3HU5A

Crystal structure of isochorismatase family protein from desulfovibrio vulgaris subsp. vulgaris str. hildenborough
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
190
Chain Sequence
b'NRTVALAIIDMQNDFVLPGAPACVEGAMGTVPVIAGLLAKARAEGWMVLHVVRAHRADGSDAEKSREHLFLEGGGLCVAGTPGAEIVAGLEPASGETVLVKTRFSAFMGTECDMLLRRRGVDTLLVSGTQYPNCIRGTAVDAFALDYDVVVVTDACSARTPGVAESNINDMRAMGITCVPLTALDDVLAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Isochorismatase family protein
publication title CRYSTAL STRUCTURE OF isochorismatase family protein from Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough
rcsb
source organism Desulfovibrio vulgaris
molecule tags Hydrolase
total genus 62
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3hu5A00
3O94A 1NBAA 1YACA 4WH0A 3TG2A 3HU5A 1IM5A 3TB4A 3EEFA 3R77A 3OT4A 1YZVA 3IRVA 3KL2A 3S2SA 1NF8A 3O93A 2A67A 1NF9A 2WT9A 4L07A 3UAOA 1J2RA 2FQ1A 3LQYA 3OQPA 3V8EA 3TXYA 4H17A 2B34A 4WGFA 3HB7A 3O91A 1X9GA 4L08A 3R2JA 2WTAA 2H0RA 1ILWA 3PL1A 3O90A 1XN4A 3O92A 3MCWA
chains in the Genus database with same CATH superfamily
1CR4A 2I2AA 3FSGA 1JZQA 1ODKA 4P32A 4IAOA 5J58A 1QQAA 2J7KA 1YR7A 4EDHA 3FZEA 5DGIA 1IB6A 5EJ2A 3WRXC 3Q9UA 1QF7A 1RXUA 2QY6A 3OCYA 3OTWA 1OTXA 3QU2A 4ZIRB 4PS1A 4E7OA 1ZD3A 2VHUA 3OICA 3HWX1 4UVEA 1PR2A 3U4CA 4HWSA 1EIZA 1GUZA 1RVV1 2Z1NA 4ND6A 5D3MB 5U4QA 5JSUA 1E9AA 2W0MA 3CPEA 2WWFA 2H3EA 3EXAA 4G8JA 1D3AA 4GPBA 5F1YA 2B36A 4FMBB 1A5BB 1PFWA 2BJHA 3CG0A 2WNIA 3AHDA 3P9NA 5F1KA 3TN7A 2GJ4A 2F17A 4QUJA 3FRJA 3ZCUA 4MK4A 3PC3A 2IH4A 4IGKA 5EUCA 2TMGA 5KU1A 2XADA 2QXUA 3PL1A 2QIOA 3K31A 1YF3A 1SCKA 2GH1A 2EHJA 1GTJ1 1QTQA 1C0IA 4GPD1 1XTZA 4L7VA 4UATA 3KLMX 5ALHA 1QHXA 3SDSA 5LSAA 4QTTB 2PXCA 4BNVA 3G0HA 3B1JA 2JIPA 2ZYRA 1BXZA 2XTZA 1NKTA 4PTYA 5FUVA 1NJFA 4HJRA 3I6QA 3KAPA 4TGLA 5LQJA 3UAWA 3NAGA 2NZYA 1SB9A 2EZTA 4IO0A 4L8YA 1MC5A 2X3YA 3HBAA 3KVRA 3T7RA 1JEAA 4WKPA 4X95A 1SU8A 1XRNA 4EZBA 3TXXA 4JVOA 5C8YA 2FPGA 2X0KA 3B89A 4RW0A 1RD4A 5ESWA 3CUUA 4CF3A 1GTVA 2I78A 4U6SA 2OGSA 1Y81A 1K7EB 1MZPA 4AXBA 4R5MA 4FJ1A 1PR5A 1R5BA 5F5NA 4DLVA 5BW8A 2REBA 4W5NA 1CY6A 1R4MB 3CIOA 2VNIA 4KMMA 3UV7A 2O2DA 3EYWA 1QH9A 1G20A 3HL0A 3NXSA 1C0KA 4RJIA 3VFDA 2JIMA 1ES9A 2EW2A 2EF0A 1Z16A 3KK0A 4NJOA 2PWZA 2QMOA 5EINA 3TD2A 3VTKA 3LBNA 4Q00A 1MC1A 2CLKB 2Z04A 4EDFA 3LFHA 1AGNA 1YC5A 4ETWA 4UBNA 3W8EA 2A5JA 1JIIA 2WNHA 2C96A 4O6VA 4TSKA 1Z22A 3F4KA 2XB8A 3G6WA 3U3RA 2WFAA 3K30A 4MQFB 2PVPA 2Y92A 4PN3A 3CLUD 3DFUA 4G1CA 4OHOA 4ZAYA 3TLYA 2QN1A 5AVZA 4R3UC 5B6IA 3SXPA 2DEUA 1EZ1A 2DYKA 3AVWA 5ICFA 4FFMA 4GKKB 4XIYA 3CT6A 3FFAA 1Y6GA 4YP7A 2CHQA 1I4DD 2EFJA 2PL9A 3GP3A 5P8WA 1J2YA 3V6LA 3OURA 3NC1C 2NVUB 3WSTA 1Y1RA 4EY5A 3AR8A 2NZVG 2RCYA 4PW0A 4U4AA 1SC6A 1GQOA 3QXGA 4PNHA 1N1DA 3PQ4A 4XD2A 2WICA 4BVAA 4RAQA 1XE3A 1H2BA 4KODA 2JBAB 4MUKA 4B6RA 3RSHA 3SI7A 2VAWA 2R00A 3DTNA 4C0SA 1D2MA 1FX1A 4XLLA 5F5XA 4RZXA 2ZM5A 3FHCB 4XUEA 1XLTC 5GONB 3JYPA 1W73A 1X7WA 3WIBA 4EUFA 4D82A 5JSHA 1JE1A 2OCAA 5JAZA 1TKAA 1M7HA 2QG9A 3DMDA 3R0VA 3QVKA 4C43A 4CT4B 3O38A 1T3SA 4OMDA 4TMVA 1TMGE 1SK9A 2D7CA 1FS5A 2G5TA 3EG9B 1ADFA 3O26A 3P27A 3ZGVA 3ZS8A 4JCCA 1KDZA 2WHQA 1QYVA 1X7DA 2P9CA 2R751 4PGGA 5ARBA 3E8MA 2FN3A 3N76A 3OOYA 1P73A 1XAHA 1NVTA 1J20A 4HOYA 1JWLA 4K9PA 4O2AB 1Z82A 4M9RA 1G63A 5ALIA 1LFDB 1PJ4A 1OJ7A 3A4MA 4HQNA 2WIGA 3EEOA 1C29B 1QQTA 1OU4A 2QG4A 3ZD9A 4Y2JA 5KYNA 1C9DB 1JNYA 1MDBA 3G0BA 2Y4OA 5EJEA 3BDAA 1M1ZA 3EF3A 1JSRA 4IUDS 1RFGE 3BD7A 5I8WA 5AP9A 1GD1O 4DR2B 4WH0A 2FPRA 5JQGB 5DNDA 2VHQA 1WULS 4ENUA 4PZAA 4RGBA 3COJA 3TM4A 1KHHA 2PS1A 3RS2A 3RYTC 1N2HA 1V26A 1SHJA 1RI4A 1X1TA 2MIIA 4CR8A 4N0PA 1RQ7A 2IF0A 2DFTA 3EGWA 3NT5A 1HZJA 3V2GA 2O8EB 2JGFA 3DONA 3ZGNA 4ZVQA 3DL4A 3ZHYA 1NU6A 1Y6QA 5IWAB 1Z07A 2PLNA 1PL6A 1UKAA 4OREX 3VJLA 4TTSA 3WP1B 4CM1A 3GZNA 1QOQB 1YB7A 1MEEA 1N0IA 1G38A 1BROA 3PUZA 2VIIA 3GMTA 1Z63A 4N12A 721PA 4CVNA 2IPNA 2OO3A 2JJ1D 3AJ8A 2LCFA 2HQ1A 4FR2A 2QX6A 2PEYA 5I9NA 4MV3A 5UKDA 1ISHA 3KXKA 3NH6A 2XT6A 4PRYA 1O89A 5HQ3A 4YT8A 5EP3A 4PPNA 3JD1A 4IOMA 5JCJD 1GTSA 1FXSA 2YRXA 1FS4A 2O14A 1LPBB 2L19A 5JS1A 5ED4A 4A26A 3UOAB 4N5HX 3LL7A 4D9KA 5LZ2A 1Z62A 5CK5A 1GNTA 2DJIA 1WUHS 4QQKA 3OZFA 3FPHA 3LLUA 4C6TA 1T4BA 5DWQA 3WWCA 2RK4A 1P7CA 2A5GA 3LH5A 4KV7A 1FSZA 3O0TA 2PZMA 5KX5B 1KDVA 1MFZA 2Q45A 3U7QB 4JUBA 4ZD6A 3V9AA 5BVHA 5FBVB 5BWMA 5KHLB 4F3TA 5BQOA 2Q1WA 5KJCA 3D64A 3OPYI 3P2EA 4JAVC 4QYTA 4AQYB 2W6CX 1YCFA 4FFRA 1Z33A 3S4YA 2ETXA 5KMGA 2F9LA 4G0OA 5L4NA 1KJYA 3QTBA 4URXR 4BVJA 5CDFE 3ZJVA 1WF6A 5JYCA 3ZV4A 1JILA 3ETLA 4OG2A 4GZLA 1YZFA 3UAGA 4ZYUA 4RCVA 2GASA 3H83A 5THXA 3JD3A 5JSZA 4OGGA 1CQXA 3NOVA 3W8NA 5WRFA 2ODPA 5I4BA 3PVSA 3W5VA 2BONA 2E1PA 2LCQA 4BNXA 1YJ5A 2M32A 3IUPA 1EHIA 1JDBC 1Q3KA 1BCSB 1L7OA 1SQGA 1P9WA 3FMVA 3KCNA 2ANBA 1YKGA 2Z5GA 3GZTB 3LHIA 3GZJA 4KDFA 3TPFA 4WW0A 2RGNA 2C9OA 3RARA 3AKYA 4UM9B 3WNCA 4YRCA 5TR9A 1BCRA 1UPBA 1F5NA 4KYVA 3LDFA 1ISIA 1L5QA 3FY4A 4QXRA 2Q2WA 1LF0A 3Q1KA 4YP9A 3R24A 2WSMA 4R1PA 3BD9A 4Y2QA 3SIWA 3ND9A 4TMZA 3KZOA 2IEZA 2PZFA 1ZI9A 2VQFB 1R5OA 1E3WA 2HHJA 1RAHA 2VG8A 4RE5A 4ZJZA 3JVUA 3DYBA 1E5TA 1GU7A 4GMGA 2X41A 5BSWA 1S8NA 3ZOZA 1KVSA 3AVQA 1JX6A 3ZLTA 2Q3DA 2VNAA 2XUIA 1FXWA 5DHAA 3MGKA 2C4VA 1OXXK 2AFIA 1PIWA 2O3JA 2AMFA 1Q0QA 3PDIB 4RCZA 4TMYA 2I2DA 1DEAA 1GJRA 2RHTA 3IQEA 3KR9A 1Z29A 1FFHA 1GCGA 2ZWIA 4KO8A 1EEHA 4YAJA 4MQEB 2GSDA 5D1HA 3PQDA 5FOVA 3U48A 3TZEA 5CLJA 2NLOA 2K6GA 3G9XA 4P3YA 4QOSA 3UBMA 1CB0A 1XTKA 4JUFA 5KNDD 3UMSA 3KOWA 3ZLUA 4ESEA 5KVSA 4PC7A 3QUBA 1YB4A 4R2WA 4L78A 1PV4A 3ENWA 1PR0A 2WWWA 4PLWA 5FYDA 1V7CA 5AVUA 1AK2A 1XVIA 3ZZ0A 4UZEA 4BTVA 3EY9A 4DMHA 5JZ9A 1GEGA 4TTRA 1Y9AA 2G28A 2VNHA 5CX1A 1Z08A 4FOLA 1G4HA 3KYCA 3D0OA 1C7JA 1EFPB 3QBDA 3ZNOA 3Q7QA 4FFBB 4LHXA 1JG2A 3HKDA 2HCFA 2OECA 3AU9A 2V6MA 4Q4DA 3ZHOA 1NFQA 3UMYA 2PU7A 1Q0TA 4Q4AA 2REOA 1W8IA 2ZP1A 1DG9A 1P62B 1VL6A 3CN7A 1N6OA 4PLGA 4MX8A 3I73A 3CV3A 3OJLA 4J3NA 4HLQB 2CL7X 3D6UA 3VZCA 1CEXA 4A8TA 1GAEO 4LX0A 4XSVA 2IYXA 1BS1A 3IAXA 3SR4A 3C6BA 4FX2A 3V8MA 1ODLA 4EX7A 4R7ZA 3S6JA 1ZIOA 1FDUA 1K89A 4TT3A 2QVXX 2PN1A 3CF4A 1JDJA 5FNVF 4FLEA 4E5VA 2WFMA 4KG7A 4UDXX 1GYPA 1LK7A 1UKCA 4G9GA 3HB9A 5KAMA 3AR4A 2GF9A 3HXTA 1VCOA 2A30A 3NKVA 1JHXA 3B12A 4FC6A 4UNQA 5U9CA 2P27A 3MA0A 2XWPA 3G2HA 1NVDA 3THYB 5C7YA 4N7BA 3K6SB 3N7UA 2AVNA 5DGDA 1Q1QA 2ERCA 3HB4X 3MT9A 2FOXA 3IP6A 4NV1A 1DXOA 3HDVA 2BZGA 4QJBA 1JPVA 2FSIA 1P2UA 3H8WA 4EEXA 3P19A 1SBCA 1W52X 1RLJA 4DB2A 2JIZD 2V6JA 4KVGA 2Q0SA 4WBNF 2XA2A 1X7YA 2UZ0A 4O02B 5KNLA 3TLEA 2W00A 2ZJOA 4MS1B 4TTPA 4DA0A 2V3VA 1Q0HA 3RU3A 1R9JA 1SGWA 1SVUA 3L84A 3WNVA 4B44A 5K3EA 3U2QA 4R51A 4BNHA 3LXMA 4BO7A 1JFSA 1EWQA 2IC5A 2JLRA 1RKVA 1KERA 1NQXA 2BAGA 3DQZA 3I9JA 3PIRA 3GJQA 3QI7A 3PC2A 1DRVA 4WMLA 3IBGA 2G88A 1M6YA 1U8AA 3T4PA 1MRNA 3ESXA 3NRJA 2M6SA 1JMYA 3H0KA 4FFSA 3A36A 1IHPA 1EDZA 1CY1A 1JU9A 1VFNA 1H4TA 4AAYA 2DBVO 4ND5A 4G4SP 1XZJA 1TQ8A 5KREA 3UUFA 4XW2A 3U09A 1XL0A 5E1DA 2JIBA 5JMWA 2W2PA 5GGXA 1CY0A 4ISBA 4OHUA 1OAAA 3LQ2A 4G25A 5TEWA 1N6PA 3DKRA 4DAOA 2DGDA 3DKKA 3ER6A 4HN4B 1FDWA 2XMQA 2PT9A 3PEEA 2X19A 4S12A 1LPMA 3A04A 4CN9A 3PX7A 1LRJA 1UC8A 2Y0DA 3PCRB 4INJA 2KLHA 1A4XA 4GM0A 3I6BA 4KX3A 2DUJA 1M75A 3OESA 3IAHA 2A3RA 3TG8A 3FG9A 2YWHA 2CVOA 1LDEA 2P2NA 1LWOA 3QPVA 4K46A 1KEEB 2ZYTX 2YUIA 3NM6B 3L0PA 1GUDA 3GLFE 1L7QA 3WVNA 1NVVQ 4IYRA 3SF8B 1GZ7A 3DEHA 1YI0A 3RTDA 2H0AA 3QSGA 4O0MA 1NDUA 5HA5A 1WDKA 3DOFA 1WY5A 3A6EA 2JAHA 3L1VA 3LT0A 2P40A 2ZBPA 4J03A 2FP3A 4TRNA 5ANRB 5A9RA 2CMHA 2BFMA 5SZIA 2V59A 1N2XA 4HWPA 3V9PA 3OIUA 3PNPA 4N3GA 3QUSA 4ALNA 3BMOA 4YMUA 3UPUA 3CRZA 4D9MA 2JLWA 1S7GA 3DOHA 3H9QA 3DBIA 1XPRA 3DF9A 3WXMA 3CRRA 4YFVA 5DDIP 1PUXA 2OSBA 2CMGA 3Q11A 4R1MA 4AWBA 4C7VA 3B5EA 2BSAA 2OLJA 2XEDA 3MTIA 3PZRA 4WKGA 3TIFA 2IDZA 1H4SA 4OMFG 1AXGA 1QAOA 4W5TA 3EGIA 3NOOA 2ZUDA 5CYOA 5P21A 1DO2A 2P2SA 1I2CA 4G5QA 1T4CA 3CSUA 3KBBA 4KAAA 5DI3A 2AT1A 1ZD5A 4MZDA 4TTAA 3A2KA 1PQUA 5HZHA 4KWHA 2P4QA 1W5SA 1YQXA 4RENA 4MQMA 1PSDA 2ZE6A 3I83A 5H4HA 1AUOA 2CKMA 2NZXA 3E53A 4J4BA 5DEOA 3RNOA 2HA7A 2IYVA 1T2NA 2UUAB 1AKQA 1ISJA 1GPLA 1JTEA 4KXYA 4U5XA 3UOWA 1R9MA 3CZMA 1ML3A 1QHSA 1LSOA 1OLSA 3G79A 4G84A 4NK5A 1BKYA 1LI4A 2IUUA 4EG3A 3CZQA 2VHXA 1Q50A 2II6A 4JD5A 1ZCJA 3CZ5A 1QRDA 4JXJA 3KXLA 4CCYB 4B17A 2R1UA 3B3FA 4AWAA 4GYJA 4MGYR 3RS7A 5FWNA 1IZ7A 4LGYA 8ATCA 1UMBA 2H4ZA 3ZDFA 1RZRD 3N0XA 3I9FA 3TYXA 4FSDA 4X62B 4I1PA 1DTWA 4TLDA 5JARA 2NU8A 3RT7A 4AZ0B 1VJ0A 2I29A 1RWPA 1A69A 2FUKA 1PWXA 1FJHA 3EGCA 3IIKA 1BX3A 1NSFA 4MTCA 4YCMA 1MAWA 5AW9A 2QF7A 4R1QA 1ONPA 6PFKA 1P1KA 4YAIA 1RJEA 1TJYA 3C7CB 3QBEA 1TMYA 1TUGA 5LZ7A 10MHA 3QEJA 4QUDA 4N48A 3OLWA 1E3TA 1J00A 4I3HA 3MCVA 3U4DA 1NXXA 3A28A 1BMQA 2CLIB 4LOLA 3WDSA 5K0JA 2PQ6A 1E9VA 4IKEA 3U4GA 3VR6D 1O6GA 4AWXA 2BFDB 2QPOA 2XUPA 2Y6UA 2NSJA 3INGA 4TXLA 4I1SA 4MVJH 4GMFA 3BFXA 3WB0A 1KI7A 4FDLA 1WCXA 3JQPA 5BXQC 2EP8A 4X5OA 1M1YE 2H5EA 3IQXA 4KFRA 5I3ZA 5DISB 4B34A 2RGRA 4CEJB 1MQSA 2OT3B 2FMUA 2KLBA 5EZ6B 2PLFA 2R0QC 1T5BA 2B1GA 4PC1A 4E5MA 4EJ0A 2DZDA 4HPXB 1L2TA 4GLFA 3W1VA 4E3ZA 4ASUA 1ZISA 1WP9A 1K88A 3SQOA 1H6CA 4QT0A 1ZLYA 1OVGA 2JHGA 3QEAZ 4OUDA 3TW6A 5JZBA 1NATA 2FHSA 1AKEA 3I6ZA 3FYUA 2E4YA 3K9BA 2QE7D 1Z35A 2HOQA 3G9UA 3D0KA 2PT5A 2E55A 2P2GA 3R7AA 3FBWA 4X3CA 1XB2A 5KNCA 1N0UA 4KAFA 2XCOA 2C7RA 1QRSA 3ZJ4A 2R00C 1ACJA 3H9GA 4NU8X 1DRWA 3G82C 1N33B 3EF0A 2BEKA 3KKEA 2GHQA 2XNDA 3KQLA 3UXEA 3ZCSA 2GK7A 1PZFA 2CFOA 5INTA 1YD7A 3AETB 5JDIA 2ZOSA 4OTZA 1JHMA 2AK3A 2I7DA 4E09A 2JLAA 4YAGA 2AHOA 3TQIA 4MUHA 1W59A 1EQAA 2HMSA 3ET4A 3LX6A 1VYHA 1GLNA 3PUVA 4M9CA 1LU9A 4NCKA 4WLEA 4Y6OA 2W2LA 3L7BA 3RDPA 5AIAA 2WVGA 3R75A 3R5XA 4EY6A 3ED5A 1EKXA 4Y0VA 3TKYA 1I4LD 2XMGA 4R8RA 1KQFA 1H66A 4Y2SA 4L8WB 1QYWA 1N4AA 4PY2A 1R6UA 1WQ4A 3OFKA 2GZ2A 5F1OA 4F38A 2HV8A 5JXGA 1VOTA 1SQ0A 3FH0A 5EWMA 5JOQA 1UKZA 1KFEB 3ZWXA 2H54A 1NVGA 3TNLA 2ENUA 1ZMRA 4R9UC 2QAGB 4Q1VA 4QGGA 2RAUA 3C3JA 4P2BA 1O08A 3AUUA 5IAEA 5IT9A 3F5MA 4NZOA 2P9JA 1CZNA 2ZRGA 2C07A 1PCXA 1D8AA 3JQAB 4EYEA 4YMHA 2D4AA 1DAPA 2V96A 3B7GA 3LP8A 3HJTA 2FGJA 3RFTA 3ZXYA 1A97A 1R4NA 3F1KA 1U1IA 4JIGA 1CRWG 2QRZA 1SEPA 1SY7A 3COWA 3SD7A 1DAMA 3MWJA 4DW8A 3HHPA 3BK7A 5ALRA 1MMFB 3A37A 1TT7A 2X2OA 3GX1A 3ONDA 2C0QA 1AD2A 2ZB3A 4FGLA 2D2FA 1SRRA 4S1NA 5CTJA 5IM4F 1ZP6A 1EUQA 4D6XA 1J7KA 3UGTA 5G53C 5BURA 2IKQA 1JAHA 3G02A 2Q07A 4QXMA 1M66A 4R98A 3N2KA 4B4KA 2Z2IA 2FA9A 3AX6A 3D7MA 3ETEA 1X7XB 3D3WA 3PQ3A 4GHWA 4JB3A 5DE3A 3VU8A 1SBTA 1QWSA 5ALXA 3FMIA 2Q8QA 2QMHA 4XJXA 5KTNA 2HRRA 3VR2D 1P0FA 1C3EA 2XGSA 5JH7A 4YUZA 2W6MA 3KVNA 4C0BA 4DLLA 5LYYA 2AN5A 1RPAA 1G9XA 3NGMA 1QK3A 1TJ4A 3VAYA 1B76A 2A0KA 3O4RA 4MUYA 1RVDA 4I08A 1FQOA 4X3PA 1JR3E 4HH0A 4Y9DA 3RJ5A 3M3PA 4ZJPA 2FCRA 3UXHA 2ZUEA 4J1NA 3T61A 3ZX4A 1NC3A 4EMUA 4RV4A 4BZWA 4HEQA 1W44A 4ZT6A 1M0EA 3LOQA 5DLYA 1L5RA 3L7MA 2JZOA 5BW6B 1QJ4A 3O8CA 4NNPA 1IZZA 2P9HA 3EDRA 1O96B 3BWBA 1A8QA 5IF3A 3F6SA 2QT0A 2B4TO 3F5SA 5CCBA 2H1VA 1WPXA 2V74B 1KTVA 3OHMA 4P0TA 5FUBA 4DFDA 3KEFA 3S68A 4CG0A 1BAPA 2BR4A 3FPEA 2H18A 4JP1A 4NBWA 3T5PA 3I4CA 3ECAA 3I72A 4N5DA 1PU2A 2XUJA 1M9NA 1MD9A 4P7FA 1P31A 1CR6A 1V16B 1GNPA 2AZXA 2KHZA 3IXMA 3HGMA 3VNQA 3OX2A 2I9PA 1KVQA 2RGNC 2ZB2A 1J0XO 1ZOOA 4YJHB 1PR9A 1UAAA 4M60A 3E7DA 5EMMA 2PXAA 3L01A 4UFNA 3TZLA 1RLOA 2AG1A 4Q6WA 3QQ5A 1PBNA 1SXGA 2L42A 3V2IA 2GEBA 5CBPB 2HTFA 2O1XA 4JL8A 1T36B 3V1YA 5IZ4A 1U0BB 4XVCA 1TOAA 2HUPA 3E05A 3BE4A 2GYWA 1MT3A 3I3OA 3GLHA 4BATA 3CNEA 1E1CA 1YU9A 3C7DB 2LE0A 4FOPA 1BH6A 1X1EA 2ICAA 4OHVA 4PIPA 4D46A 2DQ4A 2CC2A 2ZJ3A 1W94A 3BM5A 5CU7A 4A2CA 4DIBA 4EYSA 5BNZA 3PXCX 4FHFA 2V7BA 1AG9A 4QUHA 1YVEI 5IJXA 1PR3A 2I3AA 1JP7A 3HUDA 5ELXA 3CINA 3J80A 3PXDA 4NBTA 5A7FA 1R0KA 3HDJA 3OEWA 5K8VA 3OOEA 3ONFA 1F20A 4MS4A 4UHCA 1ORHA 1XJQA 1OZFA 3O8OA 4NK4A 3AR9A 2MSKA 1XDUA 4OI2A 3WY9A 3OJFA 3H1BA 4N18A 4IV5A 2B25A 4I50A 3ZGXA 1UBFA 4ZI5A 1HG0A 3O82A 4F9TA 4JHXA 3G0GA 4NYIQ 3FDJA 4AZ3B 2YFHA 4ENWA 2GRUA 4FZRA 4UMFA 3A7DA 4XR9A 3L06A 4AIIA 2ADFA 2B9EA 3T94A 4DC0A 1G64A 5H59A 5AJXA 2GKSA 3CF6R 3PXXA 1A27A 1SCUB 2JEZA 2HA0A 2I6FA 5M34A 1JEQA 1UWCA 2C8JA 3JRWA 2EBUA 5IX8A 5GQSA 3S3TA 3SICE 4X61A 5EZQA 3GGCA 1KGDA 2BISA 2BC9A 3LDAA 1G8KA 2FUEA 3TQFA 4AZTA 5LBUA 1XVTA 1NR7A 2X2PA 4NAUA 4LY3A 1YUNA 3KLOA 4P3NA 2ET6A 1GCUA 3EW9A 4PLFA 3RBVA 3SM3A 5CVTA 4PFSA 4UTXA 2WT4A 4PU0A 2WWGA 4EI9A 1J8QA 3M4XA 4IGEA 2ZWAA 4LF7B 4BLWA 2BP7A 3ANSA 1WQ1R 4LDQA 2OHXA 3OUZA 1C0PA 4F86A 5DYGA 2BZ0A 2Q5FA 3UMGA 4IEIA 3JX9A 1ZH2A 4CKEA 1VHQA 5THQA 3RC8A 5EKSA 4LWQA 2Q3BA 4C2BA 5CIYA 4BX3A 3B2NA 2PK3A 4TKZA 4G37A 3EGDB 1BJRE 1FP1D 1MX1A 2YHSA 2HY7A 3CSSA 2HO5A 4UHBA 2NUTB 4EUNA 1DSSG 1F8XA 1COWD 4IIJB 1DJMA 3GDFA 4WRRA 3S8EA 2I1WA 1AT1A 1ZIYA 2DM6A 2X2FA 2QTRA 2O3SA 3R3YA 4A0HA 5A1TA 4J0EA 3C1UA 2B8JA 2HJ9A 4RHYA 2ZCJA 4GOLD 2HWYA 1OFUA 4KIWA 4OEHA 3DT8A 2GYVA 3H9BA 3P20A 5DCWA 1LBIA 5GVSA 2R68A 3C39A 4OHBA 3IXQA 4AP9A 3B8EA 1IRXA 2BR5A 2FPIB 3U3KA 5LVAA 2YXEA 2G9QA 4B83A 4TTJA 3R9WA 3GFGA 5LOVA 1C8BA 1XZMA 1D2HA 3L5OA 1C9KA 1J09A 3N8HA 3TTVA 2PUJA 3RVPA 1O77A 4FFDA 2XKAA 2VF5X 3DFKA 5LC1A 1AZLA 2GK6A 2WKQA 4KIJA 5CXXA 1PEYA 4DMMA 3HDTA 4MYTA 4IX1A 4GX0A 4NENA 2V7PA 3PPXA 1M2HA 2I91A 2GR9A 1MLDA 2CWWA 4HDSB 4OB7A 3PKIA 1NJGA 2HK6A 2FE4A 4KLNA 4Q9LA 1DBWA 3V8RA 3I2IA 3BSSA 4AYTA 4EKEA 1XXHB 4PWYA 3M9XA 2AN9A 5LQSA 4PFJA 1EJ6A 2QM7A 4E7PA 5L3SA 3O84A 4C0WA 5TPWB 2BMDA 2J32A 4AZVA 5JW6A 5B7PA 2A4MA 2UYOA 4JEMA 1DWPA 4M49A 2XMPA 4Q7LA 1VGVA 1LPAB 1GFIA 4I4IA 3ZDQA 1NQVA 4RMHA 5GWXA 5G3YA 4BQEA 2CXRA 2BTQA 2L82A 1G1AA 1H4QA 4TSFD 1BVUA 1E6WA 3EUAA 1CFZA 1W19A 5AOCA 4Q4JA 3WGGA 5AQ1A 3LW7A 4S04A 2NMVA 2CFTA 5T64A 4CLOA 3P0IA 1BIFA 3AHJA 3A1UA 3SKYA 5KYYA 1N0VC 4DNOA 2J9XB 3T3IA 1U0SY 3K9NA 3KD2A 3OX3A 3DNFA 2E37A 2Q6KA 4LDPA 1VLZA 2J59A 2C7BA 1VE6A 2QNRA 4B6GA 3OY2A 2ZIWB 4CT0A 2EJWA 3L8ZA 1QTRA 3U4AA 2HEIA 5C3UA 2KM1A 4FKZA 3SEFA 3AJAA 2OA0A 3VX4A 4CM9A 2FHPA 4RTRA 2FP4A 4ZAFA 3SIXA 2VNJA 3VAAA 3UNXA 2VDKB 4FOSA 2PHZA 5HF6A 2ZZNA 3KQQA 4HS4A 4NR0A 5C18A 3ILSA 2CVHA 4F3RA 1L4HA 5IJ9B 5JXJA 2DAPA 2YXDA 3DMYA 2Q0HA 2BHNA 2XZDA 3HKBA 2PMDA 2WYOA 3AEQA 2YMMA 4HRVA 2GPJA 2WF9A 3T5MA 3MEQA 5CM2Z 4C7MA 3PFFA 1E6MA 2C54A 3FKQA 1W4RA 2OTCA 2UUOA 4LV5B 8GPBA 3AW8A 3SN6A 1NXVA 1T4DA 4JLNA 5M04A 3LPLA 1G4AE 2HQOA 2PKYX 4JWKA 3RC9A 3PDUA 1Q0ZA 4IDHA 1FW8A 2DFLA 4ZO7A 2QT9A 1BDJA 4R5HA 5T3UA 4YONB 4A15A 3RKUA 2VTVA 3C1AA 3I6MA 3GJ6A 3KAKA 2GF0A 4MKRA 4HDMA 1GM5A 3GOHA 2I3DA 4UOQA 1ORRA 2RGYA 4GC9A 4HB3A 1TA9A 1U7TA 1YGYA 3KYIB 3NHRA 4EFKA 4Q48A 5AW3A 3VHLB 3ECSA 3UWMA 4F3KA 3IURA 1LQUA 2ACVA 2BUCA 3MBKA 4BQPA 2FUNB 4FHDA 4FYIA 3K0FA 2QTGA 2Y1XA 1O6BA 5TQ0A 1Z39A 2NTNA 2J46A 3RJ9A 4MQBA 4E4TA 3JVEA 1Q0UA 4ZCSA 2W4IA 1TECE 3AP2A 2DC1A 4LFBB 2FX3A 4L4SA 1U0OC 2DE0X 2EDAA 3BRCA 1HNNA 3I9MA 4IDNA 3VVMA 4H77A 4XWOA 4LCEA 4OFWA 5JC8A 3F0TA 1NLFA 2Q28A 2QLTA 3P97A 4FS3A 1K6XA 2JLCA 3GU3A 1BRMA 2I3GA 3T1HB 3GT3A 4PSKA 3P9XA 4KQHA 2CZCA 5DWVA 2XHEA 3FJ1A 1N2CE 4GSKA 4MUGA 3EXHA 5E7JA 3AF1A 3LRPA 3QYFA 2E85A 4HYTA 1L3CA 2RHRA 1IZ0A 2F3SA 1POXA 2QL7A 2A94A 3FCCA 4RTPA 1SQ5A 1DJLA 2OQVA 1AZTA 1RU3A 1LB1B 1S5PA 2VH1A 3AI3A 4ZKEA 3UTCA 1GGFA 2AEFA 2XH8A 4YAWA 1NX9A 3L9WA 4XTCS 4RY2A 3E5MA 4DLKA 1L5FA 1DINA 4DHWA 4HAUA 1NVMB 4UUPA 3JWEA 5AW4A 4I5FA 5JBQA 2ODAA 2WG0A 5EKDA 3GVHA 3JWJA 1LLFA 3TRDA 3U0BA 3D6NB 5AVSA 4KFCA 3OIYA 5HJ5A 2HB6A 3U7GA 4PC6A 1TLLA 3ZIAD 3G1TA 1I0IA 4M83A 3UW3A 4YRIA 4ME6A 5T67A 1E9RA 2CW5A 1SIBE 3OX4A 5KQRA 4EUKA 1N7IA 1G5HA 3K8ZA 3L40A 3PRYA 4DREA 4BC1A 5I4KA 5FUQA 1CUUA 1B8NA 3NJ4A 4HNSA 4JUIA 4DJAA 1WB4A 1Z2OX 1DVRA 2J41A 1Z3CA 4URWR 5U1PA 3KPJA 3SPXA 3BXFA 5T4FA 3EAGA 2IP2A 4XGKA 4BLPA 2XAAA 1W6UA 2FWMX 3QVOA 2R3SA 3FYUC 4OIMA 4CEIA 4U6QA 4OQLA 4FNGA 5JZOA 1C7RA 2C9CA 2P65A 3NUQA 4FIZA 2CXNA 4QVKA 3IKJA 1LBTA 1NI5A 2VLBA 3IEUA 2VQEB 3BXZA 4JUCA 4P36A 4OJYA 5BYBA 1N77A 2X42A 4IJWA 3LDHA 4IIGA 5F78A 1AV7A 2ZT5A 2OESA 1B6RA 2JZNA 2A5FA 2Q6VA 3MUEA 4IIJF 5JDIC 1G8AA 2BKEA 3ZR4B 3GCDA 2BH9A 4JSTA 1PGPA 2HHAA 4IIUA 5SV2A 3LYLA 1K4YA 4PNEA 1QF6A 1A2OA 1GGEA 2WZQA 3GR6A 4W6QA 4OHMA 4YGXB 5EP2A 3SQLA 1PWHA 5E8RA 2BFCB 2OCKA 1JHYA 3AO0B 4NDZA 2GARA 4D4HA 1GZ5A 2D8MA 2C3YA 4ZYVA 2P4UA 2Q8NA 3DWIA 2C0PA 5F3WB 4MRMB 4U8HA 4NU0A 3W7BA 5A62A 4QQ8A 1XTSA 2JAPA 2QRMA 1U3VA 3EASA 3KM0A 4IG9A 3A26A 4RSHA 5DPMA 5J4HA 3GJ7A 4KR3A 4IRMA 3TOCA 4B7ZA 3AUTA 1KMNA 3Q3EA 3LQFA 2E1RA 3WLTA 5AD1A 3W5SA 3JYQA 4YJ3A 2ZAMA 1M1XB 1YZLA 2C99A 2C0CA 3GVIA 4Y6PA 1JFFB 1B23P 3O94A 4ZVOA 5KZMB 2DTEA 5G0VA 5L4LA 1EVZA 4C7XA 4LF5B 4R9RA 1ZZGA 3ZYCA 4LJRA 1XU9A 3QHQA 2H8GA 1TAGA 1SC9A 2ZXEA 4YYZA 1NTOA 4KIGA 2D3TA 4QYIA 1WXHA 2PKEA 3JQGB 4NH4A 2WHYA 2P9ZA 1P6UA 3OKCA 4EI7A 3JWHA 5FO0A 3D4PA 1XHLA 4QGHA 1VMDA 1X80A 3KZNA 3LWZA 3RAPR 2IZ1A 2ECQA 3PPWA 4C07A 3B3JA 3QBJA 1SUFA 5JC1A 1YS6A 5I6DA 3DAHA 2WA2A 3ADPA 3E35A 2YJZA 3JALA 3M6VA 1S2LA 1Z4NA 3NOXA 4PX2A 3EE6A 3U7EB 5H5JA 1S9HA 2LKDA 3HXMA 1ZWLA 2FR8C 2O48X 2NTEA 2OGWA 3DXXA 5A5GA 4QGSA 2F8MA 4WI1A 1WDTA 4BWGA 4EUEA 1QIIA 3ZV7A 1JPUA 2J3IA 1MO3A 1EDDA 2Q2VA 2JK0A 4JFAA 2CUZA 5ADHA 2I65A 2XYQA 2XB4A 2CHGA 1U6IA 3QUCA 5I9SA 3AVUA 4TRJA 2WVHA 3WGQA 2C3OA 5JSFA 1QCYA 3BICA 4FGUA 1G5TA 3D7SA 2IVFA 2HHCA 4N0QA 1UJCA 2AJTA 4RF3A 4C0QC 1E2DA 2JD0A 3OECA 1P6XA 2J5BA 2Y05A 3L7JA 3Q9NA 4ZCLA 5LN1A 3FKJA 1XDZA 2XECA 2EFDB 1UFQA 2D2VA 2V5VA 3CTPA 2OV8A 1FP2A 4ENVA 4CMAA 5CURA 1PZXA 5E3HA 3TQHA 2CKDA 1BWRA 2RGWA 4S24A 4D44A 3PHGA 1QC5A 3TEFA 1VCHA 4UMVA 3S0JA 4AKHA 4M55A 4YCCA 4UEJA 1YE8A 3LX4A 2ONCA 3P9QA 2B98A 2EZ4A 1C81A 3T1TA 4Y6GB 2YY5A 4XJTA 4HX9A 5EIWA 2PX0A 1NT4A 4JBXA 1QF9A 5L3QB 2RHGB 3SFTA 3KHTA 2QVGA 1FJXA 4YIHA 5HDQA 3VH4A 2QTWB 2X8JA 1OYWA 4H1TA 3C6MA 5DW3A 1CJKC 2V7XA 4TT3D 1SUDA 4RU1A 1W9HA 3RSGA 3EIXA 4EL0A 4QU5A 4JN6B 3N8IA 4OQZA 3RK0A 4E21A 5BPFA 4P0QB 4KXNA 5BUQA 1ENYA 1H05A 4P84A 3HEBA 1SFRA 3H65A 4GM1A 4AX8A 4J16C 1K7CA 1K2VN 3ML1A 3RTBA 4MV0A 1P81A 3HLTA 2E6KA 3OFJA 2FB9A 1KSGA 1EUDA 4OFXA 4NBRA 4P7BA 3WJ7A 2FH5B 4MW1A 1YQWA 4JLAA 4QSMA 3STTA 4AT1A 1IXSB 5TMPA 1CQIA 4LEIA 4M86A 1K1EA 1XRLA 1BEEA 3WYCA 4JLPA 1JSLA 2OUIA 3G8AA 4N5LA 3O93A 3BD6A 1ZVVA 2F7SA 3HJNA 3OZIA 1O6ZA 2LKCA 3QVTA 1E2IA 4Y2GA 1JLRA 2ZYHA 2H2IA 3L77A 4EMTA 3PGA1 5JAUA 3OOHA 2AFHE 1CS0A 3ITEA 5B3LA 1QHGA 1ADJA 3OM0A 2CV0A 1JEJA 1O58A 1GADO 4CUZA 3PUJA 4IJKA 3DOJA 3E7WA 3BHIA 1G3RA 3IMEA 3HO6A 4ABYA 2WQ7A 4EQ6A 2Q6LA 2Q5EA 1ZCBA 4WVFA 2WDZA 3U7IA 4O5AA 4NE9A 3M1IA 1J97A 4BJ5A 5MF6A 2SBTA 5IPFA 4U2DA 2AKEA 4WZ6A 4LGMA 3B6IA 4NWIA 2RHDA 3IBSA 1DKRA 3NOQA 2COUA 2PX8A 3PF9A 4KSBA 1DT3A 4P92A 5FHRA 2IY9A 2JGJA 1BEUB 4ZI2A 1H6BA 2X9NA 1RQLA 1TK2A 3WMFA 4FR0A 3OO0A 3BH0A 2D3WA 4FW9A 1C14A 1HEYA 3NHMA 3V48A 1FIUA 1AKVA 1LJLA 1ZJJA 4IXMA 3OF3A 2CWDA 1W9MA 3MMZA 2VF2A 1LJUA 1NVWQ 1U0NA 2BEUB 2IYUA 3FPFA 3LGSA 4TLCA 4CF4A 5K0BA 2P9BA 4LG1A 3L8DA 5L40A 1DCMA 4G9EA 3DZJA 3SYKA 4F8EA 3ZKAA 3NEAA 1RLIA 2WP0A 3E1GA 4DADA 4EPRA 4QJ3A 3JY6A 1IEVA 2VK1A 1C50A 4ZVUA 4G6ZA 1CUXA 2NTVA 3M4JA 5FRDA 4F2HA 4LPKA 2QTVA 4RJJA 3E9MA 3NDPA 1N2CA 3KPUA 4BECA 1NJ2A 4A91A 4NFHA 2N0SA 2NVOA 4HATA 1VBNA 3DA8A 1VGRA 4AX4A 4XRGA 4JR1A 1P6QA 2IPLA 4FGZA 2M6KA 1V3VA 1H2AS 2GO1A 3K1AA 3LPCA 4IJQA 4MV1A 4DDUA 5KU7A 5L6LB 1RKUA 1A8SA 3PJEA 2PKXA 3QE4A 3WRYC 4ZN6A 3DULA 2P6UA 3MMNA 1KL7A 3H0EA 2PKQO 4TYQA 1U2GA 3CF0A 5I7SA 5GIOE 2D2EA 3DLIA 3UJHA 5K6AA 1AZSC 3QNUA 3BGSA 2P0EA 2R25B 3A3NA 3OZ7A 1BOOA 1ESMA 3LJKA 4TTQA 5CEEA 1E2GA 4LMRA 4BO2A 1I2MA 3S28A 4AY6A 2DKOA 1W85A 4PFKA 4BU1A 5NULA 1R1DA 3ITDA 3IR5A 2ZT8A 1Z18A 4F2GA 2B1RA 3D31A 2HPZA 3HKEA 1KAGA 3IAS1 2H07A 1L7MA 2OZLB 1F51E 2XVZA 2R6ZA 3IMFA 3MSXA 3HEAA 3QHPA 4IF6A 4RPJA 4PBRA 2ZE8A 4UVDA 5ITWA 4KB5A 3WLJA 1M5UA 2GZ3A 3A1FA 1O5IA 4PTLA 1QM5A 1OV6A 3FZQA 1RXSA 3GDWA 3OZVA 1VE7A 1IWPB 1HDGO 1LH0A 3OIGA 4IJ6A 4IXNA 2R6DA 3R5TA 4FDMA 3R7WA 4UTVA 1FEZA 2WPDA 2EGGA 2G07A 1HRKA 4BCBA 2E7ZA 4JOQA 1E9EA 1Y8QA 1G55A 2EJVA 2Z9CA 2CHEA 4TKUB 2CSXA 3RR2A 4TMXA 1II8B 2SNIE 1JDBB 4EB6B 4K1LA 3BGVA 4G01B 5AK5A 5B4VA 3DOEA 4QSHA 1SHZA 4QXAA 3AQ4A 3LHSA 2WIKA 1IOVA 2QNBA 2GF2A 5EVCA 1F2TA 2D2IA 3HP4A 3KEMA 3NVDA 3X1MA 1OGJA 3QLUA 4WY5A 2Z83A 1RCFA 2V8OA 5H3LA 4ZU3A 1FK8A 3SEZA 4PSVA 3PBKA 1JKIA 1EFVB 2BGLA 2FRVA 2R2GA 2F1OA 3C6ZA 3SSNA 2H2GA 4XYLA 1Y7TA 1RKXA 1I5OA 1W49A 4IXTA 4EL5A 5KOJB 2QKYA 3ZGLA 4C4ZA 3R7NA 3AHFA 4ERNA 5JVDA 4G41A 4A8HA 2YKGA 4B4VA 4LPSA 1RE1A 1GWNA 5TGDA 2AD5A 3R9XA 4ASUD 4RH1A 2VR1A 4PQRA 5ALOA 3QBTA 2NXCA 2Y4NA 5T4EA 3X43A 4DS3A 3EZYA 2X3UA 3OQ1A 1NVEA 2NUBA 3BQMB 3GJTA 5EN4A 2YS7A 5TARA 3UWKA 5BR4A 4RABA 3PEWA 2V98A 2XBMA 4QYWA 1LSUA 1R4ZA 5CT6A 4QG7A 1SQSA 1MGOA 3BK2A 4LE0A 1P39A 1R6DA 4PNPA 2X8AA 5AOVA 3RPEA 3ZKWA 4GLJA 4N5IX 1SNYA 4OHXA 2O06A 1Y4DE 4PO8A 4L74A 4WKOA 5FULA 3WGHA 4BDSA 4EHLA 1T4MA 5KNCD 1YDFA 1VE1A 5IAJA 1M34A 4IIBA 3G2LA 2NGRA 1JAXA 1WSAA 3LBFA 2OGZA 2XNDD 4FGKA 2QBYB 1ABEA 2IBSA 4CL0A 4F4FA 2D0IA 4NCIA 1EM8B 1VG9B 4RCYA 3SHOA 1S02A 1BMDA 4OGFA 3WL4A 3BB4A 5GADl 1QHYA 3L4JA 4EO9A 1Z26A 2DWPA 1KOJA 1QIDA 4FJ0A 2XNCA 2W2LD 1OLUB 1TU4A 1U3WA 2Y1GA 2PT6A 3F2IA 4FXPA 1T2UA 4IEFB 4OOFA 1J7JA 3ZDXB 1BA3A 3IQGX 1WDWB 3U80A 3T35A 4Q5IA 5CYGA 2WW8A 2O8NA 4C03A 1X3LA 4H4CA 4XI9A 2XCLA 5A9SB 1WLYA 2FPWA 3KXDA 3PT9A 4IDEA 4U00A 5CVCA 5F64A 1F1JA 5DYWA 3GN1A 3AL2A 3ZHSA 3EA5A 2O2GA 3ZWMA 1WBDA 1TEXA 1DKQA 4B46A 1QWOA 4A9AA 5HUHA 2VJMB 5HX7A 2VSYA 3KZCA 2CYCA 2Y0BA 5TQ2A 1CD5A 2B0CA 2OQIA 2OFWA 1RI2A 2REQB 2WILA 4HUJA 1NF8A 1SZJG 2GPSA 1B0UA 1CJUC 2GN6A 3STWA 4A2WA 5B4UA 2Z5LA 4MVJA 1EGAA 2I2CA 1GRVA 3BH7A 4M8LA 4M53A 5D2CA 3IOBA 3A2NA 5JJ5A 3BAFA 3DC7A 3FKSA 5A2QA 4CKCB 5KKCA 1GAXA 4HYQA 3RBZA 4JGGA 421PA 4GSYA 5BVGA 3KQYA 1JKJB 5K4GA 1EUCA 1R8QA 4RZ3A 2F8SA 5JANA 4DG5A 4EH1A 1TW2A 1EM6A 1REQA 1LI7A 1F06A 1G6OA 1UC5B 2NAFA 2YCBA 4H1HA 4NC9A 4BV8A 1P45A 4RPCA 3NG1A 1YH3A 2C3PA 4QYMA 3U3ZA 3EC1A 3LKBA 2JAWA 4V1CB 4DQKA 4CFSA 3FNEA 5FT9A 3WK5A 1EFKA 3BN3A 4UAJA 1CK4A 4AQ7A 3F5FA 1BGWA 3H5IA 1WCIA 3SZMA 5HYVA 4U02A 2AG8A 3DBLB 2IOQA 1D03A 1OXUA 3KEOA 3HYRA 1MG0A 3S2YA 4HXYA 2OC9A 4XGNA 2R47A 3DHNA 1Z2EA 3U4QA 4HSEA 2X1VA 4HP8A 2ZTHA 5EHZA 5CEFA 4IH9A 5FWXB 1ND5A 1YCGA 4I9FA 3T4XA 3QX3A 2Q6IA 4NCAA 2FW1A 1GQQA 2YWGA 1OGYA 4E6PA 1Q77A 1XA3A 1YK1A 1JGTA 3DBHB 3DDSA 3KQOA 4FD2A 4UXJA 2O4CA 4CDGA 3HKCB 3X1KA 1DT5A 1P3DA 4UTRA 3WL6A 3H4VA 3BZUA 3TBKA 3LKVA 1XR3A 3NBYC 5FBQB 1RNLA 2GHIA 4JJFA 4RPKA 4ZZ1A 2CHUA 4OI4A 3CCBA 2XCUA 3AIIA 3JPWA 2WAAA 2DERA 1XNRB 1SUAA 3A6JA 3OFSA 5G1NA 5BXYA 5KWJA 3BFPA 3Q15C 2RGDA 3I0ZA 1JR6A 1KARA 3G9TA 3Q12A 1W36C 2LBPA 1H2XA 2P9YA 3FR8A 4OBWA 5DYNA 5BV7A 5LYJB 3LQKA 4J07A 4MYRA 3OEEA 1FA9A 3OZXA 3D9QX 4P08A 3C3BA 3NHBA 4EYQA 3AILA 3P9PA 5CFNA 3F8SA 1MA0A 4U8GA 1FL9A 2CNLA 5GV7A 3ABOB 3VPSA 3QVGB 5AVVA 1U8EA 4GPIB 2H9YA 1VLJA 3T1VA 3OE4A 4W8HA 2ZSDA 3KJEA 1Z12A 4QJ5A 3ZXUB 4UQPA 2ZJAA 1Z34A 4DCOA 5DASA 3UKOA 1YWGO 1ZOIA 2J67A 2WD8A 3T9AA 5LKAA 4ZTBA 1E5XA 3GUZA 4NP6A 2TSYB 2JJQA 3G59A 3R6WA 4RZIA 4BLQA 4BYGA 1NQOA 1KDPA 1XQVA 2BR3A 4Y3UA 1SELA 3BMNA 3ORHA 4D3YA 5DNCA 3LGAA 4ZQIA 3E9QA 3U4HA 3WK6A 3QYAA 2OZEA 3EZ7A 4INAA 3H11B 1J0BA 3NV7A 5DI9A 2ASVA 1BFDA 1XTIA 3GGGA 3MJCA 4UXIA 1RWXA 2H2WA 2ZSIA 1GG5A 3THSA 2EC5A 4HDOB 1OPXA 2XITA 4IY1A 4YREA 5JATA 4KPFC 1X15A 5KOIA 2IHJA 1B00A 1YQUA 1HETA 3L18A 3BORA 3ZCVA 3M6AA 4J0FA 4A0GA 3JQ8A 1GPBA 3GLVA 2IUFA 4WZBE 2IZOA 5TPZA 1YO6A 4RIHA 2C8LA 4KQIA 3AFMA 2GNAA 5JDCA 3VKFA 4FJ2A 5C4GB 2B61A 3FBGA 3AF5A 4RPHA 5COAA 3G2IA 4ZRNA 4EB8A 3GQBA 3WKCA 1ODFA 1VGQA 1CLUA 3B1XA 3DOCA 5C1BA 3BWDD 2VJOA 4HGZA 1NHGA 1NUPA 1DLIA 1VBKA 1YB2A 2IBMA 1J1IA 3F47A 2J9FB 1X92A 1G20B 1RAIA 2YV5A 3BRSA 1LPOA 3MG9A 1I6LA 1UPUA 1VDMA 1GZHB 1L8OA 1CE8A 3MLAA 4R71A 1J2RA 2JF0A 2RHOA 1HDYA 3S2FA 2R6GA 1WOMA 3COPA 4R1SA 1KDOA 1BHQ1 1R66A 2R6AA 5B37A 4LRSB 1ADBA 4WFIA 4MDHA 4EY3A 2PKCA 2J3KA 3C14C 4HXFB 1JVNA 3Q7RA 2B30A 2J30A 4LQCA 4RADA 5JT1A 2F3RA 1G3QA 3ZBQA 4O08A 2WOJA 5A4IS 3TRKA 1Y5MA 3HYNA 4XWAA 4HB4A 5CPFA 3NVAA 3VU0A 2ZJBA 4LNUA 1SCIA 5TS3A 2JHFA 1AB5A 3I05A 3IBYA 4BLTA 4YP6A 3CR7A 1JA9A 3M6LA 3CGWA 5DTEA 3P1JA 3TM5A 2RJNA 3ELWA 3AHEA 3L8GA 5LNK1 1GRQA 2IYTA 2XF8A 3OJEA 3WMEA 5IMSA 1W0JD 3OLVA 3ZW9A 4NBUA 4XB6B 2DPXA 1GV0A 1TIKA 1JQAA 5I9LA 1L4MA 2OC4A 3HJRA 3OQPA 4RIFA 4FYYA 3HXOA 1YRWA 3H2YA 3IQFA 1GHTA 2ACEA 4W82A 2P1DA 3THXA 1KNXA 4GECA 5IS2A 4EYOA 3EVTA 2C2HA 3AHIA 3WGTA 4L2IB 2KQUA 4YTEA 4X1KB 3N3AC 3S99A 3TCKA 4BX9A 1XCOA 2C2YA 4TOIA 5A4FS 1IBSA 4LHSA 2HM7A 4NCJA 3TE7A 3WO1A 5FWYA 3HK2A 3B3QA 1VIYA 2CEAA 3FX2A 2IPAB 1UCFA 1JH8A 3KWJA 1XN1A 1QFYA 2QTHA 1JHAA 2BGNA 1FF9A 4X41A 4Y0AA 3G2KA 3LHFA 4KMOA 2XKJE 2XE6A 1GNSA 3EN0A 1QMGA 3FHLA 3PQCA 3RS9A 3UB3A 3JD2A 4B4OA 4DSAA 1TT5B 2I3BA 4QRHA 3LC0A 3QXSA 1R27A 1LS6A 5JJKA 4KVAA 4C2TA 2Z5VA 4NS4A 4ABTA 2PUCA 3EOBI 1IG0A 3TK1A 1T5IA 3QZUA 3VR0A 3EC2A 4HEA1 3FDZB 3HG7A 5F4ZA 4NATA 5J4VA 1V7QA 1B93A 1FRNA 3F74A 1NRIA 1OWPA 3QE2A 4MO2A 5CLHA 5IBQA 5ICMA 4F4UA 2IYNA 2O1WA 2OQ2A 5IVIA 2VYQA 1UXHA 1JG4A 2HAEA 3IC5A 1BQ3A 3LV8A 4MHSA 3V4ZA 4XVUA 2M9MA 1TM5E 3DVLA 4HX2A 5JS6A 4AB1A 4ZTUB 1YE3A 4BMZA 2MHCA 4XCXA 4NBSA 2AX3A 4YRTA 3KWMA 4KKVA 1WCV1 4JODA 2NO0A 3KVYA 4CG1A 1ENZA 4ZT2A 4DIFA 16PKA 2XNJA 3GJZA 1C3XA 3ZY3A 5CD1A 2ILVA 5CVJA 1QYDA 2FYTA 3E4CA 4ZZIA 1BDIA 2R8ZA 2J5QA 5IKXA 3GZNB 4IQFA 5EVJA 5E6SB 2YHUA 1KYIA 3H2HA 4O3FA 4UZSA 3WLOA 4LDZA 3EG5A 4KP7A 4HDAA 4M0FA 1KEZA 1PYDA 4L8LA 4HTFA 4WADA 5CA1F 4HWKA 1J6UA 5BV8A 2YVUA 3CKYA 2I8CA 4UW9A 1H0KA 3PPYA 4JQZA 4DIMA 3PC4A 1MVNA 2C4HA 3KJHA 4BQRA 4YAKA 3VTFA 3DDWA 5ALKA 4YRPA 4BV2A 1PAUA 5K3DA 2BFAA 3LQQA 2B8WA 3I9V1 1Z8HA 1VB5A 4A2QA 2VEOA 2YWRA 1U2GC 5H7XA 3E3LA 3WGUA 1KP9A 2FSVA 5AO9A 4UPEA 5K6AC 3KELA 1OZGA 2POQX 3Q88A 1G21E 4MB6A 4NG4A 5LYJF 1I6WA 4C6TB 1W88A 3W6UA 1LLUA 4P3KA 1D2EA 1H2FA 2NUPA 4YASA 2ZKIA 1A8UA 4D3DA 2JVIA 3ZEAA 3AKZA 3IVGA 2FKAA 1QB8A 1GPKA 3AONB 4MUAA 1BZYA 2CXPA 4PQGA 2QQFA 1SKAA 4GMHA 3WRVA 4K9QA 2G4LA 5JFTA 1W4AA 2VP0A 3T3DA 5IJAA 1ZN8A 3B13B 4CLRB 4RZUA 4FQ5A 4BFYA 4DZRA 3TCNA 3DNMA 1SB8A 3KZKA 4GI2A 3ZWWA 1ZMXA 1YHNA 4Z0TA 2J5KA 4FEYA 1Y3BE 1B1CA 2ORYA 2FWAA 3MCTA 1NKVA 2DPGA 3NUZA 3ZGYA 1NKSA 1NL3A 1MN6A 1R6BX 4PM4A 4QREA 2MYPA 3CXUA 3GIWA 4F6LA 1NI4B 5ITZB 3FYDA 4NPHA 3DF7A 3EXIA 3JAKA 4GPTA 4UUMA 3ZV6A 4RBNA 4MDEA 5C7OO 1OWNA 5DK4A 2ORED 1CP2A 1YV9A 2PJUA 3QYJA 2PWAA 4Q37A 5I7AA 4D8XA 1RXYA 2Q2QA 4LK2A 5CW1A 1KC1A 1HDOA 3OT1B 4Y67A 4W1QA 1HYEA 3QLUC 2X0NA 4JSYA 3MWEA 3LKZA 1GQYA 2VDQB 2N3ZA 3GUYA 4N3NA 3QU9A 1I7NA 3PR3A 3ZCQA 4DMCA 2XMRA 4HAVA 3HDGA 4PG7A 1Z9BA 3SWWA 4HX5A 4HUQA 4D98A 3R0JA 1XD9A 1P1CA 3E3AA 3M6FA 4OLJA 4RS3A 2PQ2A 3T3GA 3DE2X 1GZ4A 1OTHA 5TGTA 1LK0A 2ZANA 3OO1A 4JLBA 3RWOA 2G9VA 3WYBA 2EL9A 3PEYA 1YZYA 3NDJA 3ZE0B 3SHWA 2J08A 3TUJC 4URHA 4B80A 2HI0A 1YASA 1Z25A 2VBGA 1XNGA 3KZ1E 4WIAA 1E79A 1FSSA 1Y82A 2V5UA 4S0XA 1F0NA 4CI9A 5IWCA 2JJMA 3EXEA 1G7CA 4BO5A 1QLHA 2FZVA 1KY5A 1E98A 5B58C 1OI3A 1ZONA 1G2PA 3K32A 3JARB 4QO7A 4UDOA 2Z3ZA 3FVQA 4JGBA 5B2ZA 2OLKA 4KGDA 5LL6P 5CFOA 5A5VA 2B94A 2G1UA 2GN0A 2PGDA 2YHIA 2YV1A 3K0HA 5EJIA 3REFA 5CX1B 5GTDA 3W2HA 2HSEA 4N7RA 2D5IA 2GBIA 1PLLA 1TCUA 2PR7A 1OGIA 5I51A 2BY4A 5JNVA 4IR7A 5EXSA 3BIFA 3ND8A 2BEVB 4YQYA 3HE3A 4ZEXA 3W78A 1T8SA 1T5OA 1TPYA 4XVRA 5T6MA 1TC1A 1WDMA 4IOKA 5JALA 3RRYA 1W36D 2IY8A 1EBUA 4MWCA 4CR6A 2A9PA 2VAPA 2YXNA 3UO8B 3STHA 4B7AA 1P0PA 3IUJA 1SIUA 1RJ9B 2J85A 3TAHA 1E92A 3E03A 3ZWCA 1T9BA 4OB6A 2F2TA 2PGAA 3SQNA 5K09A 3BHMA 1NAIA 4I19A 3R0XA 3LY7A 5IJZA 3L1UA 4M0KA 3B9RA 4TV9B 2GETA 4WZBA 3WKDA 4EO4A 1MJFA 1JYEA 3PUXA 3RSOA 1KMMA 3FPGA 4WNAA 1TEHA 1Q1ZA 2ATEA 2E2WA 1YBMA 1WZUA 5EPOA 4BRWA 1E1QA 1R74A 6AT1A 1WXEA 1ONBA 2QRVA 4LZNA 4PQFA 5HIIA 1UBNA 4BFVA 5CRIA 1ZGCA 2DG2A 3WLRA 1ECJA 1QAQA 1UBGA 2RSLA 3R41A 2X58A 2WU1A 4X7RA 5H3HA 1SUWA 3K1ZA 3VHXB 2J07A 3LT2A 5C9ZA 5I45A 4YIKA 1GITA 2ARKA 2Q9BA 3QW2A 1BD4A 1CLEA 2ATXA 3AUAA 3PX2A 1TNDA 3PZBA 5BORA 2ZI6A 2K7ZA 3IOYA 4MCHA 4KQEA 3HB7A 1Z2DA 2H00A 2Q2NA 3NFRA 3MS2A 1C7IA 3M2PA 4MULA 4NJMB 5H83A 1FRFS 2O7QA 5GV8A 3SYLA 3Q2KA 2AJLI 1OV4A 4LXXA 1VC2A 3N1UA 4J6EA 4GNKA 4WT7A 4C14A 3C7KA 1OFGA 1V1MB 2ERYA 1ULBA 4HL6A 5ENDA 1J8VA 3RLIA 4WECA 1CUDA 3Q10A 5A0VA 1L7PA 5G1PA 1ZGJA 4RWEA 3UCFA 1RMTA 5DF1A 2IOHA 3SYMA 5J9FA 3RS0A 2O7SA 2XZLA 4I6GA 5AVKA 3T34A 1AIPA 1NHWA 2XJ9A 4LRXA 1ESDA 1N7JA 1YC2A 4KJZA 3OU7A 1RWVA 2XY4A 2Y77A 3QKIA 5AJYA 4OPMA 3OJ0A 2UZ4A 3G7SA 3HCEA 5JQWA 3DE1X 4I6JA 3RD5A 2Y3IA 4X91A 1QGOA 1RRPA 4LDAA 3IHWA 3M0EA 2E4UA 4HZGA 3WGJA 2NADA 3EQ6A 3PE6A 2P4SA 4I4LA 4G8BA 1XU7A 4CQMA 4UBMA 4MW5A 5B3KA 1V43A 5K3OA 1VL5A 2XXAA 1ECLA 3QG5A 4U7PB 4OV6B 3DFMA 4L3VA 4B3IA 3W2FA 3K15A 2H4HA 1CNMA 5JS7A 1SM4A 2C5BA 3BRWA 1Z06A 2DLDA 3LUKA 3SK0A 3PDCA 5ERXA 1QAMA 1UDWA 5F7ZA 1E20A 4HB0A 2UYHA 2IEAA 1R0ZA 1IBLB 2QQ5A 4LS3A 2XGJA 1ATZA 2C2OA 1QS0B 1X0XA 3F3YA 2W5UA 3KTAA 3TTWA 2ZUCA 1LLDA 3DW1X 3K0CA 1SBIA 1L7VC 3BMOB 1XJWA 4YECA 2P5TB 5LPNA 2BMWA 1S8FA 1E9DA 3MT7A 1JB1A 3LF2A 3W2EA 4ZO4A 1R5JA 3U0VA 2EKBA 2GXQA 4BB9A 5KPJA 3DKVA 4IVQA 5CIQA 4BP8A 1WO8A 1NVUQ 2QN6A 4JL5A 5EE5B 3GD7A 4JASB 3F5DA 4LF8B 4JLOA 1PKXA 1ZBDA 1OREA 3VPFA 1MJGM 3VMMA 3QVSA 1XJCA 3SZGA 5DI3B 3T1NA 4AYXA 4C4SA 5K4HA 1PHRA 3GMIA 3Q3GE 3WYEA 2P2CA 4KN8A 3A32A 4GEGA 1NMSA 4JOCA 4DMUB 3ZLJA 3D2LA 4CTKA 2HJHA 3N53A 4UVHA 4ZC8A 5I9TA 5A4KA 5HPYB 1M5RA 1KZ6A 1QR6A 1TEVA 1U7DA 4FWIB 3VKVA 5E7IA 4DYDA 4C0KA 3QFSA 4Q1CA 3EZFA 1NBAA 3UKDA 1UZLA 2WSYB 3V4SA 5A2GA 2C9MA 2J5XA 4L95C 4TSRA 4TXJA 4E13A 2PQMA 4H15A 4Z99A 1M2VA 3GLGA 2BEWB 3W8FA 3TJMA 3HXLA 2O3QA 4TTTS 3D5QA 1SOVA 4E30A 1BRTA 2VT6A 3RUDA 4MKXA 1DFGA 1K27A 5JDCC 2NU9A 1FXWF 1SC3A 3OC6A 2AQHA 4LWZA 2ON6A 1VKNA 4MIOA 3AVPA 1RWOA 4O5OA 4AMVA 3ZDBA 3WDLA 4CQLB 4ENPA 5K20A 5IMBA 2G1KA 2H1OA 1VYTA 3OZTA 4IRUB 1D5WA 3OWXA 5FOTA 1XMXA 1NBHA 1ZX1A 1T6ZA 2DHEA 2GCEA 2IYLD 2JBWA 3N6RA 3GEGA 5IDVA 3HR7A 1LKZA 2XZPA 4PS0A 1PFYA 3CUKA 1VL1A 3PCTA 3E1KA 3QKTA 4NZMA 1S3GA 3KUKA 1WD7A 3K09C 4B9AA 3UUGA 1U9YA 3A4VA 3C48A 3H6KA 2HPVA 4H7IA 1ZRMA 5DYIA 3S2GA 3W6ZA 3ZVLA 1B3BA 4G67A 1J33A 1EINA 2I71A 4MWOA 3CX3A 1U2QA 3II6X 2VQ6A 1X13A 3PTZA 4RY0A 3NIGB 3AZPA 5GJCA 3W2TA 4G36A 3AEKA 1UANA 4LDJA 3FVVA 4MR8A 2VTBB 4ZJYA 1TUBB 9LDBA 1N6IA 3AJ9A 3I4FA 4P4NA 4BVBA 1GNLA 3D3EA 3WIVA 3KQSA 4C4XA 4I5DA 1H8HA 1H23A 3OZBA 4BWYA 3NRCA 4WN9B 1W4BA 4PNZA 4P5PA 3B48A 3NASA 4IDAA 2CHVA 3N75A 3Q6MA 2E0IA 4MSUA 1KQPA 3R6GA 1TAHA 1DJPA 2GJSA 3F9CA 4DIEA 4EKIA 1WW3A 2AI3A 3BXXA 1H2YA 1UMKA 4QOEA 3ITKA 2FU5C 2GZ1A 3OZCA 4G24A 3ZDYB 5HKAA 1TVKB 3KT0A 4UDNA 2V4UA 2VYVD 5D86A 1CZRA 3S81A 3OZUA 4GMDA 1HUQA 2RHWA 3LYUA 4Z3OA 4X8LA 4DR5B 4OQEA 4Z9BA 3UN1A 2R5WA 4J90A 3FGZA 1Q1GA 4MMZB 2B1JA 5HSGA 4F7WA 1PZNA 4OHWA 3LO8A 2WPDD 3UH0A 4MR7A 1S89A 4GRDA 3PA6A 1A2KC 1MT0A 2QN7A 3BXGA 3CLHA 3NYRA 1N2EA 3M70A 3O4HA 3QOYA 4OP2A 2XCSB 3VKHA 4Z3KA 2W83A 1N2BA 3REQB 2PL1A 3AG6A 2FZ4A 4LJ4A 1C7FA 1MJHA 2VUTA 5KSWB 2FZLA 2CLCX 2RKWA 5F2KA 2AJDA 2PUHA 3V8VA 4GSLA 4Y1RB 3KHUA 1FPQA 3UK1A 2JIQA 1JQBA 3MBIA 5ITVA 1JBEA 3U3XA 5EFOA 4P86A 2MINB 2ZR9A 4H2DA 1KEPA 3NBMA 4REOA 3TBFA 3RUCA 4GVPA 3KSBC 1Z7WA 3W5UA 4ZYWA 5EE9A 1Z5UA 3BD8A 4BQOA 4EB0A 4B73A 1B73A 5IAKA 3UHAA 1HX7A 3GLRA 1R4NB 2A9KA 2Y68A 3FGNA 1ZY2A 1GPWB 4RVDA 5CDTA 5HQTA 3PDJA 5AXBA 4MRNA 5FYQA 4A23A 4QUIA 3VV2A 3QUQA 3VR3A 2VCYA 3JQ7B 3R9KA 5ESXA 2FWBA 2X4DA 2ZJ5A 1OHHA 4Q21A 1P4RA 4OHYA 1JAYA 1POWA 2DCUA 3F3KA 2D0OB 4TLLB 1T2VA 1TZMA 4TYYA 2J4CA 3H5AA 1JHUA 1G18A 3D6VA 3IALA 3KL2A 3D59A 4LXQA 3H9CA 2FGKA 1G9TA 2IZ5A 3EXG1 2QD1A 3KRTA 4GC5A 3N2KB 2XBLA 3VYRB 3D3WB 4P33A 5J40A 4D1YA 4HNAB 4LBYA 3H3JA 3HCOA 3BKXA 5FBZA 2PKQP 1ULZA 3A2LA 3GEMA 3GGDA 3CKLA 5CDUA 3RBXA 4RJ2A 3D3KA 5JH7B 2ODEA 3BYZA 4RZHA 1JDVA 1ZYUA 4ARCA 1E7YA 1P19A 2JKZA 1K8XB 2G5GX 2EQ5A 2FSVC 2BFNA 2JA2A 3TQTA 1I3NA 4ER7A 4IIVA 4MEAA 3M82A 2HMUA 1EP2B 3SVTA 2G9UA 3IFSA 3ZWOA 1W581 5ALZA 2JGEA 3AFHA 3QWFA 4E2YA 3CZCA 2WD9A 4GKBA 3CURA 3N2ZB 3PEFA 5TXGA 4Z9YA 3R8CA 3WLHA 4DT1A 4W63A 1TKRA 4X94A 3COSA 3CM0A 4ZAVA 4J8PA 1FYWA 1L4LA 1FQKA 1ZHFA 1J99A 2EWMA 3IEPA 4IGFA 2JVKA 3OBIA 1A4IA 1UEIA 3VXKA 2GZHA 2VF4X 3JCZA 2B5WA 2W6ZA 3MTJA 4ZRDA 3RS3A 3SMQA 5L9AA 1V8DA 2AWOA 2J48A 1K9SA 1A98A 3L6EA 4JENA 1I14A 2VUHB 2V6GA 4RL4A 2PCJA 4M6WA 4F4JA 5AK0A 1FFEA 3F49S 3FTNA 5D5QA 3JZIA 1LVUA 5KOYA 4UHFA 3KKKA 1FS6A 4PAMA 4P2GA 5IH7A 1AUPA 1RRGA 5JNSA 2CZGA 3ZV3A 3LGXA 4DDTA 4S2EA 3F2VA 3OP1A 4XGIA 2LXNA 1XTRA 1UK6A 5EPUA 1A4UA 2I7CA 5I4IA 2PX3A 2RJOA 1NONA 5HK9A 5BSKA 2JGDB 1Y7HA 3BUSA 1DIGA 3R1IA 4QNRA 4UTNA 3AUXA 4UCFA 4JI7B 2RKBA 4LCJA 4WXMA 2JLQA 2VTKA 3Q5DA 5HKKA 1EB8A 1GAQA 1SMKA 1UXKA 3SYTA 2DVMA 2XD9A 3P4XA 3D8UA 1ZJZA 2C98A 2BOVA 3C16C 4IDFA 5HE8A 4RTNA 2OUKA 3KJZA 2QJFA 4MICA 4R1TA 4Y9RA 5ECDA 3CZ9A 4OQFA 2I2WA 3GLIA 2OHJA 2QTZA 4R84A 3PF8A 2VHCA 3SOZA 3GLFB 2EWVA 5BV2P 2ZTVA 3D81A 1JQKA 4NYMQ 4OM7A 5IANA 1CUCA 1YBVA 4U2GA 1P74A 1MO5A 3DBVO 4D8YA 4KPEC 2PUDA 1DOZA 2NVBA 3MS7A 5KTKA 3LSTA 4A8JA 4MWEA 3HSYA 1HKUA 1F2VA 1Z6TA 4L5IA 2UUCB 4BUCA 3WDMA 3OCJA 1JEDA 4BHTA 4OXQA 3JVVA 1GOTA 4MVJI 3U62A 1HYGA 1SOWA 4J0QA 1IJBA 5BOSB 4QXOA 3K9QO 2HZ7A 5YASA 4XX0A 1KQ3A 1L7RA 1P9NA 3PNVA 4PEVA 4TZ0A 4A1FA 2G63A 3S7TA 1PV1A 1YRAA 3H8SA 2X86A 3PJFA 4H6WA 4MV6A 4A0QA 3RO7A 5KYKA 2OO5C 4FHZA 2FMFA 3KQKA 5KKAA 3KOMA 4GX2A 3RAJA 3TX2A 4MITA 2JFBA 1S2OA 4XSGA 2VXOA 3E2MA 1FLDA 1TMKA 1SVKA 3X1ZA 3E9RA 1DO0A 1JJFA 4NMLA 3LCCA 3MELA 2NPFA 1O0BA 4AN4A 1II9A 5D84A 1HT2E 2Q3EA 1RQRA 4U9IS 5GM1A 1RYMA 3TR6A 3L46A 2RONA 4YRRA 3I34X 3PQEA 4KVFA 1DAFA 2D1FA 3UJAA 1YA6A 4EVSA 4GKAA 2JI9A 4Q1AA 4II3A 3EIOA 3FOZA 1IIRA 4RA9B 4G4JA 1LTHR 2HWUA 3DWGA 3I01A 3ZDZB 1KZYC 5HKBA 4MGHA 1SXPA 2GM5A 2Z43A 4LW8A 3E5RA 5BRAA 1YRYE 4HGYA 1W87A 4QPCA 3NP7A 3BJMA 2YWFA 3HCDA 5BSTA 4UM5A 3QF4B 4FGSA 3H1AA 4ZJUA 1U3DA 1C1XA 1QFSA 3ESCA 3NDBB 3L0OA 4LHWA 3L8MA 4FXOA 1S01A 1J49A 1K3FA 4CNBA 1FFGA 3AEUA 1F7VA 1EU1A 2MR5A 1UAGA 4I4NA 4OQDA 4ZT3A 5J4KA 4TLEA 4AL4A 2JFZA 2I4RA 4G5SA 3URMA 3ZE2B 1N36B 4FWBA 2Y71A 4KQGA 4RETA 5FORA 3IDFA 4XQ9A 2CN1A 3PV0A 1FSPA 1VPEA 2QR5A 1CG6A 1P61B 1RAEA 2YR0A 2AZMA 3O5AA 1PYGA 4I55A 4MWGA 3PE4A 4B0OA 1IK4A 1AN0A 2R7AA 5HVNA 3R3SA 5LDDC 2Q1TA 1YFLA 3AF4A 3D7RA 1FUKA 3O8LA 1M1YB 1X8KA 1M72A 2IGBA 2XMBA 5FBLB 4V0QA 3IOCA 4EPTA 4PCVA 3TB4A 2GWHA 1HLGA 1ULHA 4GVXA 2VK2A 4HDQB 2ID4A 3AEYA 2BFPA 1XI2A 2KMLA 3D8RA 1FMLA 3M9LA 4Z4HA 1E3MA 2OOSA 2N46A 4JJZA 3NI2A 4DJJA 2BGIA 1F0PA 3WR5A 3MWYW 5B1EA 3I09A 4UD6A 2H9AA 1M8FA 4RD2A 2GHTA 3BE6A 3COYA 4Y2XA 2XRZA 2YOFA 2MSLA 1TD9A 2ADOA 3FWZA 5BY2A 3OTIA 3P5BA 4Q7QA 1UBEA 1IBMB 2W43A 2VDPB 4PONA 2R7MA 4REMA 4FB4A 1Z4KA 5EKXA 5L3SB 2ZVDA 1JEOA 2WWTA 3C70A 1SUIA 3ILYA 4K8OA 4UPDA 1EA5A 2HDNB 3O9ZA 4DM7A 1KY4A 2O23A 3D6TB 4DG8A 4CU2A 3JASB 4ZODA 4EFDA 1PTJC 2ZSKA 4UVIA 2HJWA 1ZW1A 3J7TA 3L4SO 4MKFA 4MVJG 4RK7A 1Y1SA 4AF8A 2ZJZA 1EVEA 1YDMA 3E9EA 2TMDA 3FPLA 1KK2A 1SU7A 3E7XA 4WOPA 5CH8A 5F73A 5JH7F 5BSEA 1DC7A 2RIRA 3P9ZA 4RD3A 3GY0A 4LAFA 2G1PA 2X9VA 3JATB 5FLXA 4X6YA 2Z5FA 2VBCA 1EWVA 1RIFA 1VHDA 1UXOA 2BDEA 2POCA 4TV8A 2JFNA 3NATA 1QH1B 1PHPA 4AIRA 5DMHA 5IC5A 5ILQA 4ZICA 4H35A 1RAFA 5C8XA 2YZ7A 1WCYA 4XWGA 4L5CA 2O2EA 1XG5A 4XQGA 3O3CA 4ZA2A 2FP4B 4UKDA 1AXEA 4DBLE 5K8UA 3LC7O 3P2OA 3QPBA 5ALUA 3I53A 4WESA 1Z83A 4DLRA 3K0CC 1SKQA 2X5NA 1W0KA 2L69A 5K1ZA 3A9RA 4YQEA 5ED0A 3RROA 2P9FA 3IMKA 1Y3AA 1TZJA 2A84A 3L8YA 3N74A 4FDAA 4CT5A 2PEZA 2I62A 4EAAA 5BQXA 3GJYA 2AOVA 3KQWA 5C1PA 4JV5B 1DI0A 2ZQYA 3HV2A 1KDYA 1JE0A 1QDUA 3NT4A 4P82A 1QFZA 2B3DA 2OCYC 3DYIA 3WBKA 2H5LA 4CKBA 2ZBGA 5H1YA 4F3YA 1T9HA 2YNMA 3IAM6 2F3PA 1YRBA 2LGJA 3P9IA 4L15A 1K8RA 4MYSA 4P54A 5GOZA 3HA3A 5JASA 3B85A 1ZUNA 2QVBA 4H0NA 2OYSA 3EXFB 3E9NA 3LUBA 1VPWA 1SIOA 5HR5A 4IHKA 4DTCA 2QEQA 2N1MA 2VN8A 4R7TA 3FNBA 3HR8A 1G2OA 1MB2A 3V97A 4DA8A 1KVRA 1P18A 3CRVA 1V6CA 4WKCA 3ZEIA 2Z08A 2EHDA 1YS7A 3NUGA 1SJ9A 3PU6A 3QELA 4GF5A 4LJAA 1I6MA 4O4HA 1WL8A 5IW8A 3VGJA 3F6PA 3TGPA 1G8JA 2FMXA 3HDHA 1KQOA 1D4FA 3K73O 3IP8A 3M9WA 4JI8B 2CFIA 2V4ZA 1KAEA 1Z0SA 5TF4A 2I6UA 1ULTA 4ZAXA 5IU6A 1DOHA 3IYLW 1PD1A 2QZSA 2FV8A 1QG2A 3EFHA 3M7IA 3SXUB 1FRQA 1VI5A 4I2VA 1EX9A 1I80A 1QOZA 2B4QA 3DDHA 5FBHA 4JXXA 4HQRA 4I8DA 2ONZA 4QASA 3AR5A 1ZM9A 3C1OA 3T4UA 4EG0A 3H5RA 2AJBA 5LZ9A 1JJIA 5IF9A 1JHOA 4CKYA 2D4HA 4DNPA 5DGCA 2IXTA 3MLBA 3PPVA 4V2IA 2I6GA 3H9UA 2IU0A 3UGJA 1B0PA 4QQFA 2NU7B 1CUHA 3GCXA 2JFVA 2LCIA 4RA6A 2RC5A 2BHTA 3MWFA 4E1VA 2CJFA 1BN7A 2NZ8A 4NYJR 4MUEA 3TUZC 3DBOB 4IFTA 5EIAA 3S29A 2EWWA 5L7TA 2XB2A 3MT8A 4HNHA 1GPJA 1COZA 1CQPA 3ES9A 3R5KA 1E3LA 1OI7A 4B7XA 4X8MA 1IDOA 2O8DB 4R8VA 4WNYA 1I9GA 3O4VA 4QRDA 3E81A 3C45A 3TR0A 2ZIAA 4IW3B 3WQSB 2P90A 3L0DA 3MYYA 4KO2S 2P62A 3Q8MA 1Y4SA 2ZYSA 4UUBA 4ACAA 4CEIB 4FLFA 3WLEA 3ZWQA 3CS3A 1MFPA 5G41A 1QR2A 3ZQ4A 1A9OA 1C9EA 5EJFA 7GPBA 1D0SA 3Q8WA 4ZHQA 5KYXB 3VVBA 5GIPE 3WBJA 4MRPA 1XEXB 4B85A 1ZVQA 3NHWA 1Y0BA 1DHTA 3K2BA 5A4AA 3E6AA 4IUYA 4HDNB 5LU8A 6LDHA 1ETUA 4H16A 4DA6A 1KPHA 5FPKA 1MX3A 2XRYA 5HF9A 4W5OA 2OHOA 5BV0A 5F2NA 2REXB 3A9CA 4DRYA 4RZ2A 4P3OA 3IV7A 5FLEX 4BKQA 2WIAA 1WV0A 4MLCA 4MW0A 1B41A 2VKTA 5HRCA 4ATNA 1BDMA 3W77A 4GP9A 1KDRA 4K6HA 3BIOA 4ZVNA 2P9QA 1VRCA 3NORA 2OV2A 3A9WA 3T7DA 4IVNA 4YXWD 4KR0A 4RGQA 1M1UA 3CHYA 2OBNA 1UMDB 4NU5A 2AMVA 2X8WA 1HYHA 2WYUA 2GFIA 3HN6A 2PRIA 4BX0A 1K06A 4DJFC 3ZG6A 5DTIA 2BGRA 3DP7A 4YRGA 4IOLA 3CW9A 1FNCA 3AR7A 4EA7A 4MYDA 1G42A 1IVSA 2VUUA 5C5IA 1W5FA 5BUSA 1YOVB 3I5YA 3ESYA 3VYUB 4YJKA 4WACA 1HGXA 3ACCA 4HRYA 2WUDA 1JIKA 4YRDA 3LLMA 5DLDA 1I4EB 2B5OA 3HMKA 2D13A 3HACA 4FFVA 5CB0A 4W1SA 2ISSD 3OCXA 4Q24A 2PZ8A 1NDQA 2XPCA 1I3CA 4R05A 1TQ6A 3UT6A 1QV6A 5K8LA 3ZBUA 1X80B 1ARZA 4TWZA 3HU3A 2OXEA 2BV3A 4UM8B 4C06A 5B64A 4YLGA 5HMLA 2HCTA 3SJZA 2SICE 2HMVA 5DXAA 1X87A 4ZOEA 1BNCA 2PBLA 5ALQA 3WC4A 4EHHA 3KE8A 4A6EA 3RUFA 3GDHA 3OLCX 4IZIA 5BP7A 4EW6A 5IEBA 3IRUA 2W2NA 1SKYE 3DQPA 4CTJA 3K9FC 3W5HA 3ABZA 3HU5A 3PS9A 4RIEA 1E7WA 2GDJA 2HNKA 3A1TA 3ASVA 5ALYA 3RF7A 5EJ9A 4LXYA 1US8B 1HNWB 4QBKA 2P30A 3SMVA 1UBLS 4CMIA 5KUTA 1OWMA 5CFLA 5DZSA 2XOKA 2B6NA 3KYDB 2C1XA 3SDBA 1Y5RA 1KJ8A 1M2EA 2C04A 4XDGA 2FCAA 4JX8A 2JRCA 3QI2A 2IU6A 2CJPA 3JAWB 4MR9A 2GBPA 1ODIA 3PQFA 5FA5A 3RYCA 1IMJA 4R2IA 3VDRA 1NQUA 2IV3A 1ITZA 3C3WA 2J3JA 1QC5B 4ZCTA 2WTUA 5LQMA 5F33A 1R8XA 1DKUA 1Z0JA 4IFBA 4LVUA 4INOA 2X7JA 2NZ2A 3AI7A 3P9KA 4BAZA 1F3LA 2XMCA 4AICA 2GZRA 5IHPA 2YJ3A 4EYKA 3RYIA 3DP9A 3DO8A 1P3JA 3CH5A 1O6CA 1MNQA 4XGQA 3WGOA 1QE5A 1U80A 2K4MA 2GNPA 3CUVA 4WK0B 1XNQB 3GUUA 4JQOA 2X8JB 1JEYB 1IJKA 3O6VA 1LX7A 5F35A 5FTLA 1VE3A 1SUSA 4CM4A 4BOYA 4LN1A 4YR7A 1YMVA 5J4YA 4L4UA 1PR6A 2QX4A 4PYRA 2BFEA 1H0RA 2W70A 2A9RA 1W35A 2QTMA 2WPNA 3RAGA 1E1QD 3I39X 3UJDA 1ACMA 4M1MA 1Z7EA 2N42A 4U39A 4Y6LA 4QWMA 4XM1A 3RYHA 3VZSA 2EZ8A 1LLQA 1FDRA 3ROMA 1BN6A 3B1WA 1UJ4A 4DQVA 2OD7A 3PJRA 4YJ2A 5CLFA 5BYKA 5BMVB 2OGTA 1B2RA 2VHYA 3H87A 1QIKA 2WINI 3KKLA 3D8NA 3N2GB 3VSCA 3TQQA 4GYWA 1RT9A 4NOLA 1RCUA 1WJGA 3KJQA 3RRXA 4BN5A 2Q1YA 2IZ7A 4JYBA 4OLHA 5H0IA 7ADHA 4HNRA 3WGYA 2ODBA 1CDDA 1HTTA 2WD7A 3DCIA 3DVSX 3GRKA 4KBFA 3T95A 3CH6A 7REQB 4TYWA 2DU8A 3FDIA 3H7IA 3HJUA 2ZIXB 1K6MA 4II2A 4LYYA 4Q3CA 5EQFA 1DBSA 3TIIA 1CUWA 1OBOA 2FG5A 1FP4A 3MQ2A 3PXEA 3W3AH 3ZCPA 1YB1A 3BEDA 1Y8ZA 3ZD7A 1HMYA 2OKCA 2QMEA 3BBPA 4DDVA 4Q3NA 4M88A 4A8JC 4A82A 1O94A 3AJDA 4R68A 4QGBA 2JLUA 3LA6A 1XMPA 4DMFA 2N1BA 1GUBA 3MGAA 3TL3A 2AG6A 3LK6A 4D8VA 4LOIA 4D5EA 2RJ3A 2OGUA 3ADDA 2VP4A 4ZQBA 1ZAYA 1ZM2A 1U5BB 4A2PA 3TFOA 4MWSA 2AI2A 4Y2HA 4RKEA 2WWXA 1DAOA 4XJVA 2JCGA 1SIWA 1WV1A 4K26A 1WSWA 3H16A 4PFQA 2J9ZB 3L6UA 1U81A 2FJUA 2RH8A 3E84A 3SAJA 5BRJA 1ODTC 2DFVA 1WNTA 4CRWB 1DQZA 4MEJA 3ACDA 1UUFA 4NMMA 5M3BA 1I1QB 3SEQA 1G8HA 4CQMD 3VZRA 2ZM6B 2C9DA 4UHHA 1U2TA 2IHNA 1MX9A 4YWJA 1R2QA 3ZQJA 2OL4A 3AFNA 1E5DA 5EHXA 2EW1A 3ASZA 5SY6A 2R48A 1RSZA 4O8ZA 5EYPB 2RHLA 2Z1DA 3BRWD 1WHTB 4G09A 4G1UC 2LZ0A 3NANA 2RMKA 4GP6A 1K6IA 1Y8RA 4AQDA 1N8NA 4Q82A 3PB3A 3EGOA 3NDIA 3CQ9A 1RFLA 2EARA 2LP4Y 1T2CA 3VVLA 4UUNA 1N2CB 2IGTA 3VSDA 1HE2A 4KBYA 3MK31 3TIGA 3WLKX 3NYIA 4YRFA 1G5IA 2VHJA 3K1AB 3OPXA 4F97A 1NYQA 4W5QA 1OH6A 3WK8A 4AKIA 5LM3A 5LP1A 1FY2A 4JDPA 1WBJB 1FE8A 3P26A 5JY1A 5IK2A 4DBVO 2QUAA 3D4IA 1G16A 3R9IA 3ZU4A 2BI4A 3NWEA 4UC0A 3FNGA 1DKOA 3I32A 1QGED 4IO1A 4KH1A 4MRSA 3H2BA 4DCCA 2FUG1 4NVRA 3PXGA 2QXTA 2X9QA 2PX5A 1CVRA 3WGKA 2GCGA 8ADHA 5ICEA 2PLAA 5C52B 3A1CA 3FW1A 3UANA 3ZHRA 5F98A 4JT2A 3EZ2A 3AINA 1OH8A 3FN4A 3MBOA 2HU7A 4G89A 1TYEB 2C4NA 4RC9A 3W6NA 4L3WA 1JTFA 2D5AA 1RBMA 2AOTA 1S6YA 1PJCA 4ESOA 2FE1A 2C94A 2C4WA 1ESCA 3VR4H 4ZZ0A 2CBZA 4F1KA 3BPSA 3FHTA 3QEMA 3RV4A 4A0SA 3ZWYA 3ISJA 4XEHA 4J0GA 1VL8A 2CUNA 1JLLA 3UICA 5F4BA 1T13A 4K3VA 4C1NA 1VSBA 2VUSA 1Y8QB 3CCFA 1P9RA 5KQLA 5C53B 4KE7A 2OCIA 5GINE 2VT7A 4WJLA 4ADSG 2BKUA 4A6DA 2OM2A 2O8BB 1ZNYA 4CGYA 1NN0A 2WM2A 5EUBA 1WXQA 1BE0A 4K5QA 1CXZA 4W99A 4WVLA 3NHJA 3F4BA 3CVJA 3NVMB 1GU0A 4GOXA 2BJWA 4NU6A 4C4AA 2VS1A 4O1HA 1Q92A 2GEFA 3GJ8A 4L0MA 3EUEA 4HQOA