3HUFA

Structure of the s. pombe nbs1-ctp1 complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
320
structure length
301
Chain Sequence
MWIIEAEGDILKGKSRILFPGTYIVGRNVSDDSSHIQVISKSISKRHARFTILTPSEKDYFTGGPCEFEVKDLDTKFGTKVNEKVVGQNGDSYKEKDLKIQLGKCPFTINAYWRSMCIQFDNPEMLSQWASNLNLLGIPTGLRDSDATTHFVMNRQAGSSITVGTMYAFLKKTVIIDDSYLQYLSTVKESVIEDASLMPDALECFKNIIKNNDQFPSSPEDCINSLEGFSCAMLNTSSESHHLLELLGLRISTFMKELISKTDFVVLNGIFCLTIEQLWKIIIERNSRELISKEIERLKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nbs1 flexibly tethers Ctp1 and Mre11-Rad50 to coordinate DNA double-strand break processing and repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
molecule keywords DNA repair and telomere maintenance protein nbs1
total genus 84
structure length 301
sequence length 320
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3hufA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3hufA02
3.40.50.11080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hufA03
4BU0A 2INGX 1GXCA 1G3GA 1Y98A 1JNXX 1K3QA 1L7BA 3PXEA 3T7IA 4U4AA 1LGPA 5E50A 1OQAA 2ADOA 2HTFA 3UN0A 3COJA 3POAA 1UHTA 1CDZA 3II6X 2EBUA 2M2IA 3JVEA 2K7FA 3VA1A 3PC6A 4A0EA 1T15A 3UEOA 1WV3A 3UNMA 2JPEA 2W3OA 1J4LA 2EBWA 3UENA 1J4QA 3VA4A 3L46A 4OFBA 3GQSA 2E2WA 1LGQA 2XNHA 1R21A 4XPZA 2AZMA 3UOTA 2KKLA 2COEA 1KZYC 2L42A 3T7KA 1IN1A 2JQLA 2KB4A 3AL2A 1N5OX 2WT8A 3PA6A 3PD7A 1YJ5C 1DMZA 3HUEA 3U3ZA 1FHQA 2K6GA 3QVGB 3KT9A 4BMDA 3I6UA 1K2MA 3ELVA 4IGKA 3KTFA 4EJQA 3K16A 1J4KA 2KB3A 1Z56C 2XT9B 3PO8A 2JKDA 1MZKA 1FHRA 3I6WA 1T29A 3AL3A 4D9VA 3PXBA 3OLCX 4XQ0A 3SZMA 2LE0A 1WF6A 2JQJA 4IFIA 2KFUA 4H87A 3L40A 4Y2GA 1G6GA 4ID3A 3VPYA 1YJMA 5DJOA 3K05A 3K15A 2COUA 3T7JA 3HUFA 1J4OA 1WLNA 3EF1A 2VXCA 2EH0A 2A0TA 3PC8C 3PXAA 2R1ZA 2DUNA 1K2NA 2AFFA 2G1LA 3PC7A 1K3JA 4JLUA 3L41A 3T1NA 3FA2A 4G2SA 2LC1A 3HX1A 3I0MA 1L0BA 1QU5A 3SHTA 4BMCA 1GZHB 2ETXA 2FF4A 3UNNA 3SHVA 3MDBA 1J4PA 3UMZA 1IMOA 3PXCX 2VXBA 3PC8A 3UV0A 2FEZA 2PIEA 2BRFA 3OUNA 1K3NA 3PXDA 2D8MA 4QCJA 2NTEA 4JONA 1T2UA 3ELSA 3QVGA 2XNKA 2CSWA 5A8IA 2EP8A 3K0HA 5ECGC 3FM8A 2COKA 3K0KA 3I0NA 1UJXA 3EF0A 4BU1A 4Y18A 1T2VA 4N40A 2JQIA 2JW5A 3SQDA 4EGXA
chains in the Genus database with same CATH superfamily
3HDTA 5AW7A 5E9WA 1G6HA 4PC6A 1QPBA 1F38A 4C2TA 1CG6A 1I0LA 4HYTA 1R0LA 3NTVA 2Z8XA 3STTA 3SZLA 4A8JB 1ZG3A 3SWWA 4HYQA 3ZGXA 1ZVJA 4BNDA 3CZMA 4NEGA 4ZQCB 2PZEA 1K7SN 4DCPA 4Y98A 4KUHA 4F7DA 2DCUA 3U9TA 3BCRA 5THXA 1EG7A 2XSZD 4BIIA 2D5CA 4CEIB 5GZ1A 1MK2A 1G5PA 2FRDA 1XCMA 3L2OB 5CFOA 1I0IA 4ZDJA 4GXRA 1CVRA 1UC4B 1LZLA 3AHEA 4AU1A 1LV7A 2CF5A 3WB2A 4B3RB 1PYOA 3AG6A 2AG5A 4C4TA 2OTCA 1A8QA 5C46F 1P4GA 5JZMA 2JA1A 3EEQA 2P9CA 2VJAA 1H0RA 3PD7A 5B1IA 1FFXA 3I28A 4WOJA 3D0QA 2FQWA 3L7BA 1H93A 3ZDEA 3FNQA 4N5HX 3ON5A 4LMBA 3H87A 4EW1A 3H11B 4MQBA 1XVAA 4C0BA 1ANKA 2FPPA 2CXRA 2NT4A 4REQB 2PUBA 3P0FA 3VV3A 2BTQB 3CF4A 3AEUA 1BX3A 1RHQA 2WOOA 3PUWA 4N6OA 4DJ5X 4YN3A 5A6SB 1VIDA 2Q4RA 2AHOA 4C03A 5F3WB 5HK9A 5EUQB 4L4UA 1D4ZA 3UAZA 1RMYA 1SVLA 1JKXA 2QMOA 3UJ3X 1W85A 1PZXA 4H3SA 4GYYA 3NMUF 1RAHA 1CJTC 3T95A 1SBYA 2WLSA 5HJ7A 5I8PA 1CU1A 2ZTSA 1C9NA 3H2SA 2VPTA 2JAOA 4MYTA 1ODFA 4YACA 3QMMA 3SYRA 4ARVA 5B57C 2GTPA 4KIGA 4AYXA 2BFMA 3UNXA 1KR5A 1GKUB 2CHQA 3N2ZB 3E9EA 5FJIA 4JXZA 2HQ1A 3OZXA 4LE2A 3TBFA 5I51A 1YZHA 4MW4A 1B76A 3MSXA 2DR0A 3L1JA 5AI5A 5MN4A 3OQJA 1C9DB 4O33A 1ZIYA 1H9AA 3QVUA 4MQEB 5ESRA 4DABA 2JCXA 2WUWE 4LY6A 3NIGB 3UAWA 5CDYA 4HGRA 3K4QA 1E4YA 5FOTA 2HSWA 3HB9A 3GVIA 3QPWA 1CUUA 4QEDA 5B2FA 5JSZA 1FCJA 1J0XO 4BQEA 1JQ3A 2G6TA 3KX2A 3AVTA 1QF9A 1WWKA 3DQQA 2V7GA 3RJMA 3W2GA 2Y71A 1X3SA 4LWPA 2XCQA 2CB9A 5IKPA 2XCIA 3VTAA 2BGKA 1YC2A 2Z2ZA 2VPPA 1Q2XA 4FCVA 4U8HA 3TLGB 1QRRA 2CCJA 4RFSB 4LNHA 4O8ZA 4XTCS 2ZUSA 2C96A 2R44A 1PFKA 1IEQA 3PUXA 4LJAA 3QUSA 3UKDA 4X0EA 5TEVA 3ZIDA 2JVJA 1P6XA 3PG5A 3C6MA 2F1RA 3WNZA 5JC1A 3GW8A 5A6SA 1QHYA 3G6KA 1P8JA 1I80A 3CLKA 1C9EA 2IP1A 2H0RA 4U2DA 4LF7B 3HXLA 4GI7A 1EWTA 3EVTA 1W85B 4D43A 1TEXA 3O8RA 1MU0A 1RWVA 2QL6A 3F98A 2OBLA 1MQ9A 3FG9A 3QELB 4PE5B 4BFWA 1B6RA 2GHQA 5F78A 3SICE 5DT2A 3LE8A 3WLNA 4K8OA 4ASUD 1GY8A 4MLZA 1CUGA 3IDQA 4LNAA 1UJXA 4EJSB 4JOCA 3TQHA 4Q1FA 3R0VA 4OHBA 1M0SA 2IK8A 5TSDA 4AS3A 2Q5IA 3HYCA 3CR8A 4Y9RA 2YJ5A 3PYLA 4TSFA 5GJWC 4ETWA 3F5FA 5C8DA 1N32B 5FNVF 4FZJA 4NYJR 3AEQA 4ZCSA 1TAQA 1J8FA 1YONA 3NBZC 1VJ1A 2QRMA 4US2R 4DNXA 2WKRA 3SX4A 3Q7SA 3DTYA 4DHWA 1G8GA 3EXAA 1H1DA 4UOQA 2VBIA 5GQSA 4F4CA 2PXAA 3O03A 3EIOA 2HTEA 2WZQA 4MPDA 3DBRA 3VR4H 4AFNA 2WQ6A 3GFPA 1QDEA 4D56A 1FPMA 1XKQA 3OFKA 3VC2A 2ZUEA 3Q0EA 5IRCD 4MW7A 4QTYA 4B40A 4NFLA 3GLIE 2XX3A 2YJ6A 3AB3A 4GI2A 3EG9A 1BDMA 4JK3A 3GQSA 1LPNA 2NAFA 2GK7A 2YWGA 4FZ3A 4ND5A 4NMMA 5JQGF 5I9IA 5F2EA 1U6KA 2BP7B 1T13A 2VDKB 2W6JA 3G0BA 1GCOA 2EKZA 3TIFA 4CU5A 1YBHA 3FMIA 3HL4A 4I50A 5L7YA 1M2VA 1BOFA 1FHQA 1RU3A 4RFVA 1HYGA 621PA 5JAPA 1LRJA 2MR6A 3A04A 3DVRX 4KVZA 4MKGA 1E1MA 1RPJA 1TU0A 3DZ8A 2V5UA 2I6FA 1BMDA 3EAQA 2AFIA 4FOOA 2MIIA 2ZB7A 3DMPA 2YWRA 3O8LA 2BHNA 3RUIA 3OZIA 4D0LB 4OX9Y 1G20A 4PO1A 1W1WA 1XCPA 1XBTA 2CKDA 4G01B 1AGRA 5JNTA 2OBBA 4CHTA 1UJCA 4IXMA 1Q14A 2YFQA 2PRIA 1AC5A 1S0UA 4I5DA 4LRXA 4EJ6A 3EFBA 1CY7A 2AFHA 2ISSD 4ZO4A 5BSVA 1OH5A 4WJZA 4NV3A 3NR2A 1DEKA 1Z7WA 2POQX 4WINA 5JNWA 1J97A 5CCBA 2W8BB 5HWSA 2ZJYA 1GNPA 3M6LA 4I5FA 2VQ3A 2FZEA 4YPFA 4B3CA 4N12A 5K8LA 4JQYA 4CM1A 4WERA 3OZEA 2OLEA 4ILEA 3OKPA 4IIBA 4N9QA 4IMRA 4TKVB 3D1JA 3R3HA 3DE0X 3K1YA 2H1CA 2MYUA 1NJ8A 1KORA 4S2EA 2OA0A 3W3AH 3T1TA 1U63A 2GMWA 2HNAA 2NNLD 4QWMA 2O59A 3HR4A 4G9EA 3UJ8A 4MR8A 3A1WA 5F9HA 5I9BA 4AKTA 2B69A 2ZJ1A 4Q4JA 1J06A 3QKTA 1CNMA 3MMNA 5JEKA 1NBWB 2QD2A 1GT6A 2YW2A 3IBCA 3I01A 3L41A 5EZYB 4CV3A 2ZETA 4D4HA 2J9YB 2V98A 3EIUA 4WJLA 1G4HA 1MVLA 3P9QA 3R6DA 1TCBA 2PYIA 4LYGA 1B16A 4ZODA 1KERA 3UM9A 3EBPA 2VJLA 4D92A 3ZV3A 3ZX5A 3DFIA 2WC1A 4ARUA 1FMLA 1VLVA 3PC8A 1NW8A 2VR1A 3PGJA 1ZJWA 3QBJA 4OHMA 4B3HA 4MICA 5JOQA 3BM5A 2FWJA 5ICEA 1EXNA 5KTSA 1Q15A 4UPDA 3M7IA 1U0TA 4PLYA 4KODA 4BJ3A 2B4AA 4XJTA 3W5VA 3D2LA 3D5QA 3NO4A 4PX5A 2BDTA 3K3PA 1ZO8A 4IIFA 4MZDA 2R5NA 5JFGA 1YE8A 4R54A 5DULA 1YBFA 2WD9A 4GHWA 4HATA 4IYJA 3B6IA 4EI8A 2E89A 1VPTA 3LZ6A 3TOXA 1O0CA 4Q7JB 1ZK3A 2OC9A 2RGXA 3HVIA 2O5EA 1WQ1R 3TB6A 6Q21A 4BY9E 3G9ZA 5G41A 1CDOA 3QTLA 4IWXA 3K4PA 2ATCA 4Q1VA 1R6DA 3R4VA 4HZGA 2O06A 4DA8A 4AKHA 3R6WA 4CKEA 2LKCA 1SKUA 1BW9A 4FSDA 3NDBB 4DCJA 2FOXA 2QB5A 1G41A 1YZGA 2CGEA 2VPIA 2W83A 3TZ6A 4B31A 4TYPA 4KVGA 3I04A 4JI7B 2ORWA 4RXTA 4YT5A 5BSTA 1CY4A 3LUAA 3E7PA 1Q74A 3L4SO 5BUCA 5LXTB 4CM7A 2V7TA 3MWKA 4LJ8A 1ISSA 1T5LA 1Z6QA 4PZUA 1HKUA 1UKCA 3CKYA 3LRTA 4LQLA 3NHKA 2MTBA 4DXDA 2JGLA 4NU5A 2O3UA 2QN8A 3LLUA 2RJNA 4S1TA 4MGIR 4RVGA 5IABA 5DNVA 5G02A 1NNSA 2QRVB 2RGGA 1VHTA 4KU4A 1U9YA 3E3LA 3H4TA 3NONA 4NFYA 1FY2A 3EPJA 2IP2A 3BXFA 3X1JA 4UTZA 1FYFA 4ZRDA 4AZ0A 4PZZA 4R2JA 2BUBA 1U7HA 4ETIA 4ALNA 3EJWA 3R3ZA 5KJCA 4P4SA 5B7NA 1RYBA 2MU1A 2V9CA 3DS8A 4G89A 4P5DA 4YAOA 4UNQA 2YY5A 4GSYA 4QE3A 3EEFA 1P31A 1PR4A 3VNAA 1CE8B 1PWZA 1UWVA 1SQ6A 4PRLA 4CVNA 2CDNA 4RFLA 1SBCA 3I2KA 1DEVA 1T36A 4HJRA 3VVLA 3RUFA 1YZUA 1MT0A 4GLFA 4MGHA 5BNFA 3ZGOA 5LNK6 4KQKA 1M2KA 2Z2YA 2ZAGA 1QQ7A 4H1TA 1XROA 4MEBA 3CUKA 4CKEB 4LRUA 4CUJA 3I73A 4D46A 5BSKA 2I62A 3GNTA 3VI4B 3QX8A 1QOQB 3D6NB 3MWJA 2COUA 5F7XA 2VP3A 3B1JA 5FDFA 1NT2A 4U5XA 2IRWA 4LOIA 4G0WA 2C9DA 1JLLA 4XUGB 3AVUA 4JLNA 2WWYA 4KYIB 4GL4A 4Z1MD 5F1YA 1QIGA 3ZU2A 3M0EA 1BE8A 3M9LA 4FUQA 3A14A 2PSEA 3R7BA 2OSVA 2IY8A 1BXGB 1L5SA 2A2ZA 2HF9A 3L79A 5J4LA 5ALSA 5K4HA 2OCYC 1IUKA 4JI2B 1ISIA 3JR7A 4C0SA 1KI3A 2XOEA 2ZBRA 3DWGA 3G68A 4XFKA 2RHOA 3UXHA 3ZJ4A 2XQIA 1R0SA 3HM9A 4HDOB 3U19A 1RWNA 1VE6A 2K2QB 1THMA 2JANA 2OHFA 2ZUBA 4O5OA 4RY0A 5FIUA 2OYRA 4BVEA 2EGGA 4EF6A 3Q8XB 4FVTA 2LGJA 4LXHA 3EN0A 4ARAA 4IICA 1UDCA 5ITSA 2VWPA 3LC1O 4GOLD 1GGNA 1R18A 1AZTA 2GN2A 4JT2A 2B98A 5C18A 3PDUA 1XF1A 1Y5NA 4BVBA 4BHTA 2G5GX 2VF4X 4JWKA 4MAFA 5ECGC 1XV5A 1CHNA 1GTMA 4JU8A 5K8JB 2IYOA 1MJHA 1SKMA 2B35A 4NJMB 1YKSA 4TTAA 5JWRA 3T8YA 4IJMA 1TTTA 3EOAI 1QK4A 1RMQA 4W1QA 3ZWWA 5CFZA 1B6TA 4MRSA 5FR1A 1L1QA 3A28A 1ZZGA 1K8RA 3UAYA 4RNCA 4TS1A 5FD8A 1OHHA 1Q50A 2W93A 2H2FA 1NP6A 1BSVA 1QMGA 2Y1GA 4HTFA 5MFPA 2HTFA 2OPBA 1JEEA 2C2KA 2DJIA 3B3AA 1YIOA 3K32A 4MYCA 5AK4A 4DCNA 4ZYLA 1GEEA 1ENPA 1PZGA 3ZGYA 2MT9A 3RC3A 2X5KO 1TL7C 1DBVO 3FPLA 3EWNA 1OREA 5E3HA 4QTZA 3GARA 2G82A 3DO6A 1S4QA 2DBQA 4FMPA 4PTLA 1XMVA 4TWIA 2F1JA 1NDUA 3GRFA 3SVZA 3LXRA 1YJ5A 4FJ2A 5L4NA 2CNDA 4CKBB 1F5NA 1RRMA 1A04A 4B79A 3ZKWA 3CUWA 4K87A 3GUZA 2J67A 4K6OA 1KZYC 2WF7A 3QPAA 3OFSA 2VJBA 4EPYA 5JBQA 2IBTA 2R6ZA 3VNUA 4K6HA 3GHHA 3OZUA 2NV2B 5HRCA 4RD0A 2ID4A 1BGWA 2PMWB 3R3VA 4B6EA 2A9VA 2WI8A 3QF4B 2YY7A 3GG9A 3AETA 1I6WA 2H5EA 2YN0A 5DCYA 3AV0B 1M2EA 4DA7A 2PZFA 1L7RA 1CYDA 2XE4A 5EZ6B 3KDSE 3BEDA 4TMZA 2WFAA 3I6UA 1UP4A 1MNQA 1ZD4A 3VU9A 4CG2A 3C3DA 4DSOA 2FWMX 1Z36A 3R6LA 4LDPA 5JH7F 5EHXA 3TSCA 1X7WA 1K5HA 1KAEA 1CDDA 4DJAA 5H02A 4CGYA 1FQOA 1GZ6A 4HTFB 3PTAA 1U99A 4YRQA 1YDHA 3ZE9A 1H9BA 1EFTA 2IBSA 2AWNA 2DPYA 5JIBA 2HDOA 2NVUA 3GLKA 1S2GA 4AURA 4EYOA 4B4UA 2KJQA 4PX2A 1VMDA 2XZOA 3SAJA 4N48A 3NOVA 4BEVA 2O8DA 1ID8A 2QMYA 1J9EA 5H3CA 1JQ5A 3K5IA 4P84A 2FOIA 5BYKA 1YQGA 1AS2A 4G24A 1W48A 4HRXA 1IXYA 2Z2IA 2HFKA 3RAEC 1PDOA 5KTOA 3AUJB 1J4OA 1LW7A 2CZGA 1NRIA 1X74A 1T2CA 2VRWA 4B7CA 2FPIB 2IIPA 2R1ZA 2IPAB 2H63A 1T35A 4XOUA 4CV2A 421PA 4F12A 1GFWA 1J9GA 3PUVA 1JQJC 3W05A 2BONA 2PX8A 1GNQA 1TT5A 3ROEA 4C9BA 3E5HA 1X1RA 2BE9A 3F3MA 4YP7A 3LSYA 1QRTA 3I9OA 5HYVA 5LA6F 3KB1A 4P3YA 3DEFA 2P4EA 3OPNA 3DNFA 4NKRA 4L5AA 1K1EA 3UJAA 3WWOA 1J70A 4PIPA 4UU8A 5LUAA 1FQKA 4FFSA 3PQ4A 1MC8A 2A58A 2JHFA 5CEEA 1RYZA 4PG4A 1ZNWA 1DJLA 1N9GB 3NH6A 5UKDA 4IQ8A 3UTDA 2IYAA 3SU8A 3WYDA 2QVGA 3PNBA 1N8TA 1JTVA 1T2UA 4KAAA 1QZZA 5EKXA 2ZRNA 3HFJA 4EY6A 2O8VA 5A8IA 1G8HA 2WJJA 3L06A 1G8KA 1GRVA 4JBHA 4TTPA 3CNBA 2NVOA 2EHJA 2CW5A 3P2EA 4QATA 4RCVA 5DI3A 2R00C 4NU0A 2VAVA 1X9HA 2ZT6A 1E5TA 4D4JA 5L45A 3AFOA 5BN5A 4ALIA 2JW5A 2ONJA 2R751 3AR4A 4LDQA 3FSJX 5I01A 4YT2A 4ZV4A 1W0KD 4PZDA 2XPCA 3EXIA 5DOZA 1SBHA 2O54A 1XLVA 4QUKA 1X8JA 4WT7A 2CZQA 2QLLA 2PZAA 2WIKA 1V16A 4YP9A 2Y77A 4RS4A 3STYA 3WK8A 4EPRA 2HO4A 2Y1WA 3ORHA 5CRIA 3SM3A 4LRSB 3V1LA 2XW6A 1ZUD1 4CQMA 4XUCA 3PFCA 1BYIA 4PCVA 3N8KA 2QVBA 1P5JA 3OUUA 4JC8A 4E3ZA 4G1UC 5CHYA 1G291 3TKLA 3WMGA 2UZ1A 1Y0BA 2I4RA 1OWOA 1PT9A 1WUTA 2YHBA 3F1LA 4W6ZA 2J09A 3IP5A 2FOLA 1V8ZA 2GVDC 4TV8B 5AUQA 2BI7A 1RAAA 2G4CA 3Q3GE 5EJ6A 3WKBA 2YYYA 1FS4A 1T4DA 1GCAA 2BDEA 4R01A 1AKWA 1SXJB 2WD7B 2UVQA 2I6XA 1CZLA 1H23A 3IMCA 2HA4A 3IDZA 3N07A 3ZTYA 5BW4A 4EQZA 1QHXA 2C3UA 1ZGCA 2BI4A 5F9MA 3STHA 1PZEA 3RW9A 4JEIA 3DVAA 3IVCA 9MHTA 1CCWA 3ZVLA 3EUEA 4OHYA 3HYTA 5EJ2A 3ENKA 1R0ZA 2YV5A 5YASA 1Z8HA 3DAHA 2ZU0C 3JQ7B 1C8LA 1ZEJA 3BMQA 3OC0A 3EIHA 3AMVA 4JKIA 2BKLA 2BMAA 3L18A 5CLHA 3F6EX 1NG1A 1K3UB 1TC2A 1TU3A 1ZOIA 3BDVA 3LH5A 3GJ3A 3JD3A 3OD1A 4AG6A 5BMVB 5C5CA 5KTYA 1LPMA 2QR5A 4OB8A 1FTGA 5L3ZA 2GN8A 3C5VA 2XE6A 3T54A 4CNBA 3J81k 2A7XA 3GJTA 1O58A 4N65A 1I13A 5CBKA 1TAUA 2A3NA 1KMQA 3IALA 1D8AA 4KQXA 2DFTA 2IXDA 3RFFA 5JERA 4DG9A 2WHRA 2J32A 4PLFA 4MUIA 2AHRA 2XDYA 3BWCA 1ZD3A 3WYGA 3WLTA 1BEZA 4LMRA 2WFLB 2IXEA 3T7RA 4PLGA 4X24A 2YNMD 2XTAA 4UU1A 1U0NA 1R15A 2M32A 1H6AA 2H31A 4QFMA 4CHGA 3BXPA 1ZR2A 3O2NA 4FT4A 3SNKA 1IJFA 1EP9A 2JLXA 1W0JD 2XOKD 3U0BA 1RR6A 2GFHA 2VUHB 4JENA 4A23A 4TL6A 4YH1A 1YQXA 1O9HA 1XYVA 2VUIB 3IUMA 3HRHA 1LJLA 2QZPA 2CNBA 4C4PA 1R4NA 2C07A 4KNVA 4W9NC 4JBWA 1CEQA 2P79A 5K4AA 2W98A 2OO5C 2RJ3A 3EVBA 3F90A 3FVRA 2Y76A 2Y68A 4HGQA 4D8YA 2DWUA 2P6RA 2B25A 4TTSA 2V7VA 2AUTA 4K0RA 3PXCX 1VG1A 6YASA 2QRQA 3QUQA 3SE0A 4UUPA 1FDRA 2WTBA 2IITA 4BQQA 4A8PA 4YRSA 1EESA 3N86A 2B2CA 1WPQA 2X1HA 4KQMA 9ABPA 2VT2A 3CIOA 3OMLA 1HL3A 3LLMA 4FNMA 1RVV1 3WBBA 1PO7A 2AFRA 2KHZA 4IR7A 4LHWA 5I4IA 3WGIA 4N4AA 5DM2A 3EC7A 1E3LA 1J4AA 1Y8QB 2FQYA 1IATA 3PR3A 3QJYA 4H7HA 4DREA 3JZAA 3A6KA 4GR5A 4EOGA 3E9CA 2WUFA 4MRNA 1TPYA 1NW9B 4HX9A 2PZMA 4M60A 2CD9A 4OBBA 1YFLA 2CFTA 1Y98A 4KX3A 4AMGA 1P4HA 1RHMA 1UBHS 2W70A 1QV9A 3PNLA 2IP4A 3GVXA 4QTTB 2XCTB 1PT7A 1UQTA 2AI3A 2J41A 4XJSA 3RFCA 5D7NA 3P2MA 3VR0A 5JZOA 2R0QC 3LC0A 5JD5A 2VJMB 1U31A 1UZNA 1XZKA 3POAA 1IN5A 4LXUA 4C6RA 2IV2X 2PMFA 3T61A 1UXOA 2AOTB 3M2PA 2YWHA 1FYXA 1ZIDA 1Y6JA 3UC9A 3VA1A 4ZVOA 2W6CX 2GWHA 2E5FA 1WZUA 3C6BA 1ESCA 2R7KA 3EFOB 2DAPA 3KD2A 3V7FA 1KI9A 3PC2A 4NAUA 1WMDA 2HC9A 2R8YA 3FZEA 2NU8A 1H1TA 2FP3A 5E4TA 4DSAA 1HSZA 4N0QA 2OGWA 3QKIA 5DXFA 3UV3A 1H42A 3S68A 1RZVA 3K0CC 3LIPA 2WT8A 4DMKA 4EATA 1R7RA 3GBVA 5B1YA 4C7OA 4CIDA 4L8VA 4RM2A 1YR9A 3LSTA 3GJ6A 3FLBA 2BZGA 2KS6A 2ZIWB 3JY6A 1CJBA 1D0SA 1VBFA 1BFDA 1K89A 2WB2A 4ZDKA 3WK5A 4CW7A 3ZD8A 4L28A 2BFAA 2JGAA 1K88A 3EK2A 6AT1A 5I4KA 2DLNA 1IDOA 1V47A 2AFIE 1MO4A 4J91A 4YJ2F 2PK3A 4BO6A 5KOHB 2UZ4A 4G1BA 2OHGA 3OY2A 3CNOA 1DC7A 3C39A 1DDOA 4JBYA 3EHEA 2JZNA 2PUJA 4DC1A 3VPAA 5K6TA 2NUPA 2P2GA 5EPOA 3ACBA 2YJZA 4I46A 4NJEB 3U09A 5EG5A 1KFBB 3LV8A 4EM6A 2XOXA 3VH2A 2VVTA 1MV8A 4PVDA 4LRWA 4P4GA 2PX4A 4WK6A 4ZICA 4LYHA 3OAAD 3O0TA 3EZNA 4HB0A 4JYBA 2I2CA 5DB4A 4H7EA 1UBJS 3UCXA 5JROA 4HAYA 5DASA 4R1SA 3TUJC 4A82A 3F49S 3IQFA 3LI2A 3UXYA 3DEZA 4BO5A 4ETNA 2V4MA 5IT9A 4A5SA 1E0JA 1MP0A 4LBWA 4BJ1A 2I2DA 2ZE7A 3PX3A 2CSXA 3KT0A 2DUNA 4AG3A 3RU3A 4OHKA 3V97A 3IXMA 5SY6A 3H0KA 3D7MA 4HAWA 2M6SA 1EX6A 2EX0A 2JGFA 2A0XA 1BHO1 4IQFA 1I3KA 4JLDA 1X1QA 5BN3B 1JG4A 4TKUB 1CEXA 1QYVA 2ZULA 3ZU3A 3JQBC 1TD1A 1TTQB 1RXSA 5TV2A 4HNHA 3UATA 3D59A 1CY0A 2K7ZA 5HCIA 4WA7A 3VDRA 1GG8A 1N2IA 2AW3A 2R79A 4L8WB 1VCMA 4XCVA 4CTOA 3N8GA 3KFVA 5CURA 1CZRA 3FCXA 3IS3A 1IVYA 1H4TA 3GROA 4MVJD 2OMKA 3L9WA 1AXEA 2RFLA 1ACLA 3GWZA 5JECA 2CNLA 2H8GA 3WK9A 3IDOA 1I24A 1Q0PA 4NJEA 3KYCB 2ZYWX 1I4OA 4WXPA 3U3XA 1K75A 4DCOA 4UU7A 2DX7A 5HKLA 1XRLA 5JADA 3LT0A 1LA2A 2IYQA 3AB7A 3E22B 2HOQA 1Y7PA 2QRPA 2CXOA 1E9BA 2PD6A 2VSNA 4HB2A 5BPHA 2GDZA 1RI2A 2HMWA 4IIJF 4R2IA 2PX2A 4AM8A 1ESNA 3QWFA 4EPWA 2QPAA 3TMAA 4F91B 4LYFA 2PX0A 5EFOA 1MFPA 4CUKA 4K9SA 1XWWA 2QZJA 1M34B 1DOZA 2OV2A 3L7KA 3V4OA 1PV2A 2P69A 1BXRA 3PQ6A 2JLWA 2ODWA 4YXFA 2O7SA 1W5AA 1FFAA 2ZS9A 1BD3A 1JGTA 2RKWA 4DS3A 1CQWA 5E3JA 3D31A 2BEWA 3UMCA 3CNHA 2O14A 4ZTBA 4C4XA 3ZIAD 4RHXA 4LOLA 2J4DA 2P9YA 1QGOA 3AU8A 5DLDA 5A9SB 4LF5B 1KDOA 3QWHA 4RZ3A 1IE3A 3VZCA 2FX5A 2HHLA 2HV9A 5GM1A 1N34B 4E0BA 1SBNE 1S01A 3BFJA 3OD5A 4O4LF 3HXMA 2EGHA 1J5PA 1GZDA 3OWOA 2ZXFA 5JV5A 5BW5A 1JDBB 4TWJA 2D7DA 2BCEA 2DVMA 2QM3A 4PQRA 1KQFA 4XIGS 2H1OA 3ROFA 3IQDB 2IA5A 1HT0A 1OIVA 3GFQA 1V41E 1ECPA 4RLSA 3REGA 4CF3A 1D2AA 3TI9A 1XMXA 1VG9B 3EDMA 3M6AA 5H3LA 3G1TA 4LVNA 5JZBA 2ANCA 3I32A 4AIRA 3KT8A 4RV9A 3L6EA 4JR1A 4FC7A 4DRXA 5F98A 1GSHA 5K3FA 5AHRA 2FMTA 5B58C 1WB9A 3MK31 3FNRA 1YA4A 3MUOA 1U0FA 4DPLA 4GGMX 5IBCA 1KEPA 1I3NA 2AWOA 1J4KA 2BZSA 5EHQA 2ZG6A 3KKQA 3K09A 1JLRA 3TQTA 2PGAA 1XDUA 1TF2A 3U7QA 1S2NA 4D45A 3I6WA 3V1YA 2D8AA 2ODEA 4ZQEA 3WXMA 2XZLA 4LGMA 5BSMA 3ZX4A 1SCUA 1ZC4A 3RVRA 3VQTA 3IESA 2G63A 4C05A 4JI1B 4BYGA 2C5LA 3VVCA 1K06A 4G5XA 1YV9A 2ONYA 3DAFA 1J90A 4QARA 4YFYA 1QKJA 3TQOA 4Q7QA 3LD9A 5JXGA 3GPDG 5EIWA 2JIDA 3I6ZA 1IZZA 3HRKA 3WIEA 1NI3A 4AJIA 1DQNA 1AKVA 3ZKWB 1ZGAA 1NY5A 1TMOA 2EKDA 2R84A 4LIPD 3VO1A 4B1FA 1CUWA 2CNOA 3I12A 5I4CA 2RHDA 3E7WA 4GYKA 4LJYA 4TWBA 1T0JB 1I32A 2G1LA 1I4WA 3B5IA 1VMEA 3LOPA 5EMMA 4ZWNA 2PJRA 3GF4A 3PQ2A 2JKZA 5JASA 4EX7A 4PIMA 4PYQA 3FRHA 3B1XA 3K70B 2ZZMA 2PSDA 1XF9A 2P4SA 3U4CA 4R1TA 5JY1A 3S6JA 2IX3A 1W2HA 2OP0A 5F4ZA 3KYBA 5A2GA 1CEYA 1TTHA 2HJWA 3K6JA 4QDZA 3SG0A 3VKVA 5KNDD 4AY5A 4MLDA 3JQEA 1SC6A 3R0JA 2A30A 3UV0A 5C3MA 3DXYA 1QAQA 2X0KA 1CQXA 1OY1A 3Q10A 3MCTA 2XTJA 1QF6A 2GEFA 3SC2A 4YYZA 2YJNA 2GBFA 4P7FA 4OBWA 1VRVA 2ZPAA 4ZJPA 1NOJA 2TYSB 4OXIA 1KVQA 1UKEA 1YHYA 1FRVA 2Q5HA 4GYWA 4FZVA 1YGYA 4OG2A 4RADA 3S1LA 2ZCVA 3EF0A 5KQRA 1QYIA 4UCQA 2RK6A 4N39A 1GHTA 4JLAA 2FV8A 2YQZA 1U5BB 3AUKA 5DO9A 5J47A 3SE7A 1Y81A 3H1AA 4RAOA 5EIXA 1OW3B 1QU2A 4J8PA 2XYRA 5FPPA 2ZYTX 3MJRA 3UB4A 3HO6A 2BR4A 5FO0A 1F14A 1KBQA 4CUZA 3AYXB 4R69A 3V4PB 7MHTA 1N2HA 3KJXA 3G8YA 1QHNA 2G04A 2G3YA 2JFFA 5EZYF 1MXFA 4A7PA 4B09A 1TZBA 4UAJA 1VSTA 4MPTA 2GLUA 2XMBA 2GN9A 2VHTA 4ESOA 4RK5A 1NT4A 1P6QA 1ZQ1A 1YUMA 1EUYA 4BLQA 3QXHA 4RENA 1OFHA 3I2IA 3G23A 3SKYA 1U90A 2WUVA 3KU1A 3V4LA 1OWLA 4FHZA 3LBAA 2VXYA 1A27A 3RDPA 3NHUA 1M34E 1P29A 3T0FA 3FMVA 3KXPA 3OT5A 3PA6A 2J4CA 4C6TB 4ACAA 1P3JA 4Z7OB 2PH3A 1QE3A 1WPGA 1FX0A 1G6OA 4R0NA 3KETA 2F3QA 1P19A 1XPRA 4XDYA 2QTZA 4KV7A 5G3ZA 3IC5A 3BRSA 3SHOA 4S24A 3PJGA 3RAGA 2IEBA 1P9RA 1UZMA 2EFJA 5H7XA 4B6RA 3C8ZA 4ZEOA 1FNMA 3U4HA 3EULA 3N58A 1NW6A 3OX4A 5IKOA 1GUDA 1F7UA 1MR1A 1O89A 4RKYA 4CLDA 3DHEA 1TD9A 3UYKA 2KB3A 2Y2VA 4O2RA 4F5DA 1EAYA 5SY9A 2C00A 3U7RA 4HB4A 5K99A 3AVVA 4Q4DA 1NGSA 1T8SA 5CGQB 5KAMA 3DVQX 2YR0A 2XTNA 3EQ8A 3JSXA 1X7ZA 2WJYA 4PHCA 5JE8A 3ZXIA 2X1VA 1YXMA 1GDTA 2R00A 3LK7A 3CFYA 4DDWA 1H2AS 3AERA 5FFNA 5DCWA 2QPTA 5BN4B 1WP9A 2R6DA 3MC1A 1F2TB 2BGGA 3KR2A 4QLBA 4A6XA 1HEUA 1V3QE 1O94D 2NU9A 4YQEA 4O4JA 1S7CA 4C87A 1G59A 3GHYA 1UPFA 3HM2A 3C15C 4DCCA 1IZ7A 2QMHA 5M7EA 2A0YA 3RARA 1K2NA 1Q5PA 4HQNA 1RQXA 2NXWA 4LAFA 5IK2A 1GSIA 5DGHA 1SELA 1NKSA 2D62A 3GJ7A 4PS1A 1K27A 1NMEA 4YCJA 1L5HB 5AESA 3TN7A 5JJKA 3OEHD 3CA8A 3OX3A 2J48A 4JUAA 4KXWA 1ZR4A 4NBTA 2O05A 2B0CA 2QQ5A 3CB4A 4OQLA 2H08A 2WTXA 1FFBA 1CS0A 4ZQFA 2ZJFA 1M66A 4MR9B 3W1VA 3HUDA 4LY3A 1MAWA 1HYHA 4JVSB 3SR0A 1WPXA 2D3TA 3AP1A 3B6KA 4MMYB 3HG7A 1BYUA 1R8XA 3LQQA 1T3GA 2HA5A 1ZISA 3T9FA 3D6TB 4ISBA 4MVJP 1Z5WA 2OGSA 3LOUA 5JYDA 2PWBA 2AV6A 2ZREA 1HDCA 3JYNA 1H0KA 4JVLA 4C07A 1G8JA 4OFXA 4QU8A 4C5BA 2UUOA 4DIDA 4PAGA 5ALLA 5HX7A 1WD5A 2P0YA 3OOHA 3TZKA 1LY1A 1T8RA 1YZVA 1ZA1A 3EVZA 4XPZA 5T67A 3ZE7A 4CCAA 4HQLA 3TTTA 1PV1A 2PG3A 4RA9A 1DIGA 3RFTA 2C5GA 1C4WA 1TUBB 1SUAA 4HR7A 4QHSA 3ZBTA 2JLBA 5BVGB 2XQKA 5HBRA 3JATB 3WYCA 1NM5A 2PZ8A 4XXHA 4MUMA 3MRXA 3NV9A 2VFAA 2X2FA 3PPXA 4R8MA 1LX6A 3ACCA 1RYYA 1V4BA 1A5TA 1TUGA 3GUVA 3T41A 1OXKB 3N0VA 2C5SA 4NG4A 1MB9A 1NRJB 1SY7A 3ECSA 3ZVKA 2WAAA 5J2UB 3HJCA 5L40A 4PYNA 1BS9A 6REQB 1MUUA 2JH3A 1C7FA 5AW9A 3H4IA 1U1IA 2IGTA 3SEQA 4AK9A 4FMDF 5AP9A 4YR7A 2DT8A 3S81A 3ENQA 3WTBA 1KQGA 3VJRA 3RS9A 4ZN6A 3MVEA 1GYPA 2Q6OA 3KSDO 3LDGA 4M89A 4DIUA 3NZEA 4IX1A 1JXQA 1EJ2A 1NVWQ 1XALA 3KZ1E 4NONA 3M34A 4TROA 2IKQA 5EE9A 3RCBA 1OH7A 2GA8A 2AQ8A 2ZAMA 4FYMA 1G9TA 2ZBFA 1ZRHA 1H94A 4FFPA 4PGFA 2R6HA 1MDFA 1WSAA 4ABYA 4KR7A 2DTEA 3BQNB 4ZCPA 2QA5A 3PWTA 3GCDA 4ZEXA 4DQXA 3ZCXA 4UPEA 1CF2O 2LCIA 4LSWA 2FMXA 2ZFUA 4A8JA 5HR5A 1QP0A 4MH0R 1KXZA 2W6PA 3RTEA 1QJ4A 2QG4A 3HFRA 1DKNA 4I4TB 4WHMA 1E7MA 2QT1A 3TLGA 3TRDA 4JUBA 4HNQA 1VIYA 2XKKA 1M5UA 4PN7A 1JSRA 3AJEA 3LC2O 2FE1A 5ALVA 5LZ4A 4FUTA 1H5UA 2Z04A 4QYTA 2ZYHA 3OU2A 4DJFC 2CEKA 1PT5A 5BT8A 2XADA 2AVNA 4MCIA 3W8FA 1QANA 1L5QA 1TCCA 1U0EA 3OZTA 3WDMA 1T9GR 3HU2A 1NVTA 1U1EA 4N5MA 4CIWA 4Q03A 2FZ4A 3OH8A 4X7RA 4V0RA 4CMIB 1NNEA 1XTKA 2GHIA 3VPYA 3SZOA 3D4LA 3X1YA 1P5HA 3S2EA 2FLWA 1KH3A 2F43B 2C59A 1Z0UA 4EHBA 4ENPA 3MM4A 2R6R1 2O0LA 3NWPA 2VP9A 3PC4A 5CM8B 2ZSHA 5DM70 2GILA 4XYBA 4GXTA 1VJTA 3C87A 3CXUA 4POAA 4LYYA 3WADA 4BNUA 1UT5A 3VTKA 1S2DA 2J3JA 5JD3A 4GIBA 2AJBA 3O75A 4MRMB 1C14A 1D2MA 4NU8X 5NLLA 1N1MA 1FFSA 1PT6A 3UNNA 5LC1A 4BB6A 1EGVB 1QCCA 2LUOA 1GFZA 1J21A 4KVFA 1KAMA 4JSTA 3MMZA 3RJ9A 4LKOA 4F21A 3KPVA 3QU4A 3FCYA 3H2BA 4HUQA 1PE0A 4I08A 4QPCA 4G0OA 4Y6RA 3RJZA 3OUNA 4DR2B 1Z0KA 1HE4A 1K4KA 1VC2A 3H9QA 2NUPB 4MP8A 1P1HA 1ZM2A 4CEHA 5LLSA 3OJCA 3U37A 3AM1A 2Z6VA 5JJIA 3LOQA 1U3GA 3PQ7A 4ENQA 2XD4A 5EMNA 4I55B 2O2ZA 2CBZA 3KALA 4ZCQA 1MLDA 3KV1A 1KARA 4QPZA 3Q3VA 4M1ZA 5JG7A 3VFDA 4BN0A 1MABA 3RYIB 3VAZA 5FCDA 3OJ0A 1RBQA 2CL7X 3IR7A 4V0SA 2YNMA 3WGZA 5JSZB 1NHGA 1Z8NA 2JFUA 4LECA 1GTSA 1UP7A 2EW2A 1W5FA 2DFNA 3A9TA 4HEHA 4HH4A 2M6LA 4ZFNA 5KB3A 3D6UA 2H1SA 5E4FA 5KX5A 4AWBA 2H06A 3MJHA 3HVRA 1PJ3A 3JS5A 4JC4A 3ZJVA 2EKBA 3UUGA 2HH9A 5FV4A 2I6TA 1XZQA 3I64A 5HK8A 5HQJA 3LLCA 2CL5A 1AK1A 2Q3HA 1AF4A 1WNFA 1HE3A 1NVDA 5K9ZA 4FM9A 2P6PA 4AN0A 1QDLB 5H0IA 3ISVA 1KYVA 3DR3A 1Q11A 2LPMA 2DBYA 3DDZX 2NO7A 2K7FA 1TRHA 3K9CA 4WESA 3DBLB 2GR9A 4MKZA 2XTZA 4DHEA 4M9UA 3LNCA 1HR0B 2PZLA 1J7JA 3OG9A 3ZU5A 1D3AA 3QUBA 1EUCB 2A94A 4YUYA 2VBGA 4KLRA 3LGXA 3M1IA 5IHPA 4PHFA 1ZNQO 4YMTA 1A2BA 4TT3A 2V3VA 5HA5A 3V5NA 3OEYA 4GAEA 4QXPA 1PTKA 2CNWA 4EJSA 1W5SA 1LDBA 1U0JA 3CN7A 3MERA 4Y6QA 2V96A 2WWVD 4RPJA 2O6HA 3G8BA 1GDHA 1PFGA 4FMCF 4OUDA 4Q1BA 4OFZA 3SJ7A 3LQKA 2DEUA 4E5DA 3QEBZ 4WKOA 3DYIA 4EMBA 1G98A 1O9BA 2HIMA 3NHJA 2CDBA 3H5NA 1YSCA 4RMJA 3JAWB 4OP1A 4OP2A 1J2RA 3V4ZA 1KRXA 3E03A 3PCXA 2A1TS 5K6AC 2XYGA 4RGVA 3ZZUA 3FUVA 1NX9A 3FI0A 4Y7DA 3P1JA 8OHMA 1NQ5A 4HS9A 1XHFA 4AX4A 4MLCA 1Q7EA 3HWSA 3RO7A 1G60A 1KMIY 4B3SB 2NP6A 4CQMD 1R10A 5FPYA 4H6VA 3H13A 3THWA 4J03A 4V38A 2WUGA 4D9IA 4FZ5A 5LIPA 2ZJZA 1U0BB 5JARA 2G09A 5DF1A 1MW9X 3S2UA 3H3XA 4B3XA 1INLA 4AWXA 5FI0B 2HF2A 1DIBA 3F74A 4CM4B 5CH8A 1XTTA 2J0UB 1E99A 2HIAA 2JBAB 4JZYA 1O6GA 3FJYA 3QPVA 5CUQA 1I2MA 3RG8A 3WK4A 3E9MA 1OZAA 4E7OA 3B1WA 4DAOA 4XGIA 2R1VA 4C3OB 5SZHB 2FUEA 2P7IA 1JHVA 1H3NA 2IEAA 3FA2A 1F1JA 2QJWA 2UAGA 4D3SA 3AESB 2W90A 4RPLA 1YCHA 3R7DA 4X1OA 5DNWA 4OUDB 3LWNA 5H9VA 3EY9A 4ZEVA 3AI3A 1QVAA 2F55A 1RWPA 1JQKA 2PX3A 3H83A 3ETCA 4EPVA 4C2UA 1D9ZA 2FR0A 1TEHA 1UOOA 2N9UA 3IAHA 4WZ6A 3B85A 4FLMA 3PXDA 3B38A 3DT9A 4FOLA 2VDPB 5C4MA 1QIFA 3KHUA 2WAYA 2H4WA 3EDCA 3QFRA 4LVCA 2QVZX 3OESA 3ST7A 4IZOA 1M8GA 1UKVY 3K92A 3RV4A 3HBFA 2LDBA 2FNAA 1XL0A 1LKZA 1V5FA 1X1TA 1U7DA 2GJ9A 3NAZA 5FRDA 4BP9A 5KNLA 4EUSA 3LDHA 1FC0A 2ODQA 2H2GA 4G97A 4WZBE 2GCEA 2IEZA 3KWMA 3R4CA 1BRTA 2ATXA 2Q3MA 4Q4JB 3T99A 1NF3A 4RGYA 3VSEA 4NICA 1T1JA 2VRCD 4Z0HO 4CM4A 3MPUA 4M1TA 4IL5A 1DLJA 5JD6A 2ZB8A 4I9HA 1PD0A 4BUZA 5BUZA 1D7OA 3K1TA 3M3PA 3QLUA 4RIEA 3T15A 4AAYA 3D81A 2R1VB 4UHKA 2POCA 3FX2A 2WMYA 1DMRA 1HYQA 2JGIA 4YONB 3CVXA 3I9NA 1NVXQ 3OWHA 1LU9A 1N78A 1PX0A 3O91A 4JP5A 3QUCA 5D00A 1AUPA 3D3EA 4OUKX 1ZH0A 4Q7KA 1NTOA 4Z9AA 5AXAA 1V6SA 3FPFA 5C0OE 3VR4A 1F2UB 1XA4A 4IHQA 4DDVA 4EJMA 5KEIA 3EGEA 4TUYF 1UKYA 1ZICA 3RH0A 2RKBA 3WK6A 3NATA 3HTXA 2P2DA 2ZQYA 3MWGA 3GDGA 1QO0D 3SJUA 4E5SA 4L0MA 3N0WA 5J4KA 3WTCA 1OAKA 5GMOA 4FYHA 2O2GA 3DOCA 3S1SA 2W11A 1R4MB 4N3GA 5F35A 1J2FA 4DMCA 4OAPA 1HNNA 3GGDA 1FBTA 1JFFA 1MO5A 2ZUVA 4KGXA 3SBOA 1I7PA 1A9RA 5KNBH 3FWHA 2FSHA 2Q4TA 4LZPA 4DTIA 1W1IA 1LF5A 2OHXA 3OETA 4BX9A 4LVUA 1LUAA 1P60A 3PHHA 1IU9A 1HUQA 5K8VA 4B2LA 4O3MA 4KXXA 2P9QA 4WRRA 2P1ZA 1TO2E 5ITVA 4X84A 3MTQA 2B5OA 2BI8A 4IIUA 4R31A 5TC4A 1QO0A 3UBMA 4BB9A 4IVPA 1UMDA 2QYOA 3C8MA 1R4AA 2OOSA 5LZ7A 1FXUA 3ZLTA 5CIWA 2OCLA 5GONB 1RWOA 1FS5A 3VR2A 1G21A 5JYEA 1JHUA 1NN1A 3C6QA 3WIDA 3T7JA 1U98A 3C48A 1G0NA 3IPYA 1VLQA 4DJEC 3THXB 3H2YA 1DQSA 4YO7A 4UVEA 1DKRA 1GQQA 1ABEA 1T0HB 2PSSA 3N5KA 4DJDC 1X7YB 2QP3A 5CCXA 4ZCIA 1AQ6A 2ILVA 1PG5A 1QR2A 2I1VB 1GZ3A 4JQCA 4AUKA 5EJ8A 3LUCA 5I7EA 1GZSA 2I6SA 2IYNA 5DSXA 2R8OA 1H2WA 4PXYA 1EI9A 3IDSA 3TM4A 4J9VA 4C78A 2ZBPA 3FPGA 1RAGA 2XQVA 2PL5A 3UCFA 4XSVA 5DCLA 721PA 1D04A 5FWYB 1WZ2A 3R3XA 4BNYA 1S3FA 3KPJA 3D3QA 5DHSA 4YQZA 1Z4PX 1VIMA 4HYEA 3VPDA 3HJHA 2Q1SA 1Q20A 2ZE8A 1YGSA 4QREA 4PANA 5BWMA 5KMGA 1CQJA 4H1HA 5LOVF 1USUA 4CM8B 3IT1A 1WEKA 1LI5A 3MWYW 4R1NA 3RSHA 3TGLA 5D1NA 2Q2NA 1YJ8A 3PK0A 5L8VA 3EA4A 3MW8A 3N2GA 5EOVA 3I9V1 1U8ZA 2HY7A 3DCNA 4LRYA 1JRLA 2AMYA 1WU8A 3EIFA 4KSBA 3ZS9A 3A9SA 1LDMA 3FTCA 4TL9A 2BSAA 1NV9A 3I52A 1LQTA 4JLJA 4ZYYA 5JAZA 5LPNA 2V3CC 1K3QA 4KQJA 1BVYF 3G5TA 1HYEA 4REQA 1C50A 3S44A 4K9QA 4OV6B 4AMBA 3NBMA 3PT5A 1TNDA 1L7NA 2FRDC 4L76A 1OTYA 1JKMA 4DR7B 3OTQA 2PFSA 1KO1A 3CWZA 4GF5A 5IU6A 1X7YA 3ROTA 1E2KA 4PZAA 1DFHA 1J8MF 1NBEA 4IWYA 5HIKA 1FUYB 1VJCA 4OD0A 4MRAA 3WZ2A 3F9RA 4LXXA 2A0UA 1GP2A 3NTOA 3SMQA 1SXPA 2VP2A 1OSNA 4X90A 5CNKA 1QKIA 3TG2A 1IEVA 2DT5A 3FBTA 1XP5A 3KUUA 3DMDA 3IEPA 4Y2SA 3I2JA 3IE2A 2ENWA 3PWSA 5DN6A 4C0XA 5BQFA 4CQNA 4GMFA 3KR0A 1AKMA 2IZZA 2OESA 2L42A 3I1FA 5C34B 5K0FA 5K45A 2C5EA 3K6SB 1S3SA 1W6UA 4HVTA 2I7TA 3M5PA 2PQ6A 1AGNA 1JMVA 3OCJA 3OQPA 5G0TA 5B4UA 4K0KB 4BE9A 3WISA 2PSJA 4RL4A 3E8MA 4QPJC 4L2IA 1CFJA 2QRHA 2V65A 3N2GB 3ONWA 3R23A 4TRNA 4BLRA 4D3YA 1MR3F 5LQNA 2REQA 1FFHA 4HDMA 4CBVA 3TLBA 1BXRB 1QO7A 2VBCA 1PSZA 2PKCA 2ZIXA 1KTVA 3FSEA 2PVSA 2D7JA 5EE1A 4RFSA 4AIIA 3NGXA 5JSUA 2HSEA 3E27A 2YXNA 4G6ZA 5B58T 5BVGA 3K72B 1JEDA 4Y1RA 4HDAA 5T4BA 1KWGA 4B3IA 2DUJA 1DRUA 1VGQA 1WBJB 2FXVA 1WE2A 2YASA 2OKGA 4R8SA 3WWZA 5I9LA 2Z09A 5ILOA 3X44A 4BBZA 3ND6A 1KGSA 4V0OA 1CVIA 2J4FA 4URVR 1NXSA 2ZR7A 3CQ9A 2J0EA 3OTWA 2QM8A 4NIMA 4YUWA 3ANSA 5TF4A 4LYEA 3G7SA 4EA7A 1FXWA 5K3EA 4AROA 1Z2AA 3ADDA 3RKRA 2EWWA 3K2EA 4BMNA 3G2LA 4KCGA 1NM5C 3NKLA 3T5DA 5K0TA 4UEKA 1RBYA 5TIIA 1KK3A 3WDLA 3BJEA 4E7PA 2C61A 2HA0A 1QNFA 2X1MA 1G3QA 4K2HA 4C7MA 2BCJQ 1CUSA 3I39X 4JYZA 4WBNF 4A91A 1VB5A 1U9ZA 1JSXA 1PEDA 2XH8A 2WTEA 4AW9A 3PL5A 3KZMA 2JCGA 2O3RA 3K6RA 3RKSA 3RSFA 3MPOA 2IC5A 4WK4B 2HCTA 7GPBA 2JFQA 2VHCA 4MQMA 4DSNA 4F72A 2PGXA 4JBIA 2X0DA 5C8XA 4GEGA 1T2NA 3GT0A 2ZI3A 5FV7A 5IT4A 4EHHA 3K9GA 3MB8A 2C7BA 2RGCA 3BMXA 1SWVA 2GO1A 4U7WA 1W4LA 1YB4A 4Q5IA 4GZ6A 1M74A 3NS7A 4RE6A 2G08A 2SKEA 5KUTA 2B6HA 2XNKA 4KXUA 1NUUA 3UWDA 4G8JA 1KJIA 2PNFA 2R9VA 4LSGA 2Q27A 1QG0A 5EHZA 2PKYX 3H1PA 1JDSA 1G42A 2WV7A 2L0XA 3A6FA 4HKTA 3MB5A 3ET5A 5KBYA 4KQGA 1HMPA 2D1FA 1HDXA 4JDUA 4OM8A 1W96A 5IH3A 3U4AA 1JYSA 2C3PA 2H2AA 1PFYA 1T6YA 4C14A 3OM1A 3V9AA 5A4MS 4ZIRB 2X8WA 2PJUA 1AXGA 1SCKA 2FWIA 3QWBA 4D0RA 4GP6A 4HAZA 4ZT6A 1N57A 1XVUA 2QWXA 1ZAYA 1E9FA 1H66A 3L8HA 1DC3A 1C8BA 3OZWA 3QY9A 5FPSA 1GV0A 3CRMA 4R1OA 5BMVA 2X0EA 4MVJG 5G4KB 3E9RA 1KHHA 1UBTS 4KFSA 2I8LA 4ZZ0A 3A4TA 2GAFA 1KAGA 3TTUA 1USKA 3HUTA 4DT1B 1ZINA 3SC2B 2RHTA 4EW6A 3QM1A 4BTLA 2QX9A 3WOHA 5IEBA 1L4FA 2HT1A 3STWA 3C6YA 4ENRA 3KQUA 2WJGA 3HP1A 2VDQB 3OX2A 4FFVA 3A6DA 3MBOA 5DGCA 5KZMB 1ZYUA 1NF2A 4Y9UA 2ZBQA 3V1NA 1CYEA 3LA8A 5K0EA 4TTVA 5F3RA 2F1OA 1R6AA 1RI5A 2VUTA 2JI6A 3I4CA 2A35A 3QVGB 4JZKA 4Y0AA 2JHGA 3AI2A 1NNI1 1P9LA 1V37A 4FOTA 3QNUA 4FTWA 1VPLA 1B8OA 1KXJA 4FYJA 4FSXA 5K0LA 1AT1A 2C95A 3HS3A 3IBTA 3VOSA 3A9RA 4H6WA 5HFAA 2EZTA 3KLOA 5CJPA 2JVKA 1PK7A 2ECFA 2PS3A 2X5XA 1WDLA 3P52A 4MEAA 4W7IA 4E2XA 3ZVNA 1N1GA 4NE7A 5HDQA 1WBBA 2FG7C 1U7FA 2HT6A 3DPUA 1IG3A 5FB3A 5EJGA 2ORYA 4MWOA 1KZ4A 1VSBA 2UZ1B 4LW8A 4MS3B 5B64A 5BVHA 2D00A 1A2KC 2H17A 2W2LA 3TEFA 1G3UA 2WWHA 5DX0A 1GAXA 1Y82A 4EEXA 3OO0A 1WSBA 2JD1A 1DT5A 4OI0A 3F47A 5ELLA 2FUCA 2OZLA 1CR1A 2ZRAA 2OORA 1UIRA 2CEAA 3CXRA 3A6LA 4G0XA 4TQ9A 1NE2A 2HK9A 2JIRA 1WMBA 1QZTA 1E92A 4DZZA 5FTJA 1XTIA 3EDQA 2SKDA 1S9HA 4ZREA 5IAKA 5E6UB 4EABA 5BSWA 1JIIA 4YV7A 1LDGA 1R37A 3L8GA 1KPIA 1NBME 1UFKA 1U1GA 2CE7A 1E6EA 5A9TA 1XNQB 1NN5A 1VECA 2Q99A 4PPQA 4GBJA 4PYJA 2IY9A 3SEFA 3SYNA 3VR5D 5ECYA 4HNVA 2ZSEA 1AU9A 1ISRA 1EFVA 1F6BA 2P9FA 3EW9A 3IO3A 4ZPXA 3KR9A 2HX1A 2FF4A 4YA6A 1K3FA 4GX1A 1GUYA 3IJPA 5HKBA 1BW9B 2RCNA 4E46A 3KL2A 5L6LB 4CT4B 1SURA 2QROA 5D6NA 1P73A 1O54A 5I7OA 4KHPB 2WY2D 1KMHB 2HWUA 4K9KA 4NMLA 3EPPA 4WKBA 3TX2A 3W04A 1GO2A 3A6JA 3KG2A 3NORA 3TW8B 4BC0A 2QTWB 3R2JA 3NYWA 2F3PA 4X3OA 1P2UA 5GWXA 3WYBA 4A0GA 4YJ2A 1P0QA 1XXHB 4FFMA 3KJZA 4UEWA 4MDEA 4MB6A 3AG5A 4RJ2A 4ARSA 1BU5A 3IP3A 4BQPA 2WR8A 4UEQA 3CEPB 4RZQA 1BZYA 3S5JA 3ZE2B 1DFIA 3G0IA 5LKRA 4F06A 1N36B 2GCPA 5GGYA 2YIMA 2E1PA 3NRBA 1L5NA 5L6MB 3OPQA 1CSEE 2BGMA 3CR3C 3CMMA 4P7KA 5F33A 4R2HA 4QYXA 4IPTA 4UNPA 4X20A 3ZY2A 5JXJA 2Z6QA 3FOCA 1R4NB 5A9RA 4R8KA 3SOZA 3UGQA 3BE5A 1D1PA 2XWBF 3II6X 3HV0A 1FZQA 1NY6A 4JD5A 1YGPA 3LUDA 5AXCA 1SOUA 4KLAA 1W6RA 4A16A 3AOEC 3E3NA 2PLRA 1T1GA 1A9YA 1XD8A 3LCUA 2I33A 3ZYCA 3R7NA 4ARBA 2XA2A 3GYGA 4W8OA 5LUBA 3D9QX 5U1PA 4IMIB 1ZIXA 1B8PA 2Y6VA 3WGJA 4BKPA 5BNWA 5CDSA 1O94A 4MAAA 1JI3A 1ECLA 1RJ9B 1RLIA 3E1GA 3N59A 3QUAA 1RJDA 3DG9A 4KPEC 5L3SB 4LZJA 2C7QA 1Y8QA 2IU3A 3AOGA 5ERYA 3CX7A 2BEUB 4TTJA 4V24A 1XRPA 2G9QA 1WHTB 4Y30A 4L07A 2G40A 3BIJA 4BTEA 4E4YA 4JIVD 2C84A 2Q8QA 3F46A 1UK8A 3ER8A 3K9QO 1AKRA 4KH0A 5AHKA 4LZNA 5A7HA 3KM0A 3ZWBA 3I5XA 3DXXA 1F4PA 4G25A 3KKOA 3BFKA 1M0EA 3PDIB 3O73A 1L3BA 2AYZA 3K0EA 5ARBA 1V8DA 3R8FA 1E64A 1KQPA 2OWDA 3V8BA 1E5DA 2HN9A 2ODBA 2PQ2A 1JA0A 5JDCA 1VA5A 5EESA 3WIBA 1WETA 3GRZA 1CRZA 3KAPA 3EIWA 1US8B 3PE3A 3EDYA 3AVWA 5JWHA 3SKVA 4F97A 3QU9A 2X8BA 3MD0A 4KG7A 4Z0NA 1E61A 4PLCA 521PA 4B6OA 1UINA 2EZ9A 3HCRA 3JQPA 3BXGA 4UHDA 2OBXA 4U9UA 4DJTA 3HN6A 4ZQGA 1Q77A 4HFMA 4BMZA 2DQ4A 3AW8A 4M0PA 2O8BB 1Y9EA 5FNVA 2I1LA 2XGJA 4I1VA 3DJFA 3HO8A 4XJXA 5LLTA 4HHEA 4U1RA 1OA1A 4R5MA 2WP8J 2C9MA 1IM8A 3G8DA 2HBZA 3E22A 4O2AF 4YP5A 1BWRA 3NV7A 2A0TA 3UXEA 1NXPA 2QW0X 3S70A 4A2PA 2JK1A 5AW0A 3WLAA 1YB1A 4TYMA 4Z53A 2ZB2A 5JAHA 1DG3A 1E7YA 3JRXA 5CB4F 4UTXA 4KUEA 3B52X 4JOQA 1E9AA 2JB9A 4FI3F 3V2GA 4DV2B 3HNPA 2QX6A 3E9YA 4JB8A 4XKJA 4BNXA 5KPDA 4OYHA 5CNMA 3WYNA 4PZ0A 4HNSA 4GXNA 3BWEA 4ZZIA 1A8HA 3PDIA 1V1JA 4BNTA 1EXMA 3D7SA 5AI9A 1FW6A 1DBWA 4A73A 2OV4A 2DKFA 2IOFA 1U3TA 1CRQA 2Y1LA 3Q7IA 1D2HA 4ZQHA 2VDOB 1SIBE 4EZIA 2H18A 1NQUA 4V3CA 1PQ4A 4M0MA 3VHLB 4ZVSA 5FBKA 3VZRA 5LDDC 3UWKA 4PYMA 1QBKC 1RQPA 3FYUA 3DZFA 2DB3A 1T0IA 2C94A 3ESCA 3QPBA 4AJNA 4BFYA 5BNZA 2WW8A 1LNSA 1J99A 3V4FA 4NNJA 2X76A 3G1UA 3EIEA 2JFHA 4G0ZA 4U4AA 1Y5LA 5K3FB 4ALJA 1RAEA 2BGRA 1U8AA 1T34A 2WILA 2WAOA 1NW5A 1PR0A 1T3ZA 3QE3A 4RMNA 4HLDA 3ERCA 1ONPA 4MKXA 1PEYA 2DFDA 2N1MA 3KUCA 3LF1A 3QFSA 1BWPA 4G5FA 4K5QA 3OEHA 1SKAA 4EG5A 1DJMA 1V3VA 2JJMA 1Z5UA 4URUR 4YUVA 4TKVA 3A36A 1C80A 3F7TA 3LWZA 4ZTZB 4J4BA 1UBCA 1C7QA 3Q1KA 2D74A 2KBEA 4OKNA 3TJMA 3ZGNA 5BSGA 5CA0F 1N0HA 3TCKA 3GAAA 5ICSA 3J7AC 1VFPA 3DFUA 4WOCA 2VP5A 4I55A 3AVOA 1ZVMA 2UXCB 3WQHA 3W5IA 1WLSA 5JVDF 4UUBA 4Z1MA 1IAQA 5EZYA 1ZOPA 2O50A 3FOAA 1EE9A 1T9BA 3JYQA 3TQSA 3RIGA 4BLSA 2OHHA 4HQRA 4C4YA 2FN8A 2O3SA 1EP2B 2PZKA 2FFQA 1KH1A 3U1TA 4ZJYA 5M34A 2IZ5A 1GAQA 2E55A 2G6BA 3AL0C 2QN2A 3ISTA 5KX5B 1Q1ZA 3FYUB 5L7TA 1Q84A 1YDGA 1J8QA 2JCYA 2OZPA 3QITA 5DBEX 2XUJA 4ERXA 4M55A 5JS1A 4M1MA 1JR2A 4RLFA 5DBOA 4CV0A 1T8WA 2BCGY 3ANYB 5KYYB 3H04A 4UW9A 2ZAIA 1C4OA 4IDBA 3AGQA 3PJRA 2C2XA 1T8PA 1F8GA 1EXWA 4YRBA 4XOIA 2R85A 1W93A 2GRUA 3AU9A 4JWTA 2ZSDA 2IGBA 4TLMB 4ZKEA 1V7ZA 4BV8A 1RT9A 3H8JA 4Q82A 4E5PA 4Y1GA 2CDRA 1C4KA 4JJ7A 5J40A 1HDRA 3V3TA 1JJBA 2ZW9A 1JKJB 2EJVA 2F8LA 4FMBB 4RK7A 4RORA 5NULA 4A6EA 1UDRA 1YOVA 1OHHD 1U94A 1SVMA 2Q9BA 1G6GA 4M36A 4X44A 4XVHA 1OH6A 5HCNA 1YD7A 2NV6A 1ZJJA 2XHZA 1AHHA 2I29A 4B3JA 3PC8C 4C3VA 3G8AA 5K6RA 1KEKA 2HV8A 1U5BA 1JAYA 2FEOA 1O8BA 1I1QB 4WXYB 5J58A 1EBBA 4J16A 2K87A 3CYFA 4FMCB 2XA9A 3JARA 5JCXA 3EXHC 3HLKA 5AKKA 4EY3A 5DSZA 1BVRA 1A9SA 4DOMA 4OHOA 1AMOA 3N5CA 5IASA 4TL8A 3JRWA 3U7QB 2YJTD 3VX3A 3WGLA 2BFWA 1CNEA 4MHSA 4TYNA 3O8QB 1YQWA 4GKJB 3U80A 5ISMA 3C4VA 5E1DA 1HWYA 1NX6A 3NDJA 3RUEA 1WKVA 3NM6B 4L27A 3O3MB 3EJ6A 4NECA 3T0IA 3A3OA 2SKCA 4B2PA 3M89A 2HZBA 4JNCA 2IH4A 2O3TA 5JS6A 1XCJA 3D54D 1C0KA 1LQUA 1G8YA 2XWQA 3HWX1 4JKOA 1GQYA 1VSQA 4FYVA 4CDGA 2YRWA 3AIKA 3IVXA 4C6TA 4CTJA 5EJEA 4Y18A 1CP2A 4BLVA 1JALA 4G37A 4A0RA 5LFAA 2PRYA 3VH4A 5JELA 4MV3A 3Q0TA 4PC3A 3T12A 3LXMA 3TOSA 3C4QA 1U1FA 4BKRA 3NVAA 1DIOB 1HDYA 1TZCA 3QFTA 5DRTA 1CUVA 1GNTA 4L5CA 4OK5A 1TYBE 3WK7A 5IXSA 1USGA 1JFTA 3USZA 2QF7A 3SXJA 2R48A 3IEXA 3JVEA 4TTRA 2IELA 1Z75A 5IJ9A 1GUZA 4D9BA 2UZ3A 3DUWA 1MEJA 3L3BA 3P4XA 4FX5A 5J23A 3NWBA 3CW2A 4LE1A 4MB2A 4YI5A 3THRA 2J5BA 4UTNA 1Z4MA 2IBMA 3GA0A 4P7BA 3TQFA 5DTJA 2JG3A 1UOPA 5DDIP 4Y0VA 2ZBUA 1WZCA 4JT9A 3BZUA 4MIOA 5DEOA 4M87A 4P3NA 3IXQA 3L7DA 2FEKA 1SUBA 1ZSVA 1E9DA 5HMMA 3WAJA 3D4NA 5CTAA 5KC8A 4YCAA 1QHGA 3QE9Y 1VE9A 1KAQA 1HY3A 1S8FA 3RRBA 3UMYA 2UUAB 4KOAA 2VZLA 2XT6A 3OOWA 3PI7A 5CH5A 1YO6A 1C3EA 2KMLA 2X2PA 2FMUA 2LXNA 2XB8A 1WMEA 4FU0A 1G3IA 2PV0A 4W63A 5TNXA 3Q87B 5L51A 2P1RA 2QSYA 5LQUA 3KTAA 1P17A 3OJOA 3QVWA 1WQ3A 3AEKA 3N7UA 4MA4A 2CF6A 4IHKA 3W6ZA 3BHNA 5CXQA 1EWKA 1XTQA 4IX9A 2PJZA 4BQSA 4ZHQA 2ARKA 5A05A 1QGUB 5TRTA 1S3IA 1T29A 3MUNA 4YRLA 3X1ZA 5JQWA 3COPA 1N5DA 3M1LA 2NYRA 1F4LA 2PUHA 3DMNA 3EGCA 4B87A 2FLKA 1G3RA 1TO1E 1U0GA 4DLXA 1Z7BA 4R51A 5KWJA 1CS4C 1X80A 1PTJC 3RYCB 3W2IA 1TGVA 1XTVA 3LCRA 5CEJA 2ZBVA 1SK8A 4A4YA 3PVCA 3NEAA 1NU8A 4N0EA 3SIXA 4DILA 2WDPA 4GVXA 2XCOA 1U8XX 2Q3FA 4UCFA 3HDYA 3AVQA 4MYDA 5ICFA 1PUXA 2VLBA 1GSOA 3IAS1 3UH0A 5FUQA 3BSYA 1MJNA 1DARA 3EISA 1JB1A 1JHRA 1NNLA 4QNMA 3ZIAA 2AF3C 5K3OA 5EXPA 4EHFA 1AVTA 1K4MA 2AD5A 2W9XA 1QF7A 2FETA 4F9FA 2G25A 3E84A 4DC9A 4MV1A 4H31A 4RY8A 4JJGA 4DRZA 4QELA 3BKXA 4F8JA 5KJEA 4AJPA 1EK1A 1L7XA 3MDBA 4IHJA 2CUZA 4NR0A 5E6RB 3I6QA 3V7UA 2AN3A 3V34A 6REQA 4MP3A 2H92A 1N9KA 4MB0A 4ND8B 4WLUA 1ZUHA 4PQYA 1NZDA 3HUUA 4BDSA 3MJSA 2FZLA 3TAUA 4AXXA 5C7OO 1C9KA 1UEIA 2GD2A 3Q8WA 4AVYA 3ULKA 1WD7A 1S2LA 3H2IA 3NETA 3SBXA 4DARA 1CJSA 1YIAA 2R68A 1XMIA 3KTOA 1RC0A 3LUJA 3U3OA 3W8NA 2PANA 1ISHA 1ZIPA 2QVLA 3ID6C 1VHQA 2QGFA 4PSKA 4UMDA 6PFKA 4RKRA 4WL0A 4QRHA 3BSWA 1NOIA 1WKCA 1LGYA 4PQEA 2YZ2A 1GRNA 2WLTA 1TXGA 5B37A 5EZQA 4GO1A 4EY7A 2Y4OA 2VH5R 3GCZA 4RQBA 1YMVA 4HZUB 1RC1A 2GGSA 4NENB 4DW8A 1GUAA 4XIFA 1GLNA 4IS3A 1PHRA 1M2NA 4OFWA 4MQEA 3E5RA 2Y2UA 3I72A 4FYIA 4FP9A 3BRCA 1RC8A 4EVRA 1QG2A 5AI0A 4DCMA 1QH9A 3KL4A 3ZW9A 3LUFA 3MINB 2FP4A 3TS1A 3PGVA 1N5KA 2Q6VA 4H4DA 2HKIA 2ZKIA 3CEMA 5F5NA 2OO3A 4AULA 5JBIA 3K5WA 3FWZA 2C1ZA 4D26A 1SUFA 5LA6A 2ONCA 4YIHA 5DXJA 5J4HA 2ACWA 3K0AA 2Z43A 1NPYA 1GCGA 1MVNA 1E8DA 5GY7A 3LTNC 1TYCA 3A2LA 4HD8A 4IDGA 3SSNA 1XDDA 1ZMXA 1QOPB 4MP6A 3U7HB 1BN7A 4MYHA 4RKQA 3KNZA 5B4VA 2I6GA 4H1VA 4HL6A 3V7YA 3KOWA 4ZOAA 5CDHA 1LX7A 4KQFA 1KU0A 4UM8B 2BBTA 2QY9A 1JT9A 2ZIZA 4ZZ2A 1IY9A 2H85A 2DQKA 2OKCA 4P0TA 1EAMA 1OF1A 2P6OA 4DMFA 1TDJA 2MHCA 2GM3A 3OCWA 4PINA 4IH1A 4HQFA 3BICA 2B37A 2HJRA 5TT1A 2HQSA 3KZNA 3FGOA 2NADA 2EKQA 1USIA 5AK3A 3CTPA 1NBOA 2H00A 1Y3FE 5IAOA 1WW2A 2XCUA 1M7BA 5F2KA 4OA8A 3VPSA 4H7DA 3K6SA 2ISQA 1QIEA 4GPD1 1RZRA 2MMGA 5EWMA 3W8EA 2HGZA 1ATIA 3FYTA 3MT9A 2WUEA 3AY3A 1HNWB 4G4GA 4WZBB 1SOWA 2WKPA 4B81A 1DX6A 4BDTA 4DQVA 4YCNA 1B26A 1MF7A 1NONA 1K3JA 2CLLB 3HJAA 3Q5GA 1H85A 4CU2A 4DDUA 3GCXA 1KEZA 5AVOA 1G7SA 3CV3A 3OPVA 3L93A 1DCTA 1ETHA 2P6UA 4M2LA 4Z7JA 1X92A 3BERA 4UFOA 3EG9B 1J0CA 3DKVA 1TFRA 3D64A 2Q3BA 4PYKA 2PGNA 2BTQA 3NAGA 3HKDA 4KTTE 1JKIA 1BFKA 3W9BA 3GEDA 2B4KA 2G8LA 1MOQA 1SIOA 3RANA 3X1MA 5HZKA 3QH4A 4J07A 4WDQA 1ZM3A 1CUYA 3QU2A 3TSZA 2BKXA 3GMSA 4AMUA 4U00A 3OWXA 3PCTA 4I4TF 1E2DA 3QYFA 5KNCH 3MAJA 1FDSA 1XHEA 1TIPA 2H7VA 3H8VA 4ZEWA 2RI1A 3ZLBA 4YEDA 1DJNA 3H2HA 4HNGA 3RVBA 2ZJ0A 4KN8A 2JIQA 3QG1A 4UATA 5I8WA 1E62A 3M3HA 5KX5F 4HNRA 1URPA 1W76A 3LHSA 2AZ4A 2O7VA 4MS4B 1U7TA 4Q47A 1B1AA 2D5BA 1FLNA 2ISCA 3C1UA 3DL7A 3PQ3A 4U7PB 3SJCA 5EWMB 4ZMRA 3TFOA 2O4CA 3TIGA 3GZ4A 1WTCA 3PBKA 1RPAA 1WL8A 2ESRA 2DHQA 2WSYB 2Y1CA 3EAGA 1RDFA 1K0UA 1RP1A 1RLMA 2QD5A 3IHLA 5HJ2A 1L4GA 2RMKA 2AN4A 4KH1A 5GJVC 3CVYA 1M10A 3P9IA 2VHZA 5ALRA 4GMXA 4I1IA 1BCRA 1YTUA 3KSRA 1TLTA 5TPWB 2VYNA 3UW1A 1V9SA 4CM9D 1MX3A 3UNMA 1R12A 3SJAA 1F12A 2XNCA 3I5MA 3I62A 2FUKA 2PIDA 5T7BA 1DX9A 4YMUA 1REQA 2W0SA 1RWKA 2Z2XA 1PNRA 8MHTA 3VPGA 4RBNA 1Z0ZA 4BQFA 2ZSKA 5KIAA 5CLGA 3W9SA 3GJ4A 3BN3A 3Q2OA 3WWEA 5DX1A 2H1IA 2AVDA 1PTJA 3TTYA 1EA5A 4TV9B 3LNTA 5COQA 4YRZA 5A5GA 1W4CA 3LLVA 7REQA 1FZTA 1E2PA 2ZXEA 3OCYA 4CPDA 3WS7A 1AB6A 1TJ5A 1ZD2P 4YRDA 4RDXA 1PQWA 2E4AA 4IQGA 1ECGA 3PX7A 4AMVA 5TS3A 3GLGA 121PA 3EGVA 4BCCA 2QRJA 5JJLA 4WK2B 3FGPA 2REBA 5EP1A 4D3ZA 3KKNA 1CUEA 1ZGZA 2E4YA 2UZ0A 3FMGA 3HKBB 4WGGA 1DKPA 2C4MA 5DP1A 2HBQA 3KT6A 4Q00A 3RG2A 2HLNA 3DCYA 4CODB 1ZITA 2H1WA 3KQVA 5G4KA 1ORRA 1TADA 1T9AA 5EWLA 5L4LA 4IOJA 2JJ8A 4L5IA 3JZDA 4BNMA 4AJJA 1HFJA 2A14A 3GFGA 1SD2A 2Q3CA 3K0BA 4YALA 3NNDA 2WYVA 5E8JA 4F4IA 1J2EA 3UKOA 4BX3A 4DRYA 3NVMB 3O83A 4M7WA 5C32A 2C5BA 1V6AA 4BMVA 5A2QA 1IZYA 2ZPUA 3NBAA 1HV8A 4B82A 1VPDA 4RD6A 3BMCB 1P7VA 3GR6A 1RXWA 1G63A 5KYGA 2BJHA 3D7NA 5H80A 3LG2A 4ZO9A 2PD3A 4RKFA 1W36C 3GLIA 1VBKA 4HLUA 5KSOA 4JA0A 2VDUE 4PGHA 2CLDX 2FGJA 3DPIA 5EWJB 4HYYA 5JS8A 3ZWKA 4DV1B 1QBGA 3EVFA 2X58A 4I50B 3M4ZA 3AI1A 3HCOA 2Q0SA 4QYWA 3TXYA 2LD4A 2Y1XA 5ALOA 2HL6A 5HJEA 1GAEO 1J0BA 1Z6ZA 4A2WA 3RRYA 2Y4NA 1ZIOA 3I2HA 2PUFA 3RBZA 3W2HA 1LBTA 3JW8A 2UYQA 3RODA 1EM8B 3N8DA 2ZTLA 4ON9A 1HKHA 4TS3A 3R7AA 2GZSA 3FCEA 4F4UA 1R0CA 1NLZA 1R27A 2MYNA 4IKEA 1J0DA 1GPBA 1U3FA 3D6FA 5EWLB 2L69A 2X5JO 2FCRA 2JFXA 4UNNA 1FS6A 4BFTA 1LF0A 1Z2CA 2C8VA 2OUKA 1MB2A 3FNHA 5E3IA 4CMCA 1XZGA 4QOEA 4H1WA 5B53A 5IK2D 4FN4A 5C5EA 4ZO6A 4ROSA 5D3KA 4D41A 5GJBA 3U4MA 3T3MB 1RYNA 1IOZA 1H8HA 1QFXA 2YOHA 3Q40A 4XIYA 2WT4A 5INTA 1EYZA 3FMPB 2IY7A 3K9FC 2GYVA 3B9QA 5BO5A 4C5CA 4ZGWA 3O4GA 2HHAA 3TZBA 1SGWA 1WV1A 5J4VA 2CXUA 2J0SA 2B9VA 4KMSA 4YIKA 3BFPA 2NYVA 1IFXA 5D87A 3CINA 1FYDA 2E6UX 3FYDA 4OIFA 3P5SA 1EUDB 3IQGX 3NM5A 4K9PA 4Z7QB 5HM8A 1K9SA 4ND6A 3EGDB 4F9GA 5GONF 1A9TA 1E69A 2PUCA 4HN9A 1LNZA 1W5EA 4R1LA 2W2KA 4V0KA 5K3BA 4C6SA 5G53C 2C2GA 2YTZA 2WYUA 2Z4TA 3U48A 4X61A 1NW4A 3NP7A 4M4SA 3ZDBA 2C7GA 3GDOA 4IKOA 1VLLA 3UMJA 3CEJA 2PXHA 4YMGA 2CE2X 2ZIUB 1KHTA 3V46A 4F71A 3A0UA 1Z83A 4W99A 3LX4A 5BN4A 3WSWA 1XDGA 2OGZA 5CT5A 2R6FA 1C29B 1C4XA 1XXHA 2GN4A 3PNOA 3SPXA 1JHAA 1RRCA 4ZI5A 1BVHA 4LJRA 3Q8LA 1SRQA 4ZQBA 4Q12A 3DDNA 2HWKA 1B6SA 4Q05A 3ZGLA 1ND5A 1X7XB 1ZLYA 2CBGA 1F5SA 4JSYA 1WXDA 3EVCA 4KO3S 4E32A 1WUHS 5C4IA 2Z4RA 3IKMB 4HQKA 4PYLA 2FSVA 3B36A 1DGQA 3WRXA 4JIWD 1BFUA 4C76A 3HHEA 4X20B 4QU0A 2HU8A 3AIOA 5EVJA 3FHLA 3OZFA 1FYWA 2G80A 3ISJA 4N54A 1FUUA 4RDHA 1O8CA 2C78A 3MWDB 2Z2JA 1E2JA 2ZIAA 3LUHA 4OQXA 5E7MA 3HY3A 5E9JA 1ZOOA 1LBHA 3NJRA 1U2GC 2REXB 4WFQA 4QJ3A 1FHRA 4P4UA 3QVXA 1KIAA 1WUYA 3ORSA 5IG2A 3T34A 3HYNA 4E07A 3QUTA 4BX8A 1SBTA 1YVDA 2AKYA 4G4SO 1ISPA 1VYVA 4LMAA 2LE0A 3F6BX 1J00A 1UWCA 1Y1SA 3KU4A 4QOHA 1SCJA 3GU3A 3ENWA 3F6YA 1F9AA 3ZE0B 3ITEA 1VE1A 4EGCB 3U6KA 2Y66A 4UJ5A 3VKWA 1QTNA 2B1JA 3PEEA 1YKFA 1XAJA 3BD8A 4MWSA 2EH0A 1NZFA 1K5PA 4ZMSA 3NX4A 4PLPA 1EVEA 1Q7TA 1XDSA 3T7EA 4CDMA 4P82A 2HK6A 1ZMTA 1FU7A 3QVSA 5A3RA 2ZWAA 4JLUA 4RDCA 5MN5A 1QLWA 5CCDA 3O26A 5TE9A 4GQIA 4BP3A 3JRNA 3MILA 2AJCA 4GVLA 4CI0B 2YMLA 1EZ4A 3RNOA 3T1VA 2FSSA 1UKBA 1I2AA 2WIJA 4B6QA 1JG2A 3B53X 3K9NA 5KQMA 5HBGA 3BMOB 3BK1A 1XCGB 3H7IA 4O4LA 2I03A 4Z51A 2J33A 1JEYA 3BRWA 3I9V6 2GBLC 4BRWA 3HCNA 2G5TA 2OEPA 2RSLA 2FN7A 4MARA 3TAHA 4AZ0B 4AZTA 1QX3A 3U39A 1HOXA 1NLUA 4WFKA 3TNJA 3JAMA 2PXXA 4JFRA 4WZAE 4C1BA 3RHTA 1DC5A 3E35A 5KDOA 5KI6A 5C53B 1QS0B 5LP1A 2P4QA 4J90A 3LQFA 4QJBA 3O31A 3OCCA 4Q9IA 4HPWA 5ICGA 1JEOA 3I6MA 2O8CA 3IIKA 2X9GA 1T36B 4RVNA 1XLTA 4BB5A 3DD5A 3BH7A 4OLFA 3VU9B 3Q7QA 4E1BA 4AF8A 5L95A 2GSWA 4UHCA 5IYZB 1QCYA 5CK4A 1M6HA 5AWFC 1G6KA 5C37A 5DNCA 5IT5A 5ALFA 4L4SA 4ZU3A 1X2EA 1RYMA 2CLSA 3HABA 5JHHB 1ES9A 2IZ0A 2HF8A 2XYPA 4JP8A 4TMWA 4P7JA 2G77B 3IVGA 1AV6A 3A6HA 3R7WB 3G2MA 3NWJA 5LKAA 5GJCA 4YRGA 4J4TA 5I5EA 1MQAA 3PUZA 3EGXA 1YDFA 4MWDA 2H2HA 1M2WA 4DA9A 1MRSA 4WLOA 2WSLA 3B7GA 4Q3NA 1GITA 1K3TA 1J8VA 4TZKA 1XD2B 3PPVA 4ZVVA 3PEWA 3DHVA 1IXKA 2BELA 2I4LA 3H1FA 1G55A 1QHHA 1VA4A 2FPIA 3O7WA 3PSHA 4GOJA 4XASA 4HWRA 4TM7A 1O08A 1ZY2A 3AL2A 3WFJA 3P2KA 3BEOA 2WFZA 1VKJA 3A32A 1AM4D 1P4SA 4BAUA 3AUUA 4P4TA 5CPFA 3CWCA 3MXOA 4NZPA 2PXCA 5JPDA 1OYVA 5AJZA 1YQ9A 1JZQA 2PVPA 4PAOA 4IM7A 5K1ZA 4BBPA 1B8VA 1TYDE 5IT0A 3WGMA 3I0ZA 4Q1AA 3VOAA 5TMBA 2MSEB 3T7TA 3FJOA 4QJIA 2WVJA 5EZSA 2C98A 3I76A 3KOOA 1ICIA 2OM2A 3TL2A 3UMBA 3LT1A 3FOFC 1LNQA 2HLDD 1KPHA 4G1MB 1ZCFA 5HQ3A 4WKPA 5JZ9A 4IGAA 4C0JA 4E09A 4EL0A 4MKRA 2IYXA 5AXBA 2XCRB 1YTLA 3HZHA 4W6QA 1ZK0A 4BNGA 4D9FA 3RNLA 2RCYA 3RWBA 3VO9A 4BFXA 3WGVA 4EYGA 4TSKA 3TDKA 4M98A 1HT3A 1M54A 3GY0A 3N3BC 4I2NA 4NFSA 2GNAA 4RX1A 1U8UA 3E0XA 1LC0A 5FLEX 3KP1A 4GMDA 3EXIB 1QPZA 2H29A 1RLOA 4J49A 2DLCX 4ZVNA 2GAJA 4O0LA 4KACA 4C88A 3QNWA 2QM0A 1WLNA 4IHAA 4D8TA 4EKNB 4R2XA 4CKWA 4FHGA 2KB0A 2X19A 4PC2A 5JYCA 4P93A 1DAEA 1NVMB 5BNIA 4Q3OA 5D3ZA 2JBHA 1FDOA 3MS2A 1AQJA 1MA3A 3MJFA 4QUHA 5DBIA 2JIBA 1XWFA 1SXIA 2I66A 5EXSA 3ZDFA 2GRAA 4CEJB 1D1TA 1ETUA 2WPDD 2ZDHA 3BHMA 4DA4A 1X86B 2H1FA 3FKSA 3HJTA 4IDNA 3ZHVA 3OPYA 3UMMA 4M46A 4TV8A 5JISA 2ZJBA 4BCDA 4BKMA 2WVHA 1OBHA 2DUMA 2IX9A 2J6CA 4RSGA 4LJSA 4RQUA 1QDUA 1V48A 3DAGA 3LCMA 1EVYA 1MEEA 4MJ7A 2P68A 4RAQA 2VTKA 4OAQA 4CE6A 3GH3A 3K0SA 3A6EA 3I5UA 1IONA 3VZSA 3IDFA 1P0MA 4TLEA 2V1UA 3AKYA 5EE5B 4KKXB 4DEYA 2WMOB 3EQZA 1YRAA 3ZY4A 3UJPA 2YKGA 4P32A 3IERA 1FFWA 4BGDA 4J6FA 3C8DA 4J3FA 1Y3IA 3NEJA 1JH8A 3G2IA 3DEYX 5IVHA 1F3LA 4I36A 5C7IO 3WKAA 3T9BA 1NQTA 1FSGA 2BM0A 1RRKA 2VF8A 3DZIA 3F5MA 4X41A 1A9PA 4PHTA 3RFXA 1TIBA 2CC2A 3B9BA 3DDHA 3OC6A 2VCYA 3JD4A 1WOYA 3DZHA 4I3FA 3U0VA 3ZDXB 3O3NB 4RD2A 4BBAA 4Y2XA 2WIBA 2GZHA 3RHSA 4YT8A 2Z5FA 4L0CA 2GESA 2RB5A 3NHMA 5DRYA 4KBYA 1HRDA 1QG4A 5KVAA 4O1IA 1YQDA 1JFRA 2ST1A 3KVYA 3L0IB 4E4TA 1YFKA 3G2QA 4IG4A 2PNJA 4ZAYA 1M2HA 5JRDS 2J3DA 1QVWA 1ZOLA 4JBLA 4IZ6A 2M9MA 5K3SA 1FVOA 4YO8A 2I6UA 3PIIA 1NP3A 1TW3A 1VJ5A 2XKAA 4FGWA 4KE8A 5GGXA 1MORA 2RD2A 3KEMA 4QL3A 3PITA 3F9CA 4G85A 3EMBA 5BWCA 3WLLA 1IN1A 4R0VA 3GEHA 3U7GA 4KIWA 1KYQA 1NVBA 1SVWA 3MCWA 3TRJA 4RK4A 3J7TA 3HU5A 3THYA 3RT1A 1W88A 4LXGA 2HGSA 4C04A <