3HUFA

Structure of the s. pombe nbs1-ctp1 complex
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
320
structure length
301
Chain Sequence
MWIIEAEGDILKGKSRILFPGTYIVGRNVSDDSSHIQVISKSISKRHARFTILTPSEKDYFTGGPCEFEVKDLDTKFGTKVNEKVVGQNGDSYKEKDLKIQLGKCPFTINAYWRSMCIQFDNPEMLSQWASNLNLLGIPTGLRDSDATTHFVMNRQAGSSITVGTMYAFLKKTVIIDDSYLQYLSTVKESVIEDASLMPDALECFKNIIKNNDQFPSSPEDCINSLEGFSCAMLNTSSESHHLLELLGLRISTFMKELISKTDFVVLNGIFCLTIEQLWKIIIERNSRELISKEIERLKYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA repair and telomere maintenance protein nbs1
publication title Nbs1 flexibly tethers Ctp1 and Mre11-Rad50 to coordinate DNA double-strand break processing and repair.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Cell cycle
total genus 84
structure length 301
sequence length 320
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00498 FHA FHA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.200.20 Mainly Beta Sandwich Tumour Suppressor Smad4 Tumour Suppressor Smad4 3hufA01
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 3hufA02
3.40.50.11080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hufA03
1Y98A 3POAA 2WT8A 3PXAA 3MDBA 3I0MA 2JKDA 3GQSA 1J4QA 1FHRA 1K2MA 3K15A 3EF0A 2JQJA 4D9VA 3UENA 4XQ0A 3VA4A 2EP8A 2COUA 3QVGA 3PO8A 2XT9B 3HX1A 1MZKA 3EF1A 2ETXA 1CDZA 3K16A 1G6GA 2EBWA 3T1NA 3L46A 3JVEA 3I6UA 2HTFA 3SHTA 3FA2A 3KT9A 1K3JA 1KZYC 2FEZA 3PXBA 4OFBA 1DMZA 5E50A 1T2VA 1J4OA 1GZHB 3SHVA 2K6GA 3OUNA 1UHTA 1K2NA 1G3GA 3L40A 1T2UA 3I0NA 3L41A 3SZMA 2NTEA 3UNNA 5ECGC 3K0HA 1J4KA 2KFUA 2JQIA 1WF6A 1J4PA 2A0TA 4N40A 3T7KA 4BMDA 3VA1A 1YJMA 2COKA 4IFIA 2KB4A 2FF4A 3COJA 4G2SA 3UMZA 3PA6A 4IGKA 4EGXA 3T7JA 2AFFA 3OLCX 2PIEA 3PD7A 1L0BA 3I6WA 4ID3A 4BMCA 1OQAA 3KTFA 1T15A 3ELVA 2COEA 3U3ZA 2W3OA 2EBUA 2CSWA 4Y2GA 2LC1A 2KB3A 2E2WA 1LGQA 3VPYA 3AL3A 2VXBA 5A8IA 3PXEA 1J4LA 1UJXA 2BRFA 2D8MA 1K3QA 3PXCX 4EJQA 4BU0A 3UNMA 3PC6A 2LE0A 3PXDA 1LGPA 2XNHA 4U4AA 1WV3A 2M2IA 3PC8C 3T7IA 2L42A 2JPEA 5DJOA 4XPZA 1N5OX 1R21A 4QCJA 2DUNA 1Z56C 1L7BA 3QVGB 1FHQA 3K05A 1QU5A 2JQLA 3AL2A 2KKLA 3II6X 3FM8A 2AZMA 4H87A 2EH0A 3K0KA 3HUFA 4Y18A 4BU1A 2G1LA 3PC8A 3PC7A 4JLUA 3UEOA 3UN0A 2JW5A 4A0EA 1JNXX 2K7FA 2ADOA 2XNKA 2R1ZA 1YJ5C 3ELSA 1GXCA 4JONA 1IMOA 2VXCA 3UOTA 1K3NA 3SQDA 1IN1A 1T29A 1WLNA 3HUEA 3UV0A 2INGX
chains in the Genus database with same CATH superfamily
3LCUA 3BK7A 1M2VB 1HDIA 3H8WA 2OHGA 1GAJA 4XARA 4EQ6A 4EY7A 2WLSA 1UF9A 4F96A 3UYKA 2RCNA 1JU3A 3U56A 1MJNA 2Z0MA 3ZW9A 5CBPB 2K7ZA 1M8GA 3JATA 2ERYA 4YJ3B 4HDCA 2VWQA 4KVGA 2I1QA 2BRUC 2OOSA 5TARA 1DG1G 1CJCA 2ZR7A 4DC1A 5JS7A 5KS2A 1YIOA 2AMJA 2J5QA 2Q0QA 2V9CA 1TLLA 1UAAA 3B5JA 1SU8A 2PG3A 1SB8A 5LOVF 2JD2A 1XZGA 3H4TA 5DM0A 5IKMA 2D6FA 3DLCA 4P82A 3EAGA 5C8ZA 2QV7A 4OQYA 5KYUB 2VTBB 3A2KA 4HXFB 1ZOSA 2DF8A 2WR8A 4TX1A 2P75A 2YN4A 3VVLA 1KMNA 1CDOA 3DE0X 1T9CA 2Q7OE 4BO3A 1IN6A 1SAYA 2O59A 2C57A 4CBVA 4ESHA 1TT7A 1Y6ZA 4DV3B 1SCJA 4Z9XA 2IHTA 4TXHA 2VQEB 5HDQA 1WDTA 5IHPA 4RXMA 5EIXA 1MVNA 3EEFA 3GEHA 3ISJA 4CMCA 4UPEA 5H8WA 2X76A 5CEJA 2OQIA 5D00A 5IABA 1A97A 3UICA 1D2NA 3T7KA 3HGQA 2GHRA 3S55A 3IQIX 3DDOA 1V8PA 2COKA 4BRZA 4CMHA 2AMFA 4Q05A 4ZVVA 5H4HA 4MX8A 3UMZA 1LB1B 2DY1A 3IBGA 4HAZA 4IYJA 1KZGB 1NOIA 2C77A 4QXMA 4TL9A 4ZT6A 5FQNA 2WQ6A 2EKBA 1JT9A 2DR3A 1PG2A 4TXJA 4FBLA 4BO0A 1ZI6A 1MOSA 1YZKA 4DA7A 2OG1A 2XT9A 3K20A 3ESRA 4YK7A 1Y1RA 2CNKA 2ECPA 4IMRA 4QTYA 1T4MA 1XOIA 1PK9A 1SEVA 3W9YA 2QRLA 2VHVA 2HZ7A 2GPSA 3KB8A 3LWBA 4W9RA 4QU8A 1OIXA 5LQKA 3GLQA 5J4YA 2FW7A 2W71A 2FDCA 3G0HA 1JIVA 4ZEVA 1IPEA 1R6AA 4INJA 2JGLA 5DSXA 1YB5A 3W4JA 5EG5A 3EFEA 4UPDA 3CUVA 4Y2JA 2D62A 1TQ2A 2NACA 2ZBGA 3OUTA 3S7TA 3WGMA 1T9KA 2PX4A 2FQYA 2V0CA 3UUWA 2WE8A 4AZ3A 3CM0A 3CONA 3I39X 3NV9A 1EEHA 2VDUE 3E58A 3G7SA 1N8TA 1XO1A 2A9QA 2BMEA 2OILA 1FMFA 5EJ2A 2V45A 1R0RE 3HL0A 4N39A 3A7DA 1X2EA 2GAIA 5HM6A 2PX6A 4DILA 2CHQA 1ZOLA 1B93A 2C97A 2NU7A 4UNNA 1DQRA 2VN8A 2Z04A 1I3CA 2Y66A 2PUDA 2FZWA 2OB2A 3SICE 4KYVA 1WUHS 3SJCA 4E6PA 1L9XA 1J1IA 1RCFA 3U3RA 3ZI4A 3LKZA 1UBEA 3RBXA 5A62A 2KMLA 3BSFA 1ECCA 1U8FO 4MUAA 4QASA 4RLHA 3CNEA 4DNXA 4LF9B 5AJHA 3ABOB 3WP1B 4I9GA 1JHPA 2CN1A 2ZVJA 2OV4A 1O95D 1JBEA 1LJLA 2JI9A 2OT3B 2A9OA 1V7CA 2VUSA 1GNRA 3P0HA 1E1RD 4KK3A 2P67A 3SR3A 4HGRA 5H80A 1JLKA 1O5OA 2XTNA 2JANA 1MRNA 1XFAA 3PS9A 4OG2A 4WKPA 3TB6A 5A5DA 1H65A 2BCEA 3GX1A 3KPJA 1JSLA 2PKXA 4D98A 3QKIA 3G0DA 4ZTUB 1PWXA 1JLLA 2ZYRA 3R6WA 2C42A 3RHZA 1X0VA 4NZYA 4IUYA 5I45A 2YQZA 2J6BA 2I4MA 4TYPA 1U8EA 4PLYA 1K2MA 1K0FA 1RRVA 1F60A 1T4DA 2IQIA 4FE3A 4NS4A 5HUHA 1T26A 2PGDA 3EH1A 2CVPA 2CB0A 1HY3A 2H11A 4KC0A 3LOPA 1YUMA 2FWBA 4LWOA 3L7MA 3EH2A 5TVKA 1U02A 2PRJA 3BFXA 5F5NA 5JS6A 2X42A 1DV2A 1ZOIA 2EJCA 4QARA 4PIMA 3ZNPA 1GGKA 3VAAA 2IL1A 2YWHA 2H9AA 2VH2A 2Y1GA 4D7AA 5GJBA 2VPXA 4LYAA 3FOAA 2ZSFA 4XPIB 1FB5A 4K87A 4BLWA 4HL6A 2D1RA 3H8SA 5AM3A 4CDGA 1E4OA 1ENYA 2UVQA 4LHXA 2VQFB 4UM5A 1K7FB 4X91A 3SHOA 2Z6QA 3ZNOA 1N5IA 5IK2A 2R6JA 1PT9A 3ZBTA 3HUDA 1V11A 5CM9C 5EMKA 1HQDA 4KJZA 4A1FA 4V39A 3L4BC 3AIIA 2PMCA 3UXMA 2NUTA 3FUTA 4ANFA 4AN4A 5KBYA 1KZ1A 1C14A 4GZMA 2FWPA 3KE9A 4L7QA 4FZ3A 1MUUA 2H1WA 5JAPA 1WZNA 3HCFA 4O4IB 1UQTA 2VQ6A 1UMKA 4MLCA 4RTPA 4J9VA 1JMKC 4X5OA 3TZQA 1K5GA 3MJTA 1UK9A 4XVCA 5FI5A 1O03A 1QYWA 4RIFA 5GV7A 2QJFA 3ZQUA 1Z2EA 1MJGM 1NW5A 1S2MA 3OF2A 2ORED 4ZI3A 1YVDA 3ZV4A 2J5RA 1DEOA 4OK5A 2MCFA 2OORC 5AVYA 2CZCA 2B94A 5ICMA 4LYDA 3PXXA 5KCZA 4E0BA 4MW6A 4DZTA 2L18A 4GMHA 4UEKA 4WKBA 2ARKA 4R8VA 4ZI7B 1GQ2A 2IBTA 3THOA 1AT1A 1FU4A 3O7MA 4R9RA 2AR9A 4ZO6A 1K2VN 5ENDA 1J39A 1OFVA 3WIOA 4UHHA 5L51A 1ADBA 2I87A 1QP0A 4U9UA 1GQQA 1GQRA 1N0VC 4RK4A 3ND9A 1RI3A 2FMIA 4G37A 1N6IA 1RWXA 5K03A 3V8NA 3WIEA 3I8SA 2O2IA 1RHQA 3WLTA 3T0IA 4CKCA 3FM8A 1PJTA 1V39A 4C5BA 5A0FA 1ZD8A 2UV8A 1CSEE 4CF7A 3DTVD 4B84A 4HYEA 1NF2A 1UODA 3AEQB 5EQJB 4MROA 2PYZA 3C43A 3A10A 2VSOA 2J6CA 3N5KA 3O0DA 1KSJA 2IJGX 3IDOA 4KMRA 2NTJA 3NG1A 4JLUA 4BNLA 2BUAA 2FXVA 2YJTD 4WZAA 4QT0A 4XTCS 1XE3A 3A27A 2EJTA 2Y0PA 1N33B 2ZIVB 4GQBA 1NRXA 2XNKA 4F2WA 2R1TB 2KBFA 4RO0A 3D0KA 2WIDA 2HLDA 1YS4A 3BK1A 3CIOA 3EGOA 1G8KA 4F1JA 2QRJA 2J33A 3QLVA 1Z8HA 5A3RA 1VXOA 1PUXA 2WTMA 3MSXA 3DLPX 3EXEA 5YASA 1C30A 1VIYA 2VF4X 2Q6IA 3LFUA 1FPMA 1N8SA 4FHGA 3W90A 3WZLA 2WYWA 3LPNA 4JP3A 3HYRA 1EWRA 2CDRA 2BGTA 2CNWD 3AXTA 4ZJPA 1JXQA 5JLJA 5HFAA 3KLMX 4X6LA 1SEPA 3V2HA 2DWQA 4O1HA 1CJKC 3OT4A 5LZ4A 3I9V1 2HFKA 4GBMA 3AI7A 3EF1A 3EJ6A 4LRYA 1Y8RA 5KQPA 1QX3A 1KEWA 2IIBA 2B37A 3R1IA 5FRDA 3WIDA 1EWQA 1PNOA 1NR5A 2CLEB 2VAXA 3MQFA 5DNUA 4TL8A 4BTVA 8AT1A 1ODTC 4RGQA 2P68A 2WZQA 2CLKB 1F48A 1U5CA 4UEJA 5FUXA 5C32A 2J6IA 1D6SA 2ZWMA 3GT4A 3K8OE 5CX4A 1LV7A 1ZM4A 4RIIA 3R74A 2I78A 1SCQA 2BGMA 2J41A 3E61A 3IAFA 3IV9A 1PDVA 3L6OO 1SHTX 4M1ZA 4TTIA 2HWUA 3A1WA 4X90A 3O94A 3OZSA 1MHTA 2G83A 4GPD1 4P9NA 5M34A 1W87A 2D0IA 1A27A 1Q15A 4HJRA 4FQ7A 4PG6A 1OH7A 3HCRA 4B3SB 3KSAC 3E9ZA 4M9UA 2ECFA 3HPRA 4NR0A 4YY3B 1R4NA 2HJ9A 3GMJA 1BC5A 3QKSB 4WLOA 3S8MA 3W8EA 1QUFA 4AMVA 3TG8A 3OAAD 2NZJA 1K7SN 1F0YA 5T3YA 1HDXA 2EKLA 3AONB 3N3BC 1Q11A 3LUKA 4HZIA 6PFKA 3SEQA 2M1ZA 3CF6R 4BMCA 1H4TA 3RK1A 1KL7A 2FR8C 1UXHA 4PRLA 3QFFA 3CMMA 1RYEA 4RZ2A 2RG1A 4HDOB 1ZNXA 2IXAA 2AZTA 1BG6A 5A7GA 5GMOA 1ZCFA 2PFKA 3GNSA 3KOOA 2VPPA 1SKQA 3KJHA 2BMJA 2ZK7A 4JYPA 2JCXA 4P38A 4JR2A 3B7GA 4ND6A 4G0QA 4FFWA 1V0JA 4N8DA 4DCCA 4AJJA 1DDOA 2D5BA 4P4TA 2AC7A 2XNSA 4BFLA 1PFWA 3EFOB 2BP7B 2RHGB 4NQRA 4Z9YA 4QPCA 5DKFA 5BVGA 4TT8A 4N3BA 4R54A 4TRJA 1E1CA 5DTEA 1FVHA 1IBCA 1W5FA 3E5NA 4R8RA 2X4DA 5B6JA 3KUKA 4LCBA 4ZCLA 3N0XA 3F3SA 4B4WA 4QUBA 1AXRA 4ZOLF 2PAFA 4WLFA 2C84A 4G4SP 1G2OA 4C0BA 1B8OA 2JHFA 3RAJA 1TM7E 3INNA 4JASB 4KLRA 4I6EA 1T1SA 1PT7A 2A0UA 2WOJA 3FWHA 3M5DA 1UFRA 4RVUA 5C8YA 2HA2A 3VO2A 5A03A 4WH0A 4DARA 4QXAA 2RHJA 4BNUA 4TMYA 4WA7A 4ZO9A 5LQDA 3QW4B 1O77A 2H4FA 5I9LA 1JA0A 2P5SA 2C5FA 5GVRA 1BVYF 1Z4JA 4HCJA 2GN6A 4MHSA 4RYLA 2G6BA 2HU5A 2P0YA 4GWLA 3U9SA 3COZA 2EP7A 3NT2A 4MEJA 4D4GA 1W0CA 3E3MA 4N5NA 4D9CA 4Y1EA 2XRZA 1S4QA 3FMVA 1KO8A 2AEEA 4LI3X 1JDNA 3DZBA 3AF3A 5DT9A 5I5GA 2FN7A 2KS6A 1JVBA 4ZMBA 4QLOA 4PGMA 3DAGA 4U8HA 3MJHA 5DB4A 3U9TA 1FTQA 3EGIA 1WHSA 1ZZGA 3HN2A 1G64A 1V5GA 4WY5A 4GECA 4LFBB 2ZIUB 3GRFA 4Q7EA 3DA8A 2H9YA 2QN8A 1KWGA 4X71A 3BILA 1V71A 3EMDA 1WXEA 3W6OA 2TMGA 5JRJA 2KX7A 3H11A 4MVYA 4OSEA 4KSYA 4RELA 4QZVA 5LP6C 3CR8A 1V95A 1Z62A 1Z5GA 4QGGA 3P1JA 2GYVA 5A5FA 1BW9A 2C95A 1IXRC 5TMPA 4X6UA 4P80A 1X9IA 1VKOA 3D7RA 3ENVA 1PR4A 2ZEJA 3H2JA 3HCNA 4QELA 4Q7KA 4Q48A 1E3LA 4V1CI 3PJEA 4QU0A 4OEHA 4P7JA 3FRHA 1C1XB 3ND6A 1E1LA 2PRKA 4HGQA 2H4YA 3D3WB 1ZINA 3HYLA 3TIXB 1RHKA 2OESA 2I4RA 3LPMA 3C48A 4CM4B 2BKXA 1HUQA 3WBFA 4YYZA 1SU6A 4V3BA 4EO9A 4RETA 2FWIA 3L40A 1VMDA 2C9MA 3HFJA 5C31A 1XSEA 1KQOA 3GJQA 5DHUA 2NAPA 1NV9A 3NU1A 2WM2A 4R1NA 3NFYA 3IUSA 2DBQA 3AU8A 3RSSA 3FROA 2VTEA 3SFZA 3ZV6A 5JTUA 4EW1A 3GD5A 3ETGA 1NTOA 2WG2A 3IUJA 5CDFE 1YC5A 1YJMA 4EHHA 4ZYZA 2RAFA 4OYRA 1W0KD 2C5AA 1V1RA 2ZR8A 3AEUA 4YMSA 1YA4A 1TD9A 4C5CA 5SYAA 5DASA 3B6EA 4YV2A 5AJZA 3QIAA 1XL0A 3RG8A 2NSDA 4U7GA 3K0AA 3QVWA 4JLJA 4KQGA 2FPIB 3C3MA 5BN1A 3DO6A 3P19A 2I2DA 4PHHA 4QPPA 3WLRA 2BDTA 1E69A 4L9RA 4OGGA 4P33A 2O0JA 4OQMA 1Q19A 1VPTA 4ALNA 2BEVB 1RWNA 1CS0B 3ZOZA 1SOMA 4W5QA 2ATVA 3WHPA 1GCUA 3VGPA 1H42A 4L4SA 4S05A 3PXEA 1MRZA 2ET6A 2L17A 5J2UF 2J48A 4A10A 2DAPA 3I34X 3K1TA 2FSHA 1V4NA 2F67A 3ZD9A 4MHTA 3ZXIA 2ZUFA 5DJOA 4Z3KA 3TKLA 5K2MA 3I2HA 4KN6A 3USZA 3WMWA 3A4LA 5H1YA 1DS6A 2AN3A 2W2LD 1FDUA 3CQ9A 6ADHA 2C8JA 3HE3A 4C4RA 3QTLA 5IARA 2NO0A 3ESXA 3AIKA 2PKWA 1D8AA 2B7LA 4Y98A 5EMHA 3C7TA 3DBOB 3CUYA 4AMUA 1LVGA 4E5VA 1J8VA 1LBIA 2ASVA 2WPDA 3QVOA 5EUBA 1U2GA 4XB2A 1C1DB 1NNUA 4L78A 1CC1S 5AXAA 5D7NA 5HF8A 3U3XA 2NZ8A 4JHXA 5C7YA 2ACVA 4ME6A 2IE0A 3K0BA 4ER5A 4DLKA 1RTKA 3W8FA 4PYJA 3IIJA 4UTRA 2X8WA 2GHIA 2W2MA 2ZATA 4RKQA 4JI2B 1Q1QA 2MIIA 1BFDA 3PFBA 5J63A 4IO1A 4OPMA 1K9SA 1D6NA 1PJCA 1VI5A 2QZZA 3PB3A 5EZYA 1WXXA 3RAGA 4CG1A 4LJRA 2CUZA 1E9BA 2FLWA 1Z29A 2XQGA 1I7QB 5PNTA 3EWNA 3RCBA 3UHPA 3A6JA 4L15A 2HDWA 3EEQA 1D0SA 2CXNA 3L7CA 4NVRA 3DCNA 1YJXA 4NFHA 3FVRA 3SJUA 5DI3A 4KLNA 3ZCRA 3GQBB 2O5EA 1SQ5A 4M54A 1EBBA 2FGJA 3WQQA 2B5WA 3M4YA 1XRLA 3TH5A 4WRRA 1I9GA 2DPYA 3HB4X 1D2HA 3EEYA 3KKQA 3GUYA 3CEAA 5CBKA 2A1UA 5LP6B 2X6QA 5C8VA 3ONFA 4YAOA 4KBFA 5E9QA 3KWFA 5FWXB 2PRYA 1VLQA 2ZT5A 4PZEA 3THWA 3ZJVA 1UKAA 1RYMA 4AX8A 4OFWA 2ZUTA 3KVVA 1W48A 3SOZA 4LEIA 2HSJA 5EQTA 4L0CA 4RPKA 1QQAA 1K3JA 5JAZA 1RWMA 4ZDIA 3L2OB 1TK3A 1JA1A 5EPEA 5K8JB 1C9EA 2V3CC 3UB2A 3Q3EA 3VO9A 1JVSA 4HGPA 1AOXA 1VJ5A 2HPHA 3ACBA 3WRVA 4OLHA 3SCZA 4JUIA 2A67A 2H1FA 1G5QA 4RJIA 2OAP1 3MAJA 4HP8A 1AF4A 2ODNA 4ABYA 3DMTA 3RARA 4FFSA 4Q3DA 4M4SA 4BX9A 1U9IC 4M37A 5EIBC 3J7TA 2I03A 5M3BA 4JFAA 1BRMA 1GXSA 1W75A 1KY4A 3WKAA 1M2VA 3ZD8A 3ELWA 1GTJ1 3EA0A 4NFSA 3EARA 1IJKA 4DA8A 4FIDA 4U0KA 4KRFA 1WTAA 5GINE 1KBOA 3JQDA 1Z5UA 4XW2A 4WKCA 4F3YA 1LX7A 2F62A 2YQ5A 5EJGA 4HDQB 1XR3A 3L7KA 5FBVB 4YJ3A 2I9PA 3ELVA 3FI9A 4L08A 4RV5A 2R00C 5JLAA 5THXA 1PBTA 3OESA 3U39A 4GLLA 1D2MA 4I2VA 4HQ6A 4MCHA 1JEEA 2GMWA 1RAEA 4P5EA 3THRA 4ZFNA 2IH2A 4YRKA 4C4ZA 1T8UA 3QX3A 4JSTA 1JXOA 5GZ1A 5KYUA 5DCWA 1VE7A 3CVUA 1YFZA 3EVFA 2Y99A 4GEGA 2JCVA 3GLFB 4QE3A 3QXCA 4RPCA 3UAXA 2GZDA 4LAFA 4YPFA 4Q00A 4AIRA 1HKUA 4ZQHA 4ND7A 1F2TB 1NJFA 2P69A 4NMXB 4ZVOA 1YL5A 1CPYA 1IL0A 3DLIA 4WOJA 1LBQA 5FI1B 3WGVA 4CF5A 2XGGA 3MN1A 4AUKA 4G36A 1WIWA 4L3VA 2GEFA 4RPIA 1A95A 1EU1A 2GBGA 3LWDA 1BVUA 4N0MA 4OA8A 4A23A 3DEIA 4LJKA 3VR3D 4TSRA 4UUBA 2V7EA 1RRKA 3KSMA 3AHIA 4BZZA 4DMHA 1QHYA 3RVMA 1OH6A 1GR0A 5B6PA 3WTBA 4D43A 2OXIA 4HC4A 3E1SA 4BV9A 2AEMA 1HO3A 4JLAA 5B4UA 4LRXA 1U63A 4BKQA 2YWEA 1XP5A 4Q4JB 2YC2C 3T4XA 3F6RA 3H1AA 5FL7D 4H2DA 3UJDA 4D0GA 1NBOA 4MQEB 4D4KA 5LA6B 3HS3A 3NEAA 1C7FA 4KIJA 4MP3A 2B9EA 3T1TA 4AS2A 3NANA 1U28C 4RD3A 4CM9A 1Q92A 3MRTA 1OX5A 4EFNA 2Q9BA 4MV8A 5H3HA 3ONWA 3V4SA 2FOLA 4I4CA 4FJ1A 3FNRA 2P1ZA 2EZ4A 3MJSA 4G5HA 3ZJTA 4LKRA 3TVDA 3QMWA 1KR5A 5F78A 2WFMA 4M1OA 2IZ1A 2X0RA 4FX2A 1X92A 2OHHA 4OMUA 4I4NA 1P7ZA 2RH9B 3AI3A 3W79A 2GBFA 5AK6A 5E3HA 2QMYA 4L8LA 1SG6A 2DQZA 5DSZA 1KBQA 4DUZB 2ZSHA 1SXQA 1P3DA 2D2IA 2EQAA 4FGZA 2C1EA 1ZL2A 2H59A 1KRHA 1T6BY 1L3IA 2HQ1A 5IMSA 4MVWA 3VC2A 2WAOA 1Z4OA 3GN2A 2FSIA 4IZOA 5FB3A 5FUWA 1X1RA 4YMUA 2AT1A 1QFSA 2YFQA 1IWOA 1QE5A 1YI8A 2ZE8A 1VL2A 5KNLA 4QICA 1XMVA 1ZIOA 1OX6A 3S44A 3ZHZA 1ISGA 3H75A 4TTTS 4I5EA 1H5NA 3PI7A 2K6GA 2XMCA 3V32A 1UBMS 4BE4A 5CH3A 6REQA 3FHLA 1QLJA 4JI4B 2QI9F 3GJTA 2I91A 3K6JA 4WI1A 4V38A 3WG9A 3TRKA 5JO0A 4MMXB 4C7VA 1YB6A 1ZITA 2NMVA 3TD6A 3F47A 3OOJA 3UNNA 1R88A 4LE0A 3NS7A 3R7SA 4ZYYA 3U7HB 2G36A 4PG8A 3ZDAA 3S68A 3RC8A 2YBDA 3ELDA 4H59A 4U63A 1EEXB 2ZDQA 4X00A 1L4FA 3DAOA 4WESB 2VDLB 2CLIB 3EPLA 3GFSA 1XNQB 1EXNA 3OWHA 2R7LA 1O9BA 1BQEA 3OHMA 1ADYA 1K8ZB 1SCIA 3HO6A 2A59A 4K81B 4XSVA 3TR6A 4NYIQ 4CF3A 1KVSA 3GGDA 2ZJ5A 1T13A 3ABRB 2C92A 3CG0A 3I9KA 4UBIA 4WXPA 5FUVA 4EECA 5LXTA 4G9BA 3JD2A 1UK6A 2Q7DA 4C3OB 2CZGA 3N6RA 4FYPA 3RSCA 2Z4SA 3FTPA 1QTRA 4JS0A 4UAVA 1SIBE 1OZGA 2C2OA 3R23A 2G8LA 2R0QC 2BRUA 1TAHA 2YVUA 3FMPB 2JIRA 4TROA 4DQ0A 1THGA 1IBLB 2ZCJA 3KD3A 2O19A 3LDGA 3M6IA 4E5PA 4XPIA 5JXJA 4LF4B 1T9GS 5FLKA 3OOSA 3VAZA 1A5ZA 1K75A 2JJ8A 1HDYA 2OCLA 2PT7A 4AJHA 4BO4A 2B69A 2ODQA 5KTRA 5AQEA 3VNRA 4RDHA 1B2LA 1JXAA 4I5FA 3LBHA 3SYTA 5HFNA 4JY7A 1OA1A 2FR1A 1AKUA 1QRUA 2PTGA 1WQ4A 1U5AA 4H6WA 4TVBA 4MI1A 2LV8A 2C3MA 2ODEA 3T5BA 4FMDB 3C87A 3GG9A 4Y3UA 1QO7A 2KKLA 1XWWA 3K4PA 5AI6A 3ICPA 2UDPA 4E5MA 5CB6A 1K6MA 2EH0A 1UK7A 4O4IA 1DAKA 2WTXA 2C83A 5K4AA 4MKRA 3P5SA 4MZDA 3Q15C 1W30A 3IURA 2ZAYA 2FN4A 1NDHA 5DIFA 4A3SA 3N53A 1VBNA 4QTXA 5B64A 2YHIB 2G40A 2QAIA 4I5DA 2G5CA 1QGED 3SKVA 3UB3A 2PE5A 2OBFA 2AXNA 3CIFA 1M2FA 4ZU3A 3WFIA 3BB3A 3VHQA 1CZKA 2WKSA 1CY1A 2KSQA 3B53X 3KXPA 1II9A 3ME5A 3BDAA 3HUEA 1L7DA 1QGYA 1VE6A 4IHJB 3T7TA 1SELA 4ZI7A 2WWFA 3BMOA 3MEQA 3ZX5A 1E9EA 4DLRA 2QZPA 2OVFA 2JIOA 3PKIA 3NTRA 3UJAA 4PO3X 3EVAA 3ZWCA 4MO2A 1GZ5A 1V9SA 2QIPA 3N7TA 3RF7A 1E5XA 4DJTA 2OFPA 4IGFA 4XQCA 4J91A 1RABA 1ZWKA 2RI0A 4QWMA 4UHJA 4Y0VA 3TSCA 3DSHA 3IKMB 5A71A 5FV4A 1RZUA 1DL5A 1OJLA 3EZ6A 1K5HA 3OHPA 1N5JA 4K1LA 4GZLA 1FLNA 1IMJA 3LQKA 4HAYA 4G5SA 4N3GA 2G9NA 3OJWA 1S3IA 2QRNA 1PJ8A 4M46A 1GY8A 3NHAA 3H0CA 1U7UA 3DE2X 5C81A 3IQGX 1X0XA 4MS4B 3SE7A 1U0LA 1XL1A 3HCBA 1QKKA 4DKJA 1ZGAA 1C7RA 1R8YA 4QXOA 3RHSA 4ALJA 1GRCA 4QNNA 1VBKA 5AW0A 4R3UC 3WNCA 4J4HA 2GFIA 4OL9A 2CNOA 5FQOA 1V41E 4F93B 4EUNA 3GLKA 3QHAA 2JKYA 3PIRA 4Y7CA 2PJUA 5EN4A 2O8EA 2BI4A 1B43A 3HR4A 3QYAA 3AO0B 3OKAA 3O4GA 4JYCA 3HWRA 1VHDA 3WLLA 1WEHA 3R4CA 3D5QA 4GPAA 1ZNQO 4TV8B 3PEWA 3BAFA 4EL0A 2HLPA 1GAEO 1IN5A 2Q2VA 3GBPA 4K5QA 3L01A 1Z17A 3LVRE 2A57A 1OD6A 2GN2A 2HD4A 5ADUS 1J99A 1QTQA 3ITNA 2DJ5A 3WO1A 3IOYA 3CNLA 4IILA 1LDYA 3CF4A 4JLMA 5DTRA 4V0ME 3ZQ6A 1YR8A 3WA7A 3DGEC 5LC1A 1OT5A 3A04A 3FR7A 1BDMA 1HNNA 1C3VA 4C4SA 3LUPA 4INAA 4M0MA 2PBRA 1E89A 1O94A 3HRKA 4JMPA 1HE4A 4Y6QA 4I1SA 2OLEA 3PCRB 4JEHA 4I8DA 1T0HB 2B6HA 3FCAA 1ENPA 2PH1A 4EVSA 3PC6A 4MVJE 1D2AA 5AOBA 1NE7A 2FOIA 2A0YA 2O1SA 3F6BX 4N5MA 1B23P 2VRWA 3CPEA 5FOVA 3TE6A 4X64B 2H29A 1FJXA 1AUQA 4A6XA 2CFSA 2IEGA 4KGDA 3T12A 1YVEI 3JQGB 4X9XA 1U1GA 4W63A 4XEHA 1T0IA 3L4BA 3JQFC 4B9AA 3ONNA 2CY0A 3M1YA 3PT9A 4HUTA 3LPLA 4IDGA 1USUA 3FHCB 3EGDB 4CQMD 1ZGZA 3DZ8A 2G1LA 3O9ZA 5DV9A 3RTGA 2Z6VA 3WDLA 3TGLA 5AK5A 3VZBA 3O47A 2YV1A 5FULA 1JAHA 1TW3A 3TRIA 7AT1A 4XA8A 3GPLA 1L7XA 3G88A 1TYBE 2JLCA 1YB4A 1XTQA 4HV4A 1YKFA 1XXLA 2WMYA 3E9NA 3QXGA 1JQEA 1SUIA 2OORA 1XZQA 2XSZA 4FDTA 5REQA 2I0FA 4YJGB 5DGXA 1G66A 1PL0A 3QXHA 1EI9A 5KSPA 1IJEA 5AW5A 1JG2A 2PWPA 3AFNA 3WE7A 4U6SA 2EFJA 1FU8A 2DH5A 2E4WA 4QQRA 1T9HA 3IALA 4EF5A 5C8YF 2C7OA 4I9NA 2CUTA 1MIHA 3TTXA 4D3SA 1X19A 2R44A 5HZHA 5KC9A 2QGZA 4EVRA 1TZJA 4HSEA 4DB4A 3GLRA 3RGWS 5HX7A 3A37A 4JI8B 2VYVD 3F2VA 3U49A 3LT5A 4MVCA 1VIDA 2CUNA 4BZXA 2P4QA 4UQOA 3AB7A 1XMIA 1KDZA 5DF1A 3RTEA 3NIBA 1AKQA 5T8KC 1X1TA 4LVCA 3DCYA 2EGGA 3G9UA 4EYEA 1PS0A 1LC3A 1XI2A 2FN9A 3HLYA 3N76A 3T3PB 2HF7A 2OCGA 3BFJA 2C1ZA 3I23A 4DV0B 2WK1A 2QRKA 2HTFA 3UAYA 3EBLA 3UOGA 3KC2A 2CD7A 1R8SA 2CLCX 4PF1A 1YE3A 1MAWA 3A1UA 1IXYA 2R86A 4NULA 4KSBA 4AJKA 2BR3A 1N32B 3GDHA 3KSZO 1RCTE 2RHTA 5A06A 4RV4A 1TYAE 1VG0B 2GXSA 2W98A 3UAWA 4DCNA 3IEUA 3MCAA 5CLIA 4KR7A 2I1LA 2YHAA 4AWBA 3CNHA 3M9XA 3KJQA 3FCEA 1L5QA 3JR7A 1KTVA 3AQIA 1N0HA 3DUFA 3L0SA 4MUHA 1Q17A 1P5RA 3P52A 1QWSA 3IKVA 3RYCB 2HMYB 1W35A 3Q5DA 4FUTA 4QUHA 2IRWA 2XV1A 1PJZA 4KBGA 3LDUA 4NOKA 3WMXA 3NQ41 4DLLA 3QNUA 4EO7A 4FI3F 3ZGNA 3VR4A 1XLTC 3BMQA 3OLQA 3C3AA 5BSRA 4UD2A 3EAFA 4DLVA 1NAHA 2YZ7A 3KAPA 4FHDA 3P9ZA 5JV5A 4JP1A 4B8ZA 3VKUA 1XFDA 4I55B 3V4ZA 4UM9B 1JDTA 2HSDA 1ODFA 1NZJA 1PUJA 4HR7A 1F1BA 1XVUA 4DNOA 1AO0A 2R4UA 3FKJA 3ASVA 3MGKA 1RP1A 4YJFB 4POAA 3MVEA 4V0RA 2HRDA 3K6SB 2WHQA 1E1QA 3QBDA 4M0KA 1OBVA 5FTJA 3ZGLA 4BE7B 4MDFA 1C1XA 1NPDA 4ZV7A 4MW2A 2XQFA 3WGOA 2X0DA 3DYBA 3E05A 4D9MA 2VK2A 1J4LA 2BRFA 4N18A 3GDGA 3IAAA 3PXCX 3H2HA 3FRIA 5DBGA 3OCZA 4PX3A 3TEJA 2QTGA 5SYNA 5J4KA 1TXGA 5C35A 1GCOA 2W22A 3M6FA 2XCIA 1KI9A 1OXMA 3NZEA 1Z3CA 5D5QA 1V8BA 1L4NA 3ZCPA 4FD3A 2GARA 4MRRA 3SQXA 1M7GA 2JHAA 4QGAA 3AVYA 2DWPA 3FPGA 1X42A 2F3SA 1KQNA 1NXWA 2OHFA 2UVDA 4DR6B 3VR4H 1OSNA 2P0EA 4YB8A 3I9NA 4KOEC 2IPAB 5JAQA 4BDTA 3JZDA 3D4OA 3K3PA 1PJQA 4OOEA 2AOUB 2XWSA 3GOQA 1Z06A 2CVOA 2PQMA 4A4YA 3CWZA 3LX6A 3PC7A 3QG5A 1F6DA 2QX7A 1MNQA 1EM8B 1H4VB 1KH3A 3KQMA 2IODA 4CKEB 3EVBA 1PSZA 5AHKA 2FPIA 3NVKI 1H2FA 4YA6A 2EFYA 4O2BA 5AHWA 1XN1A 2FW9A 2CK3D 3PNOA 2GF9A 2R7AA 3ZU3A 3D1LA 3AM1A 1BOOA 1EFHA 4EI7A 2H6EA 4YASA 4WFJA 2BEVA 1DOAA 1UC8A 1QP7A 2JBAB 3HR8A 4B3CA 2BEWB 4CEHA 1CUHA 1GGVA 4JC0A 1QZTA 1ZM2A 1T0UA 3D6UA 4BIIA 1M6HA 1P19A 2D7CA 4GH5A 4JBXA 3TJRA 1A2QA 2HWKA 3O3NB 4X97A 5E7IA 3ADBA 1TM2A 4AZSA 4AUMA 3W1WA 1WPQA 1T36B 1O6GA 1QHEA 2HK7A 1Y3FE 1BHJA 2VJKA 1LW6E 4QOJA 4WVFA 3IELA 2R68A 3IKLA 4XQ0A 2C7BA 4FYWA 4B75A 1YDHA 3PV0A 5LB4A 2AVNA 3OIYA 2CJXA 3SIWA 5G02A 2JIQA 4BY9E 1KI8A 3EQ2A 1X1EA 2Z83A 1DMSA 2JFUA 2E87A 2WINI 3U3DA 3KJFA 3CRW1 2VJOA 2UYHA 2C2WA 3BFVA 4CKWA 2ZT7A 4K9RA 3LNTA 2O20A 4J0EA 5CDFA 1D2GA 2XNCA 1C0KA 1A0OA 2YY5A 1CUSA 3DOEA 2C5BA 1MJGA 2CGEA 3A9RA 5CA0A 2IS1A 3LW8A 1PO7A 5CVCA 5ENZA 3K9GA 4C3UA 4JKIA 4LYJA 1GZ3A 3IXQA 4DVGA 1TX4B 5JW6A 5MDHA 3O8CA 3RDPA 5DPMA 3FD8A 2L2QA 4XCXA 2VT3A 3DYIA 4QLAA 1CJTC 1D5WA 1U11A 3BFPA 3P7MA 2HCFA 3PKJA 1TCCA 1S3SA 4CQLB 5AUPB 2NU9B 4KFUA 4YHHB 1PRYA 2FWJA 1J06A 3ZD7A 1IOLA 1M34E 1XPOA 3UUFA 2Z95A 1OC4A 5CP8A 1VGVA 2P2CA 1GQYA 2VBFA 1ZNWA 3PGJA 3A77A 1G42A 1U7XA 4XOUA 2IZ6A 1XK6A 3GA7A 3NJ4A 1HXHA 5LP6A 4F12A 2C3UA 4JKYA 1GUZA 2B30A 2AYXA 4DIBA 5EMMA 3HY6A 1C8LA 1L3BA 3DDNA 5DDIP 4RSGA 3UF0A 4EUFA 2OV2A 1USWA 2RGEA 2QQ5A 1BFKA 1SRRA 5H3CA 4JJFA 2HJRA 4QTUB 5LLSA 1JTFA 1N5KA 2A3RA 5TPZA 3U6KA 1OWPA 3GT7A 4N5IX 4B73A 4RTKA 2IBSA 1R5JA 4HDAA 4OOFA 3T3OA 2P4UA 5DO9A 3DMPA 3O26A 2BLLA 3OQHA 5J2TA 3EZXA 1A98A 1AB6A 4U0JA 5K0BA 5HFJA 4ON9A 4HTAA 1BDJA 1JPVA 1YBMA 3W3AH 1JG1A 3EF3A 1JLMA 3KQOA 3DWEX 3HWX1 2QUAA 4C0SA 4YJ3F 2YMMA 1UZLA 4MI6A 4QM6A 3M70A 3VH3A 1YMVA 2AI1A 3JAWB 3AGQA 3RS9A 5BSVA 4MVJG 3URKA 2PSFA 4LX0A 2YV5A 2ZM5A 1NW9B 1HEYA 1XTSA 3H5TA 1GCIA 2EU8A 5A05A 1U8YA 2VYNA 2QVGA 1X8JA 1EIZA 1IB0A 2I4IA 4UATA 4ZWNA 1QTNA 1RRCA 1YF3A 2Y1KA 4RZSA 1ABEA 4Q1EA 3S28A 1BXZA 1OASA 2IY8A 3BCRA 5JECA 4TXNA 3HEAA 3VZQA 2P9EA 3PR3A 5E4YA 4J1QA 4M7RA 2EBHX 4UE6A 4Q16A 4ZYLA 3HH8A 3M2PA 3PQ5A 2NOAA 1Z08A 5AW4A 4PX5A 2E6KA 1TU3A 5JD5A 1O3YA 1IJBA 5DK4A 3T38A 1PCXA 4P3NA 4CETA 1HDEA 2GVNA 1XZKA 4JV5B 1K7YA 2JFBA 1R0KA 3AX6A 1LC0A 4CF4A 5F76A 2ANCA 2FW6A 1NP3A 3K32A 4L5JA 3NIGB 1KMMA 4KNVA 1I14A 1P4HA 1FFCA 1JDPA 2ZIGA 4J3FA 4OJNA 4C0QC 4Z4GA 3GJ7A 4XUGB 4BFYA 3FCUB 2CXHA 3OCUA 1ANKA 1C4XA 2J5KA 4V02A 1KYTA 5JJLA 3TI7A 5A5VA 3GROA 1U9ZA 3O4RA 1IEXA 4PLGA 4ROTA 4LZLA 3K1JA 4UHFA 4KK4A 4ESOA 1I7DA 4ENTA 1K4YA 1AV6A 4RDCA 5D7BA 1XAJA 2N1BA 3BBPA 5ER9A 4HNHA 1EDEA 1MPTA 1RQGA 1L9KA 2PPVA 3QKRB 4KDRA 5E6UB 1FFWA 3NGLA 3KZOA 1EDZA 4MI9A 3VR5A 2P2GA 1V43A 4HKTA 3TE7A 5BT8A 3ACDA 3LP5A 1ZSYA 1QQTA 3MPOA 3PPYA 5CYOA 1H8ED 3VNAA 3A1CA 3ANNA 1E1NA 1KRXA 5LA6A 3BCHA 5LUAA 4OBXA 1QGUB 1Y63A 1G8SA 1CZOA 2CDCA 2WA1A 3MLEA 4MK4A 3OH8A 4A73A 1CW2B 5CTJA 2E6UX 3G8YA 5ICCA 5ITZA 1PZEA 5FKJA 5DTQA 4LF8B 1VCMA 1ULUA 3MS7A 3LBFA 3ZI0A 5A4KA 2ZPTX 3BICA 3CPSA 4JOBA 4EGCB 3P97A 1QMGA 2C3YA 4QDUA 5A6SA 4CLRB 2QD2A 4URHA 4MUNA 2IU0A 3L1VA 3MS2A 5AHRA 1FE8A 2H4JA 3M4XA 4IF4A 3KTFA 4AUEA 1G59A 1V7ZA 2NP7A 4R0MA 2P35A 4TLEA 5ERYA 2COEA 5EPUA 1D7OA 1NFRA 4HBGA 5K2OA 2ZBRA 2HJSA 2EATA 2CCGA 3ANYB 3DKVA 5DU2A 1I94B 3D59A 3TQTA 3GGJA 3LLCA 3OTWA 3VR5H 1NJ6A 3TO5A 3V8RA 5TQJA 4WKOA 2OCPA 1WMDA 4ZD6A 1THTA 4JXXA 3I6IA 2R8YA 4KWIA 1AH2A 2VYFA 3SFTA 1CUDA 1UKCA 1B6TA 4P98A 3EEIA 4GZ6A 3FUXA 3U48A 1EE9A 3BWBA 2Q4TA 3HYTA 1YRYE 1WDKA 1NU8A 4JZKA 1K7CA 1NJSA 4EW2A 3N39C 4TZTA 4FNMA 1TJ3A 1U9IA 2XE4A 1OREA 4J2TA 1Z25A 1ZMOA 4ZVSA 3ZQKA 2PTHA 2O2GA 3A1EA 4Z0TA 3AERB 3OE7D 1L1QA 1UEXC 1ZMRA 3Q7QA 3T7AA 4FLFA 1C9MA 2PH7A 3G5UA 1OZHA 1VLLA 3UMYA 4R3NA 1IUNA 2AG6A 1CQZA 3ODGA 4GWKA 3LXXA 2ODBA 4IIJB 5ABPA 4TV9A 5JCZA 4C4TA 2Z6AA 4WCDA 5I8WA 5EWJA 4CV0A 1QC5B 2OK8A 2DTEA 2R00A 3PX2A 1VE5A 4H7JA 4HHEA 3U3JA 4BRSA 2CV0A 1G8PA 1YR2A 1Y5NA 3BZUA 3JX9A 1HEIA 3HCEA 4FOOA 1ODIA 1P72A 2BHSA 4LDPA 4GKBA 4LSGA 2FCAA 4QPZA 4HQLA 2K5UA 3I5XA 5F7OA 3AI1A 3AHEA 3H1EA 4DMMA 2YV3A 1XP8A 1CQIB 5L45A 3SK0A 1GJRA 4KVAA 4C87A 1EFPB 2ILTA 2JB9A 3LUGA 3QF7A 2DU8A 5LWQA 5AHOA 2IPMA 3VO1A 3MAGA 4QJ4A 4TM7A 2VA9A 4ZVKA 4PSDA 1KI6A 1W6RA 1SKMA 3ETEA 3VNVA 3L6EA 5JFGA 1J23A 1OF1A 4XX0B 2H51A 4KPYA 3MBKA 2WFLB 4MWTA 1VKZA 4TMKA 1GT6A 4OK3A 1G5FA 3B1XA 5AKZA 3T4UA 4LRWA 4EA7A 4DR2B 2FWNA 2A5GA 3UCEA 4HNQA 3AJ9A 1HBJA 3IP7A 1Q5PA 1SVKA 1WXHA 2CYCA 2XUQA 3SLRA 4ZI7F 5INTA 1M6VA 3IULA 4RY0A 1T5SA 1G7RA 1H0HA 1OKKD 1U0RA 3VZSA 4WEOA 1YNSA 1EQUA 4XLZA 1BE8A 1FDIA 5C1DA 3HRHA 1T25A 1GKLA 3BCUA 1NPTO 4B85A 5MN6A 2IXBA 3FX2A 3O3MB 4MDYA 1V6AA 4AYXA 1UEIA 4LZWA 3JQ9C 4IHJA 4P3OA 2ZJZA 3TMYA 2X3FA 1K08A 2W2XA 3VR1A 2VZ0A 4BNWA 2V7GA 4KV9A 3UK2A 3I9FA 3AR3A 2XYVA 3CW8X 5FDFA 3R7FA 1E2MA 3A2LA 4LTDA 5ARBA 3ZHVA 2OAEA 5JZMA 1HMPA 3ZZ0A 3CUUA 5I7FA 2WG0A 2X5OA 1NVKA 4PAMA 3LQ4A 1E0AA 1I80A 4XB1A 3U7QA 5B3AA 1Z6PA 3O4FA 3GMDA 4RJKA 1J56A 5KTTA 4RTRA 3C85A 2G3YA 1TOAA 3HJAA 2IEAA 3E7PA 3C8MA 3R6TA 2IP2A 3FZEA 4A8TA 3HM2A 1KSFX 5DLYA 1FC0A 5IYZA 3U62A 2J3LA 3IHTA 2XITA 3D3EA 2KB3A 1OCEA 1XZNA 1YZYA 3QLEA 3N7UA 3NM4A 3A25A 4HFRA 2Y92A 1P2GA 1A9TA 3KEOA 2N47A 1SZDA 2OHXA 3LGXA 4G1CA 2JFFA 2CE2X 4RLFA 4G1UC 2H85A 4DLUA 3WLSA 4ZVNA 4C2UA 1VI6A 2ZIXA 2XPCA 4IJVA 4J1TC 5K8UA 3MMPA 1QFYA 2F9FA 2ISSD 2ZCVA 3B82A 3DVRX 1W1UA 4YIKA 5DULA 4D0SA 3U7JA 1VFPA 3D31A 3D6HA 4TTJA 3WGNA 4EKDA 4RVSA 3EVZA 2C20A 3UW1A 2VJLA 3JCZA 4Q1VA 3USES 4ZXFA 1A96A 3C3WA 3OIWA 4EJ6A 3D7LA 3OJOA 5H82A 5KIAA 4H7KA 4L4UA 5TSDA 8ADHA 2OM2A 4UQLA 4AO7A 4ZHSA 4AKIA 1WCWA 3WXMA 1VLHA 5BNIA 1W0JD 5HTKA 3ZY3A 1L4YA 1R3UA 1T1GA 3PWSA 2O48X 1VZ2A 4WXRA 1VLZA 3MTQA 5JJBA 1D1SA 2OXCA 4AIIA 3TUZC 1EJBA 1EDBA 2AMVA 3KWMA 2DPLA 1NY5A 3LCMA 1QK4A 1MQ9A 2WKRA 4MDEA 2Q99A 5ICEA 4NYMR 2I76A 4IH9A 3D1JA 4GLBA 1F0KA 3FBTA 2FPPB 2NVUB 4GG1A 4W5WA 1GUFA 1DV1A 2JLYA 4HAXA 3ZWOA 4J16A 1PYGA 3POAA 1KEZA 3B2NA 3KTDA 3W2TA 4EKEA 5JDIC 1UKBA 1SG9A 3OU6A 2DVMA 3AETB 3BVPA 3DTVB 3VVCA 4OXYA 3RSZA 4DT1B 1VC2A 4EJFA 4ZAVA 1U2PA 5C18A 1SBYA 1XRPA 2R97A 3M6WA 2ZE7A 5TLSA 2Q3EA 4LCJA 3GLHE 3OF3A 2UUBB 2PEYA 4QEZA 2QSZA 1U9YA 3SAJA 3AR2A 1HORA 5JMTA 3IAHA 2J0SA 2VRBA 1M0SA 1H2BA 3AQ4A 3E23A 4KAJA 5CDHA 1FYWA 5G53C 1JIUA 4RA6A 3CYFA 3VOBA 2VHEA 4TUYB 4CG0A 2FJ0A 1QU2A 2VYCA 3EGDA 3NOXA 5DP1A 3F9RA 1VLMA 1RRGA 3BHIA 2PVSA 1J0BA 1RWPA 4DUGD 3KCNA 6YASA 1L8OA 4R0VA 4YCJA 4AI6A 4A7PA 4MV3A 3SHVA 2E82A 4NBWA 1E6WA 3U7GA 2OZKA 1TVKA 1WAMA 4ED9A 1ZLXA 5ALKA 1SHZA 5L3SB 4RHTA 4HNTA 2DKFA 1PJRA 1ZC4A 4V0MA 5CK5A 1CUAA 1OTYA 1ECFA 2FMTA 2O2XA 2TMDA 2XZOA 2UYCA 3ADCA 1SC1A 1HDOA 2R87A 3UKJA 4BEVA 4UEOA 4NIMA 2PUWA 2W6JD 3IH5A 2RHMA 4IGKA 3IVRA 3L06A 2QZJA 2GERA 4EB0A 3RSGA 1NBEA 3B1KA 4E30A 1EX1A 3MWEB 2F55A 1RTTA 1C9DB 3IPYA 2R47A 2F43A 4U00A 2PD3A 5JH7B 5FD8A 5HJ7A 4B0PA 3ESYA 3D8HA 1Y3IA 2UVPA 5HQJA 4XIGS 3CS3A 3T7RA 4P22A 4OGWA 3GRAA 1E79D 3W9BA 4BGVA 4X84A 3GFOA 5L4NA 4HXGA 3V6MA 4I46A 5FR2A 4TRNA 5CDGA 3NLLA 4Z9BA 1AQ6A 1OFUX 4IUBS 1KS9A 3E2PA 4RK1A 3TBKA 3U3KA 4B09A 2AVDA 1FNNA 3PXDA 3WTCA 1FTYA 1W25A 4PLZA 3ZVLA 1DRVA 3SE0A 2LIPA 5IJAA 3NPAA 4GSYA 2ZZMA 3OJXA 4UPVA 4CN8A 2YW9A 4U6QA 3CH4B 3QA3E 4TOIA 1Q2XA 3R3VA 4RKFA 1ZSNA 5FA5A 3OM0A 5FCDA 4CIAA 1PGQA 1DXHA 2GWHA 1R6VA 2RIPA 3RYCA 5AI5A 4LK3A 4R1OA 5EQFA 2XB2A 4RM2A 2GA8A 5I7WA 5K8LA 4MVJH 2IYZA 1TTQB 3RF6A 1SZJG 4CKZA 4CWAA 1BU5A 1Y7PA 2WYHA 3UEOA 2HTEA 1BYUA 5C4MA 1IBKB 2AUNA 1KHUA 4I55A 5CPBA 4YRFA 5FWYB 3C6KA 1AN0A 2EC5A 4NCJA 4UULA 2NU8B 5U1PA 2TS1A 4PE5B 2ZLBA 3V4VB 1ISIA 2E4VA 4YJFA 1XZHA 1U4SA 2UYOA 4Z4CA 4MI3A 8GPBA 1E66A 2Z8YM 3ESBA 4HDSA 1CUJA 4JJ7A 4II2A 5CNJA 4B81A 4E11A 5KVAA 2ZUEA 3E03A 4DDTA 2P7IA 3F49S 4BNNA 4MQFB 3ABZA 5E7JA 4K86A 3RS8A 3Q8MA 2ETVA 1IXSB 4U7WA 5AVKA 1UBTS 4ZQGA 2HA0A 3RBZA 3UK7A 5F73A 4CR6A 4M21A 1POWA 4C43A 3MRVA 1DRWA 2ZDHA 4N6GA 1VQ1A 1CUYA 5LIRA 3KQWA 1BWQA 1JS1X 2BM9A 4CM8A 5B1IA 3GNQA 3LAWA 1VZ3A 4HVCA 4OXXA 1LQ2A 4RHYA 4PLFA 1EVQA 4FYKA 4B3HA 2ZWVA 4M98A 4MCIA 2CD9A 1QHIA 3SBXA 4C4PA 2X9LA 3PHBE 3JVIA 4MV1A 2HMSA 2AOUA 4CL8A 4EYGA 1Z7WA 2AIRA 2GHQA 2V5VA 3LT1A 2R6AA 2XIQA 3UV7A 1WW3A 3H6HA 5EPOA 4C21A 1LZKA 3BL5A 3DAPA 1EM8A 6GPBA 3ETDA 5CGQB 4KGVA 3VYVA 4Y67A 2AWOA 4OB6A 3UMSA 4D44A 1VJTA 3DFZA 1REQB 3G1WA 3IE0A 4OQLA 3RU7A 1E98A 2R65A 5CCDA 3EZ7A 1U3FA 1RYZA 1ST2A 1V2HE 2ZRQA 5D5HA 2IC5A 1TYDE 5FORA 5AW9A 1DRJA 4UOZA 1DBVO 1CJMA 2OMEA 1RYFA 1UXKA 4RK5A 5DOZA 1XPUA 2C4HA 1XU7A 5DBIA 5ARCA 5EJHA 1NT2A 1K8YB 3CY6A 3PNYA 4IKOA 2BZSA 2DHEA 1VXRA 2FSFA 4DR5B 3PVZA 1YI1A 2H52A 2Y1DA 4E1VA 1FDRA 5IC4A 3SYKA 1DEHA 1Z0UA 2FUCA 1DXOA 1PGNA 3EXG1 4I5GA 3QX9A 4NQZA 4DTCA 1GZVA 1JEOA 2KQUA 3TLZA 1IZ9A 4IDPA 3NFRA 5KPJA 4M8LA 1BJTA 2F59A 2V1XA 4KODA 4RPJA 1OBCA 2FEAA 2DQ4A 2WHEA 4UEWA 5T8KA 3TQQA 3WRYC 1YRBA 2V96A 1IN4A 1WXQA 2QM3A 4Z4FA 2ZUUA 2GZ3A 2NNLD 4IDQA 3WK6A 5C4VA 3PQ8A 1UC9A 3P9CA 5JCOC 3E8XA 1ZKMA 5EKDA 1L7VC 5IXSA 1SCUB 3NHPA 1JEJA 1TJ4A 1WUKS 2ILVA 4G1BA 2BFDA 3QVMA 4GFDA 4GICA 5HM8A 4JLVA 3OE4A 2I62A 3JQAD 1Q1NA 5B53A 1N5OX 1UH5A 1TCVA 4EYOA 4TRRA 3GHHA 1TFUA 3TR5A 1I1OA 3DQZA 4I3GA 1OB5A 1U65A 2Q0XA 3ANXA 1EP1B 3WP0A 3IEXA 3EDMA 4CMGA 1T10A 3F7TA 1I0LA 5LP6F 1RS0A 3Q8KA 4WCFC 1TADA 3AV3A 1EGVB 3GFVA 4CQLA 3JQBA 2Q7XA 4CV1A 1NZDA 2BFFB 4JOQA 1OGYA 2G72A 3U3OA 4V1CB 2G4VA 2JJ2D 2X1VA 1W2GA 5AI8A 4DQXA 2CV2A 4B40A 4Q03A 5LXTB 4RQAA 1I6KA 3KK0A 2VHYA 4G56A 4GP7A 3V4LA 4BO7A 1A9YA 1W46A 3ZBPA 4JX9A 3FGPA 4FWIB 4QYXA 3I4FA 1GXCA 3HK2A 1TJ5A 2NO9A 3LVFO 2IS6A 1RXSA 2Z4RA 1WMFA 2P6UA 2VNAA 3EPPA 3EZGA 2D3WA 1I3OA 1VKRA 1WNFA 3MILA 4C07A 3TIVA 1Z74A 1JKJA 2YHUA 5CXUA 1YVPA 2QE7A 1AGNA 2ZJ1A 1Z4NA 1H23A 4QJ3A 4YR7A 4ZT4A 1FSGA 5JAHA 1J4QA 3TGPA 3BRWA 4KLAA 1VCIA 1LDMA 2YCLA 2VATA 3GFQA 3QU2A 4MWSA 2EYQA 3IP5A 3EQ9A 3OLZA 5J4HA 1PYOA 3B48A 3BWYA 3VI4B 3F96A 1SUBA 1ZRNA 4EI9A 3WDSA 3VC1A 4PPFA 4DCJA 1QFXA 1E59A 4N9QA 4XJVA 3OPYB 2WZDA 3O8LA 1B42A 3DMRA 3S4YA 1MVOA 1TMGE 4X1IB 1YRWA 3JAWA 2PKYX 2IGTA 4ZT7A 1HTBA 3DMNA 3NCTA 4K2AA 4UM8B 3A1TA 1L8XA 1X6VA 3FYDA 3BE4A 2YFYA 4DM4A 2BBTA 4FQ8A 4YWHA 4ARZB 5ALVA 3AOGA 1U0EA 4FC7A 2PLNA 1LI7A 4IDOA 1M34A 3E5MA 4Z1MA 3TFOA 4MW7A 2ZIWB 3R3WA 5LMUB 3L1JA 2MYTA 5I3ZA 3VKGA 4OL0A 4YROA 4JEUA 2AJBA 2DR0A 2PMFA 4JGGA 3S2EA 2RFLA 3G1UA 2GHTA 4NBSA 5FTMA 1DAOA 5DP2A 3SQLA 1EBUA 1YTUA 3LIPA 1H94A 1BGWA 2PCLA 4JBGA 2JVJA 3DL2A 3N2ZB 1JHZA 4HPXB 4MCAA 1LS6A 5DMHA 3ZJ4A 4CE6A 5KNBH 1WMEA 2C4VA 2W00A 4EHJA 3KJXA 1ZS9A 4XGRA 3GJ8A 4XI9A 2GM4A 1WSDA 5CU7A 2Y93A 1EINA 3BXXA 4J6EA 4P84A 3RKRA 3WYAA 1T4CB 4JMLA 3KQQA 3E4CA 1D8TA 4KWCA 2B98A 1APBA 5BW6B 5LZ5A 3CRMA 3MTIA 2R8RA 5LA6F 4JNCA 1YMQA 1EUCA 2P5UA 3C5VA 2H1SA 3WKEA 2DT5A 5DXAA 4Q93A 3AHHA 5DM4A 5EI5A 5D6NA 2J30A 1J1UA 4KQ9A 1K3QA 3AYXB 2O3JA 5E6UA 5A2GA 1P8AA 2WJHA 1ZHFA 3C8HA 1T8SA 2NXNA 2WUGA 4HLUC 1MENA 3HXOA 1HSOA 3FCSB 5EXXA 2C2BA 3V46A 3M83A 4P7BA 4D8YA 4ENRA 7REQB 3BPSA 2IYAA 4LGMA 4RS3A 3U40A 4WFIA 1Y3CE 1OIWA 1QGUA 1VHTA 2QTHA 4IMIB 1KTIA 4QHTA 1CZHA 2JQLA 3DOCA 3HJHA 2GRJA 3FNGA 1C1YA 1PV4A 2P91A 4JROA 2HYIC 5JHGB 1BS9A 3T3GA 2QUKA 4BU1A 2J3QA 4EY5A 4ERNA 1JR4A 4KKXB 4X8HA 4WCFB 1BE0A 2BDUA 3MUOA 4FFRA 4X3CA 3ILSA 2LCQA 4CLRA 5ALWA 2QQGA 3MJEA 5TX7A 4BFVA 5LZ2A 5ALQA 1E0JA 4ZVPA 4PZPA 4HDKA 2ZT6A 3GRZA 4DA0A 1DXYA 1GVNB 1MFPA 4I6JA 3EPJA 1CB7A 1FP7A 1UKEA 4LQCA 4OX9Y 1MX1A 3C5HA 5EE3A 4M7WA 4X6YA 2XBMA 1EM6A 1P74A 4LXTA 4YJ2B 1J5XA 3V42A 5KJFA 1EFKA 2P9FA 3NUZA 4AJIA 1EXDA 2HPZA 4GX1A 4I36A 4V2IA 1FY2A 1KO7A 4XAQA 4AG6A 1T4BA 1Y1LA 4Z7QB 5JQWA 4KR2A 3UM9A 1SB9A 1PWHA 1MC1A 2ZIFA 4ZGGA 1GL7A 1RBZA 3H2KA 3LOQA 4PHTA 1NR1A 3KS9A 1JPUA 4UEQA 1TC1A 2DFDA 3L07A 2EGHA 4C04A 5I7RA 2ZKIA 1AKMA 2NVWA 2AUTA 1RZRD 3ROFA 3C15C 4B3TB 1P81A 1PIWA 1UPUA 2W58A 4QBHA 4HB4A 3TZHA 1WZEA 3ZXSA 1L5FA 1LDGA 1ORDA 3DE5X 1LFAA 3GJ3A 3QVVA 5JR3A 3WBJA 3OIVA 2B36A 2SCUB 5LYJB 1GNTA 1VHJA 5IM4F 2B7BA 2QBYB 4OXIA 2OO3A 4QBFA 2DUUA 3AERA 3SBEA 4D3FA 1LDEA 2AW5A 2EHJA 4GX5A 4PYOA 4F04A 5K9ZA 2X9VA 1E9VA 3ANTA 3HMQA 1OU0A 2C2KA 2G4CA 2P1DA 3P2OA 4GUAA 1IOVA 3ISTA 1ZK0A 1GSOA 3GLIE 4IIJA 2CFRA 3PWZA 2Z58A 4RL6A 4CPDA 3W4KA 3TN7A 2AFIE 1OLOA 1WU8A 3Q10A 3GEPA 1ZY2A 1ZCZA 4WUVA 1RI5A 1ZR4A 3AV0B 1G8AA 3FG9A 5KTKA 4FMDF 1N6RA 4IXMA 5KCMA 5HWSA 4IL5A 3WKBA 1TYEB 1CQIA 1YONA 4LXIA 4M0CA 4TS4A 3W77A 4CIVA 4JX8A 1JA9A 2I99A 4FVTA 3S8EA 3EWAA 4C01A 3GOHA 3OCJA 1RSZA 3TUIC 1RT9A 1XZPA 1JWLA 5CT6A 5MFZA 1OZFA 1T15A 2JLSA 3R0IA 2QVCA 4IDCA 4BN0A 4TS3A 4Z0PA 5KYXB 2VJQA 3FOCA 2IY9A 3LUCA 5B3LA 4HEHA 1OV6A 1O95A 2LC1A 5DHRA 1XJQA 3EXHB 2BMWA 3G0BA 4UU0A 2WFLA 3ZXUB 1E1RA 4B4UA 1VB3A 2ZG6A 3MBOA 2RJOA 2VJCA 1MH1A 3DE4X 4IAOA 4AJ9A 4IHJF 4MITA 1DX6A 3TXAA 1NY6A 1G3IA 2PJZA 3VSEA 2QG9A 2XNHA 4CJXA 1N2IA 1F0PA 4X60A 1HDZA 1T5IA 2KBEA 5TE9A 3Q1KA 1NV8A 4GUDA 1R6XA 2L42A 3F6EX 4JXJA 1B2RA 1YS7A 4NPHA 4C20A 1UT6A 3KAKA 4TTVA 2IPOA 2OBLA 3AIMA 3AT1A 4RDXA 5DYGA 2PRZA 3GLIB 1LS1A 3LFTA 3PHGA 2BISA 1T3GA 3B78A 2YN2A 3INTA 3PD1A 1ESEA 2ONCA 2AFIB 3K2EA 3RVLA 3ZWNA 3X1XA 4D3ZA 5CT9A 3UMGA 1L5HB 5EHXA 2JC3A 5ANRB 2REQB 4I14A 2ROQA 2CLLB 3VYRB 4B4VA 2QJTA 1M2JA 1CQJB 3AJRA 3ELBA 4JITA 3NBAA 4RX1A 4XIFA 4F7WA 2EYUA 1QG4A 1D1TA 3D7NA 3BTVA 3GDWA 4K9KA 3L4JA 4WLVA 2FWAA 7YASA 3HCPA 2EKQA 3VJLA 2YZGA 3S5UA 4Y9UA 3V4FA 2JCSA 5K1ZA 1LBHA 5F9MA 5FLEX 1H2HA 3LBYA 3C8DA 3OZTA 3RYFA 3O8OB 1A72A 1N92A 1Z75A 3G5LA 3GCGA 4YMLA 5G0UA 2XGJA 1BO6A 3W5BA 3CFYA 4KL8S 3NRBA 2OQRA 2AF4C 1GSHA 1ZQ9A 1PEDA 1RWKA 1UJNA 1TUBB 2GYUA 1FDWA 3JYQA 2ZTUA 3F6SA 4TV8F 4ZJUA 1LWNA 3HMKA 4AZ0A 4XKJA 3H87A 5EHZA 1BEEA 5K8CA 4RSHA 3B38A 3P20A 3KU4A 4Z1OA 5JEDA 1F7VA 4CXMA 2QM8A 1JDSA 2B21A 5HKKD 5ELLA 2OD9A 2FOXA 1D0VA 1ULBA 4JUDX 2YX1A 3JXEA 2H65A 5TQ0A 3ZCUA 4YMTA 3FCXA 4P3XA 2RC6A 1W19A 4LK2A 2HLHA 4M9RA 5H9VA 2X0KA 2Z4TA 4NSNA 4ND4A 4RF3A 1CRLA 2CCKA 3TR0A 1J5EB 2J46A 3QEBZ 1YL7A 1RRMA 4R2HA 3VPDA 3D7SA 1ZL0A 1JR3E 1UWVA 3WGTA 3U1BA 2B92A 2EAUA 2BR4A 3K35A 5HKBA 2IYQA 1ULSA 2YWBA 5EESA 1U2TA 1SXGA 1WVGA 4IR7A 5E1OA 4L1KA 3RVRA 3RYHB 3QIVA 3VGJA 2NVUA 3EVCA 2FPPA 3DCJA 2WUFA 3AFGA 4OYYA 3I9LA 1DAFA 1U8TA 1TZKA 3D2CA 4BNDB 1YU9A 3OLWA 3N2GA 4DB2A 3SQNA 4C0AC 2QRHA 5BN3B 1OB2A 3DTVA 3KO8A 4DT1A 3BA1A 3A05A 4W1SA 3CN9A 5AD1A 2PU7A 2AHOA 2EZUA 3ZDEA 4LOAA 4RD1A 1ZIXA 3ZIAA 1YE5A 2BSQA 2A1TR 2XZDA 2CBXA 3V97A 1QHHB 2IOQA 3FTDA 1T35A 5J9FA 3KZKA 2FVXA 4B7CA 4DG8A 2AS0A 1M8JA 2FSSA 4H6XA 4QUDA 2I8LA 2OV8A 2YJ3A 4AG5A 3E27A 4DBLC 5JSUA 4TUYA 3NTVA 5LXTF 2F2TA 4J0DA 4E4RA 4H0CA 3IXLA 3JVVA 1BN6A 4ARVA 4CU5A 2AJ8A 4XYGA 5AUOB 3D6NB 1ZN9A 3HCOA 2BZ1A 4R9NA 1UKZA 1Z0JA 1FDVA 4LPSA 1IHDA 2CNWA 4BCBA 1K3TA 1RZ3A 2F9LA 2F9MA 2XCLA 2XDAA 3GT3A 2FZGA 3U44B 1FNCA 1XVTA 1RRFA 2AL7A 2PLRA 3B2EA 4B32A 2BLNA 1J2FA 3O21A 3WQRA 1YGSA 1AS0A 5DNVA 2WB4A 4UUNA 1I4EB 2WAAA 5D01A 1NU6A 2EZTA 3ND7A 2YXNA 2OV6A 3FDIA 3HADA 3SHQA 3WGHA 1GNQA 1TJYA 2DBZA 3GP5A 1GQFA 1KYVA 1YACA 2JK0A 5FBHA 3L7YA 3O9MA 4CGYA 4GXQA 3GA0A 3TL3A 1AV7A 1VKNA 4I50B 4Q4LA 1EP3B 1ZUIA 4RMNA 3RUPA 1AKEA 3UN0A 2HMUA 2MYPA 4I1YA 5JCJD 3KETA 5FA6A 3JQ6A 4Y6LA 5F3RA 5JH7A 3E18A 4QVGA 3FGNA 1ACLA 1DPFA 1HYQA 4Y2XA 2BF4A 2V9ZA 5DXFA 3TJMA 1KZ7B 2XDWA 3FBWA 4DWWA 3RUEA 1YV9A 4GXTA 1UZMA 1X15A 2PZBA 4S24A 3W5CA 4DCGA 1UJMA 2WNHA 5GGYA 4G2NA 3VKHA 1OWLA 2E0IA 1EUDB 4MNTA 4XH9B 1R0LA 1YS1X 4NJEB 1WE2A 3T99A 1NKTA 2WNSA 3GBSA 3OQNA 1IOZA 3EYWA 4A8JC 1Q3KA 4CQMB 2WSYB 3ZG6A 3NDJA 4PR3A 4P3PA 3F5FA 3GNTA 4L7VA 4QYTA 2NWQA 1Y6JA 2JLAA 3NOOA 4J1TA 1BX3A 1HDCA 2E4AA 1SVLA 2UU9B 3VA4A 4WXEA 5KMGB 2GK3A 4L6IA 2CFOA 3IHKA 3R3XA 4OA5A 4CLXA 3LRPA 2CXRA 3SLKA 4I55F 1QE0A 1U7ZA 4GM0A 1B0UA 1Z26A 1LLQA 3O95A 2SBTA 1G6GA 1RW4A 4PX9A 2EJUA 2JI6A 1I2BA 3A6DA 3TMAA 1J8FA 4MP8A 3REOA 3VTKA 4PNEA 3SDBA 3HJRA 5AJXA 3D8RA 1ZUD1 4Y30A 4L4YA 3MGAA 1K27A 3B7PA 1DWQA 1S2DA 1SY7A 4PVDA 4PPYA 3EZYA 1XN4A 3OHSX 2NU8A 3PP8A 1MB3A 4NBKA 3WLQA 3C6QA 4UW9A 4CLDA 8MHTA 4UU1A 3CX6A 4BVHA 3A6LA 4QODA 3VSBA 2EVWX 3LDAA 4JELA 1THMA 4RVCA 4CYMA 4BQFA 2FWMX 2MR5A 3QFSA 4URZR 1I8TA 3D8SA 4TLLB 4V03A 4DF3A 3OBBA 2HXYA 3PGA1 1CEEA 4I66A 1TU4A 3OZCA 3C7KA 4OMCA 4D82A 1M5RA 4RS4A 4OH7A 1ZKDA 2IYOA 1CUBA 1R50A 5HCIA 5AW7A 3RRJA 3ADDA 3KHUA 3KTAB 4EW3A 5IWCA 4LJ4A 3RC7A 1RPZA 5LCXA 4UNRA 1IY1A 4DCPA 5LJLA 1J5PA 1JGTA 5FT9A 1P1JA 4IV8A 3TDMA 3DEKA 2BL4A 2RK4A 4TSKA 5FJIA 2Q2OA 3L8HA 3GZ4A 4AROA 2H16A 2W3OA 4J49A 2OTCA 4PVCA 4W1RA 3BD6A 4MKIA 4PZLA 2EKDA 3UJ7A 2FDXA 3K4HA 3T5MA 1U9JA 4OQNA 4OKNA 2X58A 5IJ9A 3FMGA 5CA1B 2BGLA 1ZD3A 2FZLA 5HHTA 2BGRA 4WT7A 1KU6A 3T0FA 4F1WA 1QBGA 2NUBA 3QOFA 2MSWA 3TX2A 1H1LB 3AY6A 4HXEB 1CIVA 5IVKA 1JI0A 5BV2P 1GCGA 4YBZA 1DWOA 2APJA 2ATXA 2E37A 3ZKWB 3SSMA 3F5MA 3PGLA 1RYNA 3BZWA 4PS0A 2BBOA 1L7PA 2PRIA 3KXIA 4PQGA 4QQNA 3UB4A 1NUTA 3N87A 4AULA 1CJVC 2AG0A 1DT5A 1JHXA 1WF3A 3NHMA 4HWTA 4KN9S 3TNDA 4C6TA 4DEYA 5JZBA 4F5DA 2IUSA 1PFVA 4O1IA 3LFHA 5HKLA 2P2LA 3GEIA 5IP5A 4LKOA 2G08A 4FXPA 1U04A 3JPWA 2YIDA 3TAHA 1FNMA 1XQYA 4B6JA 3DEJA 5DNAA 3OQVA 3CXRA 4PAWA 3DKRA 5B58C 1X7HA 2A5FA 1NASA 4CQNA 2YWRA 4QPJC 5ULLA 2DR2A 1QUEA 5E2AA 3MYYA 3A4IA 5NULA 3QNMA 4XCVA 1JHRA 3VU9B 4YCLA 2P6PA 2YYZA 2YICA 1F8UA 4ND8B 1WMBA 5TJHA 4EJMA 1Y3BE 4FD2A 2RD2A 3DP9A 2BI8A 3MGCA 3KQTA 1JG3A 5A4AA 3HXLA 2BFCB 1ZGBA 2P3QA 2QVBA 3QU5A 4GPTA 1FX1A 4XUDA 3UQZA 2YWCA 3H5VA 4QRIA 4WSOA 4YHBA 2PM8A 1W0KA 2GO7A 3L1HA 3R8FA 4CIBA 3BGVA 1TVMA 1ZUNA 2IW3A 2O3TA 2P9JA 4A8JB 4ENWA 3RK4A 2N75A 1SKYE 4Q1DA 4H1TA 5DW0A 2RH4A 2Z2XA 3G23A 2NPOA 2ZYIA 1BEZA 1BS1A 1VE1A 3MUFA 4YCMA 4GDMA 1ZH0A 1AK2A 2AFHE 5DRTA 1KOLA 2ECQA 3GVIA 4ZPJA 3ZDXB 4DXHA 2FWRA 1U1CA 1DSSG 1E0KA 1RXCA 4RDIA 1VCHA 2NZUG 4BHTA 2YJNA 1MT0A 5F51A 1DX9A 2BFFA 3Q9NA 1KXZA 3FETA 5JNSA 1GPH1 2HXSA 3H5IA 4I9HA 5BOSA 1XK7A 5IC6A 2MSLA 3T5GA 1OH5A 4TYWA 3TZKA 3TW8B 1KKUA 3N8GA 2FKAA 1NM5C 1TYZA 1Z0IA 1TLFA 5K0LA 5BWCA 3ECCA 2ZQYA 3MWYW 4EVQA 5CYGA 3EAQA 1WCIB 2A33A 1UINA 1W49A 4GAEA 2PUFA 4ZN6A 2W2LA 1W7AA 4MR8B 5LMNB 3T6KA 4F4HA 1KFEB 4FINA 2ESRA 4N0DA 4BV2A 1P17A 3PE3A 2JEOA 1JE0A 1VHWA 3WAKA 1O0CA 2IH5A 1S8OA 5B3JC 1KRWA 1E4EA 1S2GA 2ZSBA 2E1RA 4TTAA 4YV0A 2FPGA 1EDOA 1U1DA 2TECE 2GZHA 3ABIA 4YAUA 3M5PA 1T8TA 2CFTA 5DK6A 5JD6A 2H2IA 4TGLA 1SQ0A 4ACAA 1SCKA 3M9WA 1OE0A 2PKQO 3RLFA 1SKYB 3KVYA 2IIPA 4CMIA 2JASA 3OPYA 3OCWA 1XZBA 1SZCA 4HUJA 3THSA 4I3HA 2NXJA 4X1IA 3VOAA 5IXYA 1G9TA 3EPRA 4QJBA 4UDXX 4CKYA 1B6RA 2F1RA 3CCFA 1NHGA 2VXBA 1GGFA 1JSZA 4I1PA 3WGLA 1QIFA 3FYUC 1R6TA 1B7GO 5FNVB 3RRYA 4ARZA 3GXBA 4EDFA 1W76A 4RNCA 2AI2A 2VUHB 4XD7D 3T35A 1UZUA 1ESNA 2PSDA 2NO5A 5CVEA 3OZBA 4WN9B 3INGA 3KT3A 5FYDA 2DUNA 1BCSB 2ON6A 1L5KA 3W6ZA 3RTBA 2RJ3A 4R01A 2QR2A 3AF5A 4URFA 1DHTA 2NVOA 4TN1A 1WEKA 1D03A 2I34A 3RB8A 5MFPA 3CNQS 4P8RA 3TECE 5ALIA 2HRQA 2Z08A 5BY2A 3PEEA 3AGPA 3R5TA 3VJRA 2YBEA 3R8CA 3Q41A 4CTNA 3M6VA 2OY0A 4DPKA 1RJFA 2YIJA 4R2MA 3CGGA 3U1VA 3ADKA 5A3JA 4F5ZA 4YP5A 3KAQA 3B12A 1FUUA 2IF0A 2BC9A 1ZVKA 3AKCA 4FKZA 1DCTA 1UAYA 4MR9A 5BW8A 5KYTA 1EZZA 2GR9A 5AJYA 5KNDD 2DRIA 3NYQA 3NTXA 1B8NA 2JLRA 3JWGA 1Z4LA 4BNMA 2C4TA 4MYHA 1N1EA 3ETCA 4KV7A 1VMAA 1YOBA 5ARDA 3WRYA 5A9SA 4PX2A 5JATA 4E4TA 2FPOA 4ASUD 5K0ZA 1EPUA 4YRMA 2QVLA 1LPPA 3G9QA 3TLGB 5B30A 5AJUA 4LZOA 1IWPB 1SUDA 2XLCA 4C7KA 3UAOA 2G77B 5TPWA 1NMSA 5D3KA 3WL6A 3R9IA 2PAAA 2PU5A 3KPWA 4BMYA 5I5EA 1GADO 1Z22A 3ORYA 2HB6A 2GASA 1FFSA 5GZ3A 4MPRA 3TJZA 2GBIA 3EDCA 1G17A 1H93A 2WIFA 4YH1A 4A2QA 1VJ0A 5JRZA 3T4PA 4AP9A 5ICGA 4U02A 1YHYA 3IVMA 2OQ2A 1Z6TA 3S40A 1HG1A 3IP9A 2C03A 4NAUA 4WNIA 5TXGA 2JI7A 1H9AA 3HM9A 3DOOA 1JJFA 2Q3LA 1QX4A 1GAWA 4FFBB 4ICIA 1ODSA 2QZSA 1ICIA 1PZNA 5T4HA 4CF6A 3W5JA 3JQCA 4PFKA 4ZC8A 3ZS8A 2MINB 2ZRDA 3EUEA 3KEQA 3EN0A 3W4IA 3O8BA 4ZVTA 4YJ2A 4JB0A 2H0RA 3VU8A 1NJ2A 1XCGB 2VXYA 3M1LA 4FFMA 4FYXA 1SWWA 4BMOB 5A4FS 3VR3A 1LI5A 5DH9A 4Q7MB 4JYBA 2HMTA 3LRTA 3ZDZB 4C4AA 4UVDA 4OKIA 5HDBB 3BZBA 1C1HA 2DE0X 1ILWA 4URXR 3I92A 1NXXA 1HKHA 1QORA 2W6QA 1QGOA 4JCOA 4NYMQ 4TZKA 3VSDA 3BXGA 1ZEMA 5B7GA 1XDWA 2VHTA 3SZ3A 4WTOA 3TDNA 5FL7A 5DX8A 3TSOA 1NXSA 1RPTA 1WMAA 3L6BA 4XUCA 4ZGWA 3Q98A 3O92A 1EBFA 4PTLA 5EZ5A 3W5VA 4IIJF 3ZE2B 5LYJA 3FPFA 4D0LB 1QP4A 4S1WA 3LV8A 3OA0A 1SC4A 3UGTA 3DNPA 1F38A 1H4SA 2FR0A 1LPBB 1UOEA 2XOKD 4LWZA 5K6TA 2CBGA 1WV3A 1KOFA 3A36A 3PSHA 3PJDA 4E5DA 3O93A 4WEQA 1E3MA 4C05A 1EJ2A 2X9QA 3S2SA 1UXJA 4EK9A 5G1PA 1QIEA 2QMOA 1HQCA 1WSWA 2C82A 2YINC 4DSZA 1W5BA 4IHAA 1N5RA 3CKYA 2PZFA 2GN8A 3NHFA 1MEJA 1NVTA 2XDYA 2YR0A 2PZEA 1K89A 4OYLA 3W6NA 1W4LA 1RMTA 2IUYA 1ZH8A 2X6RA 2FNAA 1AD2A 3QEMB 4YT5A 2CL0X 2HQRA 3PQFA 2RHOA 5CG2A 4ARSA 4DZRA 3GEEA 4LJSA 1XRNA 5K3FB 1ZIDA 4NBLA 4KQCA 1NONA 4CCAA 5CTAA 3OD5A 5JFTA 3NYRA 3I12A 1C0LA 3EXHA 1EVJA 5EZQA 1K86A 1FTSA 1HZZA 1QVZA 3KJEA 4US0R 3T34A 4A4DA 1WLYA 4WNCA 4C9BA 2C9YA 4LV8B 1L4LA 4UZFA 3ESAA 2RBKA 3K0CC 1DFGA 3R0QA 3ROZA 1L4MA 3N59A 3NX4A 3T9EA 4K6GA 2GTPA 2RI6A 5FP0A 3W8NA 4C03A 5LQJA 4L07A 3K15A 4J0FA 5DGIA 2XEDA 4O2AA 2VJNA 4HLUA 3BOSA 2Q1TA 4ACBA 1H22A 2QTRA 4CI0B 1Q12A 1YFKA 2G07A 2LW7A 1VJ1A 4FN4A 5ALGA 3QV1A 2V6FA 3GLIA 4MKHA 1EWYA 2FQQA 3C4VA 1G5HA 2XQJA 3WBKA 5IANA 1QIJA 1UOPA 5DE3A 5JQGB 2AFIA 1C7ZA 1YKSA 2JEYA 4UDOA 4G0XA 3RJ9A 1L5HA 2OBNA 2R5NA 2ATIA 1FYEA 1BWRA 2WA2A 3JSXA 4YP9A 1GR1A 2AKEA 3IEPA 5JNRA 4FSDA 2VJDA 1T2VA 1CQJA 1GA4A 1PAUA 1XMPA 1JB1A 3FWKA 3I3SR 3HV2A 5E6RB 1D4AA 1C7EA 4RY8A 4US2R 4FYYA 4DEVA 1N2XA 3CVJA 2ZVQX 2NTNA 4BP9A 2DM6A 5K51A 3SZMA 3G2PA 1WPXA 4RJTA 5F64A 3OZ7A 4B46A 1X9HA 2GRAA 4J0QA 4XZ3A 2C2HA 4LHZA 4EATA 221PA 4KXXA 4L22A 2FPLA 2ZYUX 4QO8A 5E0OA 2HHJA 5ALYA 1DUSA 1QJCA 3O8OA 4EKIA 1GUBA 2WTAA 3HN7A 5KOHB 1PHRA 2IHBA 3FFTA 3LUFA 3NM5A 4Y7DA 4B33A 5IHXA 2FF4A 2VHZA 3LA8A 4G1EB 1VPVA 1YBVA 1ULAA 2V7UA 1SA0B 2XHEA 4RVGA 2DEUA 1UC4B 4MWZA 5I3CA 2P9QA 1DRKA 3ZEIA 1JFLA 4RTMA 2VBGA 1LK7A 1NJ5A 1PT8A 3FCOA 4CM5A 4YRAA 2CJWA 5DYTA 1YDMA 3HPQA 2JAXA 4OSOA 3IXMA 1YZUA 3RSFA 2QL7A 3OIFA 4MYSA 2I6XA 4TLMB 1XX6A 2ZJOA 2PVCA 1PWYE 2X4GA 2RK3A 2E2WA 1NULA 1RLMA 4H7FA 5FI0B 2FG6C 1L5RA 1R0XA 1XRMA 2FZCA 1GKKA 4ZK6A 2BY4A 3PWTA 1OZAA 4QBKA 3R0XA 2OCYC 3UV6A 1IJFA 3FTCA 3UKOA 4DM3A 3PDUA 4PGAA 4DW8A 2O0KA 1BCRA 1UWKA 4XYEA 4WFQA 1IY2A 1IY0A 5DHFA 1IUPA 3BE6A 3SDSA 2G8NA 3UOWA 1MO6A 1NZFA 2Q1YA 4QUJA 3RYHA 3LUJA 3SR0A 4ZO7A 2H0AA 4CIDA 1AQJA 4KPEC 4AF8A 4NATA 3SX2A 3II6X 2OUKA 1V8ZA 3BF8A 2HT1A 3ZCTA 3S81A 4BNDA 3AILA 3HP4A 3J80A 2GXAA 5LNK1 3CMCO 1K88A 5HQ3A 4QOEA 1Q21A 4MPDA 1ADFA 4QQFA 4TQGA 2ZAMA 3WR5A 1A04A 1YHNA 2FZEA 4PZUA 5AVOA 4NEQA 1C80A 2TSYB 1Y1TA 1DLIA 3Q6NA 4HB3A 1T4GA 4TMFA 1HRDA 1SK8A 1XEFA 4CODB 2E5LB 5DX0A 4PSKA 2HNBA 1QYIA 3DHVA 1L1FA 1IK6A 2YL2A 5BUSA 4H77A 4K9PA 1QGDA 4BNYA 1JP7A 1QNFA 2VKQA 4ZMRA 5HZGA 5LQCA 1EIWA 1Q1BA 2Q3JA 3UZUA 1SQGA 2GBCA 4H4CA 2XMGA 1CR4A 1TPYA 1P39A 3UV0A 1G19A 1M5TA 1P5HA 1NX9A 5ICSA 5C80A 1WPGA 1JKIA 3NP9A 4HVAA 4N7BA 1Y6QA 4MEAA 2AD5A 4MVXA 1JDJA 3IYLW 4NCNA 3JASB 1FXWA 3NOVA 1FFEA 3IA7A 3OIGA 3QVTA 4HT3B 3PGVA 3I2IA 3T9CA 1XLUA 5EZSA 3T1VA 1TI7A 3O8QA 3NDPA 4FCWA 1JWAB 4U7PB 5JZ9A 5DHQA 1CHDA 4OI1A 3U44A 2XDQB 3CUTA 4J76A 2FZVA 3BTOA 4PHFA 2BMDA 2B1RA 2AK2A 1AF7A 1DDGA 3R76A 3RS5A 1N8KA 4Y2HA 3DONA 5HW0A 3L0DA 2X86A 2O3QA 3LK6A 1NVUQ 4LY0A 4DM7A 3TOCA 2NU6B 3PBKA 2W70A 4BRUA 4U7DA 2DSNA 2D2XA 1W8IA 2OFXA 3CPJB 4I50A 1AX9A 2EX1A 2O2SA 3WRXC 3LT4A 5JBIA 1XALA 2C7PA 1UHTA 1PVVA 1WBDA 1IZYA 2BUBA 1ODJA 3JPYA 3TTSA 2VAVA 4HMPA 4RFLA 1Z73A 2BONA 1QK5A 4JSYA 4W99A 5ALXA 3HY4A 4Q9HA 5DNDA 3V8PA 2FPWA 3ECAA 2XUFA 5KWVA 3ESQA 1ES9A 4QUIA 1HZJA 4QAJA 4E33A 3GH1A 4I0WB 1FYXA 1HT0A 1EJ0A 4ZEOA 2NYUA 4X94A 5LL6P 1ZWLA 4CQMA 4P54A 4RLQA 1ARZA 5AVXA 2YYYA 3QMPA 4H1WA 3KDAA 3M6UA 4WDRA 3I1FA 1XDBA 3HJCA 4TVKA 5KMGA 4IWYA 1ZJWA 2IUFA 2V65A 1G98A 3TRDA 5BORA 3CR3C 2PGXA 3MM4A 4YECA 1A7KA 2G4LA 4HFNA 2CSWA 3UFBA 2ID4A 1OA0A 3H1BA 1TM3E 4LRQA 2Q07A 3V1MA 2I33A 2BELA 1U81A 2IY7A 2QAGC 2XGMA 2Y3IA 4AVYA 2WWRA 1E1KA 2ZBUA 2BGKA