The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
84
|
sequence length |
320
|
structure length |
301
|
Chain Sequence |
MWIIEAEGDILKGKSRILFPGTYIVGRNVSDDSSHIQVISKSISKRHARFTILTPSEKDYFTGGPCEFEVKDLDTKFGTKVNEKVVGQNGDSYKEKDLKIQLGKCPFTINAYWRSMCIQFDNPEMLSQWASNLNLLGIPTGLRDSDATTHFVMNRQAGSSITVGTMYAFLKKTVIIDDSYLQYLSTVKESVIEDASLMPDALECFKNIIKNNDQFPSSPEDCINSLEGFSCAMLNTSSESHHLLELLGLRISTFMKELISKTDFVVLNGIFCLTIEQLWKIIIERNSRELISKEIERLKYA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Nbs1 flexibly tethers Ctp1 and Mre11-Rad50 to coordinate DNA double-strand break processing and repair.
pubmed doi rcsb |
| molecule keywords |
DNA repair and telomere maintenance protein nbs1
|
| molecule tags |
Cell cycle
|
| source organism |
Schizosaccharomyces pombe
|
| total genus |
84
|
| structure length |
301
|
| sequence length |
320
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2009-06-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00498 | FHA | FHA domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Tumour Suppressor Smad4 | Tumour Suppressor Smad4 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | BRCT domain | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
