;  1B9M A;  1MMG A;  1SEU A;  3ZR8 X;  3W2W A;  2XAQ A;  4N9I A;  2EH3 A;  1IXR C;  3F8C A;  3TGN A;  3E7L A;  2Z33 A;  2Y30 A;  4RB1 A;  2VJI A;  1WH5 A;  4IO9 F;  3IP4 B;  1YRN A;  3MCZ A;  3QWL A;  3O3K A;  4IZZ A;  1S6L A;  5K7F A;  5KAF C;  2X48 A;  1FSH A;  4KN7 X;  4XRM A;  5JR3 A;  1WJD A;  1U3E M;  3GFJ A;  3K1M A;  2N8G A;  2BGC A;  4KIB A;  4KFC A;  1SFX A;  1XTA A;  1MMS A;  1VQ9 I;  2NVY J;  2K27 A;  3OYJ A;  4D7N A;  4AWX B;  1BJA A;  1V5E A;  4UUS A;  5ERI A;  2CRG A;  3VSK A;  4RS8 A;  1YS7 A;  2KP6 A;  3PJR A;  2FUG 2;  2XGX A;  3TO9 A;  4E7J A;  5BNG A;  4EM1 A;  3MVP A;  3JCU C;  5B3S H;  1MH4 A;  4S05 A;  2LK2 A;  3KLN A;  3OYD A;  3RKY A;  2HOA A;  4Y13 A;  4XID A;  3HDD A;  4XBF A;  3I53 A;  2OTJ I;  3E97 A;  1X2N A;  4A5M A;  3OYN A;  1SFO J;  4ZDP A;  2Y48 A;  3BR2 A;  3OYA A;  1Y56 A;  3K0L A;  4IHX A;  3PNY A;  4F52 A;  2IS2 A;  1R1V A;  3DXJ F;  1BN5 A;  5HNH A;  3JRC A;  4M3B A;  2M30 A;  2CQK A;  2RV8 A;  3BR3 A;  4PGG A;  1T0F A;  2A6T A;  3G3Z A;  2F5V A;  3H9G A;  4AYB A;  2FU4 A;  2DA6 A;  3K4L A;  3KET A;  1IJW C;  3SDG A;  2FOK A;  1TW2 A;  2E71 A;  1QPM A;  1OPC A;  4B43 A;  1P4X A;  3WTT C;  2W00 A;  3MEX A;  1TNT A;  5D4S A;  1A5J A;  2EFP A;  3D0S A;  3DEU A;  4P5O A;  2CW0 F;  4J01 A;  1X4P A;  3QU6 A;  4BAC A;  1MMD A;  3CCJ I;  3L7W A;  3W6J B;  5EZG A;  3GTQ J;  2X4H A;  3DKW A;  2NS7 A;  4FE4 A;  5HLT A;  4ZDL A;  3T8R A;  3VYU B;  4PJ0 C;  2YU3 A;  2ECB A;  1G2H A;  2DFE A;  4EVI A;  1ZYR F;  1JKP C;  1OYY A;  3KYL A;  1NHA A;  1O3R A;  2PJP A;  3G71 I;  1YYV A;  3J7A Y;  3QPS A;  2EZK A;  2XGC A;  5JVT A;  1XG1 A;  5M5Y J;  3JRF A;  3GYH X;  3OYI A;  2DQR A;  1MKM A;  5FJ8 J;  2F5F A;  2F6C A;  3D1N I;  1IN8 A;  4D0P A;  1LE8 A;  3HSE A;  2EA4 A;  5LRS A;  1H89 C;  1QGP A;  3I55 I;  4BS9 A;  1MW7 A;  1LE8 B;  3QPT A;  3J81 Z;  3KP3 A;  1VQN I;  2I10 A;  2E2I J;  4BQQ A;  4C2U A;  5IOZ A;  4CDG A;  3BTC A;  4KA4 A;  3AL0 B;  4E70 A;  1FC3 A;  2HGC A;  3BCA A;  2E5N A;  1VI0 A;  1P9Q C;  1X3Z B;  4PJM A;  4FE7 A;  4Q47 A;  1I3Q J;  3CUO A;  2GXB A;  3ZQC A;  2LD5 A;  2O8X A;  1JTY A;  2FRH A;  5KVR A;  3BTL A;  4A93 J;  1B4A A;  1YG2 A;  3DFG A;  3ASO H;  1P7J A;  2IA1 A;  2VBX A;  4YRV A;  1UMQ A;  2L7F P;  3HOS A;  2ICW G;  4OWR B;  1IV6 A;  3FXR A;  2FNP A;  5IT3 A;  4JX5 A;  2M87 A;  4HRI A;  4BUP A;  1E3O C;  3AG4 H;  2I5U A;  1U9N A;  1MGT A;  3BJ6 A;  4R79 A;  1W4M A;  3GF2 A;  4UVB A;  2R7Z J;  2XPW A;  1GDT A;  3V8L A;  3ZCO A;  2XGD A;  2WAF A;  2BVL A;  4UHT A;  4M3F A;  3V7R A;  2IAI A;  2V7F A;  1GVD A;  1XCB A;  2VKD A;  2R0Q C;  2KMU A;  3G1O A;  4RM3 A;  2IS6 A;  3L9F A;  4YIR X;  1G59 A;  4XN0 A;  1MIJ A;  1JHH A;  3IRR A;  4XOP A;  4NQW B;  2VPL A;  1ETO A;  2X6O A;  3N05 A;  4MHG A;  1U8R A;  4IHW A;  4DGW B;  3HTU A;  2GOX B;  5HDN A;  1HA8 A;  3CUQ A;  3I59 B;  3V8K A;  2L9S A;  4CYD A;  3I4N J;  1U9O A;  1PYV A;  2EFN A;  1OCR H;  1ETW A;  4IXA A;  3A2K A;  4DZJ A;  2LP0 A;  1U5T C;  1DU0 A;  2DDA A;  4P9U A;  5GAE J;  2OCC H;  2YSR A;  2OV7 A;  3KZY A;  3IWZ A;  1Z1D A;  2WV0 A;  3CJR B;  3ZMU A;  2ZXI A;  2HVR A;  3H5N A;  3IH2 A;  1HF0 A;  1IRF A;  4FAS D;  4ZTF A;  1HKT A;  2XF6 A;  3BQZ A;  2NS8 A;  1R9T J;  1BR4 A;  4HF2 A;  3HHH A;  2W85 A;  4IL6 C;  5DUI A;  2L7Z A;  4UVA A;  3H35 A;  4XSX F;  2ISZ A;  2LDU A;  3MWM A;  4IEJ A;  3TOB A;  2WTE A;  1IAW A;  1DP3 A;  1XMK A;  5LFA A;  2JK3 A;  1W1W E;  2EIM H;  3KEO A;  2Z5U A;  2E34 A;  4Y7N J;  4BXX J;  1GLN A;  4G6D A;  2Z9O A;  4I01 A;  3C18 A;  2R7S A;  1B1B A;  4A3D J;  4LMY A;  2JSC A;  1Z3Y A;  1A04 A;  2XAH A;  1X58 A;  1ODD A;  4FTH A;  2HXI A;  4XRS A;  5ICF A;  4A3M J;  1MJ9 A;  2DCE A;  3FF5 A;  3BG3 A;  5C4J J;  4EMS A;  3CC4 I;  2E36 A;  4KIC A;  4M9Z A;  2EFQ A;  4GCV A;  3K10 A;  3TOA A;  1ZEL A;  2FSW A;  1POG A;  1E0E A;  1I5Z A;  2ZNZ A;  4IKF A;  2NVX J;  4KIG A;  2W57 A;  1SMT A;  4JK1 X;  2L7M P;  1V5F A;  1I1S A;  4PCQ A;  2ZFU A;  5F64 A;  1S7O A;  3HOZ J;  4QLC U;  3I9V 2;  2DBB A;  4BHC A;  1ZRD A;  4F92 B;  1EV7 A;  2ZSH B;  3PSI A;  1MDM B;  3DKX A;  2GXA A;  1Y8R B;  2OC6 A;  3K2A A;  4HF1 A;  3HOV J;  3GX4 X;  1RPW A;  1T38 A;  3BZK A;  2YX4 A;  3HPG A;  2JVG A;  3HBL A;  4KT6 A;  2ZME A;  4KIF A;  2VE9 A;  2MAB A;  4G6T B;  2HKX A;  1PUF B;  2O5R A;  4RMN A;  2X6Y A;  3ABL H;  1BJZ A;  4RLF A;  3DF8 A;  1OCO H;  1OLT A;  2XRO A;  5HS8 A;  5E3L A;  3CO6 C;  4A6D A;  2X6X A;  2W25 A;  2ZXW H;  3SFZ A;  5IOY A;  2MH9 A;  1WPK A;  4H0E A;  3BJA A;  5M5W J;  2LRE A;  5K5R A;  5L3D A;  4F3Q A;  4OIP F;  2LSO A;  4HQM A;  1SVM A;  1EKE A;  3LSJ A;  4OIQ F;  1IC8 A;  2KIS A;  4E7L A;  2HYJ A;  1KQ0 A;  4E6K G;  2LKP A;  1LNW A;  2MGQ A;  2X9D A;  3R0A A;  3HTS B;  1VND A;  2XAG A;  5E17 F;  2R3S A;  3QOP A;  3HJE A;  3EUH C;  3LMM A;  3S3M A;  1Z6R A;  1T39 A;  1BI0 A;  3I4P A;  3SQN A;  1RC9 A;  2QQ8 A;  3F8B A;  4C3I J;  2P5L C;  2HFH A;  3IWF A;  3Q0V A;  3HOT A;  3N4M A;  5IY5 H;  4B47 A;  1LB2 A;  1VQK I;  1O3T A;  2E2J J;  2AXL A;  3E6C C;  4I0A A;  4KIT B;  2VON A;  2AHQ A;  3EUA A;  3G1M A;  1T56 A;  2EBI A;  3JW4 A;  5J40 A;  4RAY A;  1C0W A;  2PX9 A;  3OIP A;  2DTR A;  2F5E A;  3D5S C;  1DP7 P;  3OS1 A;  4HYE A;  4DJA A;  4FHT A;  2K9N A;  3CC7 I;  4U7B A;  3BR1 A;  5BPD A;  2V6C A;  4M3G A;  4IRH A;  4HX7 A;  4M73 A;  3S3O A;  1ON1 A;  3PL8 A;  2G7H A;  2IRF G;  3CES A;  1WH7 A;  3LSI A;  3QPH A;  3ZP5 A;  5GP9 A;  3WTS C;  4MEX F;  3S15 J;  1FSE A;  1J7K A;  3WU0 A;  2CS3 A;  2CQN A;  3G6E I;  4U88 A;  1JI8 A;  3WTU C;  5M5X J;  3I54 A;  1IUF A;  2M2E A;  4PJJ A;  4XL9 A;  5E3M A;  1QPI A;  3ECH A;  2E60 A;  1YW8 A;  3S1Q J;  2LMD A;  2GXG A;  1S7A A;  2WAD A;  3ZQ7 A;  2HQR A;  3A0H C;  4XLF A;  2NS0 A;  4FIS A;  5CVJ A;  1DGW Y;  1XCV A;  2R92 J;  5L3B A;  6PAX A;  1BA5 A;  1SFK A;  2CQX A;  1WI3 A;  2PJR B;  3IH4 A;  1U2W A;  2XF5 A;  2BW3 A;  1HC8 A;  2CFX A;  4A69 C;  3GW2 A;  3RIR A;  1MBF A;  3FXO A;  2P7V B;  2F5C A;  3H3Z A;  4XR6 A;  2O6G E;  3CUQ B;  4F93 B;  2R7T A;  5LEJ A;  3L2Q A;  1W5T A;  2OA4 A;  4LLN A;  2PEX A;  4QWQ A;  3GTJ J;  2HQ5 A;  3QU3 A;  2TDX A;  4BQO A;  1IXS B;  4PSW A;  4XLN F;  3C3W A;  1HQC A;  3S1N J;  1ETK A;  5BOX A;  4BXU A;  4G6Q A;  2VOD A;  4JYK A;  4KJZ A;  2V9V A;  2GLO A;  2DA1 A;  3IC7 A;  5DCM B;  2XSD C;  5CPR B;  2QEN A;  1ZRC A;  4UVC A;  4NQW A;  1O4X A;  4I09 A;  2XPU A;  4XLP F;  3FX3 A;  5CQG A;  5J8F A;  4R8H A;  2Q2E A;  4EM2 A;  3F72 A;  3EDP A;  4XKC A;  2GQQ A;  4RBO A;  1IXC A;  2DK5 A;  3EYY A;  5EEG A;  3NAR A;  3ZQH A;  3HC7 A;  5DD4 A;  4DBQ A;  2P81 A;  1ZH5 A;  5JLW A;  3CCM I;  3E3V A;  4G8X A;  1R6R A;  2YU9 J;  4XON A;  4GFB A;  2ZCW A;  2BY3 A;  4UUV A;  3F8M A;  3RKX A;  5JFR A;  1XSD A;  2PFB A;  3CMA I;  1PUE E;  3K4C A;  2R5Y A;  2A07 F;  1GV2 A;  3MZ8 A;  1D0X A;  5D6F A;  2RGV A;  3Q0W A;  3MN2 A;  4MIM A;  2B63 J;  4PJL A;  4D5F A;  1RKT A;  5GTI C;  1HDP A;  4LIU A;  1NG7 A;  3FIS A;  4MO7 A;  4UNO A;  5HS7 A;  2EZL A;  1Y1V J;  2NVU B;  3OL3 A;  2H1L A;  2D45 A;  1A31 A;  1VQL I;  1G6N A;  3QRF F;  2UWM A;  2ZSI B;  2MLK A;  3Q3S A;  2KIU A;  2YX7 A;  1YW9 A;  2FD5 A;  1ON2 A;  1P6R A;  5D5V B;  1FJL A;  1MSF C;  2E5Z A;  2XKP A;  1W5C C;  3IH3 A;  4KIS A;  1N78 A;  5D4R A;  2XRL A;  3VOD A;  2TCT A;  2HDD A;  5ILS A;  2L01 A;  3TBI A;  1W36 D;  2KZG A;  1VQM I;  2R7V A;  3ZMS A;  4NC8 A;  5ED4 A;  2QKM B;  3WTX C;  4BXF A;  1ZLK A;  4BNC A;  3KZI C;  2LH9 A;  5DTD A;  4V19 K;  1CGP A;  2WAQ N;  4WXC A;  1I39 A;  2K9Q A;  2DFH A;  3IRQ A;  2IVM A;  3RPU D;  2MA3 A;  2OBP A;  3M8E A;  1I50 J;  2CJJ A;  2HVQ A;  4RAZ A;  4GDF A;  4YEJ A;  3MD2 A;  3WHC A;  2R7Q A;  4BGD A;  2VOO A;  3U21 A;  1Y8Q B;  1SD6 A;  2DYS H;  1FYL A;  3GUD A;  4UV9 A;  4LG0 B;  3HKZ N;  4MTD A;  4BJ6 C;  4WWC A;  2D1H A;  3RPU A;  2XB5 A;  3E6M A;  1B9N A;  3BZC A;  2R5Z B;  4RLQ A;  3BPX A;  2YPR A;  3P7N A;  4RGS A;  4F55 A;  2FML A;  2LC2 A;  2ZNY A;  1FOW A;  1REP C;  2BY2 A;  1F43 A;  5GTH C;  4PGH A;  3J81 K;  4D1Q A;  4S04 A;  1D8J A;  4BY1 J;  5DM6 F;  4XNF A;  2PLY A;  3OS0 A;  2BEO A;  4ZJZ A;  3RZO J;  3GFL A;  2LY1 A;  3HYI A;  3L1P A;  1YJW I;  1PJR A;  1T0F C;  4GGG A;  1RIO H;  1YX3 A;  1AHD P;  2EIL H;  4XRS G;  4XMY A;  2XGE A;  1QU3 A;  3OYG A;  3ABU A;  3MZY A;  1ETY A;  5HDG A;  3RKQ A;  4LLG F;  2IJL A;  1W5S A;  4HG2 A;  1ULY A;  3GME A;  3LSH A;  2RRE A;  4M6X A;  1YX5 A;  5AON A;  1MSE C;  3R6S A;  1WRJ A;  3CCL I;  3B73 A;  3KLO A;  1UST A;  2Y2Z A;  1G4D A;  3W3C A;  3HG9 A;  3M8J A;  4C9Y A;  2KIQ A;  3WTV C;  3CCV I;  4L0Z B;  2KL4 A;  3RTR A;  3Q5F A;  3JAM Z;  2DU9 A;  1FIP A;  3BTJ A;  2O03 A;  2HKO A;  4NDL A;  4IRG A;  3JSP A;  4HOB A;  2CH0 A;  2V1X A;  1FBQ A;  4UV8 A;  4M3D A;  4HAM A;  3RI4 A;  1J9I A;  2ISY A;  3H0G J;  2EIK H;  1GT0 C;  1RES A;  1NK3 P;  4N9H A;  3EUH A;  4LK1 F;  4W1U A;  5IP7 J;  4ZYG A;  4B4C A;  1MH3 A;  4L5E A;  1BI2 A;  3PO2 J;  5C4X J;  1SC7 A;  4DW6 A;  4P1W A;  4UUS B;  1LFB A;  2K02 A;  3OIQ A;  2R5Y B;  3ZMZ A;  2W4S A;  2QBY B;  1EH8 A;  2W1O A;  1JKO C;  2XAU A;  2DFI A;  1TBX A;  4AUX A;  2F4M B;  1HW1 A;  4AVZ A;  4EGY A;  2VKV A;  2M5W A;  2X1E A;  2P7C B;  4PFO A;  2NYX A;  4ANJ A;  4G7Z F;  1DQU A;  2XAS A;  3KPH A;  1X2M A;  1RRJ A;  2M9H A;  2DOD A;  2VBY A;  2ZFW A;  1QVT A;  2M0C A;  2M4G A;  3CDH A;  4ZDO A;  2KKO A;  2JJ7 A;  2QQB A;  5J4V A;  2HR3 A;  2I8D A;  3BC8 A;  2KZV A;  3HUG A;  5CLS A;  3N97 A;  2ZJQ F;  1TC3 C;  1W7P B;  4O5V A;  3RCO A;  4D9J A;  3CJN A;  1J2X A;  2KHM A;  3BR0 A;  1ACI A;  4B3A A;  2BHZ A;  2KJC A;  4B1R A;  1UHM A;  3GTK J;  1FPQ A;  4B44 A;  4RGX A;  3S3N A;  1TWG J;  2A3S A;  2VJ4 A;  1KYZ A;  2X51 A;  4IPA A;  3OYC A;  1QBJ A;  4LB5 A;  3NWT A;  3ZMD A;  1WKM A;  3GEZ A;  1B59 A;  4M71 A;  1YI2 I;  4UXN A;  3J7Y J;  4X6A J;  2M3A A;  3H92 A;  4N4O B;  4ABZ A;  5H20 A;  3WOD F;  2DOA A;  4QPO A;  2XAF A;  4BL0 B;  2EK5 A;  5IYD J;  3FDY A;  3H0D A;  2M8G X;  2VXZ A;  4XKV A;  2ZB9 A;  2ID6 A;  2UXN A;  2PJR A;  5IPA A;  3F22 A;  4BDZ A;  5F0H A;  1GHC A;  1QRY A;  3CMM A;  4CCK A;  1WHU A;  3CF2 A;  4NBQ A;  4AVP A;  4ETS A;  1WJB A;  5CJ9 A;  5DCM A;  2DDB A;  1IW7 F;  1JGS A;  3FKI J;  4ESJ A;  1UG0 A;  3E6D A;  1QNT A;  3IAS 2;  1P7I A;  5B66 C;  3LSM A;  3GTG J;  3PUB A;  4I98 B;  1HW5 A;  1WWX A;  4A3G J;  2LRD A;  4IQ4 A;  2MD5 A;  3R0J A;  4E7Z A;  2L02 A;  2JN6 A;  2K85 A;  1A36 A;  2ZXH A;  2JRM A;  4F7Z A;  1FTZ A;  2EB7 A;  4A2U A;  2GAU A;  3OYM A;  2VT3 A;  2LF8 A;  5JVG F;  2DMU A;  1MD0 A;  4J00 A;  1XDU A;  4ZYH A;  3A01 B;  2GM4 A;  3S2D J;  3FXU A;  4E7K A;  2VE8 A;  5HS9 A;  1ZK8 A;  2MC4 A;  1SD4 A;  2LLK A;  1BR1 A;  3PQK A;  4KUM A;  2VC0 A;  4L0Y B;  3DLL F;  2ELJ A;  4DIQ A;  3KX2 A;  2UXX A;  3KP6 A;  4KDP A;  2DMN A;  4A3J J;  3CUQ C;  5FLX Z;  3OYE A;  3KFW X;  1TP4 A;  4TV7 A;  3D5R C;  3MZH A;  3O8H A;  3F6O A;  2LFB A;  2D2W A;  5D6E A;  2IT0 A;  2UUZ A;  4I2O A;  4IHT A;  2DT6 A;  3CZ6 A;  3KP4 A;  3A1Y A;  4HPQ A;  1XN7 A;  2H8R A;  2R93 J;  1EJ9 A;  1P2F A;  2HZD A;  2XB0 X;  5JHF A;  1ZG1 A;  5TGT A;  3SEQ A;  1D0Z A;  1MND A;  2OZ6 A;  4CXF A;  4CHU A;  3ABK H;  1IN5 A;  5LHI A;  3BOQ A;  2M34 A;  3A4C A;  3OL4 A;  2ADU A;  2Z1D A;  1KU2 A;  2ME6 A;  1GV5 A;  1S8N A;  4V2F A;  3CCQ I;  3DPU A;  2QQ9 A;  1U6G A;  5GAD J;  1Q1H A;  3L00 A;  2WBM A;  4KMU X;  3H5A A;  5A2Q Z;  1FNN A;  3J80 Z;  2VKE A;  3LAJ A;  1X1D A;  2AQE A;  2KJB A;  3WHB A;  3CCU I;  1YIJ I;  2R4G A;  2DN0 A;  2CUZ A;  3R4K A;  2DOF A;  3HXL A;  3PM1 A;  3T1B A;  2M1B A;  2VBW A;  5FLM J;  5FLV A;  1BW5 A;  5EYR A;  1R5I D;  3IUO A;  3LSK A;  1K83 J;  3BG6 A;  2K4J A;  2L3D A;  3E0J B;  1GXQ A;  3JRD A;  1A6Q A;  2CWE A;  2X85 A;  3F0C A;  2OQR A;  4RB3 C;  2IXS A;  3G1L A;  2A05 A;  4I02 A;  3A02 A;  2EV6 A;  1LVK A;  1FBS A;  2V26 A;  3VYT B;  4IHV A;  1D5Y A;  2BY0 A;  2QKL B;  4Y52 J;  1QA6 A;  3VB2 A;  2DA7 A;  2DI3 A;  4M72 A;  3KIO A;  4HV6 A;  3FM5 A;  4D7M A;  3DCF A;  1JE8 A;  1BR2 A;  2IS4 A;  3CJQ B;  1WCM J;  2F2E A;  2UV1 A;  1TQM A;  2DYR H;  4XN3 A;  4CCJ A;  3RJP A;  5HLG A;  3ZQI A;  3DEW A;  5CYV A;  4M9X A;  4B3X A;  5AIQ A;  1K78 B;  1FTT A;  3MQ0 A;  3QOE A;  3H5R A;  1OR7 A;  3NQO A;  4EJT A;  5TJJ A;  4X1E A;  4KNY A;  3CP8 A;  3M3Y J;  1QZE A;  1B72 A;  1T6S A;  2OU2 A;  3DLA A;  3ROU A;  2HDC A;  3LFK A;  2MG4 A;  3CF5 F;  1HW2 A;  2KT0 A;  2CUJ A;  5LRR A;  2DMQ A;  1ETQ A;  1UHW A;  1V55 H;  2PMZ N;  4BJT A;  1HBX G;  4MTE A;  1IG7 A;  1HXD A;  2FF4 A;  1QHG A;  3M1C A;  2NVQ J;  1Z67 A;  3HZJ A;  2EQR A;  2Y0M A;  3OMY A;  1TQI A;  4JP0 A;  3BR5 A;  3H1C A;  1EA3 A;  1M1E B;  3OOP A;  3CQZ J;  5D5X B;  2HEO A;  1SFU A;  2DJN A;  3HOW J;  3S17 J;  1P4A A;  4BY7 J;  1OFC X;  2QBY A;  4YFK F;  1T8I A;  3JAM K;  3PO3 J;  5C3E J;  3M8F A;  3LQQ A;  1IDZ A;  1PP8 F;  3HM5 A;  1W7P D;  1MBH A;  2XRN A;  5K5Q A;  1BW6 A;  2QA4 I;  2HXO A;  2P6T A;  2YR2 A;  3BTI A;  4HLY A;  2PG4 A;  5F08 A;  2UZK A;  1FP2 A;  1JT0 A;  1F4K A;  3CCY A;  2K3P A;  2HOT A;  3S1M J;  4ON0 A;  2EWN A;  1ONV A;  4DNC A;  2MYS A;  3C7J A;  1CF7 B;  1QHH D;  3VDX A;  3BPV A;  3P9C A;  2GWR A;  3TP0 A;  3QP6 A;  3G4S I;  2EA2 A;  3HOY J;  1Z7U A;  2CSO A;  2RNJ A;  5E1Z B;  2KRC A;  2HU9 A;  2E1M C;  3OYK A;  3S93 A;  3BCB A;  1T98 A;  5H2F C;  4IOC F;  2QGU A;  3C2G A;  3G2B A;  2OZU A;  1E17 A;  2DOE A;  2H6C A;  4M9S A;  1J75 A;  2E1O A;  4MNU A;  4I0B A;  5K1Y A;  1XC5 A;  1D0Y A;  2XKO A;  4WF2 A;  3CP2 A;  4LG3 A;  3SEZ A;  1IN6 A;  2OD5 A;  2WC2 A;  5DDG A;  3WGI A;  2EFO A;  2GOM A;  2HPI A;  3I64 A;  2ESN A;  3EUK L;  3H3U A;  3BQY A;  3A0B C;  3ECO A;  1MNM C;  4BDY A;  5ILV A;  4HF0 A;  5EEA A;  3Q9S A;  3S8P A;  3K70 D;  1V3F A;  4FX4 A;  4BBR J;  1K4S A;  1W0T A;  1TNS A;  2CQQ A;  3V7S A;  4M74 A;  1D3Y A;  3FK7 A;  1YTY A;  5LHH A;  2L9V A;  4I99 C;  3F3X A;  2D5V A;  2XAJ A;  5KNL A;  5L3G A;  4PSX A;  1TWA J;  1OR7 C;  2O9L A;  1H9T A;  2LY9 A;  3TMO A;  1E2X A;  1S7E A;  4BEH A;  5F6F A;  2XPV A;  4DBR A;  1I27 A;  1HSJ A;  4MLO A;  1RI7 A;  4ZYE A;  1J5Y A;  2E19 A;  1WQ2 A;  5TIS C;  1JJ8 C;  3FXJ A;  1SAN A;  2QF7 A;  2K40 A;  5E3O A;  4P96 A;  9ANT A;  3TO6 A;  1XDS A;  2IGM A;  2JUC A;  2P8T A;  2VKH A;  4DZP A;  4BQN A;  1LQ1 A;  5D5U B;  1SFE A;  3H9J A;  5DS9 A;  1U78 A;  4XLE A;  3JRB A;  2KFD A;  2MFZ A;  3PNT A;  4A5N A;  2CO5 A;  3PIO F;  2FXA A;  4JOM A;  4BHB A;  1X3W B;  3WTW C;  2H09 A;  1BOA A;  3PQJ A;  5HOO A;  2LKS A;  5J1R A;  2OTL I;  4HDV A;  3OV8 A;  1HLV A;  4JBA A;  1K7A A;  5EG0 B;  3OIO A;  3LST A;  2R7R A;  4V2G A;  2A6H F;  5DV5 A;  2ETH A;  2DMP A;  1AWC A;  2JVH A;  1P92 A;  4Z2Y A;  2G7U A;  1KQ9 A;  4AID A;  4LIT A;  3DTI A;  1RKW A;  2LR8 A;  1YJN I;  3HRS A;  4MQV A;  1TZL A;  3DBH B;  3CCS I;  1UCR A;  2V1D A;  5F04 A;  2ZO4 A;  1I1G A;  1X1A A;  1FYM A;  3IKV A;  1IRX A;  1YHQ I;  5FLX K;  1NK2 P;  2CQ7 A;  3BZ6 A;  2NOJ B;  3VEP A;  2DK8 A;  4PFP A;  2Z3Y A;  1D8K A;  2JA2 A;  1TL8 A;  4M3E A;  3K4M A;  3CJT B;  3K69 A;  2JT1 A;  5E20 A;  1SD7 A;  1RZ4 A;  2QSG X;  4A12 A;  4BU2 A;  4C30 A;  2HS5 A;  3NEU A;  2IGO A;  3NAU A;  3ZQQ A;  3ERE D;  1XPX A;  3GLL A;  5E8G A;  1IZ1 A;  2EIJ H;  2H27 A;  2HDW A;  1XGS A;  1Z9C A;  4E7I A;  2WB1 N;  1LFU P;  4IHS A;  2Y0S N;  5KHD A;  1PUF A;  1S3J A;  2BHY A;  2HQN A;  2VUM J;  1SAU A;  1ZGA A;  1IV8 A;  3GTP J;  1OCZ H;  3HSR A;  4OAZ A;  5KCM A;  1H8A C;  5JHU A;  4KMF A;  2FJ1 A;  4HQE A;  3RKW A;  2VQC A;  1N25 A;  3O8G A;  3MKZ A;  3U2R A;  1OJL A;  3CDI A;  2FOW A;  2YS9 A;  1W36 C;  2LYC A;  1B6A A;  2VIX A;  1JGG A;  3ISP A;  1ITY A;  4HNU A;  2J5O A;  1O3S A;  2QEX I;  4Q5S F;  3MKY B;  4YG2 F;  3OS2 A;  4L9J A;  3BG9 A;  3RQI A;  3S32 A;  1JXS A;  3CDL A;  3DPL C;  2NXN B;  2CFO A;  2ME0 A;  3BG7 A;  2CUE A;  3QP5 A;  1APL C;  2A61 A;  4A3F J;  3ASN H;  3ABT A;  3TED A;  2XV4 S;  4YEL A;  1K6O A;  3VSL A;  1ZGW A;  2DTZ A;  3FHN A;  2XUB A;  4BEH B;  1BC8 C;  1OCP A;  3WU2 C;  1FY7 A;  3C1D A;  4OIN F;  1ENH A;  4O6J A;  2B7E A;  4ENM A;  2EFW A;  2IEK A;  3JRI A;  3HSF A;  2ZC2 A;  2OF7 A;  2MC3 A;  1FWZ A;  3F21 A;  2EV0 A;  1IF1 A;  1RNL A;  5LD2 C;  1KGS A;  4DYC A;  2LG4 A;  4GO1 A;  5LBQ A;  3DP7 A;  3LAP A;  5DM7 F;  1DGR M;  3U1K A;  5FKO A;  4UY8 I;  3J7A O;  4IJA A;  3F8N A;  3K70 C;  4KN4 X;  5KAI C;  3U1D A;  1JHF A;  5J1U A;  4NC6 A;  4AIJ A;  1K78 A;  2CV0 A;  3H3V K;  3I5U A;  4C2T A;  2AXT C;  2ACJ A;  1AA7 A;  1BBY A;  2KRF A;  2R7F A;  5L3F A;  5E1W A;  1F36 A;  3K6G A;  1YFH A;  1YO5 C;  2V9K A;  3KP2 A;  4MFD A;  4Y15 A;  3RYR A;  1USS A;  2STT A;  2BBY A;  2KIM A;  1VTN C;  4LK0 F;  3REO A;  2P6S A;  3SDB A;  1TTY A;  1UHS A;  2MLG A;  4JX4 A;  1XX5 A;  1Y0U A;  2Y0S A;  4CH7 A;  5C44 J;  4I76 A;  4G7H F;  3V8J A;  4XLA A;  1JKR C;  1B8I B;  3K1P A;  3I0T A;  3PFI A;  4ASN A;  3B6C A;  1LEB A;  1O3Q A;  3BT9 A;  1PDN C;  3OYF A;  2XHK A;  2V9P A;  4ZZD A;  2JSP A;  3TW7 A;  3U9G A;  4AC0 A;  2HNH A;  5BQT A;  3L2U A;  2RC4 A;  3F8F A;  2VC1 A;  2VL8 A;  2KIF A;  4OMY A;  1NH3 A;  2JWT A;  2RAE A;  4M6Y A;  3ZMT A;  2JQ7 A;  1XMX A;  3ZRG A;  3A03 A;  1JUP A;  1IRG A;  2OCE A;  4ITV A;  3EQL F;  3QYE A;  3ZOB A;  3ZQL A;  3S1R J;  5LLQ A;  5HOD A;  3O2P E;  2X0L A;  3QYB A;  4ENJ A;  4BJ5 C;  3SXY A; 
#chains in the Genus database with same CATH homology
 2HOE A;  5ICG A;  2WWY A;  3BRO A;  1YIO A;  5AIP A;  3R61 A;  3V4G A;  3SZT A;  1YQA A;  1IN7 A;  3FXQ A;  2XIG A;  3TQN A;  4A0X A;  4G7O F;  2HTS A;  3SZP A;  2CGP A;  1ZAR A;  4B8X A;  4HX4 A;  3TO7 A;  3ULQ B;  3LQR A;  4LB6 B;  2NNN A;  1V4R A;  3GLX A;  3KP5 A;  4L9V A;  2CG4 A;  2E1N A;  4EM0 B;  2VT2 A;  2W84 A;  3K9T A;  1R7J A;  3AAF A;  4HW0 A;  2ZME B;  1I6X A;  2JZY A;  5DCF A;  3BDD A;  3L2C A;  1XMA A;  3WE3 A;  2GA2 A;  1FBU A;  1P4W A;  1ZGJ A;  5D5W B;  1F1Z A;  5L3C A;  1DDN A;  1KQ8 A;  1LDK B;  2PQ8 A;  1R36 A;  3B02 A;  4G94 A;  3CLO A;  3FMQ A;  3TDZ C;  5H6Q A;  3O6B B;  2HWV A;  1ZRF A;  2A5Y B;  2QVO A;  1YS6 A;  5D8L B;  2GZW A;  4HV5 A;  1GVJ A;  2K7L A;  3D5L A;  4MEY F;  4LJZ F;  3KCC A;  4OOI A;  1RUO A;  4L9T A;  3P9K A;  3CO7 C;  4WX9 A;  2L4M A;  1LEA A;  1BIA A;  4CGZ A;  5IT9 K;  3I59 A;  2V1U A;  1XD7 A;  4RGR A;  4YFN F;  3FWE A;  3EYI A;  3QAH A;  1FP1 D;  4K2E A;  5FFZ A;  2OQG A;  2FBI A;  2VN2 A;  5LGT A;  1EH6 A;  4EJO A;  2ELH A;  2EV5 A;  1QQI A;  5FD5 A;  2PMU A;  2HYG D;  1LDD A;  2JTV A;  3FZV A;  2IW5 A;  2RKH A;  3WE2 A;  1SD5 A;  1HST A;  1BC7 C;  1G3W A;  2FBK A;  3GVA A;  3COA C;  3RYP A;  1XSX A;  3NRV A;  3SHF A;  3GZ5 A;  3FMR A;  5ICC A;  1H0M A;  1XB4 A;  2NRA C;  1FT9 A;  3IL2 A;  5H6R A;  1R1T A;  4GXO A;  2E1C A;  1QZZ A;  5CVR A;  4IRI A;  4R1H A;  3WGG A;  4JQF A;  2BE5 F;  1Z05 A;  5JI6 A;  4WXH A;  5FO5 A;  4CZZ A;  4BH9 A;  1HKS A;  1KU7 A;  5ILU A;  2HTJ A;  3ZPL A;  2Y75 A;  1XSV A;  4EJV A;  5BS6 A;  2BYV E;  3T8T A;  4WK8 F;  2EJR A;  1GXP A;  4HDU A;  1LJ9 A;  1F5T A;  3WTY C;  5K5O A;  3IHU A;  2IP2 A;  2RN7 A;  2K4B A;  2FMY A;  5HLH A;  5EEH A;  2O61 A;  1R1U A;  5LHG A;  4GYI A;  4KT5 C;  4A0Z A;  3FMS A;  3R60 A;  3RPQ A;  2BV6 A;  4N0B A;  4A0Y A;  4EV0 A;  3DPT A;  1IN4 A;  5IT9 Z;  5HVQ C;  1R00 A;  2FE3 A;  3EET A;  5FD6 A;  2FNA A;  4BYY A;  3T0Y A;  2DQL A;  2AS5 F;  3T5X A;  2NNY A;  1T2K A;  2L54 A;  3E5Q A;  1YW7 A;  3I58 A;  2QLZ A;  4YFX F;  1IUY A;  3J80 K;  5DYM A;  2XVC A;  2C6Y A;  5ICE A;  3K2Z A;  3F6V A;  2PMH A;  1R5H A;  2P5K A;  4XRF A;  3MAJ A;  4EJW A;  1L0O C;  4LD5 A;  3P9I A;  4IVN A;  2Q8K A;  1DPR A;  5CVU A;  1ZLJ A;  4CO8 A;  1LDJ A;  2Q0O A;  3KP7 A;  1FOK A;  2RVC A;  2DPD A;  2HYF A;  2FBH A;  4ESB A;  3FHZ A;  4L5I A;  5CVV A;  3RDI A;  4OIO F;  4AIH A;  2PI0 A;  3V7C A;  1J0R A;  1OMI A;  1SAX A;  4MQ9 F;  3ELK A;  4AIK A;  5DEQ A;  4RB0 A;  4FT8 A;  3WU1 B;  2MBF A;  4MGR A;  1FZP B;  1FYK A;  3GZ6 A;  3BP8 A;  4EJU A;  1KU3 A;  3JTG A;  3S2W A;  3E5X A;  5DD8 A;  1TW3 A;  1D5V A;  2M45 A;  3F23 A;  4L9N A;  2OAZ A;  1BM9 A;  1KU9 A;  2K86 A;  1H9G A;  5LEK A;  1MZB A;  4CIC A;  3L09 A;  3ZN0 A;  1QZY A;  5BPI A;  3LWF A;  4WXD A;  2A69 F;  4HLX A;  1L3L A;  5KK1 A;  2GA1 A;  5FB2 A;  4KYW A;  1YLF A;  3IKT A;  3HIF A;  2O3F A;  2DO7 A;  4B09 A;  3HRU A;  1SMY F;  5A2Q K;  1BI3 A;  2FQ3 A;  2G9W A;  3CTA A;  2QM3 A;  3BWG A;  3WG9 A;  4HBL A;  1UFM A;  4AD9 A;  1CF7 A;  5TRD A;  4OMZ A;  2LF7 A;  2DLL A;  1UB9 A;  1U5T A;  2PN6 A;  4RB2 C;  1U5T B;  3LA3 A;  2W24 A;  3BJO A;  2ZKZ A;  1R22 A;  3HRT A;  3VOE A;  2MH2 A;  1G3Y A;  3KE2 A;  1DUX C;  3LA7 A;  3GFI A;  2QZ8 A;  3M7G A;  1WI9 A;  1S29 A;  1ZAO A;  2H94 A;  1J59 A;  4PZJ A;  4XSZ F;  5J8C A;  3GFM A;  2QQA A;  3BY6 A;  2R7D A;  2DAO A;  3KEQ A;  1BIB A;  4OIR F;  4L18 B;  1TLH B;  5E8I A;  4L5J A;  1EH7 A;  1AOY A;  2JPC A;  3GO5 A;  1ZN2 A;  1DPU A;  2JPB A;  4P9F A;  2IA2 A;  4BHP A;  1R58 A;  2H6B A;  1FX7 A;  4EQQ A;  5CVI A;  1MJA A;  3K1N A;  3JTH A;  3MFK A;  1KA8 A;  3KZZ A;  4PDK A;  3GXO A;  2E7X A;  3HHG A;  2J5P A;  2V79 A;  4IF4 A;  2CYY A;  2F5D A;  1G3S A;  3DQV C;  2LNB A;  2IPQ X;  4LG0 A;  4FX0 A;  4OU0 A;  1MJB A;  3LA2 A;  1Z91 A;  4HZF A;  2PBI A;  3ML6 A;  2RDP A;  1Z6T A;  5LGN A;  4YII A;  4Q4Z F;  2QWW A;  4BQA A;  4LLL A;  2VBZ A;  4U0Y A;  5FFX A;  2NAZ A;  1O7L A;  2QUF A;  3WTZ A;  4WCG A;  1OKR A;  4HA8 A;  1ZHF A;  5E1X A;  4LGW A;  4P55 A;  4EGZ A;  4NB5 A;  5J6X A;  1PP7 U;  1ZG3 A;  3FM3 A;  1F9N A;  3G73 A;  5HLI A;  2RQP A;  3M9A A;  1STZ A;  5E18 F;  2JRT A;  2STW A;  3WGH A;  4ZZL A;  1ZG5 A;  1TQP A;  2A6E F;  4I7H A;  4YIF A;  3W6K B;  3Q9V A;  3ZMV A;  5L3E A;  1R5G A;  4ESF A;  2ZBK A;  3E5U A;  1K79 A;  3E6B A;  2DW4 A;  2B0L A;  1G3T A;  4O3M A;  3JSO A;  3TKY A;  1X3U A;  1R23 A;  2Z99 A;  1WSU A;  1O7F A;  1LVA A;  5DUK A;  4RGU A;  3I71 A;  1RUN A;  1XGO A;  4NHJ A;  4GYG A;  2M8E A;  4ENK A;  1XGN A;  1O57 A;  4A6E A;  3DV8 A;  2GIV A;  4ZYD A;  4HX8 A;  5HDK A;  4DQ2 A;  2ZXJ A;  5D8K B;  4U0W A;  3HRM A;  4BAY A;  1OYI A;  5LGU A;  4ZH4 F;  2E7W A;  2DPU A;  2HZT A;  1KYW A;  4G9Y A;  2IA0 A;  2QYO A;  2D1V A;  3TDU C;  2FA5 A;  3M1E A;  3GWZ A;  1FLI A;  2FEZ A;  1W7P A;  1BI1 A;  2A68 F;  1XGM A;  4U0V A;  1QO0 D;  2O0Y A;  4Q48 A;  2P4W A;  3VFZ A;  1MDM A;  1ZRE A;  4LFU A;  4ENN A;  2L4A A;  2P5V A;  4Y17 A;  2ESH A;  2ZJ2 A;  3ZN1 A;  5FGM A;  2COM A;  5F1R A;  4U7D A;  1HKQ A;  5BMZ A;  1OYW A;  2VOP A;  2DT5 A;  1B9M A;  2XAQ A;  4N9I A;  1IXR C;  3F8C A;  3TGN A;  2Z33 A;  4RB1 A;  3MCZ A;  3O3K A;  1S6L A;  1FSH A;  4KN7 X;  5JR3 A;  1U3E M;  3GFJ A;  3K1M A;  2BGC A;  4KIB A;  4KFC A;  1SFX A;  2K27 A;  4AWX B;  1BJA A;  5ERI A;  4RS8 A;  1YS7 A;  2XGX A;  3TO9 A;  4EM1 A;  4S05 A;  3KLN A;  3RKY A;  4Y13 A;  4XBF A;  3I53 A;  3E97 A;  4A5M A;  2Y48 A;  3K0L A;  1R1V A;  3DXJ F;  1BN5 A;  2M30 A;  2CQK A;  2RV8 A;  4PGG A;  1T0F A;  3G3Z A;  2FU4 A;  3KET A;  2FOK A;  1TW2 A;  1QPM A;  1OPC A;  1P4X A;  3WTT C;  3MEX A;  1TNT A;  5D4S A;  2EFP A;  3D0S A;  3DEU A;  4P5O A;  2CW0 F;  3QU6 A;  3L7W A;  3W6J B;  2X4H A;  3DKW A;  3T8R A;  2YU3 A;  4EVI A;  1ZYR F;  1OYY A;  1NHA A;  1O3R A;  2PJP A;  1YYV A;  5JVT A;  3GYH X;  2DQR A;  1MKM A;  2F5F A;  1IN8 A;  4D0P A;  3HSE A;  2EA4 A;  5LRS A;  1QGP A;  3QPT A;  3J81 Z;  3KP3 A;  4CDG A;  4KA4 A;  4E70 A;  1FC3 A;  2HGC A;  4Q47 A;  3CUO A;  2GXB A;  2O8X A;  2FRH A;  5KVR A;  1B4A A;  1YG2 A;  3DFG A;  2IA1 A;  2VBX A;  3HOS A;  3FXR A;  2FNP A;  5IT3 A;  2M87 A;  1MGT A;  3BJ6 A;  4R79 A;  1W4M A;  3GF2 A;  4UVB A;  3V8L A;  4UHT A;  3V7R A;  1XCB A;  3L9F A;  3IRR A;  1JHH A;  1U8R A;  4MHG A;  3HTU A;  5HDN A;  3CUQ A;  3I59 B;  3V8K A;  4CYD A;  2EFN A;  4IXA A;  1U5T C;  4P9U A;  2YSR A;  3KZY A;  3IWZ A;  1Z1D A;  2WV0 A;  3ZMU A;  1IRF A;  1HKT A;  4HF2 A;  3HHH A;  2W85 A;  5DUI A;  4UVA A;  4XSX F;  2ISZ A;  2LDU A;  3MWM A;  3TOB A;  2WTE A;  1IAW A;  1XMK A;  3KEO A;  2Z5U A;  4G6D A;  2Z9O A;  4I01 A;  3C18 A;  1B1B A;  4LMY A;  2JSC A;  1A04 A;  2XAH A;  1ODD A;  5ICF A;  1MJ9 A;  3FF5 A;  4EMS A;  4KIC A;  4M9Z A;  2EFQ A;  4GCV A;  3TOA A;  2FSW A;  1I5Z A;  2ZNZ A;  4KIG A;  2W57 A;  1SMT A;  4JK1 X;  1I1S A;  4PCQ A;  5F64 A;  1S7O A;  4QLC U;  2DBB A;  1ZRD A;  4BHC A;  1EV7 A;  1MDM B;  4HF1 A;  3GX4 X;  1T38 A;  2YX4 A;  2ZME A;  4KIF A;  2VE9 A;  2HKX A;  3DF8 A;  2XRO A;  5HS8 A;  3CO6 C;  4A6D A;  3SFZ A;  2W25 A;  2MH9 A;  4H0E A;  3BJA A;  5K5R A;  5L3D A;  4OIP F;  2LSO A;  4HQM A;  4OIQ F;  1KQ0 A;  2LKP A;  1LNW A;  3R0A A;  3HTS B;  2XAG A;  5E17 F;  2R3S A;  3QOP A;  1Z6R A;  1T39 A;  1BI0 A;  3I4P A;  3SQN A;  3F8B A;  2P5L C;  2HFH A;  3IWF A;  3HOT A;  3N4M A;  1LB2 A;  1O3T A;  2AXL A;  3E6C C;  4I0A A;  2VON A;  3JW4 A;  4RAY A;  1C0W A;  2DTR A;  2F5E A;  1DP7 P;  4HYE A;  4FHT A;  4U7B A;  5BPD A;  2V6C A;  4IRH A;  4HX7 A;  4M73 A;  1ON1 A;  2G7H A;  2IRF G;  3ZP5 A;  3QPH A;  3WTS C;  4MEX F;  1FSE A;  1J7K A;  3WU0 A;  4U88 A;  3WTU C;  3I54 A;  3ECH A;  1YW8 A;  2GXG A;  1S7A A;  3ZQ7 A;  2HQR A;  2NS0 A;  5CVJ A;  1XCV A;  5L3B A;  6PAX A;  1U2W A;  2CFX A;  3GW2 A;  3RIR A;  2P7V B;  2F5C A;  3H3Z A;  2O6G E;  3CUQ B;  5LEJ A;  1W5T A;  2OA4 A;  4LLN A;  2PEX A;  4QWQ A;  3QU3 A;  2TDX A;  1IXS B;  4XLN F;  3C3W A;  1HQC A;  5BOX A;  4BXU A;  4G6Q A;  2VOD A;  2V9V A;  3IC7 A;  5DCM B;  1ZRC A;  2QEN A;  4UVC A;  4NQW A;  4I09 A;  4XLP F;  3FX3 A;  5J8F A;  4R8H A;  2Q2E A;  4EM2 A;  3F72 A;  3EDP A;  2GQQ A;  1IXC A;  2DK5 A;  3EYY A;  5EEG A;  5DD4 A;  1ZH5 A;  3E3V A;  4G8X A;  2ZCW A;  4UUV A;  3F8M A;  3RKX A;  5JFR A;  1XSD A;  2PFB A;  1PUE E;  2A07 F;  5D6F A;  2RGV A;  4UNO A;  5HS7 A;  2D45 A;  1G6N A;  3QRF F;  2UWM A;  2MLK A;  2KIU A;  2YX7 A;  1YW9 A;  1ON2 A;  1P6R A;  5D5V B;  2XKP A;  5D4R A;  3VOD A;  5ILS A;  2L01 A;  3ZMS A;  5ED4 A;  3WTX C;  1ZLK A;  4BNC A;  1CGP A;  4WXC A;  3IRQ A;  2IVM A;  2MA3 A;  2OBP A;  3M8E A;  4RAZ A;  2VOO A;  1SD6 A;  1FYL A;  3GUD A;  4UV9 A;  4LG0 B;  4MTD A;  4WWC A;  2D1H A;  3RPU A;  3E6M A;  1B9N A;  3BPX A;  2YPR A;  3P7N A;  4RGS A;  2FML A;  2ZNY A;  1REP C;  4PGH A;  3J81 K;  4S04 A;  1D8J A;  2PLY A;  2BEO A;  3GFL A;  3HYI A;  4GGG A;  1RIO H;  3ABU A;  3MZY A;  5HDG A;  4LLG F;  2IJL A;  1W5S A;  1ULY A;  4M6X A;  5AON A;  3R6S A;  1WRJ A;  3B73 A;  3KLO A;  1UST A;  1G4D A;  3WTV C;  4L0Z B;  3RTR A;  3Q5F A;  3JAM Z;  2DU9 A;  2O03 A;  2HKO A;  3JSP A;  4IRG A;  4HOB A;  2V1X A;  1FBQ A;  4UV8 A;  4HAM A;  3RI4 A;  1J9I A;  2ISY A;  4N9H A;  3EUH A;  4LK1 F;  4ZYG A;  1BI2 A;  2K02 A;  3ZMZ A;  2QBY B;  1EH8 A;  2DFI A;  1TBX A;  1HW1 A;  4EGY A;  2P7C B;  2M5W A;  2NYX A;  4G7Z F;  2XAS A;  2VBY A;  2ZFW A;  3CDH A;  2KKO A;  2QQB A;  2HR3 A;  3HUG A;  5CLS A;  3N97 A;  1W7P B;  4O5V A;  3CJN A;  1J2X A;  2KJC A;  1UHM A;  1FPQ A;  4RGX A;  2A3S A;  4LB5 A;  1KYZ A;  4IPA A;  1QBJ A;  3ZMD A;  1WKM A;  3GEZ A;  1B59 A;  4M71 A;  4UXN A;  3H92 A;  5H20 A;  3WOD F;  2XAF A;  2EK5 A;  2VXZ A;  2UXN A;  3F22 A;  1GHC A;  4AVP A;  4ETS A;  5CJ9 A;  5DCM A;  1IW7 F;  1JGS A;  4ESJ A;  3E6D A;  1QNT A;  4I98 B;  1HW5 A;  1WWX A;  2MD5 A;  3R0J A;  2L02 A;  4F7Z A;  2EB7 A;  4A2U A;  2GAU A;  2VT3 A;  2LF8 A;  1MD0 A;  1XDU A;  4ZYH A;  3FXU A;  2VE8 A;  5HS9 A;  1SD4 A;  3PQK A;  4KUM A;  2VC0 A;  4L0Y B;  4KDP A;  2UXX A;  3KP6 A;  3CUQ C;  5FLX Z;  3KFW X;  4TV7 A;  3MZH A;  3F6O A;  2D2W A;  5D6E A;  2IT0 A;  4I2O A;  4IHT A;  3KP4 A;  1XN7 A;  1P2F A;  1ZG1 A;  2OZ6 A;  4CXF A;  4CHU A;  5LHI A;  1IN5 A;  3BOQ A;  2ADU A;  1KU2 A;  1S8N A;  2QQ9 A;  1U6G A;  1Q1H A;  3L00 A;  4KMU X;  5A2Q Z;  1FNN A;  3J80 Z;  3LAJ A;  2KJB A;  3R4K A;  3T1B A;  2M1B A;  2VBW A;  2K4J A;  2L3D A;  1GXQ A;  2CWE A;  2OQR A;  4RB3 C;  4I02 A;  2EV6 A;  1FBS A;  3VB2 A;  2DI3 A;  4M72 A;  4HV6 A;  3FM5 A;  1JE8 A;  2F2E A;  1TQM A;  3RJP A;  5HLG A;  5CYV A;  4M9X A;  1K78 B;  5AIQ A;  3MQ0 A;  1OR7 A;  3NQO A;  4EJT A;  5TJJ A;  4KNY A;  1T6S A;  2OU2 A;  3ROU A;  2HDC A;  3LFK A;  1HW2 A;  5LRR A;  1UHW A;  1HBX G;  4MTE A;  1HXD A;  2FF4 A;  2Y0M A;  1TQI A;  3OOP A;  5D5X B;  2HEO A;  1SFU A;  1P4A A;  2QBY A;  4YFK F;  3JAM K;  3M8F A;  3LQQ A;  1PP8 F;  1W7P D;  2XRN A;  5K5Q A;  2P6T A;  2YR2 A;  4HLY A;  2PG4 A;  2UZK A;  1FP2 A;  1F4K A;  4ON0 A;  2EWN A;  1ONV A;  4DNC A;  3C7J A;  1CF7 B;  3BPV A;  3P9C A;  2GWR A;  3QP6 A;  2EA2 A;  1Z7U A;  2CSO A;  2RNJ A;  5E1Z B;  1T98 A;  2OZU A;  1E17 A;  2H6C A;  4M9S A;  1J75 A;  4MNU A;  5K1Y A;  4I0B A;  2XKO A;  4WF2 A;  1IN6 A;  2OD5 A;  2WC2 A;  5DDG A;  3WGI A;  2EFO A;  3I64 A;  2ESN A;  3H3U A;  3ECO A;  5ILV A;  4HF0 A;  3Q9S A;  1V3F A;  4FX4 A;  1TNS A;  3V7S A;  4M74 A;  1D3Y A;  1YTY A;  5LHH A;  3F3X A;  2XAJ A;  5L3G A;  1H9T A;  1E2X A;  5F6F A;  1I27 A;  1HSJ A;  1RI7 A;  4ZYE A;  1J5Y A;  1WQ2 A;  4P96 A;  3TO6 A;  1XDS A;  2P8T A;  1LQ1 A;  5D5U B;  1SFE A;  1U78 A;  4A5N A;  2CO5 A;  2FXA A;  4BHB A;  3WTW C;  2H09 A;  1BOA A;  3PQJ A;  5HOO A;  4HDV A;  3OV8 A;  4JBA A;  1K7A A;  3LST A;  2A6H F;  5DV5 A;  2ETH A;  1AWC A;  1P92 A;  4Z2Y A;  2G7U A;  1KQ9 A;  3HRS A;  4MQV A;  1UCR A;  2V1D A;  2ZO4 A;  1I1G A;  1FYM A;  3IKV A;  5FLX K;  3BZ6 A;  3VEP A;  2DK8 A;  2Z3Y A;  1D8K A;  3K69 A;  2JT1 A;  5E20 A;  1SD7 A;  1RZ4 A;  4A12 A;  2HS5 A;  3NEU A;  3ERE D;  5E8G A;  1IZ1 A;  2H27 A;  1XGS A;  1Z9C A;  4IHS A;  1S3J A;  2HQN A;  1ZGA A;  3HSR A;  5JHU A;  4KMF A;  4HQE A;  3RKW A;  3U2R A;  1B6A A;  3ISP A;  2J5O A;  1O3S A;  4Q5S F;  4YG2 F;  4L9J A;  1JXS A;  3DPL C;  3QP5 A;  2A61 A;  3ABT A;  2XV4 S;  1K6O A;  2XUB A;  1BC8 C;  1FY7 A;  3C1D A;  4OIN F;  4O6J A;  4ENM A;  2EFW A;  3HSF A;  2MC3 A;  3F21 A;  1FWZ A;  2EV0 A;  1IF1 A;  1RNL A;  1KGS A;  4GO1 A;  5LBQ A;  3DP7 A;  3LAP A;  3J7A O;  4IJA A;  3F8N A;  4KN4 X;  3U1D A;  1JHF A;  4AIJ A;  1K78 A;  3I5U A;  2ACJ A;  1BBY A;  2KRF A;  2R7F A;  5L3F A;  5E1W A;  1YFH A;  1YO5 C;  3KP2 A;  4Y15 A;  3RYR A;  1USS A;  2STT A;  2BBY A;  2KIM A;  1VTN C;  4LK0 F;  3REO A;  2P6S A;  1TTY A;  2MLG A;  1Y0U A;  4G7H F;  3V8J A;  3K1P A;  3I0T A;  3PFI A;  4ASN A;  1LEB A;  1O3Q A;  1PDN C;  2XHK A;  4ZZD A;  3U9G A;  5BQT A;  2RC4 A;  3F8F A;  2VC1 A;  4OMY A;  2KIF A;  4M6Y A;  3ZMT A;  1IRG A;  3EQL F;  5LLQ A;  3O2P E;  2X0L A;  4ENJ A;  3SXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...