3HU5A

Crystal structure of isochorismatase family protein from desulfovibrio vulgaris subsp. vulgaris str. hildenborough
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
190
structure length
190
Chain Sequence
NRTVALAIIDMQNDFVLPGAPACVEGAMGTVPVIAGLLAKARAEGWMVLHVVRAHRADGSDAEKSREHLFLEGGGLCVAGTPGAEIVAGLEPASGETVLVKTRFSAFMGTECDMLLRRRGVDTLLVSGTQYPNCIRGTAVDAFALDYDVVVVTDACSARTPGVAESNINDMRAMGITCVPLTALDDVLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF isochorismatase family protein from Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough
rcsb
source organism Desulfovibrio vulgaris
molecule tags Hydrolase
molecule keywords Isochorismatase family protein
total genus 62
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3hu5A00
1NF9A 2FQ1A 3OT4A 4L08A 3TG2A 3R77A 3TB4A 4WGFA 3TXYA 3EEFA 3HU5A 3HB7A 1YZVA 2B34A 4WH0A 3PL1A 1XN4A 1YACA 2WTAA 3S2SA 2H0RA 1NF8A 3KL2A 3R2JA 1J2RA 1X9GA 3UAOA 4L07A 3V8EA 4H17A 3O90A 3O91A 1NBAA 3O94A 3MCWA 3O93A 1ILWA 2A67A 3OQPA 3IRVA 3O92A 2WT9A 1IM5A 3LQYA
chains in the Genus database with same CATH superfamily
3QQPA 2FMTA 1VBMA 2ZWVA 1TKRA 9GPBA 2OD2A 2BUCA 2Y1GA 4Q02A 3BA6A 1OR8A 3EZYA 4HWTA 3GEGA 4ZT2A 4EA8A 5AI5A 3ILXA 4DANA 3Q0IA 3NOOA 2CKDA 5HIKA 4X62B 3QX7A 1IDOA 2CHFA 5A7GA 2ZZMA 2NVBA 4HKTA 2AG5A 2EYUA 4ID9A 3AI1A 1J2JA 5DXJA 4JELA 4MNTA 4U7HA 3PIIA 1ESNA 3GA0A 2XODA 3RKUA 1IQUA 2OPBA 1FDOA 4MW7A 3ZWBA 2F9MA 3FF4A 2JK0A 1N57A 4URXR 1QK3A 5LU8A 1J7KA 1WB9A 2EARA 4Q9LA 4KFTA 1IY9A 1VHJA 2CLIB 4OUKX 4R7ZA 1KSHA 1UK9A 4PNHA 1MAUA 3EXHA 3BMOB 3U0BA 1M6NA 2AF4C 3V9PA 2QL9A 3N7UA 1PSZA 4R2XA 3ZY3A 3UJNA 3T6KA 3LV8A 4EO7A 4QZVA 5FNZA 1N6OA 5CJJA 3HDYA 1BYUA 2JL1A 2PLFA 4IDGA 2CLKB 4CLDA 4DTCA 3WWDA 2HF7A 1BFDA 3IAEA 4KGZA 5JZSA 2BKEA 1E1RD 2G28A 1XJ5A 1IC6A 3DWIA 3BG5A 2RH5A 3P9QA 3AB8A 4U2KA 3QVTA 2J0VA 2VXOA 3NHMA 3G59A 4MGYR 4WCDA 5ELLA 3LUDA 4M1TA 4RF5A 4KR9A 3L49A 4YK7A 3PNQA 5I7OA 3KCNA 3B6MA 3ASZA 3B53X 3IKLA 5LZ7A 4GQIA 4FSHA 1I94B 1QOQB 1IBRA 2EJVA 2BR3A 2RAPA 2RKWA 3B1XA 4BO6A 2R5WA 1A1VA 3R7BA 4FSXA 3L1VA 4FDTA 4O2AB 5FBVB 5AW1A 2VDWB 5IDVA 3L6UA 1GCIA 1KO4A 1A9SA 1WDKA 4US1R 4RKRA 3V46A 4C5CA 1XMQB 1VGQA 2WM9B 4BLPA 3A1EA 3AEQB 4LRWA 4LIPD 4LZNA 4GMKA 1X7HA 1F2TB 5B1HA 3NZEA 4Z7QB 5AW7A 5CB0A 5J5VA 2JARA 1TKAA 1ONOA 3CMMA 1PWHA 2I1QA 1K92A 2XD9A 3ESZA 4RFVA 4V3BA 3G0IA 4YASA 5K0GA 1NQTA 1NOIA 2O2EA 4LOIA 5DM70 4D02A 2P2GA 2PKQO 2I0FA 4EA7A 4YRSA 3ETLA 1ZL0A 1ZSYA 1S2LA 3CQ9A 3M3PA 5JADA 4OLBA 1UINA 1NMXA 4BWVA 3A11A 4LZAA 1N4DA 2GLXA 5CDUA 3PEFA 1SB8A 1E79A 1VIYA 1YR2A 2BFCA 3L0BA 3TJZA 3ZLTA 5KYNA 1XF1A 3C5WP 1Y6JA 2QR3A 3L7YA 1QSGA 1JYFA 2OO3A 3MTAA 4EARA 1XOIA 2CL5A 2QE7A 3KLOA 4ZICA 1G64A 2CNWA 4RJKA 1YZFA 4QQKA 5BOSB 4G0MA 4AROA 2Q2WA 4OH7A 4QOGA 4LOKA 2X6RA 1GQRA 3H6GA 3UC5A 1N0WA 2OA0A 5AJZA 3HYNA 3JATB 4YALA 1MIOB 3L4BA 4RNDB 5FO1A 4D81A 3ZQ4A 4P7BA 2C4VA 1FU8A 3N76A 4IXDA 1MPTA 3ZWCA 4V2UA 1VA5A 4XB2A 3RASA 2CUTA 3J80A 3C1OA 4B47A 1DZIA 2GVDC 3I61A 3MN1A 3FFBA 2VPQA 1P4RA 13PKA 3BH6A 4DILA 2J7PA 2VUSA 721PA 3W5BA 3HDTA 3A37A 1OAKA 1AHPA 3TTXA 5E6RA 3ECSA 1PL0A 3ZNNA 2XAAA 4Q16A 2INGX 3JU3A 3I37X 3GOQA 3ZZUA 1K8QA 2ZYGA 5AUPB 2VTBB 1L5RA 1WUYA 4UFOA 3Q85A 1OYOA 2PMDA 1ZSVA 4C87A 5ITZA 2YDYA 2EIHA 1QIJA 2AYYA 4GYKA 1JFLA 1TF5A 1ZYUA 1ZH8A 1NPTO 2I7TA 1S01A 3COYA 3NAQA 5KWVA 1DX4A 2BBTA 1RHRA 3FHOA 3QHPA 4I4IA 4IL5A 3RK0A 1IWOA 4Q6WA 2Z58A 1JHMA 3EGXA 4B32A 1E1RA 3HR4A 4HYEA 3ULKA 1J09A 3Q3VA 5ELMA 1D9XA 3BXOA 4M9RA 3GROA 3CB2A 1Z0SA 3T7JA 2PJRA 1QH8B 4MVXA 1NT2A 2OB1A 4XRRA 1YONA 3PDCA 4HCJA 1C30A 1RZUA 1JG7A 5IABA 4YJHA 2ANCA 3IBTA 4RD1A 3VU1A 2WHRA 3HB1A 1JHRA 2V55B 1UCFA 4NMMA 4EHDA 2ZRAA 3VPXA 3AR8A 2PGNA 2ZJ0A 3TOZA 3CLTC 3F7NA 5BV1A 3BB4A 4RPIA 4KVAA 3EXIB 4RANA 3I6QA 4KBGA 4JJGA 5TVGA 3ROMA 2W22A 1ZCAA 1U1FA 2YXLA 4XYEA 1BWPA 4OU5A 5HCIA 4DNFA 3E5RA 4Y98A 5SZJA 4I46A 1A9ZA 5EJ8A 1TD9A 1J2TA 5SZIA 4B3CA 3ZDEA 2GASA 4DUYB 1GPAA 2ZANA 1NF3A 1AF4A 2B7CA 2BCEA 3ZDYB 2J3QA 1JBEA 4JYMA 5BSFA 1O97C 5CBPA 1KZGB 5EJ6A 1M1YA 4B3TB 2QVYX 3AVTA 1L7AA 1LQTA 3J7TA 1LS1A 1PVVA 2I67A 3H17A 5E2BA 1JKJB 1PS8A 3UNXA 4MCJA 3WJAA 2HMWA 4NRDA 1RS0A 1WCIB 1D07A 4C2UA 1OASA 3H1PA 3PXEA 1U80A 1S3FA 4E14A 5EWLA 4X95A 2FR8A 1O6ZA 1VCNA 1ISMA 5A2GA 2MDTA 2D2VA 3LYLA 4HHEA 4LDAA 4OU4A 1IOZA 3MPOA 4E03A 1PFYA 4XYBA 3DBHB 3PVZA 4Y2GA 3PYMA 3Q1LA 4JX8A 3S44A 1ZC4A 1CF9A 1C1HA 1YE8A 3ITKA 2C1ZA 3BXHA 4GZMA 4RM3A 1H4VB 5T8KC 2C3MA 3WKCA 5J2TA 2JGRA 1RWKA 5TE9A 1ZK3A 1R6AA 4I2NA 1ZRSA 1B0ZA 5I9SA 4ND8A 3TLGA 1PW5A 3SE7A 4B2PA 5CYGA 4CLEA 4B6FA 1W4ZA 3U39A 2PSEA 4N5LA 1DADA 1AUXA 1WZCA 1ZMRA 3E03A 4WN3A 3KZXA 1SQSA 2PMEA 4HAZA 1VKOA 3IBFA 4LJSA 4HADA 5BVHA 1G7TA 4A15A 3GLFB 5LLSA 3IOCA 2DC1A 1YZYA 3OHSX 5BN4B 1ACLA 2D1TA 2EATA 2WSIA 2RARA 3GT0A 1U99A 3SX4A 3ZVNA 1E6EA 1NI4B 2YYSA 4V1CA 1TYAE 2JFYA 1KK1A 3SN6A 4EPWA 3DDOA 4KWCA 4WV3A 1TUEA 1M2VA 5LZ9A 2W9XA 4ZYLA 4IAOA 2ZRDA 3FPCA 2FX3A 2WUWE 4G1FA 1NE2A 4MW0A 1WDMA 3H1GA 4URVR 2BMJA 2QX4A 3H2JA 2AJDA 4TT3D 1FL9A 3UWKA 1OXUA 2JB9A 1YD7A 3KJZA 4RZ2A 3E7PA 4BTEA 3CCFA 4RPKA 4G9EA 3WA7A 4GLLA 1KMHA 3DO8A 2IZ7A 3ND9A 4F8EA 5K01A 5EIBD 4CT5A 3A7EA 1UPXA 1ZD9A 2FA9A 2VDUE 4GOMD 4L5CA 1SFRA 1Q7BA 1UXGA 2YIVX 4B6PA 1QGOA 4A4DA 1QQAA 2HLPA 5JASA 5K7SA 2GB4A 5IC5A 3DWEX 3USES 4QPPA 2WG1A 4YRRA 4ZDJA 2GXSA 3LXXA 1RC0A 1AQYA 1REQB 1SOVA 1Y4SA 3KQSA 4JOCA 5EHNA 1I3NA 3LT0A 3C4JA 2NTNA 1QONA 3NTLA 1TUBA 2JGMA 2X1MA 5EXPA 5FHQA 1PNVA 5I9NA 1JR3A 3AETB 4FKMA 1ZR2A 1NW8A 2O7VA 1YB1A 3LCJA 5D87A 1SIUA 4DREA 3HU5A 3NIWA 4LE2A 4BC0A 3QYFA 3ZXUB 3GD5A 1M2FA 4BNMA 1RPNA 2DPYA 3SHQA 4DSTA 4YROA 1DWQA 1NG9A 4BV2A 1XQ9A 5T4FA 3C15C 3BD8A 3MAAC 3ROEA 1XHEA 5DO9A 3DP9A 3IT0A 1HLPA 5CB6A 4ARCA 3F5MA 2JLVA 1RABA 4F21A 3I76A 1CCWA 3KX2A 4PX3A 3HVIA 4ESEA 1U2RA 2OCIA 4CMEA 1RR6A 1JHVA 4LZPA 4CMEC 2ASVA 4NQZA 1KXJA 2AEMA 3MSCA 3NRBA 2DBVO 1HDIA 3TD6A 5AVQA 3O95A 3IP8A 5JSUA 4PEVA 3ILSA 2D00A 4A6EA 3KLPX 1JJIA 1UQRA 4US0R 5C7LO 4CM8B 1PGQA 5HE9A 3AR7A 4W5QA 1C4OA 3PD0A 3ZQ6A 2VNIA 1D6SA 3GFSA 5AUNB 1GA1A 1XEWX 3PXAA 1KDVA 1ODSA 4F8JA 3AM5A 3HKCB 2QV7A 1BKSB 2GPYA 3KXLA 1GGMA 4RTJA 5BW4A 3MM4A 5KNBH 1Q21A 3SYLA 3H5NA 3QX3A 3KUCA 1OXXK 3P19A 2BSXA 1UBTS 1D7AA 3OAAA 3VBEA 1U7ZA 3U4AA 1S2IA 5JSZB 1XMXA 3LYAA 2Y05A 3R3HA 2JLUA 4PRKA 3LLCA 4PG7A 2PPVA 4C0SA 4MUXA 4AJ9A 2HHHB 3SNHA 3V8BA 5JBQA 5E4JA 3E9QA 3H84A 2HK7A 2ODPA 3VJLA 5DWDA 1GWNA 2YX1A 2V7TA 3DEYX 3URMA 1EEHA 1NWHA 1KYIA 3DDHA 2WD7A 4NDZA 4P2BA 4WA7A 1T4DA 4X0EA 3MW8A 4ZOBA 4CM3A 5UKDA 5K03A 4BNKA 2XQKA 2RB5A 4RTLA 1GL3A 2EKPA 3BHNA 2FN9A 3QX8A 6LDHA 3FYSA 5I7VA 3NO4A 1YQTA 1VB5A 2B3TA 3AUAA 1K6JA 1PJRA 1DUIA 3PC2A 2D59A 3FN4A 4OB8A 2AHOA 2ONKA 1FYWA 5IAKA 3I9LA 3OZTA 4LQDA 2W5UA 2CHEA 2P6PA 4FBLA 1K2WA 3C7CB 1XQ1A 2QPTA 3O4HA 3IAXA 3I42A 4RKWA 4OLHA 3T3MB 4YAGA 2VT6A 3NDPA 2XUOA 3ICQB 2B8JA 4M37A 4AF7A 2QOEA 3ZW9A 2ADMA 5EJ2A 2C7OA 4YAOA 1HT3A 2YOGA 3AZQA 4Y3UA 3WICA 1LBTA 1WNFA 3R5TA 4PTLA 1XAIA 3FTCA 1K0UA 2WLSA 4ZVKA 1Y3CE 1SUSA 3PKZA 2GTPA 1CRLA 1SMKA 1Y3IA 2ZREA 2MHCA 1NP6A 1Y9AA 1LPMA 2PT6A 2NZYA 2J4CA 1HPLA 1SQFA 2BRUA 2PWAA 4HGPA 4IKEA 3ZU3A 1TM1E 5LMCA 4ZVSA 2XZOA 1LI7A 1NFFA 3Q12A 4NMHA 5K8JB 4WFQA 4E3WA 4FWTA 1IBMB 3RHTA 3HN2A 4RDHA 4A6DA 4ZQBA 2Y3IA 4Z9YA 1GSOA 1P80A 1V1MB 3EWAA 2OO5A 3WMEA 1XALA 2ID4A 1S8AA 1WPGA 4R1LA 2JIOA 3GN2A 4HMPA 4NYIQ 4UW9A 5JBIA 1QCDA 3V8VA 2H7XA 3Q9SA 3A6HA 4G1BA 5FBWB 4DC1A 2ZJBA 5BMVB 4O3FA 1GT6A 4GOXA 4DR1B 5HMLA 2V7GA 3DZJA 3KQWA 3M81A 2BZSA 3MWEB 3U4MA 5IARA 1CR0A 5G4KB 4DLLA 1USVA 1JBQA 3VDMA 4CEHB 3IYLW 3TNLA 1HZZA 2EQBA 1NJFA 2NVUA 2VDQB 1U2GC 4GYJA 3T3IA 4EF5A 4DMFA 1JLKA 3FB1A 4JP2A 1GILA 5D3KA 1OH8A 2WMNB 5F7ZA 2O5EA 5ECDA 1WMAA 4BAUA 1A2KC 1ST3A 3BCSA 3WZ2A 1HMPA 4ZEOA 1IVNA 3MD9A 4RC9A 4DPMA 1FNNA 3I04A 3PFIA 2CL7X 5A6SB 5TMDA 1MR3F 3ZCSA 1MCZA 2GQ0A 2XNDA 1CUSA 1ZAKA 5CVJA 2ZRLA 1ZD5A 2HJSA 2CV0A 3MBOA 1X77A 2H11A 3OC6A 4KQ9A 4D6XA 1U1DA 3MWDB 3IB3A 4Y2UA 2HA2A 1BXGB 2P6OA 3G2JA 4P3XA 4KPFC 4AJEA 4J9VA 4PBSA 2DY0A 1FDUA 4TX1A 4Y67A 5GAJA 5GOZA 2W4MA 2Q5FA 4ALNA 2P8SA 2VRWA 2KWIA 2Q6KA 3LUHA 3EA4A 4Z7JA 3BBLA 3L05A 5KJCA 3Q7SA 3ZZNA 1C9KA 3U3KA 3JVDA 4Z3OA 4L51A 4FM9A 1O2DA 1YQEA 1KZ7B 1B8PA 3BH7A 4C7BA 3B3JA 2ZROA 2A9FA 1E2FA 2BM9A 4IJ6A 4E5PA 1S2OA 4NAUA 3T5MA 4CDNA 2G1KA 2PZBA 3K9GA 5B5SA 3QE0A 4FYMA 5CT8A 2WWYA 1E3JA 1WU8A 1X8JA 4RZ3A 2CB9A 4V0QA 3BMQB 2XGSA 1KVTA 1RPTA 3OTQA 3CF0A 1WLSA 3JQQA 4C4TA 2CXPA 4RF2A 2JGLA 3V33A 1PVOA 4NYJQ 1NQXA 3OCYA 4L5YA 1KBOA 2DJIA 1YACA 2N75A 3GZTB 2P3OA 3BSWA 4DUPA 4G63A 3SQLA 4AX4A 2AD5A 4BX8A 4L0QA 1DRUA 5IN4A 1SVOA 1TA9A 1VMIA 3C7DB 3H11A 2IPXA 4J4TA 2YQZA 5CGQB 2ZULA 3X1KA 3NT2A 2RD2A 1RJ9B 3FOFC 3TYXA 4BVKA 1CJMA 1NN1A 1IXRC 3KTFA 5JFOA 1IULA 1LVGA 2Z95A 1YFJA 2KM1A 4TZKA 4QPZA 1AS2A 5C32A 4LDQA 5DNWA 3CLSC 4HAYA 5BWLA 2PS9A 4GOJA 2YWDA 4FBMA 4RSGA 5KQGA 1J8QA 1PFWA 2YFKA 1XZEA 1M34E 3GJZA 1R6UA 2C0PA 3OX2A 3QUTA 4Q01A 1JLRA 3RVDA 5AVXA 3THWB 1V26A 2ZJ7A 1T34A 1J8VA 3F5DA 3SP1A 421PA 2BD0A 3EZ9A 4G4SP 2H2HA 4L76A 3JR7A 5FPYA 3ZIUA 3RIEA 1RCTE 1EFTA 3VR5A 1RAIA 3EN0A 1XZ8A 1KFKB 1BGXT 2DXIA 4O1HA 4U0KA 3WB2A 2JA1A 3CB4A 3S40A 4D79A 5A1JA 4NBTA 1M7GA 3U7IA 5JYCA 5KNDA 3QVKA 4JBLA 2BEJA 1JDSA 2B4TO 1CSEE 5HQ3B 1W0JA 3JAMA 4PLPA 2ZUSA 2HRRA 2RHLA 1UC4B 4KTTE 1HE3A 4Z51A 2GEDA 2IBMA 1OFUX 1KETA 3LQQA 5MGNA 5HTOA 1Z25A 1Z6GA 4IINA 4UJ5A 4WLUA 2A14A 4A92A 1SPXA 3D7SA 2JBWA 3LVQE 4R3UC 5EUCA 1QG6A 1RWOA 1YJCA 1UBEA 3FWZA 4LMRA 4ZAXA 3FXAA 4L15A 4DMMA 4BTLA 5FTNA 1Z37A 1XMJA 5LP6A 4MPTA 3Q9NA 3IPXA 5EHIA 1ODIA 1GZHB 2DKFA 1MB3A 1Z6XA 2AFHA 2BJHA 2FMHA 4LOAA 3B1JA 4MQUA 1UJMA 1QX4A 3BQ9A 3FFXA 5BQ5A 3GJ3A 1FJ2A 1P0CA 1O03A 1RXIA 1VG1A 2ZAMA 3MTQA 4M7RA 5TT0A 1O89A 3NVKI 3B20A 5DTJA 1QE5A 5KHLB 4HDNB 1F06A 4H27A 3JZAA 4E2WA 4DDHA 1HKUA 2G1AA 3PNLA 2AEEA 2CCKA 2YYAA 3L3BA 1IONA 5K0FA 3U44B 4ARBA 2I54A 3B3QA 3TOCA 2XA9A 3W3AD 1PJQA 1T6YA 2OV3A 3OZRA 3GCGA 3R5KA 1PJ2A 1SVKA 1NBWB 4YV7A 3VMMA 3V1UA 2D1SA 4BN5A 2OSBA 2V9CA 2G17A 2Y71A 4P82A 1RI1A 2WAOA 1VLLA 3MOSA 2Z9BA 2Y67A 3P9SA 2A57A 3AR2A 5AI8A 3RYFA 3PQ3A 5D1NA 2M6LA 1BW9A 1UAYA 5TVKA 4BECA 5JNUA 1KRWA 3VI3B 4COOA 3EXHB 3L8EA 3EC2A 4D4KA 3AJRA 3QEOA 3SEAA 2J87A 3FNFA 4N54A 3MOIA 1L4GA 1CEQA 2C3UA 2YY5A 1Z28A 2FUG1 2VOJA 4PC2A 3EH2A 3P0JA 3PFBA 1EDDA 1LFDB 3SBXA 4Z0TA 1J0CA 1XXHB 4QU8A 2CVFA 2W00A 1Z36A 2BI7A 3D4NA 2XADA 1SEPA 4D97A 4WFJA 3HFSA 2FR8C 1FX0A 1QCZA 2BDUA 4QFCA 4FN5A 1WBBA 3ZE6A 2L19A 2P2LA 1XEWY 4RWEA 4ZCTA 4C76A 4D4GA 3V8MA 2VSQA 4O08A 3A1SA 4WZBB 5HM8A 1SHUX 4LXIA 2FFHA 3IUBA 4PSDA 4QODA 2UDPA 1T2EA 2C83A 2ZITA 4WLOA 3T15A 3OHPA 5DH9A 4BWGA 2C95A 4EO9A 1QRDA 1SWVA 4UXIA 2VPTA 3TL3A 2O0LA 5BNTA 1L7XA 1KIMA 2H1FA 5E7MA 3GLTA 1O87A 3MWEA 4KR2A 1FMFA 1DC4A 1Z0JA 5LIPA 1B73A 3LUCA 4MGKR 3ADBA 4P5EA 1C7QA 3THXA 5C3MA 3GBPA 1Z17A 4MWCA 3MQ4A 2E4AA 3A3KA 2YMPA 2X3UA 2MSKA 2F1KA 2YWHA 2Y0BA 3DUFA 3NANA 4LOLA 4KOEC 5ELXA 3IHWA 1V1MA 2PZJA 5K0EA 3QXJA 1T4MA 4Y6PA 3OCWA 3OCUA 2Q1XA 4KLZA 5H3HA 4OLAA 2B1JA 4KYIB 1GAWA 3R75A 5L3VA 3ILYA 4LDZA 1MD9A 5IEBA 3Q3GE 2EV9A 3O92A 4JEIA 4FFSA 4PSCA 1W4AA 3E48A 1WXHA 2ZWPA 2CD7A 1OZ0A 4MV7A 4MUIA 4YRDA 1V4VA 3PJGA 5EE5B 1L5YA 1NPYA 4UVHA 2CNNA 2ZP1A 1JPJA 1XXLA 3KT3A 3PD1A 5IP5A 5TV2A 5LN1A 3NC1C 4Q19A 3E7WA 1JEQA 1EJ6A 1BXKA 1UMCB 1Y8RB 3ACBA 5I9MA 1GQQA 4PPYA 3AEXA 5B1SA 4O4LA 3D6AA 2N46A 2WV7A 3NAGA 5EE0A 3VH2A 1J42A 4IVNA 1XVVA 5SYAA 1ZN2A 4X92A 1K89A 2B20A 3T9EA 1GYPA 5C1BA 5IUNC 1KRXA 4R16A 5E6UA 1STOA 3UBMA 1ISSA 2A2ZA 1RMYA 2R8OA 3CW2A 1CY0A 1E5VA 4IIYA 1SULA 1T9DA 1KAMA 3N2IA 3K94A 4YRLA 4TSKA 1EDOA 2CHGA 5JQWA 1Q91A 4HEA1 5CFMA 1PBTA 2QVBA 1SA0A 3W5DA 3FBTA 3PWZA 4AP5A 1T5DX 1Z73A 3S2UA 5J4LA 2NPFA 3E9YA 3LQ4A 4M22A 3A4MA 3ICVA 1L4YA 2WTAA 2O2IA 3BIWA 3ORYA 4HYQA 3G2NA 2WWVD 3WTBA 2W58A 4C01A 1W59A 3U3DA 3ZCXA 3ZUPA 2EBFX 2VJKA 2PUWA 4OB7A 1DP4A 2ZE7A 2QN2A 1NZJA 3N2NA 4PZ9A 1MX1A 2HV9A 4DLVA 5AVJA 1QK4A 2HD4A 4JB3A 2J3HA 4CF6A 2VQEB 1MX5A 4BCDA 5CB4B 1ZU4A 2C8JA 4INPA 3HXLA 5LZ2A 1FMCA 4ABYA 4GYYA 4B6EA 1YVRA 1L5ZA 4AW9A 3U3XA 1RAEA 5C4IA 4HAUA 1C8BA 4O2RA 4IGIA 1JKIA 3LD9A 3HP4A 4QA9A 2IIPA 3PT9A 5ICCA 1K98A 4GZ5A 1LX7A 4KU4A 3UN1A 5KREA 4UOQA 2R8EA 5AK6A 2AVDA 4MI1A 5DM1A 3FTEA 2QZ4A 5H59A 5U4XA 4RH3A 4N39A 1H0HA 4K6GA 2P68A 1F4VA 3E9ZA 5DTQA 1ZAYA 3ET4A 4KYVA 1CQJB 1XZCA 5CFLA 4BKMA 2ZUBA 521PA 1Y5LA 1QAMA 2JLCA 2PUEA 5JSQA 2CMKA 2W4IA 2X8LA 1DIOB 5CEFA 5TR9A 3U7JA 1KNQA 2DHQA 1XBTA 4FINA 4F56A 4RTRA 2HM7A 4QBGB 2WSMA 1N8TA 3F2IA 1DBWA 3AMVA 2V0CA 4DYDA 4NBLA 3WIUA 4GBJA 3T5TA 2GEKA 1WAMA 4HT3B 5ERGB 2C5LA 4RJIA 1TCBA 5TPZA 3PCTA 2WQ7A 3SC2A 3TIVA 2H2GA 2WJ4A 1J0XO 1OU0A 5K2OA 2W2KA 3CF2A 3GBVA 1R4AA 3IQFA 1QZXA 3QMWA 1TUBB 5FNVF 4KPEC 4YMVA 2VYCA 3ZWNA 1OFGA 2FRDC 3LZ6A 1JQAA 1N6IA 1REQA 2OGUA 3CLSD 5CLHA 1OYWA 2Y9PB 4PF1A 4KIGA 3DGEC 1XKXA 3SK0A 4AIIA 1FS4A 2E89A 3B9RA 4NCHA 3VPDA 1BS9A 3ZE9A 5B6PA 1NDUA 1Z82A 2WAMA 2QSZA 3R09A 1T43A 3WLEA 4ROSA 4TRMA 5E1OA 1A27A 4LHSA 1FF9A 1WBJB 2M1XA 2ZI6A 4QOEA 1M0WA 1OVGA 3K30A 5DHAA 3MZ0A 4UUNA 1QB8A 2I87A 1VLZA 3UJ7A 4M0LA 2H8KA 4ZIRB 1WXQA 2ZVJA 3SZLA 1EWQA 4HYYA 4GX5A 3DD5A 2QT9A 1U0NA 2HTEA 2IF2A 3BIJA 4GP9A 3THXB 1B15A 4X61A 4AZTA 1I4EB 3GH1A 3JALA 4YT5A 3UB4A 1H2RS 4WUVA 1GRQA 4BFXA 4YT8A 3NAZA 2I1LA 5BN1A 3CGWA 3A4TA 4LYGA 5JYBA 1M5TA 3NW9A 2VK1A 3ZYCA 2PO7A 3QPDA 1GRCA 2VP0A 3PX2A 3QGMA 2ZU6A 4JB0A 4OXXA 5A3RA 4HFMA 4JOSA 3AFHA 6Q21A 3GD7A 4EIWA 5CIWA 2MCFA 3DD1A 2V8BA 3VTKA 1DJNA 1G8JA 3Q8KA 3ODGA 5E6SB 4W5WA 2WYVA 2YBEA 2O3SA 4QYIA 2CNDA 5F5XA 4ZFNA 4HLQB 2NV2B 1E0DA 2PZMA 5K8VA 3ITDA 1EVJA 1WY5A 5J2UB 4B6RA 2I6FA 3BE8A 1TQHA 4J0HA 4R0MA 1GTL1 1LPSA 3NGXA 1LDYA 4R41A 3RUIA 2GD6A 5ENZA 4BQPA 4JAVC 4BPRA 1ECCA 4RK0A 2VXBA 3LLVA 1U94A 2C84A 2GSWA 2Z09A 3P2YA 8ATCA 2W7TA 4PYLA 5MN6A 4EEXA 3LT5A 2JIZD 4A8PA 4Q3KA 2HJRA 5K0BA 4FFDA 3VR3D 4YMIA 1GCAA 4J1SA 2D5IA 4GLFA 2IDJA 5JCXA 3KWMA 5EWMA 1E9EA 4EG1A 4X66B 1RVDA 4DABA 2DBRA 1E3QA 4BO4A 5U9CA 1SIOA 4L8FA 1SQ0A 1P73A 4HXYA 1F38A 2FEKA 3W4KA 3VKWA 1Q11A 2JGJA 2F3RA 2EZTA 2JFHA 4JY7A 3B1YA 2PFGA 4FI3C 5LBTA 4X1IA 1JIKA 3HDGA 5KHOC 4HS9A 5EGSA 3WG9A 3HA3A 3K9LA 4A5SA 1JTVA 1PL7A 4IDFA 5G1NA 3WAKA 4DGQA 4LRQA 1I2CA 1R4NA 2AC4A 5IFKA 4L9WA 1QTIA 4LE1A 3BGOS 4I4NA 4WY2A 3B60A 3RM3A 3DTVD 3LWBA 3NVMB 4OL9A 3VR2A 3NTQA 2ZJ8A 3WZMA 1K5PA 3W3AH 4QM7A 2CSXA 1ZKMA 4JJ7A 5K6RA 4ESVA 3FIJA 4YV2A 4DFDA 5CFPA 3SZRA 1SZDA 2QGFA 4U8HA 3RARA 1RXSA 2NZVG 1SHJA 4RQBA 1VDMA 4G01B 3GARA 4ZC8A 3W8FA 2EFYA 3AOEC 5BSUA 4CHGA 5AESA 1H4QA 2JFGA 4UUPA 4LZOA 2P1DA 1FDSA 3KZMA 4ZO6A 3PB3A 3R7WA 2O2ZA 1ABEA 1P31A 1TQDA 2HREA 2Y2VA 3F9CA 4WCFA 3WIDA 1UJ4A 4EY4A 5B4TA 2FZVA 4WXRA 1VYHA 1QVAA 3B6KA 2F6RA 2H92A 5U4QA 1Z13A 2XKKA 4HVCA 1THGA 3EF3A 1NW5A 1P9RA 2EQ5A 5LP6C 4N65A 2DUNA 2D7CA 4M53A 3MRSA 2PX5A 3SQOA 2EQAA 5THXA 3TQCA 2CCGA 1YCHA 3KVVA 1E4VA 5AKGA 2XQJA 1MH1A 3OZWA 2PGAA 3LSYA 1IPFA 4QBHA 1SUCA 1H2YA 2VP9A 4YRPA 1T0UA 1KI7A 3SJZA 3QVGB 1VIDA 4R1PA 3CVVA 3D7NA 3IQWA 1C80A 1W73A 3M3HA 4YI5A 4Z4HA 2NU7B 3WK7A 2CWWA 3ZVLA 1GHTA 3VJMA 1GTVA 4IVRA 1WQ3A 2JAHA 5EJFA 3AXTA 1X19A 1UIMA 1DOAA 2QTTA 4HQRA 5ALFA 2H1RA 5FX2A 2FG6C 2PLRA 2JH9A 3KUDA 2IT1A 2Q0XA 1TJNA 1NA5A 1GUZA 4AP9A 4EVRA 1BVHA 3O6VA 2VHCA 2QYTA 5I7RA 2YZNA 1Y3BE 1LBEA 1L1QA 1OFIA 5IJ0B 3GDGA 4KACA 1XIVA 3ROZA 4LXTA 5JMWA 3OPYB 2R7AA 3AJEA 1IHOA 1P2DA 1WW3A 4TTPA 5FB3A 5ED0A 5BN3A 2OXCA 3CEJA 1SVIA 1YI0A 1IY8A 1E6UA 1TTTA 3ER6A 3R6DA 2ZSUA 3ASYA 4G65A 4KWIA 1FFDA 2OCAA 4JXZA 2EP5A 2QROA 2ROQA 3AG6A 1QFMA 3E2MA 3OWHA 1Y9EA 4HRYA 4QOIA 2XT6A 3ZLVA 3UOWA 3BTUA 5C51B 3B3AA 2HT6A 4EHJA 1FLVA 3CUUA 3SFZA 1DXOA 1EHCA 2FPGB 4NOLA 2FEXA 2WINI 2OORA 3KO8A 4OP1A 1XNHA 4QFMA 3TPCA 3UKJA 4BV9A 4DMKA 5F1YA 3KQQA 4GKBA 5BYAA 2YKGA 5IVDA 2I2BA 1VLJA 3H2SA 2MIIA 4RTNA 4W82A 3UJ3X 4P9NA 5BUQA 2GUGA 1W8DA 4CKBB 1RLUA 3HDQA 4G23A 4TGLA 1IVSA 4S2EA 4EVQA 2WAAA 2YJTD 3E9MA 4YWJA 4B80A 5CA0B 4JP5A 5CK4A 5KAPA 3E4DA 3M2TA 5IH3A 1PJ8A 1WWKA 1VYUA 1XR3A 2XWQA 4QWMA 5U1PA 4C4XA 3EEOA 5EIOA 5GONA 2P6RA 4WDRA 3L7AA 3NORA 4Y1FA 2UYGA 4WD3A 3DZGA 1W0KA 2BFEA 2QRHA 3DE2X 5LZ8A 4CG0A 1RPZA 4R3NA 1G8PA 4D0LB 3SFVA 3DHVA 3V2GA 3VRHA 4XD7A 4P0TA 3I9OA 1O95A 5EZYA 1Z45A 2F55A 2VYVD 4LWQA 3TLZA 3IIJA 3KP1A 1QIGA 2IP4A 3B3GA 4PHCA 4U7GA 5HIMA 4N5DA 5G4KA 4P7JA 5SY4A 1WDTA 1GL7A 1NASA 2BZGA 2R60A 3CYFA 3O9ZA 3IEMA 3C85A 3D8BA 4QGFA 1T0PA 2EG5A 5E95A 4YQEA 5A4MS 1OWLA 3LJKA 1RACA 2YJ3A 1UWLA 3H2YA 1UKVY 3TINA 1SC1A 1YQGA 3HWRA 3RU2A 2XB8A 1G21E 4HAWA 4CKEB 1YIOA 5A3JA 3FWNA 2JFWA 3KWLA 3OZXA 1KMIY 1RI5A 2WUDA 5JWRA 5A4JA 5I4CA 1Z62A 3L8GA 4K6KA 1QKJA 5IKXA 4Q34A 2CUKA 3W8DA 4UEKA 1XZGA 2WWFA 2Q7OE 4F5EA 4MQ6A 2WI8A 1NMEA 2OKGA 3D6MA 2IZ1A 3LO8A 1E3WA 1RWXA 4IM7A 4RMNA 4WOJA 4HRVA 3BL8A 2P9TA 4D46A 4DXHA 1FUIA 1YB6A 2J9YB 1TK3A 2XOXA 3K0EA 4DCSA 3LKVA 1ZO8A 2CY0A 4EG8A 3N59A 4EEKA 4MR7A 4PC1A 3CEHA 5HEKA 4IUDS 1FW6A 4Y2PA 2RHDA 2JK1A 2EX0A 1YB4A 3EBOA 3GFGA 2W0SA 3D2BA 3JSAA 3AI2A 1G3IA 3E3NA 3X1WA 5MF6A 3F6EX 1OWMA 1SURA 4FYIA 3QVVA 5HMMA 2V74B 3QKRB 1OA1A 1T6NA 2Y76A 3NHWA 2G9UA 2AG1A 1JHOA 3VPSA 1ZK1A 1E3SA 5D8DA 3WLKX 1EWYA 5HA5A 3ONEA 2VDOB 3K8ZA 4ZCQA 3JQBA 3MS2A 3B7PA 4ZI2A 3B9BA 3JQBC 1A76A 5JU6A 3ENWA 5L51A 1MVLA 3EXAA 3RIHA 1EXDA 4IZHA 3QXSA 2PRKA 5IK2D 5JO9A 4MRNA 1FUYB 1VMDA 3L8YA 2OT3B 5AKIA 3PE3A 1GKLA 3CX7A 1OW3B 1RE1A 3CLUC 3S2IA 4MGZR 2UZ1A 3QV1A 3CBGA 2I4OA 2GESA 3DWFA 4NF2A 5AMXA 3HUTA 4KRGA 4TMFA 2ATIA 3FDZA 1V25A 1NRIA 2NUBA 4GUAA 3CEAA 1BCRB 1QVVA 3JQFA 1XTVA 2JD0A 2DKOA 3C1AA 4J1TA 1HORA 3W3ZB 4DSNA 1ILEA 4O3MA 3A2MA 2Z8XA 4C4ZA 2Q4EA 5FPKA 3W6UA 4QVGA 4N3BA 4WXEA 2HRCA 4KK4A 1QHHA 4ZOLA 1DX6A 4TLAA 3COWA 2VJDA 3CN9A 4YAUA 2HBQA 3DDUA 3OLZA 4PG4A 4DLRA 3OQVA 4PGHA 5BWCA 3AGPA 3HKBB 2VDNB 1U4OA 2A0KA 4JBIA 3UMMA 2DB3A 4PG6A 1AK2A 1V4NA 2YYYA 1E3LA 4EFDA 4RIEA 4LY0A 4E2YA 3CKMA 3MGAA 5A05A 2VJBA 1QVZA 2IJGX 5TS3A 3ZHBA 2YWRA 3HBFA 1B16A 2A0FA 3V34A 4B71A 4DDWA 4Q4AB 3M7IA 3RSHA 4P7KA 3W34A 3ZDQA 5JZVA 2RHBA 4BLTA 3AG5A 3QI7A 4G0QA 2RHRA 4OHUA 3OCVA 1MKYA 3RVQA 1KE1A 4AD8A 3ZBUA 2H00A 4IH9A 4QQFA 2VL7A 3H8WA 4E13A 3OX3A 4JA0A 3UM9A 1QWOA 2CF6A 3I6BA 2XB2A 1N2EA 3AEYA 3QJGA 4N7RA 4ZOLB 1UBLS 2FI1A 3WIVA 4LFCB 2J4DA 1GZ7A 3IE2A 4MR8A 4F2HA 1WUKS 4L4RA 4RXMA 4WRRA 3MERA 5IJ9B 3Q5EA 2OHOA 4WXHA 1I3LA 1E1DA 2XZLA 3VHQA 3OQMA 4R2WA 1T3SA 1RZVA 1CIVA 3WNVA 1AKRA 4L4UA 3HABA 1XN1A 3QI2A 2IKQA 4YHBA 3HKDB 3HXPA 3N8IA 3CF4G 4X1OA 4B45A 1JDJA 1TK9A 1VCHA 5IFLA 1VL1A 1M1NA 5CD9A 2RIPA 4JYBA 3I3SR 1ZESA 4BCCA 4AG6A 3AHDA 2CKMA 4ZAYA 3VO9A 4QGSA 3HWWA 2XAUA 3ENVA 2XVAA 4BKQA 1CXZA 4DJ5X 2D8AA 3FSRA 5FUXA 4F12A 2WFAA 5LPNA 1VLHA 5COBA 4PAWA 4DCNA 3THYB 4INZA 4OHCA 4C08A 1OWPA 1X1SA 1Y81A 2DUWA 5TMEA 2KS6A 4B48A 3TFWA 4I55B 4MWBA 4JL5A 4I8DA 4RH1A 5JAZA 1LDNA 1YU6A 2ET6A 4LZZA 5DHUA 2IVFA 1X1QA 3HFJA 1JU9A 3C3YA 4FS8A 5AHOA 2B92A 3PQDA 3WP0A 3JAWB 1IUPA 1OI2A 4EJ0A 3GJXC 3B1ZA 1MU0A 1DKRA 1EESA 1L6IA 2AG6A 1FNSA 1FFGA 1E9VA 3AVPA 3M5WA 2WTMA 2BGNA 2CFRA 1IEVA 4DV5B 1CY1A 2X76A 3RF6A 4HB3A 3H4IA 2O50A 3QUAA 2B1GA 2J9GA 2X5OA 3PQ6A 3D6JA 4BWYA 4NS1A 1NUQA 5EJIA 1FTSA 1YR1A 3V7FA 3JR3A 2C7RA 3GAFA 1QYXA 2Z1MA 1X38A 3IMFA 4NONA 3OFVA 4EVSA 5H3LA 5LOVB 3I6YA 4YRJA 3WNBA 4OQMA 5FNVB 1SXHA 1MF7A 1DC7A 3EXFA 3P9ZA 4QO8A 1KARA 1KSJA 4RIFA 5HCNA 3SEFA 3OEYA 1ND6A 4GRAA 5DLYA 3VZSA 4G0PA 4JLUA 3WGLA 4IPTA 5HZMA 5C0OE 1L5KA 3KWJA 4FKBA 3N86A 1FCJA 2ZSDA 5EZ5A 3TM4A 3OOWA 3EOZA 1SBIA 3PRJA 3BXFA 4A8JB 4E1VA 1XTZA 2RK6A 4KO8A 4CCWA 3K6JA 3OP1A 4HH1A 3FCUB 2HJHA 4PLZA 5G41A 5TMBA 5F2EA 4NOKA 1PJLA 1K5HA 3LUAA 4CMKA 1Z4OA 1GQYA 3LPMA 1QP8A 2ZBDA 2A78A 5GONB 3ZGYA 4GI1A 3AHCA 3NCTA 3RBVA 4QG7A 2R6DA 3OJLA 1MJGA 4BGUA 1JECA 2VQDA 1PWEA 1AC5A 1QS0A 4LFAB 1E6CA 3IRVA 2PKCA 4MV6A 3OQOA 1QPGA 1AB5A 2V5AA 2FF7A 3T4PA 1I7DA 2Z6UA 4R84A 1RRMA 2Q3JA 1I3OA 1EXWA 2VQSA 4IO0A 1PR9A 2VZ9A 3ICPA 1YC2A 1Z5WA 1K6MA 5IYZA 5CVUA 3LQRA 3HY3A 1UPCA 3O1HB 3BILA 4BFCA 4M8SA 4I5GA 1FXWF 2JLXA 2XA1A 2Y2UA 1NT4A 2GD1O 2VYVA 3MUEA 4JLBA 4GI3A 4FGUA 1ID8A 5CURA 5EQDA 2B4YA 3GW8A 3VC3A 1U7WA 3I72A 2EBWA 3PC8A 1NONA 1JZQA 2GAFA 4IQ0A 4PFKA 1I5EA 5EOVA 4R1QA 2O9JA 5HJ2A 4JMPA 4HX5A 4G0WA 4B6QA 1D4OA 2V7QA 2XXAB 2IYTA 3NWJA 1EFAA 3UIEA 4GVLA 3FOZA 1A9TA 4PN3A 2CBGA 3GLVA 4TQ9A 3EXG2 1VXRA 3SXUA 4D6YA 1KEEA 4J6FA 4JVNA 2FJUA 4HWPA 1QP0A 3LC1O 1WXGA 1J39A 1TJPB 3X1XA 3WI7A 3NATA 2W0MA 4ISCA 1IXZA 1DDIA 1TO1E 1AT1A 1YJ5A 4Q37A 2IV3A 3NEPX 3M5CA 1RXEA 1H5QA 2PQMA 1S8OA 2RKOA 3IHTA 4UNQA 4ETIA 4CIBA 3UPTA 1BRMA 3RS0A 2Q5IA 2AR7A 2F00A 1TU0A 1HLGA 2XZTA 4LOJA 2B9VA 2GTHA 3DW3X 4IQGA 3TDKA 3TJRA 4F6RA 2CBZA 1V9LA 3RNOA 2ZQYA 1JEDA 4RIIA 4XSHA 3ELBA 2XIQA 4G0NA 4GZ6A 3K09A 3PQ8A 2ZIAA 1TMYA 1Z8FA 1HE5A 2W2OA 3U7QB 4QLBA 3IKVA 1P19A 5JZMA 5HBGA 3WYAA 3VX3A 3MCTA 1TD1A 1RBMA 3IQZA 1KYWA 1UANA 3OOSA 4R3WA 1GLGA 1KJ8A 3UAZA 1GUFA 4II2A 3ZV5A 2DH6A 1NW6A 5KWIA 4PXSA 3WK8A 1U3WA 1V5WA 4RH0A 4Q03A 2R00A 2BJVA 1SN7A 2FWBA 1KAQA 2PZ8A 1OV4A 3RUEA 1IHXA 1NJ6A 3HV2A 1HEIA 3IV7A 1N5RA 5CCBA 3STYA 5AOBA 1F4LA 1JALA 2J9ZB 5J5CA 2I78A 3D5QA 3CVXA 5AW4A 4E1BA 5CLQA 4FFBB 2JAQA 3VH1A 4TTAA 4G37A 4BFUA 3AR9A 4TLBA 2NYVA 2ZJOA 4P5PA 5HOQA 4PZZA 1UADA 1B14A 1Z8NA 2OOKA 2CF5A 2ZETA 5CNIA 3U3RA 2FEWB 1VSVA 2OTCA 1Y8QB 3NHBA 3PNMA 4GH5A 4ZOEA 3UA3A 5KSYA 2PSJA 2L2QA 1EX1A 4H6VA 4YRMA 1GTRA 4PRLA 1SK8A 5EPUA 3NBKA 4QARA 1GPKA 5KCMA 4AQYB 3VKHA 4C0BA 2BKUA 3FPHA 1SCBA 3DHNA 3HY6A 3ZNQA 1C8LA 1X7YA 3Q2KA 1CUGA 1JU4A 2IUFA 2XDQA 5GJWC 3VDXA 1PT5A 1UFVA 1HBJA 1SBQA 1TI7A 2C5FA 4O4LF 5IM4F 2HSJA 2QRVA 4JLKA 1MB2A 1EB8A 3MUNA 1CQWA 3P4YA 2N1BA 3RRXA 5ETJA 1SKQA 2ODTX 3K5HA 2R1ZA 4R0VA 4FONA 4UHKA 3I73A 5IYZB 1NXWA 1LLDA 4ER6A 2IA5A 1VG0B 4QDXA 1WXXA 2WU4A 1CZHA 3HEMA 5T8KA 4ZYXA 1ZP6A 1I6KA 1WMSA 4IWNA 1JB1A 4QL3A 3LFTA 2QLNA 3TQRA 1GP2A 5IKMA 5HG0A 5EFOA 4BBJA 5CTAA 2H48A 3MRXA 5LQSA 3JWIA 1N6PA 4RF3A 4EABA 4JGBA 3M1AA 1W49A 4KMSA 2X58A 3SKVA 1U9IC 2NTVA 3QLTA 1XRRA 1M75A 3U49A 2P2CA 2YUTA 4RKFA 3REGA 1NBMA 5HJEA 1UEXC 3RAPR 3AY7A 4WOKA 1BSVA 2HAEA 4YJFB 1XVUA 3RS4A 4A8JA 3A4IA 3KPJA 3OX1A 4F4UA 2IYAA 4NPCA 4YJGB 3D8NA 1UXJA 4TM8A 3WGGA 1AKVA 1RJGA 1T35A 1RQNA 2OC9A 2W2TA 4XVQA 4BTVA 5KTSA 3ZBQA 2X8WA 3F4LA 4P58A 1X2EA 3IBCA 4ZT4A 4EI7A 3DAPA 3OMLA 1OB2A 2I6QA 1ZVQA 4BHTA 1WMFA 3ETEA 3R40A 3FDFA 4M83A 4CKEA 1BJKA 5BNWA 3LIIA 2HWUA 4WZAE 3TBFA 4MCIA 1WSAA 3B9PA 4TM7A 4G5XA 4Y2VA 5DSXA 3TR5A 5A7FA 5I7HA 1NBIA 1Z4KA 3N7TA 3PTAA 1ZWKA 3MCAA 2DF8A 1NF2A 3DFKA 4QOSA 4URZR 1RYNA 4XQ9A 3DLCA 4M89A 1O8CA 5TQ0B 4GPD1 4FNOA 4H4EA 5PNTA 3T61A 1R0CA 3ZK8A 2COUA 2ODWA 4RADA 4AO6A 3VR6A 1GU0A 5L40A 1LNQA 4FT2A 3UT5B 3KKLA 3CE9A 1BDIA 2H59A 1G66A 2FSGA 1K7FB 1Y89A 2DPMA 1EFPA 2G9QA 2JBHA 3CISA 3IODA 4MGIR 1Y1RA 4POAA 3E70C 4WFIA 5BQXA 3PDUA 5BW6B 4XYLA 4RA6B 1JLSA 1YDMA 5H80A 4E4YA 2BCGY 2OYRA 2HMSA 5D1HA 1HE2A 4C5AA 1C3JA 1K5GA 2GEVA 3EF1A 3P9XA 4KNYA 1SBYA 3OLYA 1GD1O 1CDOA 4JVOA 4P98A 1NQ5A 3QPUA 5JWHA 1FFXB 3V1LA 4CRWB 4K9OA 1E8NA 3OQBA 2PX6A 4N40A 1V39A 2CXTA 4IJ5A 3V3KA 4DDKA 2D0DA 2GM3A 4E46A 4WOPA 2GT1A 1B3BA 3EVCA 1YZGA 3R8CA 1AO3A 7MHTA 3BXEA 1N3LA 2FSFA 4F72A 4UEJA 4IIXA 3DCYA 4WOCA 3F5QA 1M5RA 2R7LA 3GY0A 3HKDA 1N3BA 3K6SB 3ADCA 4IIFA 3KSZO 4H15A 3MVEA 2E1RA 1D4FA 3PE4A 3P45A 3LDUA 4OXRA 5ALTA 1M2KA 3DBVO 3HJGA 3KPUA 4DQUA 4TLLB 1HQYE 5HIIA 1DDGA 3C8HA 3IC5A 1JDBC 3PNSA 3EULA 1PT6A 1CFZA 2AQIA 2ZRGA 3FYTA 3MINB 4YREA 5F33A 1RLMA 4C04A 2O3QA 1OZHA 2AOTA 3RJ9A 1T8YA 1G60A 1LGYA 3JQ6A 5LCXA 1JDNA 3G5UA 1RNLA 1CY2A 2FUEA 4RQUA 5K45A 4CN9A 2R4TA 3C0KA 1K4KA 3GV0A 4QX6A 1CU1A 1PJAA 2PE5A 5M3BA 3UKOA 3AP2A 1Y33E 2QLMA 3MXOA 3VHXB 5LMUB 4ZVLA 2HCRA 1Z38A 4RTMA 1BGVA 5EHQA 2P9JA 3BFKA 3KKKA 3UZUA 2FXVA 3NIGB 3PDHA 2O3RA 3QJ5A 3NHPA 3A1NA 1THZA 4NBKA 1EK5A 1MFPA 1GZDA 4KFSA 4LJYA 5AM0A 3UUFA 2BM0A 2AT1A 1YKSA 5F3RA 3RJTA 3SBOA 2YIDA 4HDKA 3AUSA 4MHTA 4C29A 3HXTA 1NKTA 1JFRA 3DLIA 3ICOA 4M8NE 3L4KA 2BP7A 2P2NA 3E7FA 3D59A 3GYBA 1BC5A 1H93A 1Q7TA 2FZEA 2OFOA 4YP9A 2I8CA 2CFOA 4WECA 2TMGA 1CETA 2ID7A 2VP2A 3AM3A 2D3WA 3TLKA 1RKUA 4UNNA 3K7EA 3OQIA 1GFWA 2G9ZA 3M0EA 4I9HA 2SKDA 4Y8VA 1VKRA 3A31A 5CPBA 3UW3A 5LWQA 2Q9BA 2KX7A 4XPIA 5H8WA 2HGZA 5KDDA 1GY8A 1DTWA 2I5PO 2QSJA 4O25A 1EXVA 5HCUA 4ZP1A 4GX1A 3R7WB 3W5VA 1T9KA 4KDEA 1T0BA 1Y7HA 4ZAGA 1BYIA 3BS4A 2Y68A 2CGEA 2ZB2A 4G41A 2AZDA 1VL5A 1ZM4A 2E9SA 3BGIA 3DEZA 4G67A 1UODA 4CM5A 5C1OA 1Z47A 2VRCD 1JLMA 2CLCX 2RC5A 4WI1A 4G81A 2HO4A 4U6NA 4FFLA 4A6XA 3KE9A 1Y63A 1NMSA 3F6PA 1Y4AE 5LYJF 2CBXA 3ZXYA 1P60A 4UTXA 5DOZA 2IIVA 4EGFA 1RTTA 3DM5A 3FA2A 3GU3A 4ZCPA 1YE5A 2R79A 4RS3A 4MULA 1ILWA 1YI8A 2ZBRA 2HPZA 1CZLA 3ZJ4A 5KWEA 4QULA 1GPDG 2OBBA 1XYGA 2PMKA 3JAKB 4WN9A 4D99A 3DWGA 1JEQB 4L16A 1G5PA 1BKYA 4MQ4A 2VHJA 4E51A 2AW5A 4DLPA 5HZHA 2X9VA 1QGED 2JNWA 5IM5A 4NYIR 2BFBB 3PVCA 1WVGA 4B79A 3A2NA 3LDFA 1NLYA 2GPAA 5BT8A 2C4HA 2PKWA 3KL2A 4PGFA 2ATVA 1JEAA 4TLCA 2CVZA 3NAMA 2CJFA 5AO9A 1R0SA 5JSKA 5K4HA 3W79A 4JT2A 3P2IA 4L5AA 3KPYA 2SICE 3GJ6A 3KVNA 5C1IA 5F3DA 1AY0A 2CD9A 4YCSA 2X15A 3IJ5A 4GUDA 2R6CA 2ZGVA 3NHZA 4TTSA 4OYRA 3SMVA 4UNRA 4UAJA 4QELA 3UC9A 4CCAA 2Q5HA 3K15A 3OTHA 1ZW6A 1G2OA 3VHLB 1UBHS 2VCYA 1WULS 5JDCA 1SRRA 1MO2A 4KSCA 4D80A 1TLFA 2OESA 3DR3A 1W5FA 2PL5A 4FXPA 4KITB 2HLDD 1JJ7A 1V0JA 2D1FA 3OKPA 1A71A 4BNJA 3FGZA 5EGNA 4EI8A 4X94A 2GJKA 3HY4A 1G21A 4KI0A 4U02A 1L4LA 3MB8A 3FCEA 4K46A 1GT91 1BZYA 4RJ2A 3RFCA 2B2XA 3IEVA 4CYMA 5HUJA 3AIKA 2YC2C 3GBSA 5A6VA 3F97A 5HGXA 3EGOA 3L7KA 3PNKA 2WHYA 3GRAA 3LF1A 1N6HA 5JMTA 2WMYA 2J3LA 1SXJB 3CPHA 5GQSA 3R7LA 3OZVA 1VJ1A 2YNMC 4ZO7A 3I58A 4R83A 4F7WA 2N1MA 3KUUA 2APJA 5C8YB 1CB0A 1RC8A 2DFDA 3EUAA 1DFHA 3LXRA 3VOAA 1OFUA 1Z6YA 5L7YA 3BWBA 1C2TA 1LBHA 1WZEA 3A9WA 3I53A 5BSMA 1JHPA 1Z8HA 3BMCB 4HNQA 3HRIA 2AF3C 3O3CA 1JTEA 4PPGA 4TWJA 2EFEB 1NRXA 3PC8C 1CNMA 3G2PA 3I9JA 4RV5A 1M2EA 1V3QE 1Y82A 2OAP1 4ZEXA 4AQ7A 2C5SA 4LKRA 4GMFA 4R05A 1VE6A 4XW2A 5KYYA 1E4EA 3FPAA 3OJFA 1AQIA 4EZBA 4ARVA 3V2UA 1GG5A 1Z4PX 2QQFA 5TQ2A 4CF5A 3VNRA 3OU7A 4ENPA 2BGTA 2X14A 4M9ZA 4GI7A 4JJEA 1OV6A 2FW9A 4G8BA 3DXFA 2OCKA 4J0QA 5THQA 4S1OA 4YGYA 3WDLA 3RAEC 2J0SA 1R8QA 1MENA 3V6LA 2D0OB 4X1KB 3R20A 4PTYA 4XIJA 1XQYA 3CWZA 4BQSA 3BFJA 4FEGA 4F92B 3OU2A 1TAUA 4ZN6A 1LWOA 4AZWA 1MJFA 4DNPA 1ZIYA 4AKGA 2FG7C 1CR4A 2UUBB 1NUUA 2AX3A 4JR0A 2Q2VA 1KOGA 3PL1A 4OPMA 3Q41A 4O6VA 8ABPA 3PR1A 1ZK2A 3G49A 1ZRMA 2XUAA 3E81A 2WEKA 1I6MA 2O2CA 5EEGA 2Q7DA 5IULC 5KBYA 1JFFA 2NO5A 4IFBA 4BJ1A 2CNBA 1Z7WA 2B8WA 3QEMA 2CLDX 2AD1A 2DHRA 4BAGA 1HDGO 5GV7A 3QU4A 1T2CA 1YK0A 4B9EA 4CL3A 3G79A 2IX3A 3M6WA 3SHVA 1YRWA 2O8EA 4Q1AA 2YFHA 1HMYA 4KMOA 1L6RA 2VAVA 3GLHE 4NJEB 4GXQA 4WESB 1OAOC 3Q3CA 2VSFA 2OLKA 4KQWA 3VXKA 1QTRA 4FILA 1G7SA 1U8AA 2BE9A 4RKEA 2UVQA 3CTMA 4Q3NA 5EA2A 4G36A 1JIIA 3QVGA 5EZQA 3KD2A 4OCZA 4INAA 4TKVB 3HGQA 1S0UA 5BYJA 5CA1F 4Y6SA 2DQYA 5B7PA 2NP7A 1Y3AA 3H13A 4R98A 3I0MA 4AN4A 3TZEA 3WLMA 3N1UA 5KSPA 2O3UA 3VKGA 1OBOA 4KQJA 4X71A 2WFZA 4F4HA 2QRJA 1FPMA 2CJPA 4TS1A 2DULA 2E82A 2J5BA 1CY6A 1ENYA 1P3JA 3VZCA 1PFVA 3H6KA 1OSNA 3ECAA 5DJ5A 1U9CA 2OBFA 1G5TA 2VF2A 1UJ6A 1ZNZA 3OE7A 1J9ZA 1M2OB 2NUAA 2XMZA 3TIFA 2Z04A 3OF2A 4RL4A 4WY5A 4R7GA 1NC3A 1QU2A 2HPAA 4JUCA 3S1AB 3B5JA 5HPYB 4DQDA 3ZIDA 3WJ2A 1XXHE 2IW3A 2OM6A 2H2FA 1WHSA 3QJYA 3BB3A 3JTEA 4LBYA 5DLDA 5DBEX 5DCLA 4L50A 2I3DA 4RGBA 3ZHSA 4AY4A 3GEDA 3VZBA 1QHEA 3CG4A 1WB5A 2CWDA 3GEIA 3S68A 4PZEA 1E6LA 3DZFA 3UK2A 1XL0A 4FD2A 2BPOA 2J7KA 1R18A 3VPGA 1E1CB 5D7BA 5CB4F 1PQWA 3TZHA 4YMGA 5HKKD 2ETXA 4MLDA 4YCDA 4DIOA 3T5PA 3FZGA 2ZUUA 5CYFA 2H65A 1I36A 2XCIA 3WSWA 3GCZA 3STHA 3EVNA 4OH1A 2ZUFA 2LRHA 1QZZA 4AMVA 5AK4A 1YRBA 1AH2A 1LQUA 2PUAA 4PLTA 3M4NA 3DHYA 2MINA 1P74A 3T7KA 4BNXA 2FPRA 4DRXA 3TD2A 1SVWA 3G85A 3TQIA 2XX3A 5JAUA 3OE5A 5LQRA 3RWBA 1L1EA 2PO5A 1IRXA 3C6KA 4MB2A 5PGMA 1BWSA 3NTRA 3RRBA 3EMVA 4LHEA 5IU6A 4FMDF 2FZLA 1BMDA 2D1QA 4J7CA 4YJ3F 1ZIPA 3HKEB 2JGDB 4GXNA 5AXAA 2AFRA 3KSAC 4S1PA 3RVLA 2R6GA 5C4MA 5MGBA 2F3PA 2X9GA 2XOEA 3AKEA 4DC0A 1L7EA 4XGRA 3EJWA 1JHQA 2BW0A 4IIEA 4F4JA 1TRKA 3KHUA 5NLLA 2AJCA 3BWXA 4MUNA 1V6CA 2QSUA 3MMXA 1X8XA 1CZUA 1IHUA 2FUCA 4PLWA 3PIDA 2PXCA 1KOJA 2PD4A 3K96A 1GQOA 1XRJA 4HVTA 2AS0A 1R0LA 3RSSA 4C4SA 2GF0A 1CUFA 4R8RA 1NY6A 1RMQA 1QDLB 2QYSA 3AR3A 4UM9D 4Y6OA 5AD1A 4L73A 4UMEA 1G38A 1C2YA 3IQHX 3R6TA 4M9QA 4AZVA 1EVEA 5KO2A 2RB4A 4QDJA 1NN5A 4QYIB 3BCUA 2VP5A 3CR3C 2X9QA 3P9KA 4EY7A 2WDPA 4LJAA 3G3EA 4UTZA 3Q1KA 5FOWA 2LDBA 2VQ6A 1D03A 3QIVA 2YXNA 3VGJA 3VAAA 1FJGB 5DM4A 2JCVA 4KX3A 5L6MB 3AXSA 4AVYA 2HK6A 1ORIA 3FRIA 3WRVA 1H2ZA 4Z2AA 5FV4A 4FOSA 5HUQA 1N6NA 1VGRA 4DSOA 2DR0A 1UT5A 2YJNA 3BRSA 2XUIA 2ILVA 1M3SA 3OY2A 3QHQA 1NVVR 3TAHA 3GEHA 3Q0TA 3AJDA 2IZOA 2A1TS 2YQ5A 3P9PA 5EP3A 1L5LA 1M66A 2OAQ1 1XNJA 4BEVA 5I8PA 5FI1B 4MYSA 3NNSA 2GM4A 1S02A 1D8AA 1YFKA 1RI2A 3H0EA 5ECYA 5HNKA 1HDOA 1I3KA 3CZ9A 4FR0A 2ZRKA 4L8GA 3PI7A 3FD8A 5JWOA 1LY1A 3KJQA 2Q28A 1NJ8A 1PWZA 1W87A 3JQRA 4P1ZA 1G291 4FQ7A 4W5TA 2Q8NA 2X22A 3B8EA 4BNZA 2Z57A 4J91A 2RH8A 3AVUA 1U3DA 4D6PA 5ARCA 1HG1A 3GFBA 4MEJA 4EJMA 1UIRA 4BFYA 1DRWA 1J1IA 1XLTC 3PKIA 2V3CC 2O23A 1UPUA 4U39A 4MDFA 2UVPA 2R62A 1H2BA 2Q0SA 3EIHA 3HJUA 4L4SA 4ZU3A 4PVDA 3E58A 3RT9A 1PK8A 1OHHA 3SSAA 2DTDA 5IDWA 2FVYA 3M1LA 1KL7A 3QG1A 3RBAA 4IJWA 2WUFA 2VDLB 2OV1A 1ORWA 2H9IA 4W5RA 2QSYA 1CJSA 1SD2A 4RMHA 3DV9A 2FCRA 4D9MA 2HKIA 1F3OA 1SAYA 2R85A 3I2JA 1MA3A 4HY3A 2WJWA 4IO1A 2ZJFA 1ZM3A 3AK4A 3PE6A 1CP2A 3SZ3A 3V2HA 3N87A 1HYBA 1C7EA 4UOZA 5EJEA 4FDLA 2Q5LA 4CMIB 4JDUA 4DCUA 1C3LA 1EP3B 1IM5A 5C80A 2W2LD 5CTJA 2QJWA 3MJFA 4I50A 4BGIA 3SJUA 1DO0A 2HQBA 2I7XA 3L6CA 2WPNA 2D5CA 3X2SA 4US2R 3TS1A 3HU3A 5LJIA 4L8VA 1QHFA 3DE1X 2FDRA 4M1QA 3SVTA 1NBMD 1X9HA 2DTEA 2OVBA 2XUGA 3OSUA 3D7KA 1MAVA 1GO2A 1MOSA 4MX8A 4PWYA 3VSBA 4CETA 5JALA 3DMGA 5HF8A 4W6QA 2FN7A 2NTEA 4I1OA 2COKA 3IEUA 4AO8A 4CIWA 2QP9X 2UAGA 3WO1A 5ESDA 1QGAA 1T36B 4BV3A 1N7HA 1W44A 2VTKA 2JBAB 3GGCA 3VAYA 5HP4A 4NI5A 2QM0A 5E4FA 1EFCA 1LZKA 1CZKA 1D2EA 1S3IA 4HPJB 5DHQA 4CBVA 4DIDA 5CB4A 3GQBA 2HX1A 4LGYA 2VFAA 4IJMA 2G5TA 4IHJB 3PF8A 3PK0A 2RK3A 5K1ZA 1MTOA 4E4RA 2HK9A 5KJFA 4ZVRA 2Q4RA 5EUBA 3SMQA 1NURA 1MJHA 2VH1A 1G9XA 1ORTA 4FMDB 5YASA 4UNSA 4XJTA 2JI7A 5AM4A 3JQ7B 1SD1A 1QVWA 1FP2A 2B0JA 1JH9A 4MQFB 3G0DA 4JLOA 3DTYA 2QIOA 4N6OA 3OECA 5K0NA 4EJSB 5KU7A 2FP3A 2O6LA 4PLVA 4UHEA 3ZNPA 2H0QA 5F52A 1BU5A 1N1MA 3FSGA 3WA6A 1T1IA 3COSA 1O5TA 2IEAA 3LBYA 3PQ7A 4URYR 1QHNA 3RG8A 3WP1B 5LLDA 5M5BA 1P4JA 3N3BC 1X87A 4CG2A 3MJRA 3EY4A 2DHDA 4M1YA 4WLNA 2A1UA 1PX0A 4XTCS 3H1TA 1YZHA 1OMOA 2QPAA 4YI3A 5AVKA 3RTCA 1DZ3A 3WTCA 1HNNA 1U2PA 4Q00A 4TKUB 4RFLA 4DLTA 4J2TA 1JNXX 2QZJA 1GNVA 1WRBA 1AIPA 2DTXA 4WADA 1EXNA 2YOFA 1SU8A 4IY1A 5AVWA 4Y1GA 4WY8A 2IYWA 4FW8A 4D5EA 3ZD7A 4Q4JB 3HC7A 1U7OA 1GPNA 3U19A 4RIGA 3QMVA 4ER3A 3O5AA 1GAXA 1IXYA 2VPIA 1QAOA 1Z5GA 2RGCA 5LFAA 1E58A 1A04A 2ZG6A 4QGHA 3WOHA 5C18A 4J9UE 3IMCA 1NNEA 3ITEA 4JODA 2VTEA 1L7BA 1WHTA 2G67A 2Q07A 1BJRE 1OIWA 4GPIB 4OLFA 2PBLA 3LPCA 3ZC3A 3W5JA 1IHPA 1KMNA 4YPFA 1YZNA 2NQTA 4HR7A 2VHEA 2G1PA 2FN3A 2EGGA 4QYTA 1V6AA 1N1GA 4L8YA 4OUDB 4E2FA 4Q18A 2QT0A 1SNYA 1JHUA 2PGXA 1KVQA 5JD4A 2WM8A 3EFOA 2ZS8A 1JE1A 1USWA 1FZQA 2V7WA 2DH5A 1Z26A 5ALPA 1BXGA 4NOJA 4D0SA 3CO5A 1WB4A 1BX0A 4BO9A 4AU1A 1Y1SA 4IHKA 4D1YA 2KI5A 4WMLA 5KX5A 3PJFA 4V1CB 1A9QA 3W5IA 1V8FA 1DQNA 2VA9A 3GK3A 4GSKA 4K86A 3MHTA 1V41E 3KEFA 3O4FA 3I01M 1DKOA 4IUYA 1FNMA 1NDQA 1JL3A 3PFNA 2H7YA 3PT5A 3GLFA 4G5GA 1EHYA 4EITA 3MRVA 3X1DA 4F5WA 4EA6A 5EMKA 1HDYA 1HKHA 4O2BF 2REXB 1B6GA 1P8AA 1DQSA 3OTGA 3ZCPA 4Q9HA 4D9HA 3IAM1 3B78A 3CNLA 3RAFC 5EC8A 3O8OA 5JW6A 4YBRA 2I2CA 1MABA 1FTQA 5JEDA 4M55A 4DCTA 2QI9F 3PXUA 4P84A 5BWBA 3DBHA 1PVDA 1JWBB 4IWXA 4M76B 1OI4A 2LV8A 1NXOA 3T1YB 3RUFA 1MABB 3CSDA 1LCIA 4ZCMA 3TRKA 3DOEA 4N1AA 1EK2A 4JROA 3HYSA 2R1UA 2G70A 2O7SA 3AEKA 2XNCA 1FVXA 1BX3A 1O95D 1QORA 3R0ZA 1JKJA 4JEHA 3GI1A 4QSHA 2JA2A 3RYFB 3WIOA 4AJLA 4B76A 1W85B 5EP2A 2BI4A 2PYIA 4KBFA 5ALMA 5IBPA 3RRZA 4JQYA 4Q12A 1WKBA 1XVIA 4OAOA 4U7WA 4DCVA 1E6WA 4KQFA 5ALJA 5EVJA 2JRCA 2QTHA 3IJEB 1GARA 2XRYA 4IJKA 1U2EA 2Y1EA 4IXNA 4DLSA 2Q1TA 1WTAA 5J9FA 5DHRA 1YI1A 3DE7X 4GNKA 4K9KA 5HQTA 4Z4FA 1X1BA 5EIFA 3L4BC 3DCJA 1YOBA 3NHFA 1OT3A 1FLAA 4CR8A 3BBPA 1JP7A 4KH1A 1OVMA 1T8RA 1MJ5A 1M7HA 4YXFA 1H23A 2BEVA 3SBEA 1Z75A 3H9JA 3VVLA 2Q6LA 3MK31 2W6ZA 4OUDA 2Q46A 2AFIE 2V98A 4PG8A 2C04A 1JFVA 1TW2A 3EUEA 2VG8A 4P35A 1C30B 4MWGA 1LI5A 4MVJE 3WL8A 3ADDA 2OBYA 1ISFA 3UG7A 1HT2E 1WHTB 1G4HA 2QTBA 3KJNA 3TSZA 1OROA 4JXKA 3BZUA 3QE9Y 2YV1A 2B35A 2FWMX 3HG7A 2ZXUA 2Z3VA 1XKQA 2JVIA 4HVAA 4RPLA 3ZWQA 2GBFA 5F4BA 2VYFA 3DHWC 3IPCA 2C54A 5J1TB 1B2LA 2C9BA 2EKLA 4FGLA 4BQFA 1JAHA 3B70A 3ZQKA 1GG8A 3SJCA 5E2IA 2QUIA 1Y8AA 4DA0A 4YBZA 3KL4A 5KQSA 1VHWA 3MGKA 4BMDA 4LNUA 2Z4TA 5E6RB 1DNPA 2QGNA 4M6WB 2QXYA 3GP3A 2EJUA 2IU3A 2UYHA 2DT5A 2ZATA 2E37A 3B52X 3D0OA 1CDZA 3GLQA 5BV8A 2Q29A 1WP4A 3TRFA 3P32A 1SXQA 5BR7A 3O47A 2G63A 4KHZA 4OI4A 3TGPA 1UEIA 2JZNA 4YDSA 1ZD3A 7ADHA 3K0SA 1NV9A 3R8FA 3BTSA 3DMYA 3EPRA 4GLJA 5AI4A 2WNSA 1AS3A 1G98A 1QG4A 3DBRA 4RPHA 2ZIUB 3CG0A 1CJTC 3BH0A 2XTZA 4F91B 5IF9A 2G76A 3ZQUA 1J97A 1KFEB 4ZZ0A 2X8BA 1I4WA 4YRIA 5LM3A 3RC9A 2H5IA 4KRFA 4XE5A 4J7AA 4L08A 1K3FA 3NTUA 2ZCJA 2QRKA 1YZ3A 4XIYA 3TKLA 3WNCA 1G6OA 4HQFA 1E8MA 3LOQA 3M8KA 5DCUA 3NVDA 4BNUA 4NCJA 4D3ZA 1SIWA 5AJYA 3ZHOA 1II8A 5K51A 4N5HX 1H6CA 1GQFA 4ZANA 1S9HA 1XTJA 4B74A 2X4IA 1OOEA 4MIOA 4ND3A 5F9MA 3LHDA 4LHXA 5KVVA 3Q9UA 1IZZA 4EY6A 3REFA 2NMVA 1H8ED 2JJ8A 2KPOA 3LK6A 4EI9A 1E61A 1WCV1 1PZMA 2B94A 1Z5UA 2ZJ6A 3DL2A 3KLNA 1BCSB 3GC6A 2D2IA 3JASB 4JLSA 1SCQA 4ZREA 1KEZA 3RYHB 1P5HA 2D8MA 5AW6A 1G9SA 4ASUD 5JCOA 2HQRA 4OFZA 4Q1EA 3VR6H 4MUMA 2NU6B 3LVBA 4LJLA 4F2DA 1ZI8A 2VBGA 2X8JB 1C5KA 1U81A 1N3IA 2PT5A 1PBNA 1N6RA 2BAGA 2PT9A 1J2YA 3ANXA 2Q27A 4K81B 4FB5A 5CEJA 4UTNA 5CXSA 1ZOOA 3EDCA 1QYWA 1EUZA 4LMPA 3L92A 1SGWA 1NC1A 2R1VB 4OK3A 4S0XA 4LW8A 1VI5A 2PN1A 1NXXA 4MINA 3SHWA 5KTNA 3K70B 1XNQB 4HAXA 1T5IA 1TMGE 4YRQA 2J6BA 1H4TA 2PIDA 4K9LA 4YACA 1A8UA 4RHUA 2ZR9A 1E2HA 4TV8F 3SYRA 2AJTA 2M32A 3TEFA 1IFXA 1NUTA 3P0RA 1FTGA 4HWSA 1JPNA 1W85A 4MZDA 5FOTA 5D5HA 1ZJZA 3B2NA 3OJOA 3P9IA 5K2MA 1UFRA 3TE7A 3VDQA 4BGDA 4EUNA 1FFYA 1MV8A 1VSBA 4YR9A 5AQEA 4B2LA 2CHUA 4HNGA 1XLTA 1CLUA 4ZEWA 3RS5A 1Z6AA 1MRSA 1NYQA 4B4UA 4TPKA 4DL9A 3MMZA 1T5HX 3DAOA 3ICWA 1VJGA 4JWTA 4ND8B 4B4DA 5ICEA 1IY2A 3UGJA 3F46A 5A4IS 1UQTA 3ID6C 1U3GA 1RWVA 1ZI9A 1UJ5A 3N39C 3Q2IA 2XKBA 4GZLA 5LBUA 4BRUA 5I4IA 4DBLE 4IOMA 2HJGA 4J0KA 1RBZA 3DVRX 1JR6A 3QU7A 3KHSA 4HQNA 3RS9A 1QFSA 1HNWB 4M9SA 2JLWA 1KKMA 3VMFA 3EEFA 1E2KA 3PWSA 4WIAA 3AHEA 5AIBA 3V1NA 4RZSA 1R6DA 2B5WA 3D9QX 4IIBA 1Z4MA 2VPYA 4WLFA 3H3JA 3LP6A 3NG1A 2ZTLA 3PQ5A 4RJLA 4NCXA 3ZW8A 4CQLB 4DR3B 3GFTA 4N9QA 1Q44A 1EKXA 1EX9A 1GDDA 5HUHA 5K3OA 2GNAA 1VLQA 2EFJA 2LNDA 1HYGA 3EA0A 4FFPA 3PGJA 2REQB 5CT9A 2VT2A 3DPSA 4L27A 1RKVA 5K09A 1GFZA 2GN2A 3UTCA 3I5YA 3IELA 3A2KA 3I1FA 4DLUA 4XWOA 2P9BA 2Q41A 5FBRB 1APBA 4GNRA 2BIFA 2HRDA 1WQ1R 4Y2QA 5SY9A 3UT0A 3SHOA 4N3AA 3RWOA 1P4GA 4D8XA 3ABZA 2FVXA 2OUKA 4OMCA 3I62A 1SC4A 1BS2A 5EHZA 3FBWA 3PGVA 5I7AA 4AO7A 1U90A 3WGIA 3MRTA 2B8EA 2R1VA 4LE0A 4W7IA 5K6AC 5LXTB 1ZXLA 4IZ6A 4OXNA 2W2XA 3H5WA 4O4JB 5KYUA 1G5IA 4A5OA 3DL0A 1ZW1A 1H05A 2J67A 3L7NA 1Z3IX 4A0SA 5AUOB 1K66A 5HF9A 5DHPA 4H3KB 4CT0A 4DB2A 2IRWA 2ZSAA 3A9UA 3S8YA 4BIIA 1K7XB 3DOOA 2WD7B 1RXVA 2NU6A 2VUTA 3CNBA 2CUNA 4LDPA 3LOUA 3LW7A 3ZOZA 5KOIA 4RGVA 2IYPA 2ODQA 5DFAA 1LRJA 4RTSA 4TMKA 4KDCA 2NZ2A 1LNSA 2EKQA 3FPEA 3P52A 1JKXA 3RUHA 3S4YA 1KI8A 2DLDA 1JDPA 4IDEA 4AUMA 3CT6A 2R48A 3AV3A 2ZJ1A 4Q9NA 4YUXA 2H1CA 4MRMB 3OP4A 4IFIA 1LD3A 1ISGA 3E35A 2E4UA 4I4TF 3PD7A 4IDDA 3CONA 1C0LA 4X3CA 4JBWA 4P36A 4X7MA 1LDMA 1B3RA 1QZUA 3CO0S 3DKRA 4PYNA 1B6TA 2QTGA 5J43A 2JH8A 1AQJA 1YDEA 3X43A 4DLXA 1EA7A 4K03A 2QD3A 1N2JA 1RLOA 1YXMA 3ETJA 3VR4A 2QY6A 3EWNA 4GT1A 4BNFA 4WCVA 2DWQA 2Q5CA 4QNNA 4YCLA 3HI6A 3RTDA 4HPXB 1EK0A 4HAVA 3NTVA 1JDTA 2W42A 4IXMA 2WF7A 1LC0A 2G40A 1WHSB 1QE3A 4W7HA 3MBIA 3KDSE 3MGCA 4KE6A 5FO0A 2GJAA 4AICA 2AUMA 4D3DA 4M1OA 2Y1XA 3NWEA 3X1ZA 2C4WA 4LYYA 3NB0A 1XV5A 5IAAA 3AZPA 5EEHA 2XQFA 5BV2P 2PKXA 2J32A 2LP4Y 1EJ0A 4OXYA 3ESXA 4CMCA 2JLYA 3HCCA 3B85A 1LTKA 2VHYA 2NZXA 3E05A 1GZSA 1SCJA 1IEXA 1JJFA 4NICA 5FI3A 2OM2A 3I2YX 5J1SB 4LF8B 3I8SA 3WFIA 1C29B 1PFGA 3IDZA 1DFGA 1U31A 1ZN8A 1T36A 3CVOA 4JL8A 4JT9A 4WKNA 4F1JA 4YDRA 3CINA 4W9MC 3IV9A 2FWPA 1X39A 1S3GA 1AXEA 2OE2A 2XIJA 3KV1A 3MCVA 2JJMA 3OZDA 4IJQA 2FP4B 4X60A 4BNNA 3K4QA 2NM0A 2QR5A 2OO5C 3DMNA 1KHTA 3G02A 1AN0A 3Q11A 4QPNA 4Q9KA 4YJ3B 2VSOA 3T52A 5DN6D 3PWTA 2AMJA 1XEXB 3UCXA 3PUXA 2ST1A 2EW8A 1DO8A 2D5BA 3H5RA 3HWSA 4RVSA 3Q3IA 1HWYA 5HILA 3SIXA 4KN9S 2WA1A 4I50B 4OXIA 4QQNA 1A5AB 2DYKA 3VDNB 3CURA 1GU7A 5JVDF 3IKTA 2BGGA 1AGRA 2ZW9A 3QX9A 3T1QA 1VE7A 4F60A 2PWZA 1T1JA 3VTFA 2XRMA 4YA6A 2B6NA 4JEMA 3VO8A 5E3IA 1ML4A 2O8EB 3PICA 4J3FA 4PIVA 4ZA2A 5EJ5A 3DYIA 1ULAA 1MOQA 1VL2A 3URKA 2DJ5A 3JQ9A 3PLRA 1X1RA 1QV7A 2V6MA 4BASA 3FIUA 1ADFA 4NPAA 5EE1A 1PR2A 1N2CB 2C9YA 2ZE6A 4RHTA 2K7ZA 3ZD9A 4UXJA 4BP9A 1CRWG 2OHVA 5H5JA 1NNUA 2ZXFA 4OY3A 2XBMA 1GPLA 2IEYA 4JR2A 4Q0MA 4RVUA 2RGRA 2PUVA 1LI4A 1MO5A 3M4YA 3D4IA 3TXAA 4DMGA 4YRBA 4RY8A 3MJTA 5FBQB 1V1RB 1R6BX 5D2CA 1X94A 2ZK7A 4IQ8A 1RRKA 5L53A 1O9HA 3UMSA 4REOA 1IBSA 1ZVMA 2AMVA 3ED1A 2ZB7A 4RXUA 1N78A 3NKLA 2HU7A 4XD2A 4DLAA 4C6TB 2V4MA 3W0LB 4I9UA 5BY2A 2FHPA 3ELWA 2J30A 4GR4A 3PTZA 4HJRA 1WF3A 5DNEA 3OTOB 1K1EA 1Y5RA 4GMGA 3B8HA 2XUFA 1Z6ZA 2HFJA 5JTTA 2ZKIA 4GMXA 4TV9B 1VRCA 4ZO8A 4CG1A 1D9ZA 1P9LA 3H5LA 2EJWA 4ETWA 3ZE0B 1MAAA 5COQA 1C50A 2QVXX 1NN0A 2EZUA 1NBHA 3HCAA 2OD7A 3OTIA 5CA1B 2DWCA 3ZJYA 1NVBA 2ZKLA 2CDBA 4LF9B 1SWWA 4EELA 4CFSA 4Z49A 4WACA 1RAAA 2J07A 3DZDA 4IF6A 3K5IA 1ZUIA 4NHEA 3ITNA 2F8LA 2FZGA 1XTTA 5LQMA 2NAFA 1T1RA 2ZT5A 1KFCB 3O31A 4KIJA 5DCYA 3WBKA 1YF3A 5IHXA 3R3UA 3FTDA 5ALEA 2B98A 4MQEB 3BIXA 3BFVA 2P9CA 1N5LA 3AONB 1X7WB 5AUQA 4GGOA 1I51A 4CDGA 2AEFA 3GT7A 4CKCA 4FGWA 4JBYA 4IFTA 4EOGA 1HUQA 4C0HA 4FYKA 3UO8B 2AI2A 4JJ4A 5IMSA 3KU1A 3TIGA 4FLFA 1I7QB 5ARDA 1TM3E 3ZEIA 1E5TA 1SZJG 3JARA 2J0EA 2WV9A 1U04A 2CXUA 4G2NA 5FA5A 4YAWA 2HPHA 4RHXA 5CW2A 3ELYA 3MT7A 5KYXB 3TRJA 4R1SA 1Q6YA 2HSEA 2Y66A 3ETNA 3NTXA 3UHPA 4U2EA 3NYIA 2LXNA 5DBHX 3CRW1 3QOFA 4TMZA 3VNUA 1SKBA 1VFNA 1T8PA 4DIMA 1B00A 3U5TA 1L4MA 1YL6A 3VU9B 1AN9A 1ZUNA 4LJ7A 4GPAA 4UTPA 1G2QA 2W2MA 4MA5A 3IGFA 4BLUA 5JS7A 1VJ5A 3L0SA 3EEBA 4PAMA 1OAOA 4JOBA 3VV2A 2WJGA 4D0NA 1MHTA 1J9GA 3W1WA 3BDAA 3WX0A 1WS6A 4L0DA 4LHYA 1XJQA 3IIMA 1K8XB 1XQWA 2GK3A 2JG3A 4FIZA 2ODEA 4IMRA 4KO2S 5AJWA 2DBYA 2V6FA 4Z0HO 2WKWA 1CS4C 1P1HA 2M9MA 1P0QA 2ZIZA 4P34A 4RJJA 3DLTA 3N70A 4HH0A 3AKYA 3ETCA 5C52B 1JT2A 3TSCA 6REQA 2VR1A 1PNRA 1P8JA 4B3IA 2BZ1A 2TS1A 2WYUA 4DA8A 3BRQA 4Z0NA 3T9DA 4TMVA 1ZH4A 3IUMA 5G3YA 2DR2A 3N6RA 4BJ5A 1K7YA 1X1CA 3KUKA 3PPYA 3NYRA 4ESOA 2ZWAA 4ENUA 3HGTA 1E8DA 3F98A 1MIOA 2HA6A 5AVVA 2QRMA 5AKEA 4PHGA 2GD0A 2VSYA 2X0DA 4LSZA 5H0IA 4X3OA 3A1DA 4WTOA 2OHHA 3PUIA 3HJTA 1DB3A 1KKLA 3G89A 5FORA 3NGMA 1FQKA 3U37A 4EUFA 2J9FB 5BOSA 3JQ7A 1DAIA 2H08A 1U7DA 1BNCA 2NUAB 4G1EB 5K0TA 4JQSA 1DTWB 1KBQA 1Y7IA 3EEYA 4ACBA 4A2PA 1QGUB 2FW7A 3DMTA 1UM9B 3L6BA 4FUTA 1U0JA 4CUKA 4IIJF 3HBLA 4RZHA 1GR1A 1Q6ZA 3DZHA 4D9CA 4IIJB 4NOMA 1G8YA 4P32A 3IJPA 4DRYA 2ACEA 1KYVA 2IGTA 4BIMA 1M33A 2FX2A 4CGYA 3G6WA 3NBUA 5DM60 1OA0A 2NO7A 2AOXA 2AC2A 1P29A 2FPOA 1D5WA 4PYMA 5F7OA 2Q0HA 2GEBA 3HNPA 4JKOA 3EW7A 4JJ6A 4KPUB 4P0QB 3U60B 2ZDGA 4RVHA 4W1PA 1J56A 4HZUA 5JCOC 4JYAB 1XMOB 2DUMA 1AXRA 4WESA 4XA8A 3MLAA 2GD2A 1OILA 2OBNA 2P7IA 1SBZA 3EGCA 3L41A 3AEQA 4Y9DA 5EFZA 3KVYA 2G77B 3BK1A 2QMYA 4M98A 2DSTA 4WX2B 1PKEA 4H0FA 5JNSA 2OL4A 4F1WA 2RC6A 3M2PA 1V7PC 3Q3EA 1SCKA 5I7WA 4XWKA 2WIBA 4J29A 2NXCA 3OFKA 3PR2B 3S3TA 1I80A 1IZ8A 1RIFA 1XQ6A 1G5RA 3O0DA 2EJBA 2Y0DA 3I4LA 1R8YA 1FY2A 1KJZA 3QPVA 4L95C 1S5PA 3INNA 3P2JA 1ODLA 4NNJA 1YE3A 1MMFB 1CNFA 5HVNA 3FETA 1ZH0A 3ESQA 3WZLA 2KBFA 1M9NA 2WFLB 1VB3A 3LXUX 4BFZA 3FB4A 1Q3TA 3K6SA 1RPAA 3CZ4A 1XP8A 2GN1A 4F5YA 5LKRA 2ZWOA 5AOAA 3UMYA 3K0AB 1UBCA 5C3UA 1RLTA 1YJXA 2IDKA 4MS1A 2ZR7A 4ISBA 3LL7A 1RM3A 1EBUA 4J3JA 1XYYA 1NBAA 4RPGA 4WW0A 1WD5A 3OIGA 2JIBA 3G1WA 4TMTA 4Z8YA 3VPFA 4XWAA 3MHPA 1NNSA 1TJ4A 2PSSA 3AR6A 3SAJA 3AUYA 3JQCA 3AOGA 4YJ2F 3EGEA 2X23A 3SBDA 4CLHA 4NZOA 4DZZA 5KYYB 2NP6A 3DCNA 5CX4A 4HDQB 5JJCA 5B36A 3ENQA 1CY4A 4E5YA 4RABA 4MQMA 2J3DA 3UQZA 2HLDA 1MNQA 3X3HA 3U7HB 4EMSA 4QJ3A 3CKYA 4TT3A 1DJOA 4KUHA 2AOWA 1TMKA 1C3OB 1JDBB 2R8XA 3GLIA 3ZGLA 2A1TR 2P69A 2A30A 2AXEA 3UXYA 2RI1A 3T3DA 2IXFA 3GVPA 4NE7A 3V8NA 1JEYA 2VH5R 5LNK1 5DCWA 3EZFA 4PCAA 1RTKA 4TVKA 2EFGA 4Y9UA 2DQZA 5FJIA 4TWRA 1XPRA 1VQ1A 1JR2A 1OPRA 3P96A 3IA7A 1MOZA 4HWOA 4KAFA 5B3JA 3WGJA 4QKQA 4FCWA 3LNTA 3C5HA 3P2KA 4O4IB 3UMBA 1CUJA 1J49A 4P5DA 4PFSA 1RZRA 3R9WA 2VPXA 1ZD8A 5JXGA 3OM1A 4R81A 3WC4A 1KKUA 5KINB 1X7XA 1IU9A 1I10A 1BDBA 1YWGO 3ESYA 4K6OA 2MSWA 4OKNA 3VPHA 4GBED