3HUIA

Crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
112
structure length
112
Chain Sequence
VPRGSHMAKINFVDHTGETRTVEVEEGATVMEAAIRNAIPGVEAECGGACACATCHVYVDEAWREKVGGPSPMEEDMLDFGYDVRPNSRLSCQIKVSNELDGLIVTTPERQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein recognition in ferredoxin-P450 electron transfer in the class I CYP199A2 system from Rhodopseudomonas palustris
pubmed doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 31
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3huiA00
4YTMB 2H88B 4YSZB 1CZPA 1J7AA 2H89B 5MPOA 1L6VA 1RM6C 1B9RA 1RYJA 1FIQA 1N62A 1VJKA 3B9JA 4ITKA 3DWMA 3SR6A 1VLBA 3AEFB 3HUIA 4JX1C 4YT0B 1YJJA 2W3SA 1XLNA 2L52A 4C7YA 2HTME 2KAJA 5G5HA 1QT9A 4ZHPA 1E9MA 1OQRA 1WYGA 3P4RB 2EKIA 3P63A 5EE3A 3CWIA 3P1MA 3AE7B 1FFVA 1E10A 2MH7A 1N5WA 2PKOA 5AUIA 3BIID 3FAHA 3L4PA 1XLQA 1ZP0B 1QF6A 1WGKA 1JQ4A 2ACZB 1GPXA 2LEKA 3P4QB 4WWMA 1RFKA 4YSYB 2W3RA 1WWTA 2K9XA 1NVID 3AEGB 2AX5A 1RWSA 1JROA 3AEAB 4YTPB 5H92C 5G5GA 5C2TB 3P4SB 2WU2B 4HRSA 1V8CA 2BS2B 3W5UB 2K5PA 3ZYYX 1NYQA 1N63A 1NYRA 1QLBB 3AEEB 2G1EA 4JWUC 1FM0D 2WDQB 1E6EB 2B76B 2FBWB 3NVYA 1TKYA 2WDVB 4YXDB 2WU5B 1A70A 3KWLA 1JW9D 1KRHA 1AWDA 1E7PB 1GAQB 3AN1A 1SIJA 2WP9B 3AE2B 3NS1A 4USAA 4C7ZA 1FXAA 1N61A 1FO4A 3AE5B 3AEBB 4YSXB 1N5XA 2KMMA 3B2GA 3ETRA 3FC4A 1L6UA 1TKEA 1NENB 3AE4B 1SB3C 3AE1B 1NEKB 2BT6A 1TJEA 1FXIA 3NVZA 3EUB2 1WRIA 1QOAA 1FFUA 1ZXIA 4FXCA 1EWYC 2WS3B 3RPFC 2DWQA 3VR8B 1XO3A 2L83A 3AE6B 3AM9A 1PDXA 1V97A 5EE0A 4N58A 1DOIA 1JWBD 1SF0A 2CU3A 1QOFA 2W54A 1YJIA 5AUKA 2WQYB 3NRZA 1DOXA 2PVGC 5EE1A 2M19A 1CJEA 1IUEA 1ZOYB 1YQ3B 5C3JB 1VDVA 2JX5A 3AEDB 2K22A 1I7HA 3AMZA 4ZOHC 3AH7A 2QJLA 1PUTA 4A9AA 1JALA 1NI3A 3SFEB 2BS3B 1F0ZA 3W9CB 1UWMA 1ZUD2 3DWGC 2Y5CA 1PFDA 3AE3B 1XLPA 3HVZA 2MJ3A 4C80A 2PVOD 3LXFA 2DBYA 5EE9A 3VR9B 3W5VB 1E0ZA 3WCQA 1QOGA 4ZHOA 3AECB 3VRBB 4KX6B 1J7CA 4LTUA 4N59A 1R7SA 4WQMA 1JWAD 1FRDA 2W55A 3NVWA 2MJEA 1OFFA 2OHFA 3AE9B 1XLOA 3CIRB 5H8YE 1L5PA 1TYGB 3HRDD 2CJOA 1YQ4B 1FMAD 2WDRB 3PO0A 1QOBA 4JWSC 3SFDB 3NVVA 4HROA 3AV8A 1DOYA 1KF6B 1OQQA 2PIAA 4IDIA 1FRRA 4YTNB 3P4PB 1ROEA 2JQRB 1AYFA 4P6VF 1T3QA 2WLBA 4US8A 2MJDA 2N0SB 2M56B 2BS4B 4N6EB 1N60A 2E3TA 1J7BA 2CJNA 2QIEB 1L0VB 3B2FA 3AE8B 1JRPA 1WXQA 1TKGA 1KFYB 3LB8C 5GXGB 3AB5A 3ABVB 3VRAB 2Q5WD 1DGJA 4US9A
chains in the Genus database with same CATH superfamily
3W1SA 1Q0WB 4ITKA 1PYWD 3AEFB 2R61A 4YT0B 5JHAA 1YJJA 4BZAA 2ZEQA 2O2VA 1QT9A 4DHJD 2IO1B 2IGHA 3FAHA 4WWOA 2KJ6A 4IW0A 3FILB 4IM2A 4HKQA 2YVCA 1HQRD 2K9XA 3IAS1 1YX5B 2QSDA 3AEAB 1JROA 1VZ8A 4GXBA 3KW5B 5FR3A 1L2NA 3Q3MC 5C1ZA 3KWLA 4OHJA 2OJWA 1SJED 1AWDA 2UWQA 2N4FA 1J8CA 3RT3B 2JY6A 3WALA 2KMMA 1V1OA 2FAZA 2C7NB 1E8ZA 2N1VA 4NQKE 4H2AA 3W1SC 4M00A 4W9FA 4EOYA 2M17A 4J6IA 4F1SA 3OG5A 3FILA 2DZKA 2NPTB 4R3DA 4MELA 1E7UA 1KM7A 2QJLA 5BYQA 2KWDA 4P1CC 2VZKB 1EF5A 4KZCA 4W9IA 2INPE 3ZXRA 1CQVA 2WDTB 1E8XA 4B0MA 1YD8U 3L17A 4A90A 3PRMB 1GUAB 1LM8B 3AE9B 1TYGB 1SE9A 4HXDA 5LXIB 2D11A 3PLUA 2PLPA 3R7RA 4A3PA 2XN9C 2K6QA 1XCTL 4HDQA 3SDLC 2OEDA 2K0PA 2WXMA 4B6WA 2N7JA 3ABVB 2XK5B 4EZJA 3A9KB 2KT7A 3EGRA 3T8MA 3KUDB 2H89B 3U52E 5MPOA 3Q69A 1UZXB 4NAWA 2M1MA 2MCNB 1TS5A 1L0YB 4WIPA 2MW5A 2LMCA 2N1WA 3IT4B 4IC7B 3P4RB 1SJHD 3CWIA 4LNNA 2IPKD 2GMIC 1RAXA 1ZE3D 3VTVA 3UF8A 5DPRA 2FIDA 4ZRQA 3Q3NC 2X38A 2KXJA 2JXXA 4KKIA 1NBFC 2QC8A 2LI5A 1A5RA 3QC8B 2LWPA 3EC8A 2RDBC 2D2QA 4MM3B 3V3XA 2WXRA 2PMVA 1FXIA 3Q8BA 1WRIA 3GOEA 3HVDA 1AN8A 1XO3A 1Z5SB 3AE6B 3DPDA 1DOIA 3ZNID 2BKRB 3APDA 2KYWA 1TZ1A 2LGSA 1WGRA 2K22A 2QCZA 2ZW0A 3LDZE 1E90A 1XXGA 2JPHA 4W9KA 1WMHA 4G50A 3DCGA 1UH6A 1SE3A 3KH0A 2DBYA 5D2MB 3GB1A 1ENFA 1ZGUB 2BBCA 4IG7B 1V1PA 2CHWA 4WQOB 2WDRB 4BBNC 3TMPB 3P4PB 1ROEA 2G4DB 4K81A 4M01A 1WR1A 3N1YC 1QILA 3RNEC 2KQ7A 5IP4D 3QJZA 4LJOB 1L0VB 3N3KB 5KHQA 1WX7A 1F9JA 1WIAA 4TQ0A 3HK0A 3KUCB 3ZJVA 3PSEB 2NMQA 1VLBA 3M3JA 4BVUC 2W3SA 1EUVB 1M94A 2KANA 4KDIC 2HDEA 2MWSB 2LRUA 2JUOA 1GG3A 4DXGA 3R2TA 4ZYNA 2AX5A 2AEHA 3WANA 1QQRA 4FLHA 2KMAA 3ZYYX 4RMAA 4ZRKA 3J9CA 5AZHA 2L0FA 3EFUA 2M4NA 3VTWA 2L7RA 2OOBB 4MGKE 4XX5A 2J53A 1EU4A 2KN5A 2KQSA 2K8BA 3RFZB 1SSNA 1NENB 1BMLC 2PE6B 2GRIA 3VAWA 2KFKB 2N9LA 1T6BX 4KVGB 1GC6A 1UBIA 1E5WA 2LGXA 1LO5D 1WZ0A 1VDVA 1VRAB 3A4RA 1XEEA 3I9V1 2VH1A 2Y5PA 2DZIA 1NI3A 3R66C 3DBSA 1PFDA 3T9LA 4W9EA 2V0GA 3BVGA 1V86A 2FE8A 2LHDA 1IGCA 4LTUA 4WQMA 2W55A 3RCZA 2NVUI 1AARA 2KWCA 1WYWB 3BK2A 3RZWC 2KDIA 2NPTA 2Y5BB 2FUHB 3UIOB 3KVFB 1MG4A 5CX3A 4LLGM 1GB1A 2BS4B 4RGNA 5LNK1 3TBLD 4C4VB 2L76A 4I6NB 1MPEA 2INDC 4F8CB 2LUMA 1Q10A 5IN7A 5G5HA 3P63A 3H6NA 5EE3A 2D5GA 2K6DB 5JHBA 3U7DA 5AUIA 2ONQA 1WI0A 2AL6A 4I6LB 3H7PA 1WX8A 1WGGA 1NI2A 4A8XC 4M0WB 3KLSX 3W5UB 1NYQA 1RRBA 1UF0A 1FM0D 1IBXA 4M8MA 2WDVB 3B1LX 1A70A 1FPYA 4A20A 1JW9D 3VHTC 3N1ZC 4REZA 4GSWA 1HEZE 3QX1A 1SE2A 1SB3C 3BVZA 2DYOA 3DBHB 4W9GA 2K1FA 4WJQA 2C7MB 3H9DA 5BMGA 3VTUA 2IGGA 5AUKA 3APCA 2ZPYA 4BBNF 4DHZB 5BYRA 1P9DU 2REXA 2MQJA 3DBRB 4JQWC 3PZ7A 2BS3B 2IZVB 4HEA1 1H8CA 2LGIA 4HPMB 2N9KA 2N9EB 1BT0A 2J4XA 4RGTA 2JRIB 4N59A 1V49A 2KO3A 2KLGA 3NVWA 2MJEA 4URKA 1STEA 3OAWA 1V2YA 2IBIB 3ZJTA 2V3PA 1U4AA 3NVVA 1V80A 3AI5A 3VFKA 3SHQA 4M02A 1LFDA 2DZJA 2E3TA 2LD9A 1TKGA 1KFYB 2NTTA 3PHWB 3NS8A 2M0AA 2JZPA 3UI3A 1RYJA 2LRWA 1VCBA 4C7YA 3ZNHB 2KVRA 3WAOA 1FFVA 4C4VA 2JVCA 1N5WA 4DBGA 4HWIB 5E6JA 2KFKA 2LVPA 1HTQA 5KHOA 5HKHA 1T5XD 2NTSA 2W9NA 3L13A 2D10A 3AEGB 3PVLA 4G0NB 3PS6A 2WXKA 4BFRA 2DLBA 3NVYA 4NAWB 4K7UA 1RLFA 2FCSA 4D2KA 1E8YA 1KRHA 2D3GA 4G11A 1EM7A 1PGBA 4USAA 1SBBB 1N61A 2LJ5A 2BTEA 1V1PB 3E56A 3ML8A 3AE4B 4TKNA 4ARIA 1V81A 1Q5WB 2MP2B 4DHJB 3RPFC 2L83A 3GE8C 3B08A 5D6JB 1WZ3A 2KC2A 1WMHB 2PE9A 2LASA 3MHZA 4KSLC 4AP4C 5I4DA 5DPWA 3R3MA 3H7SA 1V9JA 1CK1A 3TEXA 3VXWA 3A9JB 1I42A 3HM6X 2AWTA 2PTLA 2BF8B 2KACA 2KMCA 3NZUA 2PIAA 4Q2JA 4US8A 2MJDA 5G55A 3Q8CA 1I4PA 1WXQA 5GMVA 4TMAB 1WY8A 1WE6A 1IGDA 5HG2A 1TS4A 2WXNA 4DK5A 5E6PA 1ESFA 4I6PA 4B0EA 2JU6X 4PYUA 1Z2MA 2Y3AA 2NBVB 1JQ4A 2R2QA 5HI1A 1GPXA 3PZDA 2EKEC 4MM3A 2GBMA 4RCOA 2BS2B 4EZKA 4PS8A 1ACCA 1X1MA 2B76B 2FIFA 2OJRA 4IOIE 2K39A 3DVNV 2KTFA 3NS1A 3DBLB 2IY0B 2O2VB 2IO0B 3D32A 2C7HA 3ZVVA 3ETRA 2Z0DB 2BYTA 4NY0A 4HVBA 2KWUB 2EELA 1L0XB 2L32A 3AM9A 2W54A 1EWCA 2RGFA 4IKGA 1VZ6A 3IT6B 1P3QU 4W9CA 3WA0A 4UDUC 2MHJA 1R4NI 4DDID 2BKFA 1WJ6A 1WE7A 2DAFA 4LNFA 3I5JC 1FD6A 2LZ6A 4C80A 3LXFA 3VR9B 1QOGA 1PGAA 4KZ0A 4KX6B 3V61A 1R7SA 3ZQ4A 3IBEA 5BMHA 1DYQA 3DOWA 2PJHA 2TSSA 3ECIA 1FNVA 2NBWB 4OZCA 4FHJA 3PHXB 4NAMA 2GLSA 1J7BA 3MC9A 2Q5WD 4ZRPA 2LXAA 4KSKC 3BYTB 4HPPA 3ZTDA 2ZW1A 3URYA 3DDCB 4JX1C 1OGWA 4ANVA 4ASWC 2MH7A 3L54A 3L4PA 3RN9C 2KVZA 2M0XA 5JXVA 4GMVA 1P7FA 1RFKA 1VR9A 2ZZPB 4PK1A 2MBBB 4MSQB 4LDTD 5C2TB 1EF1A 4KKJA 1NYRA 4EE2A 3A1QA 2V9HA 4BOZB 3DHHC 2NCNA 2D07B 1OQYA 1P0RA 1KH0A 3I3TB 4NQLB 1TS2A 3ML9A 2YLMA 1C4PA 1TJEA 3RYTA 5EDSA 2AYOB 2DWQA 2ZCCA 1SF0A 2HTHA 3JW0X 2WQYB 4EZLA 3UGBB 3T3NA 1XF5L 4TUUA 2RD0A 1IUEA 4AOFA 3BK1A 2KQ4X 3AH7A 1TS3A 1F0ZA 1D5XC 2GI9A 4E71A 1UWMA 2MBEA 3HVZA 2DX5B 4HPLB 2JRHA 2GOWA 4ACFA 3GZNI 1TT5B 2YEPB 2CJOA 4W9LA 1F2RI 2LGDA 2X8XX 4A3OA 3B0AA 1KF6B 1ZXHA 1T0RC 1AYFA 4P6VF 3X0WA 2J7QB 2KHWB 2JZZA 2H88B 3OWEB 1H4RA 1JRUA 1L6VA 3HUIA 1XLNA 4LNKA 2FCNA 3ZUNA 1HE8A 2PKOA 4PS3A 4W9JA 1R4MB 2NS5A 1WGKA 3P4QB 4LJPB 4QAYA 2DAJA 5CHFA 4XGAB 4YTPB 3V60A 1FXTB 2C60A 2WU2B 4HRSA 3AEEB 2WDQB 3N30A 2L00B 3VVWB 4LK0M 2GB1A 1PGXA 3U30A 1GAQB 1MHHE 2FNJB 2WP9B 3V05A 1TBEA 2MBQA 2BB6A 2Z59B 1MVKA 1E8WA 4J3OD 4WJNA 5AZGA 2RDHA 2WYQA 4L1BA 3PT2B 3O65B 4CHKA 5J18A 1HZ6A 2ZPNA 2KOXA 2V1YA 4NPNA 1EO6A 3VH4B 1XQQA 2WXQA 1ZOYB 3SU8X 4XZ4A 1UELA 4WJPA 1PUTA 4KGRA 2RMMA 3ZW3A 1TY2A 2JWUA 3NUHB 1P98A 3K9OB 1C9FA 2G45B 4E74A 1JCKB 2WXOA 3ZLZA 2KKCA 2PEAA 3R2IA 4NJ7A 1OEYA 4GLSC 1D5MC 2ZNVB 5E6NA 2WXGA 3VQIA 2BQQA 2OHFA 2AL3A 4WJOA 4AUQC 2D3AA 3Q3JA 2G3QB 2BGFA 1XCQL 2IO3B 3ZJUA 3PREA 2O6VA 1UWXA 3H7PB 2N0SB 2KX3A 4N6EB 3KUZA 3RNBC 3PPAA 5CTRC 3ZIMA 4US9A 1QZEA 4YTMB 1CZPA 4GOCA 3ZGZA 1FIQA 3A9JA 1ET6A 1KLGD 1IYFA 3QIJA 3RUIB 2MLBA 4GB9A 2W82A 2AQ1B 1WYGA 2J0MA 4W9HA 3EFCA 4MJSA 3BIID 2I38A 3QQ8B 2ACZB 2BWES 2LEKA 2N9PC 1T0SC 4WWMA 1J0GA 4LDTB 1NVID 3NHEB 3P4SB 3X23A 1E6EB 1M4VA 1I4RA 2QILA 3WIMA 3KYDD 1BUIC 3MJ5A 2I1JA 2XNAC 3DBHI 3AXCA 1B1ZA 2L3ZA 3TL5A 1FO4A 4WWPA 4OZBA 4JIOU 2LJIA 4JLCA 1NEKB 4FADA 4ARCA 4WH4A 4WURA 2GBKA 2WXPA 5FR6A 2WWZA 4MJSB 3AULA 1YJIA 3NRZA 5EE1A 1WRDB 4CQNA 4DQOC 3AEDB 4ZOHC 4A9AA 4IWPA 2Y5CA 1XD3B 3ZNZB 4RNAA 2RDGA 2KDEB 3W5VB 2BYEA 3QAQA 2J42A 2WXHA 1FRDA 1K50A 3EECA 3CIRB 4DWFA 3ALBA 4MEMA 4AWJA 2XEWA 4ZYSA 3PZ8A 1OTRB 4NNJB 3A4SC 4MSMB 2K8CA 3BVMA 1WR6E 4GN1A 4KDLB 2I2YA 2L05A 4NZLB 2WXJA 3IAM1 1UUPA 3T3OA 3SR6A 2KFJA 3TCAA 2EKIA 4ZDVA 1YJ1A 3PTFC 2MA9B 2YEPF 2D3BA 1ZP0B 3IG3A 2BVCA 2ICIA 3HHMA 4C00A 3Q8AA 1SIFA 4JGHB 1AW7A 1V8CA 1FCLA 2K5PA 2G1EA 2GBJA 3MP9A 3U7ZA 3VUYA 1ZKHA 2WU5B 4HJGE 3VDZA 1WGDA 1YX6B 3TUOA 2J52A 1HXYD 1RFAA 1V5TA 4HCPB 4O1NA 1FFUA 1MFWA 4FXCA 4JE3B 4M0WA 4BKGA 4BOSC 4FJZA 2N9XA 5TR5A 4DXFA 3TSSA 4OVZA 5T8IA 4ANWA 5BYSA 2JX5A 2WXLA 2KDMA 2BWFA 3ZNGC 1SE4A 2D3CA 3TJPA 1QKZA 2I1KA 4II3B 4JPSA 3QARA 2MJ3A 5EE9A 5L83A 3C0RB 2INNE 4HDOA 4TV3A 4FN2A 4LCDE 1OFFA 3DHGC 1XLOA 3KYCD 1GNUA 3EA6A 4IM0A 4AS1A 1Y8RC 2A5UA 4L2YA 1F77A 3AV8A 1G6JA 2WNMA 3C19A 4OVVA 2M56B 3ZDTA 2LGYA 5IA7A 2QIEB 3P2BA 3CSTA 2KNBA 2KX0A 2HD5B 1RM6C 2QDFA 1VJKA 3B9JA 1WM2A 3NZSA 1LXDA 2NR2A 2KWVB 3QK0A 1S3SG 3FKYA 4ZHPA 1OQRA 2M8SA 1UGMA 3MFGA 5L95C 3UQBA 2DYMA 2J0KA 4YSYB 4RFBA 3BZDB 4MH8A 1SXTA 4GDLB 1C4AA 1N63A 1Q1OA 2IDYA 2MRPA 3RULA 3ZTCA 1L4DB 1TKYA 4YXDB 5HHDG 4MGYE 5LLIA 3ZXVA 1FXAA 3Q6BA 2QEJC 4YSXB 1TKEA 3GP7A 2MSED 1ZXIA 1EWYC 1MHXA 3JVZX 4B9KA 3TIXA 5EE0A 4BKSA 1JWBD 2KDBA 4P7IA 1GB4A 2V4IB 2RR9A 2PVGC 2HJ1A 4FHKA 2N7EA 3WAPA 4GDLA 3WAMA 2FCMA 3RI7C 3TEYA 4ICVA 1ZUD2 5IOIA 4FA6A 1VD2A 2WHIA 3H8HA 2Z8LA 4KIKB 5HFYA 3CSFA 3OLMD 2GBNA 1SGHA 2KC1A 3PO0A 3U4EG 2KJHB 1YOVB 2MBHA 4EFOA 3APFA 4IDIA 1FRRA 3N9YC 5J17A 4L23A 2KLCA 3AB5A 1KTKA 2C5LC 2O6VD 3A1QB 1N62A 1WGYA 2K3UA 4HCNB 2WXFA 3A33B 4IM3A 4MT5A 1E9MA 3V6CB 4ZRJA 1LQBA 2SEBD 1XLQA 2J0JA 3Q8EA 5IKCM 3QWZB 2R2OA 3M63B 4YL8A 4M8NA 4RGMA 4WAAA 2E6XA 5G5GA 2LVOA 3HM3A 3P42A 3ZRCA 1KJTA 3MJWA 4S17A 1ZDVA 2WX0A 4RH6A 4XWWA 3RNFC 3VUXA 1SIJA 3AE2B 3VUWA 4HLEA 2JYTA 1T0QC 2BB5A 2CHXA 3AEBB 4DXAB 1N5XA 3FC4A 2MX2A 1KOTA 1WGHA 2G9HD 3NG0A 3SD5A 2JF5A 2PPHA 4EEWA 3VR8B 4NJCA 1D5ZC 2JSVX 3LYYA 1DOXA 2BPSA 2DNFA 2FUG1 2V3SA 1WXVA 5C3JB 1YQ3B 1I7HA 2UU7A 2ZVNA 4S0RA 1F2RC 4KGSA 3C8YA 2AQ2B 3AE3B 5CHWA 3SEBA 4A55A 1YMHE 5IAAC 1E0ZA 1FCCC 3DQVA 2CHZA 4AJWA 1J7CA 1KLUD 2KZRA 1VZ7A 4MGZE 2UYZB 5LXHA 4GDKB 1HZ5A 1K52A 3W1YA 2LHEA 4OVUA 4DDGD 1OQQA 3AU4A 2ZVOA 1GOZA 2WLBA 3TEWA 4PS7A 1LGRA 3K9PB 1MG8A 3V62A 4KGTA 1YN4A 3B2FA 4YWGG 3UINB 4AJYB 3ZDMC 4BAXA 2WXIA 3RMKC 3GS2A 3Q8FA 2HE7A 4FJYA 2LVQA 3N32A 3KWVA 3DBRI 1UGJA 4TSSA 2L8JA 1C3TA 3QHTA 5H92C 2LXCA 3Q14C 4K7SA 1FNWA 1YN3A 2FBWB 4XDDA 2B3AA 5J2RA 4BKTA 1S1QB 4ANXA 4WWNA 5BMIA 3ZRFA 1I4GA 4XYCA 2BYFA 3AE5B 3EHVA 3L16A 4HK2A 3IFWB 5D3DA 2BT6A 1WXMA 3EUB2 1TY0A 2VZKD 2DYBA 3U2SC 1PDXA 4K3CA 4N58A 4F7ZA 2MEKA 3QCAA 3NJTA 4IWOA 2IO2B 2KN4A 3Q3OC 3Q3FA 4P1BC 2QMTA 2VH2A 2V4LA 2WGSA 3L0WB 2A4ZA 3BY4B 4EKUA 1JALA 3I57A 3SFEB 2CS4A 1ZPSA 2KDFB 1CMXB 1XLPA 1I4HA 3NY5A 1ZDXA 1SEBD 3AECB 5D94A 3I63C 1JWAD 2JXTA 2KK8A 3PRZA 5H8YE 4HKZE 3IHPC 2ZJDA 2CKHB 1V6EA 4HROA 4RF0A 3MC8A 3A9KA 4W9DA 3DVGY 4K7WA 4E3CA 2K25A 1T3QA 3RNGC 1C1YB 3W2DA 1JWUD 1TZOA 1N60A 3MHSD 4MDKE 4AQ7A 1WSPA 3VRAB 3RZFA 1GC7A 1C77A 4XWTA 3DWMA 2HJ8A 1UNSA 1WH3A 2L52A 1K53A 2LUEA 4CO7A 4LNOA 4HJKA 5FKAC 1Y56A 2W3RA 1K51A 1WWTA 4LNIA 2O6VB 1WFYA 1QLBB 4IUMB 1OEYJ 3L10B 1WXSA 1ET9A 1E7PB 2QHOA 3IXSA 3PRPB 1YNTE 3VH3B 1EU3A 4FULA 3RD2A 5DCNA 4MH0E 4II2B 4GGQA 4GDKA 3PGEA 5BO4B 1V97A 3L08A 1QOFA 3NZ3A 3H1UA 1TTNA 2MBOA 1MI0A 2V3NA 1IP9A 1JWMD 2JWZA 5JH5C 1UBQA 3HIZA 1XT9B 2IGDA 3E9SA 4XC2A 1V5OA 5C23A 2K8HA 4B95A 4N9F4 4A6QA 4DHZE 1HA5A 3SFDB 1I35A 5CHVC 2DZMA 2L1AA 4YTNB 3TEZA 1TGZB 2JQRB 4RM8A 1FEHA 1BXTA 3AE8B 3MTNB 4MACA 1IBXB 1DGJA 3QA8A 4KV2A 3LJ3A 4GIVA 1ZW7A 2G4SA 1IPGA 3PV1A 2HTME 2VRRB 3AE7B 3OJ4B 1L4ZB 1I4QA 4FJVB 1C76A 4WAFA 2AQ3B 2BW2A 3GE3C 1RWSA 1WJ4A 2MP2A 4XDCA 3JSVA 3ENEA 5JZEB 2WX1A 3AN1A 2ASQA 1JWSD 4X57B 4C7ZA 4IWQA 2SAKA 1C79A 1R4NB 1ISNA 1NDDA 3Q2AC 1GJZA 4EUTA 2NBUA 3UQAA 3GZNB 4OZAA 2KD0A 3PLVA 3NVZA 2IY1B 4RF1A 1QOAA 2WS3B 3BYYB 1T0YA 2IYDB 1P7EA 3RNCC 1CJEA 3CF6E 1YIWA 3N1XC 1C4CA 1D6EC 1N6ZA 3W9CB 5D3IB 4G3XB 3DVNU 2FCQA 2LFIA 2PVOD 4BKSD 4ZHOA 2GBRA 3S2AA 1UD7A 1WJNA 2ZNVC 5D7GA 1L5PA 3HRDD 4XE0A 4K3BA 1YQ4B 1FNUA 3MC0B 1QOBA 4JWSC 3R7QA 3ONSA 1JMLA 4C56C 3UIPB 4K1RB 4MGIE 2N7DA 2CJNA 1WJUA 3AU5A 2INCC 1P1AA 2JYEA 4YSZB 1J7AA 2RPVA 2RPQA 1B9RA 4CYEA 5DPTA 2Z0EB 5AEKB 1D4BA 3JSVB 5G2NA 3JYUA 2KAJA 3P1MA 1WX9A 1E10A 2JT4B 4PYZA 1QF6A 2EMSA 3DHIC 1D3ZA 5FK9C 2PW9A 1K8RB 1TIFA 2C9WB 4RM9A 1F1HA 4JWUC 5E6OA 2CR5A 1PQSA 2DENB 2EMTA 4ZRIA 2RSUA 4TQ1A 3DBLI 1J19A 3B2GA 3BINA 4FBJB 1L6UA 3AE1B 3ZKJC 5TSSA 1HTOA 3N20C 2CU1A 2L0TA 3NOBA 1YQBA 1C78A 2KTRA 4KIKA 2XBBC 4ANUA 4OW0A 2CU3A 3ZO5B 2M19A 3AMZA 4P16A 2BYVE 2KTRB 2XK5A 1R4MI 3RNAC 3DWGC 1WXAA 4RGOS 2ZCBA 3R8BA 3OJ3A 4GU2A 5AZFA 5DPSA 3WCQA 3O13A 3VRBB 2DHZA 4JL9A 1KLVA 1I4XA 1WM3A 3V6EB 3BWUD 3IVFA 5IO9A 3U8ZA 1FMAD 1WF9A 2KJRA 2ON8A 2IJ0A 3DVGX 1DOYA 1E7VA 1MJDA 4PT5A 3KQ4A 3M62B 1F52A 2JZ3B 1YN5A 4ICUA 1JRPA 4NJ6A 3LB8C 3M95A 5GXGB 1L7YA 3CMMB
chains in the Genus database with same CATH topology
2M0AA 4YTMB 1CZPA 2JZPA 3W1SA 3UI3A 2WXIA 3ZGZA 1RYJA 1FIQA 1ET6A 1KLGD 1PYWD 4ITKA 3AEFB 2R61A 3GS2A 3Q8FA 4YT0B 1YJJA 4C7YA 2W82A 2AQ1B 1QT9A 1WYGA 1FFVA 1N5WA 3KWVA 3BIID 2I38A 2IGHA 3FAHA 5E6JA 2ACZB 1UGJA 3FILB 2LEKA 4TSSA 4HKQA 1T5XD 2NTSA 4WWMA 1HQRD 2K9XA 3IAS1 1NVID 2QSDA 3AEGB 3AEAB 1JROA 1VZ8A 5H92C 3P4SB 2WXKA 5FR3A 1E6EB 1FNWA 1YN3A 2DLBA 2FBWB 3NVYA 1M4VA 1I4RA 2QILA 4NAWB 4XDDA 4D2KA 3KWLA 4OHJA 1KRHA 1SJED 1AWDA 1EM7A 1BUIC 3MJ5A 5BMIA 2XNAC 1I4GA 1PGBA 1B1ZA 4USAA 1SBBB 1N61A 1FO4A 3AE5B 4OZBA 2BTEA 2KMMA 1V1OA 1V1PB 5D3DA 3E56A 2LJIA 3AE4B 4ARIA 1NEKB 2BT6A 3EUB2 1TY0A 4ARCA 2VZKD 4H2AA 4WH4A 3RPFC 4WURA 3U2SC 2L83A 2WXPA 1PDXA 4N58A 2MEKA 1YJIA 3NRZA 3FILA 3MHZA 5EE1A 4CQNA 4DQOC 2KN4A 4R3DA 2QMTA 3AEDB 4ZOHC 2QJLA 4A9AA 1JALA 3I57A 3SFEB 5BYQA 5I4DA 2KWDA 1ZPSA 2VZKB 2Y5CA 4RNAA 2RDGA 1XLPA 1I4HA 1ZDXA 3W5VB 1CK1A 1SEBD 2INPE 1CQVA 2J42A 2WXHA 3AECB 3TEXA 4B0MA 4A90A 1JWAD 1FRDA 1K50A 2JXTA 3CIRB 5H8YE 3AE9B 4HKZE 1TYGB 2PTLA 2PLPA 2KACA 4ZYSA 4HROA 2XN9C 4RF0A 1XCTL 2PIAA 3PZ8A 4Q2JA 1T3QA 3W2DA 4US8A 1JWUD 2MJDA 2OEDA 1TZOA 1N60A 3BVMA 2K0PA 2WXMA 3Q8CA 1I4PA 1WXQA 4AQ7A 2N7JA 1WSPA 3ABVB 4TMAB 3VRAB 2I2YA 5HG2A 1IGDA 3EGRA 4NZLB 2H89B 3U52E 1TS4A 2WXJA 2WXNA 1C77A 3Q69A 5MPOA 3IAM1 4XWTA 1UUPA 3T3OA 3DWMA 3SR6A 1TS5A 1UNSA 1L0YB 2L52A 4WIPA 2LMCA 1ESFA 3IT4B 4B0EA 3P4RB 2EKIA 2JU6X 1SJHD 3CWIA 2YEPF 1K53A 2Y3AA 1ZP0B 2IPKD 1JQ4A 5HI1A 5FKAC 1GPXA 2ICIA 1ZE3D 1Y56A 2W3RA 1K51A 1WWTA 3Q8AA 4ZRQA 1AW7A 4RCOA 1V8CA 2BS2B 2X38A 2K5PA 1FCLA 4KKIA 1QLBB 2G1EA 3MP9A 3U7ZA 1ACCA 2B76B 4IOIE 2WU5B 4HJGE 1ET9A 1E7PB 3IXSA 1YNTE 3NS1A 3TUOA 1EU3A 2J52A 1HXYD 3ETRA 2BYTA 4MM3B 3V3XA 2WXRA 2PMVA 4O1NA 1FXIA 3Q8BA 1WRIA 2EELA 1FFUA 1L0XB 3HVDA 4M0WA 4FXCA 4JE3B 1AN8A 2L32A 1XO3A 3AE6B 3AM9A 1V97A 4DXFA 1DOIA 2W54A 1QOFA 1EWCA 3NZ3A 4IKGA 3TSSA 1VZ6A 3IT6B 4OVZA 5T8IA 1MI0A 4UDUC 5BYSA 2JX5A 2V3NA 2WXLA 2K22A 2KDMA 1JWMD 1SE4A 2ZW0A 1XXGA 1QKZA 1FD6A 4JPSA 2MJ3A 2IGDA 1SE3A 4C80A 3LXFA 3E9SA 2DBYA 5EE9A 3VR9B 1QOGA 1PGAA 3GB1A 1ENFA 2INNE 4KX6B 1R7SA 3ZQ4A 2BBCA 1OFFA 1V1PA 5BMHA 1DYQA 1XLOA 3EA6A 2WDRB 2TSSA 4A6QA 4AS1A 1HA5A 3SFDB 4L2YA 1F77A 1FNVA 3AV8A 4OZCA 2L1AA 4YTNB 3TEZA 3P4PB 1ROEA 2JQRB 2WNMA 4NAMA 1QILA 2M56B 1J7BA 2QIEB 1FEHA 1L0VB 1BXTA 3AE8B 4MACA 1IBXB 2Q5WD 1DGJA 4ZRPA 3BYTB 4TQ0A 1RM6C 3ZJVA 1VJKA 3B9JA 2ZW1A 3URYA 2NMQA 1VLBA 4JX1C 2W3SA 2HTME 4ZHPA 1OQRA 3AE7B 3MFGA 1L4ZB 2MH7A 2DYMA 1I4QA 2HDEA 3L4PA 1C76A 5JXVA 4WAFA 2AQ3B 1P7FA 1RFKA 4YSYB 1VR9A 2BW2A 3R2TA 4DXGA 4RFBA 3BZDB 2AX5A 1RWSA 4MH8A 1QQRA 1SXTA 5C2TB 4GDLB 1C4AA 4XDCA 4KKJA 3ZYYX 1N63A 1NYRA 3J9CA 2IDYA 1L4DB 4EE2A 1TKYA 4YXDB 5HHDG 3AN1A 1JWSD 2J53A 1KH0A 4C7ZA 1FXAA 1EU4A 2SAKA 1C79A 2QEJC 4YSXB 3RFZB 1TS2A 1SSNA 1TKEA 1C4PA 1NENB 1BMLC 4OZAA 1TJEA 2GRIA 3NVZA 3GP7A 4RF1A 1QOAA 1ZXIA 1EWYC 2WS3B 3BYYB 2DWQA 1MHXA 2N9LA 5EE0A 1T6BX 1JWBD 1P7EA 1SF0A 2WQYB 3T3NA 1GB4A 1XF5L 2V4IB 1LO5D 2PVGC 1CJEA 1IUEA 1VDVA 1VRAB 3BK1A 2KQ4X 1XEEA 1C4CA 3AH7A 1D6EC 3I9V1 2Y5PA 1NI3A 1TS3A 1F0ZA 1D5XC 2GI9A 3W9CB 1UWMA 5D3IB 3TEYA 1ZUD2 1PFDA 2LFIA 3HVZA 3BVGA 2V0GA 3H8HA 2PVOD 2Z8LA 2FE8A 2LHDA 4ZHOA 1IGCA 4LTUA 4WQMA 5HFYA 2W55A 5D7GA 1L5PA 2YEPB 3HRDD 2CJOA 4XE0A 1YQ4B 1FNUA 3BK2A 3MC0B 3PO0A 1QOBA 4JWSC 3U4EG 1F2RI 1JMLA 4C56C 1KF6B 1ZXHA 4IDIA 1FRRA 3N9YC 1AYFA 4P6VF 4LLGM 1GB1A 2BS4B 4L23A 4RGNA 2CJNA 5LNK1 3AB5A 2H88B 2JYEA 3OWEB 4YSZB 1KTKA 1J7AA 2RPVA 1L6VA 1MPEA 1B9RA 1N62A 1D4BA 2K3UA 2WXFA 3HUIA 2LUMA 1XLNA 2KAJA 1Q10A 4MT5A 5G5HA 1E9MA 3P63A 5EE3A 2D5GA 3P1MA 1E10A 2PKOA 5AUIA 2SEBD 1XLQA 3Q8EA 1WGKA 1QF6A 2ONQA 3P4QB 4RGMA 2E6XA 4A8XC 4YTPB 5FK9C 2PW9A 5G5GA 3KLSX 2WU2B 4HRSA 3W5UB 1NYQA 3P42A 4JWUC 3AEEB 1FM0D 2WDQB 1IBXA 2WDVB 4LK0M 1A70A 1ZDVA 2GB1A 4RH6A 4XWWA 1JW9D 1PGXA 1GAQB 4REZA 1MHHE 1SIJA 2WP9B 1HEZE 3AE2B 3V05A 4TQ1A 2JYTA 2BB5A 2BB6A 3AEBB 1MVKA 1SE2A 1N5XA 3B2GA 3FC4A 1L6UA 3AE1B 1SB3C 5TSSA 3BVZA 2G9HD 4J3OD 2DYOA 2RDHA 5BMGA 1C78A 4L1BA 3VR8B 4NJCA 1D5ZC 1HZ6A 4OW0A 2CU3A 2JSVX 2IGGA 5AUKA 3LYYA 1DOXA 2FUG1 2M19A 2WXQA 1ZOYB 5BYRA 1YQ3B 5C3JB 1I7HA 3AMZA 1PUTA 4P16A 4KGRA 2RMMA 3PZ7A 1F2RC 1TY2A 2BS3B 2JWUA 4KGSA 4HEA1 3C8YA 3DWGC 2AQ2B 2LGIA 3NUHB 4RGOS 3AE3B 1C9FA 3R8BA 2N9KA 1JCKB 2WXOA 3SEBA 3R2IA 1YMHE 4A55A 2J4XA 1E0ZA 3WCQA 1FCCC 4GLSC 1D5MC 3O13A 4RGTA 3VRBB 1J7CA 1KLUD 4N59A 1I4XA 1VZ7A 2WXGA 3NVWA 2MJEA 3BWUD 1STEA 3VQIA 2OHFA 4GDKB 1FMAD 3ZJTA 1XCQL 1HZ5A 1K52A 2ON8A 2IJ0A 2LHEA 2V3PA 3NVVA 3ZJUA 1DOYA 1OQQA 4PT5A 1GOZA 3KQ4A 2WLBA 3TEWA 1UWXA 2N0SB 4N6EB 2E3TA 4KGTA 1YN4A 3B2FA 1YN5A 4YWGG 1JRPA 1TKGA 1KFYB 2NTTA 3LB8C 5GXGB 4US9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTM B;  2H88 B;  4YSZ B;  1CZP A;  1J7A A;  2H89 B;  5MPO A;  1L6V A;  1RM6 C;  1B9R A;  1RYJ A;  1FIQ A;  1N62 A;  1VJK A;  3B9J A;  4ITK A;  3DWM A;  3SR6 A;  1VLB A;  3AEF B;  3HUI A;  4JX1 C;  4YT0 B;  1YJJ A;  2W3S A;  1XLN A;  2L52 A;  4C7Y A;  2HTM E;  2KAJ A;  5G5H A;  1QT9 A;  4ZHP A;  1E9M A;  1OQR A;  1WYG A;  3P4R B;  2EKI A;  3P63 A;  5EE3 A;  3CWI A;  3P1M A;  3AE7 B;  1FFV A;  1E10 A;  2MH7 A;  1N5W A;  2PKO A;  5AUI A;  3BII D;  3FAH A;  3L4P A;  1XLQ A;  1ZP0 B;  1QF6 A;  1WGK A;  1JQ4 A;  2ACZ B;  1GPX A;  2LEK A;  3P4Q B;  4WWM A;  1RFK A;  4YSY B;  2W3R A;  1WWT A;  2K9X A;  1NVI D;  3AEG B;  2AX5 A;  1RWS A;  1JRO A;  3AEA B;  4YTP B;  5H92 C;  5G5G A;  5C2T B;  3P4S B;  2WU2 B;  4HRS A;  1V8C A;  2BS2 B;  3W5U B;  2K5P A;  3ZYY X;  1NYQ A;  1N63 A;  1NYR A;  1QLB B;  3AEE B;  2G1E A;  4JWU C;  1FM0 D;  2WDQ B;  1E6E B;  2B76 B;  2FBW B;  3NVY A;  1TKY A;  2WDV B;  4YXD B;  2WU5 B;  1A70 A;  3KWL A;  1JW9 D;  1KRH A;  1AWD A;  1E7P B;  1GAQ B;  3AN1 A;  1SIJ A;  2WP9 B;  3AE2 B;  3NS1 A;  4USA A;  4C7Z A;  1FXA A;  1N61 A;  1FO4 A;  3AE5 B;  3AEB B;  4YSX B;  1N5X A;  2KMM A;  3B2G A;  3ETR A;  3FC4 A;  1L6U A;  1TKE A;  1NEN B;  3AE4 B;  1SB3 C;  3AE1 B;  1NEK B;  2BT6 A;  1TJE A;  1FXI A;  3NVZ A;  3EUB 2;  1WRI A;  1QOA A;  1FFU A;  1ZXI A;  4FXC A;  1EWY C;  2WS3 B;  3RPF C;  2DWQ A;  3VR8 B;  1XO3 A;  2L83 A;  3AE6 B;  3AM9 A;  1PDX A;  1V97 A;  5EE0 A;  4N58 A;  1DOI A;  1JWB D;  1SF0 A;  2CU3 A;  1QOF A;  2W54 A;  1YJI A;  5AUK A;  2WQY B;  3NRZ A;  1DOX A;  2PVG C;  5EE1 A;  2M19 A;  1CJE A;  1IUE A;  1ZOY B;  1YQ3 B;  5C3J B;  1VDV A;  2JX5 A;  3AED B;  2K22 A;  1I7H A;  3AMZ A;  4ZOH C;  3AH7 A;  2QJL A;  1PUT A;  4A9A A;  1JAL A;  1NI3 A;  3SFE B;  2BS3 B;  1F0Z A;  3W9C B;  1UWM A;  1ZUD 2;  3DWG C;  2Y5C A;  1PFD A;  3AE3 B;  1XLP A;  3HVZ A;  2MJ3 A;  4C80 A;  2PVO D;  3LXF A;  2DBY A;  5EE9 A;  3VR9 B;  3W5V B;  1E0Z A;  3WCQ A;  1QOG A;  4ZHO A;  3AEC B;  3VRB B;  4KX6 B;  1J7C A;  4LTU A;  4N59 A;  1R7S A;  4WQM A;  1JWA D;  1FRD A;  2W55 A;  3NVW A;  2MJE A;  1OFF A;  2OHF A;  3AE9 B;  1XLO A;  3CIR B;  5H8Y E;  1L5P A;  1TYG B;  3HRD D;  2CJO A;  1YQ4 B;  1FMA D;  2WDR B;  3PO0 A;  1QOB A;  4JWS C;  3SFD B;  3NVV A;  4HRO A;  3AV8 A;  1DOY A;  1KF6 B;  1OQQ A;  2PIA A;  4IDI A;  1FRR A;  4YTN B;  3P4P B;  1ROE A;  2JQR B;  1AYF A;  4P6V F;  1T3Q A;  2WLB A;  4US8 A;  2MJD A;  2N0S B;  2M56 B;  2BS4 B;  4N6E B;  1N60 A;  2E3T A;  1J7B A;  2CJN A;  2QIE B;  1L0V B;  3B2F A;  3AE8 B;  1JRP A;  1WXQ A;  1TKG A;  1KFY B;  3LB8 C;  5GXG B;  3AB5 A;  3ABV B;  3VRA B;  2Q5W D;  1DGJ A;  4US9 A; 
#chains in the Genus database with same CATH topology
 3W1S A;  1Q0W B;  4ITK A;  1PYW D;  3AEF B;  2R61 A;  4YT0 B;  5JHA A;  1YJJ A;  4BZA A;  2ZEQ A;  2O2V A;  1QT9 A;  4DHJ D;  2IO1 B;  2IGH A;  3FAH A;  4WWO A;  2KJ6 A;  4IW0 A;  3FIL B;  4IM2 A;  4HKQ A;  2YVC A;  1HQR D;  2K9X A;  3IAS 1;  1YX5 B;  2QSD A;  3AEA B;  1JRO A;  1VZ8 A;  4GXB A;  3KW5 B;  5FR3 A;  1L2N A;  3Q3M C;  5C1Z A;  3KWL A;  4OHJ A;  2OJW A;  1SJE D;  1AWD A;  2UWQ A;  2N4F A;  1J8C A;  3RT3 B;  2JY6 A;  3WAL A;  2KMM A;  1V1O A;  2FAZ A;  2C7N B;  1E8Z A;  2N1V A;  4NQK E;  4H2A A;  3W1S C;  4M00 A;  4W9F A;  4EOY A;  2M17 A;  4J6I A;  4F1S A;  3OG5 A;  3FIL A;  2DZK A;  2NPT B;  4R3D A;  4MEL A;  1E7U A;  1KM7 A;  2QJL A;  5BYQ A;  2KWD A;  4P1C C;  2VZK B;  1EF5 A;  4KZC A;  4W9I A;  2INP E;  3ZXR A;  1CQV A;  2WDT B;  1E8X A;  4B0M A;  1YD8 U;  3L17 A;  4A90 A;  3PRM B;  1GUA B;  1LM8 B;  3AE9 B;  1TYG B;  1SE9 A;  4HXD A;  5LXI B;  2D11 A;  3PLU A;  2PLP A;  3R7R A;  4A3P A;  2XN9 C;  2K6Q A;  1XCT L;  4HDQ A;  3SDL C;  2OED A;  2K0P A;  2WXM A;  4B6W A;  2N7J A;  3ABV B;  2XK5 B;  4EZJ A;  3A9K B;  2KT7 A;  3EGR A;  3T8M A;  3KUD B;  2H89 B;  3U52 E;  5MPO A;  3Q69 A;  1UZX B;  4NAW A;  2M1M A;  2MCN B;  1TS5 A;  1L0Y B;  4WIP A;  2MW5 A;  2LMC A;  2N1W A;  3IT4 B;  4IC7 B;  3P4R B;  1SJH D;  3CWI A;  4LNN A;  2IPK D;  2GMI C;  1RAX A;  1ZE3 D;  3VTV A;  3UF8 A;  5DPR A;  2FID A;  4ZRQ A;  3Q3N C;  2X38 A;  2KXJ A;  2JXX A;  4KKI A;  1NBF C;  2QC8 A;  2LI5 A;  1A5R A;  3QC8 B;  2LWP A;  3EC8 A;  2RDB C;  2D2Q A;  4MM3 B;  3V3X A;  2WXR A;  2PMV A;  1FXI A;  3Q8B A;  1WRI A;  3GOE A;  3HVD A;  1AN8 A;  1XO3 A;  1Z5S B;  3AE6 B;  3DPD A;  1DOI A;  3ZNI D;  2BKR B;  3APD A;  2KYW A;  1TZ1 A;  2LGS A;  1WGR A;  2K22 A;  2QCZ A;  2ZW0 A;  3LDZ E;  1E90 A;  1XXG A;  2JPH A;  4W9K A;  1WMH A;  4G50 A;  3DCG A;  1UH6 A;  1SE3 A;  3KH0 A;  2DBY A;  5D2M B;  3GB1 A;  1ENF A;  1ZGU B;  2BBC A;  4IG7 B;  1V1P A;  2CHW A;  4WQO B;  2WDR B;  4BBN C;  3TMP B;  3P4P B;  1ROE A;  2G4D B;  4K81 A;  4M01 A;  1WR1 A;  3N1Y C;  1QIL A;  3RNE C;  2KQ7 A;  5IP4 D;  3QJZ A;  4LJO B;  1L0V B;  3N3K B;  5KHQ A;  1WX7 A;  1F9J A;  1WIA A;  4TQ0 A;  3HK0 A;  3KUC B;  3ZJV A;  3PSE B;  2NMQ A;  1VLB A;  3M3J A;  4BVU C;  2W3S A;  1EUV B;  1M94 A;  2KAN A;  4KDI C;  2HDE A;  2MWS B;  2LRU A;  2JUO A;  1GG3 A;  4DXG A;  3R2T A;  4ZYN A;  2AX5 A;  2AEH A;  3WAN A;  1QQR A;  4FLH A;  2KMA A;  3ZYY X;  4RMA A;  4ZRK A;  3J9C A;  5AZH A;  2L0F A;  3EFU A;  2M4N A;  3VTW A;  2L7R A;  2OOB B;  4MGK E;  4XX5 A;  2J53 A;  1EU4 A;  2KN5 A;  2KQS A;  2K8B A;  3RFZ B;  1SSN A;  1NEN B;  1BML C;  2PE6 B;  2GRI A;  3VAW A;  2KFK B;  2N9L A;  1T6B X;  4KVG B;  1GC6 A;  1UBI A;  1E5W A;  2LGX A;  1LO5 D;  1WZ0 A;  1VDV A;  1VRA B;  3A4R A;  1XEE A;  3I9V 1;  2VH1 A;  2Y5P A;  2DZI A;  1NI3 A;  3R66 C;  3DBS A;  1PFD A;  3T9L A;  4W9E A;  2V0G A;  3BVG A;  1V86 A;  2FE8 A;  2LHD A;  1IGC A;  4LTU A;  4WQM A;  2W55 A;  3RCZ A;  2NVU I;  1AAR A;  2KWC A;  1WYW B;  3BK2 A;  3RZW C;  2KDI A;  2NPT A;  2Y5B B;  2FUH B;  3UIO B;  3KVF B;  1MG4 A;  5CX3 A;  4LLG M;  1GB1 A;  2BS4 B;  4RGN A;  5LNK 1;  3TBL D;  4C4V B;  2L76 A;  4I6N B;  1MPE A;  2IND C;  4F8C B;  2LUM A;  1Q10 A;  5IN7 A;  5G5H A;  3P63 A;  3H6N A;  5EE3 A;  2D5G A;  2K6D B;  5JHB A;  3U7D A;  5AUI A;  2ONQ A;  1WI0 A;  2AL6 A;  4I6L B;  3H7P A;  1WX8 A;  1WGG A;  1NI2 A;  4A8X C;  4M0W B;  3KLS X;  3W5U B;  1NYQ A;  1RRB A;  1UF0 A;  1FM0 D;  1IBX A;  4M8M A;  2WDV B;  3B1L X;  1A70 A;  1FPY A;  4A20 A;  1JW9 D;  3VHT C;  3N1Z C;  4REZ A;  4GSW A;  1HEZ E;  3QX1 A;  1SE2 A;  1SB3 C;  3BVZ A;  2DYO A;  3DBH B;  4W9G A;  2K1F A;  4WJQ A;  2C7M B;  3H9D A;  5BMG A;  3VTU A;  2IGG A;  5AUK A;  3APC A;  2ZPY A;  4BBN F;  4DHZ B;  5BYR A;  1P9D U;  2REX A;  2MQJ A;  3DBR B;  4JQW C;  3PZ7 A;  2BS3 B;  2IZV B;  4HEA 1;  1H8C A;  2LGI A;  4HPM B;  2N9K A;  2N9E B;  1BT0 A;  2J4X A;  4RGT A;  2JRI B;  4N59 A;  1V49 A;  2KO3 A;  2KLG A;  3NVW A;  2MJE A;  4URK A;  1STE A;  3OAW A;  1V2Y A;  2IBI B;  3ZJT A;  2V3P A;  1U4A A;  3NVV A;  1V80 A;  3AI5 A;  3VFK A;  3SHQ A;  4M02 A;  1LFD A;  2DZJ A;  2E3T A;  2LD9 A;  1TKG A;  1KFY B;  2NTT A;  3PHW B;  3NS8 A;  2M0A A;  2JZP A;  3UI3 A;  1RYJ A;  2LRW A;  1VCB A;  4C7Y A;  3ZNH B;  2KVR A;  3WAO A;  1FFV A;  4C4V A;  2JVC A;  1N5W A;  4DBG A;  4HWI B;  5E6J A;  2KFK A;  2LVP A;  1HTQ A;  5KHO A;  5HKH A;  1T5X D;  2NTS A;  2W9N A;  3L13 A;  2D10 A;  3AEG B;  3PVL A;  4G0N B;  3PS6 A;  2WXK A;  4BFR A;  2DLB A;  3NVY A;  4NAW B;  4K7U A;  1RLF A;  2FCS A;  4D2K A;  1E8Y A;  1KRH A;  2D3G A;  4G11 A;  1EM7 A;  1PGB A;  4USA A;  1SBB B;  1N61 A;  2LJ5 A;  2BTE A;  1V1P B;  3E56 A;  3ML8 A;  3AE4 B;  4TKN A;  4ARI A;  1V81 A;  1Q5W B;  2MP2 B;  4DHJ B;  3RPF C;  2L83 A;  3GE8 C;  3B08 A;  5D6J B;  1WZ3 A;  2KC2 A;  1WMH B;  2PE9 A;  2LAS A;  3MHZ A;  4KSL C;  4AP4 C;  5I4D A;  5DPW A;  3R3M A;  3H7S A;  1V9J A;  1CK1 A;  3TEX A;  3VXW A;  3A9J B;  1I42 A;  3HM6 X;  2AWT A;  2PTL A;  2BF8 B;  2KAC A;  2KMC A;  3NZU A;  2PIA A;  4Q2J A;  4US8 A;  2MJD A;  5G55 A;  3Q8C A;  1I4P A;  1WXQ A;  5GMV A;  4TMA B;  1WY8 A;  1WE6 A;  1IGD A;  5HG2 A;  1TS4 A;  2WXN A;  4DK5 A;  5E6P A;  1ESF A;  4I6P A;  4B0E A;  2JU6 X;  4PYU A;  1Z2M A;  2Y3A A;  2NBV B;  1JQ4 A;  2R2Q A;  5HI1 A;  1GPX A;  3PZD A;  2EKE C;  4MM3 A;  2GBM A;  4RCO A;  2BS2 B;  4EZK A;  4PS8 A;  1ACC A;  1X1M A;  2B76 B;  2FIF A;  2OJR A;  4IOI E;  2K39 A;  3DVN V;  2KTF A;  3NS1 A;  3DBL B;  2IY0 B;  2O2V B;  2IO0 B;  3D32 A;  2C7H A;  3ZVV A;  3ETR A;  2Z0D B;  2BYT A;  4NY0 A;  4HVB A;  2KWU B;  2EEL A;  1L0X B;  2L32 A;  3AM9 A;  2W54 A;  1EWC A;  2RGF A;  4IKG A;  1VZ6 A;  3IT6 B;  1P3Q U;  4W9C A;  3WA0 A;  4UDU C;  2MHJ A;  1R4N I;  4DDI D;  2BKF A;  1WJ6 A;  1WE7 A;  2DAF A;  4LNF A;  3I5J C;  1FD6 A;  2LZ6 A;  4C80 A;  3LXF A;  3VR9 B;  1QOG A;  1PGA A;  4KZ0 A;  4KX6 B;  3V61 A;  1R7S A;  3ZQ4 A;  3IBE A;  5BMH A;  1DYQ A;  3DOW A;  2PJH A;  2TSS A;  3ECI A;  1FNV A;  2NBW B;  4OZC A;  4FHJ A;  3PHX B;  4NAM A;  2GLS A;  1J7B A;  3MC9 A;  2Q5W D;  4ZRP A;  2LXA A;  4KSK C;  3BYT B;  4HPP A;  3ZTD A;  2ZW1 A;  3URY A;  3DDC B;  4JX1 C;  1OGW A;  4ANV A;  4ASW C;  2MH7 A;  3L54 A;  3L4P A;  3RN9 C;  2KVZ A;  2M0X A;  5JXV A;  4GMV A;  1P7F A;  1RFK A;  1VR9 A;  2ZZP B;  4PK1 A;  2MBB B;  4MSQ B;  4LDT D;  5C2T B;  1EF1 A;  4KKJ A;  1NYR A;  4EE2 A;  3A1Q A;  2V9H A;  4BOZ B;  3DHH C;  2NCN A;  2D07 B;  1OQY A;  1P0R A;  1KH0 A;  3I3T B;  4NQL B;  1TS2 A;  3ML9 A;  2YLM A;  1C4P A;  1TJE A;  3RYT A;  5EDS A;  2AYO B;  2DWQ A;  2ZCC A;  1SF0 A;  2HTH A;  3JW0 X;  2WQY B;  4EZL A;  3UGB B;  3T3N A;  1XF5 L;  4TUU A;  2RD0 A;  1IUE A;  4AOF A;  3BK1 A;  2KQ4 X;  3AH7 A;  1TS3 A;  1F0Z A;  1D5X C;  2GI9 A;  4E71 A;  1UWM A;  2MBE A;  3HVZ A;  2DX5 B;  4HPL B;  2JRH A;  2GOW A;  4ACF A;  3GZN I;  1TT5 B;  2YEP B;  2CJO A;  4W9L A;  1F2R I;  2LGD A;  2X8X X;  4A3O A;  3B0A A;  1KF6 B;  1ZXH A;  1T0R C;  1AYF A;  4P6V F;  3X0W A;  2J7Q B;  2KHW B;  2JZZ A;  2H88 B;  3OWE B;  1H4R A;  1JRU A;  1L6V A;  3HUI A;  1XLN A;  4LNK A;  2FCN A;  3ZUN A;  1HE8 A;  2PKO A;  4PS3 A;  4W9J A;  1R4M B;  2NS5 A;  1WGK A;  3P4Q B;  4LJP B;  4QAY A;  2DAJ A;  5CHF A;  4XGA B;  4YTP B;  3V60 A;  1FXT B;  2C60 A;  2WU2 B;  4HRS A;  3AEE B;  2WDQ B;  3N30 A;  2L00 B;  3VVW B;  4LK0 M;  2GB1 A;  1PGX A;  3U30 A;  1GAQ B;  1MHH E;  2FNJ B;  2WP9 B;  3V05 A;  1TBE A;  2MBQ A;  2BB6 A;  2Z59 B;  1MVK A;  1E8W A;  4J3O D;  4WJN A;  5AZG A;  2RDH A;  2WYQ A;  4L1B A;  3PT2 B;  3O65 B;  4CHK A;  5J18 A;  1HZ6 A;  2ZPN A;  2KOX A;  2V1Y A;  4NPN A;  1EO6 A;  3VH4 B;  1XQQ A;  2WXQ A;  1ZOY B;  3SU8 X;  4XZ4 A;  1UEL A;  4WJP A;  1PUT A;  4KGR A;  2RMM A;  3ZW3 A;  1TY2 A;  2JWU A;  3NUH B;  1P98 A;  3K9O B;  1C9F A;  2G45 B;  4E74 A;  1JCK B;  2WXO A;  3ZLZ A;  2KKC A;  2PEA A;  3R2I A;  4NJ7 A;  1OEY A;  4GLS C;  1D5M C;  2ZNV B;  5E6N A;  2WXG A;  3VQI A;  2BQQ A;  2OHF A;  2AL3 A;  4WJO A;  4AUQ C;  2D3A A;  3Q3J A;  2G3Q B;  2BGF A;  1XCQ L;  2IO3 B;  3ZJU A;  3PRE A;  2O6V A;  1UWX A;  3H7P B;  2N0S B;  2KX3 A;  4N6E B;  3KUZ A;  3RNB C;  3PPA A;  5CTR C;  3ZIM A;  4US9 A;  1QZE A;  4YTM B;  1CZP A;  4GOC A;  3ZGZ A;  1FIQ A;  3A9J A;  1ET6 A;  1KLG D;  1IYF A;  3QIJ A;  3RUI B;  2MLB A;  4GB9 A;  2W82 A;  2AQ1 B;  1WYG A;  2J0M A;  4W9H A;  3EFC A;  4MJS A;  3BII D;  2I38 A;  3QQ8 B;  2ACZ B;  2BWE S;  2LEK A;  2N9P C;  1T0S C;  4WWM A;  1J0G A;  4LDT B;  1NVI D;  3NHE B;  3P4S B;  3X23 A;  1E6E B;  1M4V A;  1I4R A;  2QIL A;  3WIM A;  3KYD D;  1BUI C;  3MJ5 A;  2I1J A;  2XNA C;  3DBH I;  3AXC A;  1B1Z A;  2L3Z A;  3TL5 A;  1FO4 A;  4WWP A;  4OZB A;  4JIO U;  2LJI A;  4JLC A;  1NEK B;  4FAD A;  4ARC A;  4WH4 A;  4WUR A;  2GBK A;  2WXP A;  5FR6 A;  2WWZ A;  4MJS B;  3AUL A;  1YJI A;  3NRZ A;  5EE1 A;  1WRD B;  4CQN A;  4DQO C;  3AED B;  4ZOH C;  4A9A A;  4IWP A;  2Y5C A;  1XD3 B;  3ZNZ B;  4RNA A;  2RDG A;  2KDE B;  3W5V B;  2BYE A;  3QAQ A;  2J42 A;  2WXH A;  1FRD A;  1K50 A;  3EEC A;  3CIR B;  4DWF A;  3ALB A;  4MEM A;  4AWJ A;  2XEW A;  4ZYS A;  3PZ8 A;  1OTR B;  4NNJ B;  3A4S C;  4MSM B;  2K8C A;  3BVM A;  1WR6 E;  4GN1 A;  4KDL B;  2I2Y A;  2L05 A;  4NZL B;  2WXJ A;  3IAM 1;  1UUP A;  3T3O A;  3SR6 A;  2KFJ A;  3TCA A;  2EKI A;  4ZDV A;  1YJ1 A;  3PTF C;  2MA9 B;  2YEP F;  2D3B A;  1ZP0 B;  3IG3 A;  2BVC A;  2ICI A;  3HHM A;  4C00 A;  3Q8A A;  1SIF A;  4JGH B;  1AW7 A;  1V8C A;  1FCL A;  2K5P A;  2G1E A;  2GBJ A;  3MP9 A;  3U7Z A;  3VUY A;  1ZKH A;  2WU5 B;  4HJG E;  3VDZ A;  1WGD A;  1YX6 B;  3TUO A;  2J52 A;  1HXY D;  1RFA A;  1V5T A;  4HCP B;  4O1N A;  1FFU A;  1MFW A;  4FXC A;  4JE3 B;  4M0W A;  4BKG A;  4BOS C;  4FJZ A;  2N9X A;  5TR5 A;  4DXF A;  3TSS A;  4OVZ A;  5T8I A;  4ANW A;  5BYS A;  2JX5 A;  2WXL A;  2KDM A;  2BWF A;  3ZNG C;  1SE4 A;  2D3C A;  3TJP A;  1QKZ A;  2I1K A;  4II3 B;  4JPS A;  3QAR A;  2MJ3 A;  5EE9 A;  5L83 A;  3C0R B;  2INN E;  4HDO A;  4TV3 A;  4FN2 A;  4LCD E;  1OFF A;  3DHG C;  1XLO A;  3KYC D;  1GNU A;  3EA6 A;  4IM0 A;  4AS1 A;  1Y8R C;  2A5U A;  4L2Y A;  1F77 A;  3AV8 A;  1G6J A;  2WNM A;  3C19 A;  4OVV A;  2M56 B;  3ZDT A;  2LGY A;  5IA7 A;  2QIE B;  3P2B A;  3CST A;  2KNB A;  2KX0 A;  2HD5 B;  1RM6 C;  2QDF A;  1VJK A;  3B9J A;  1WM2 A;  3NZS A;  1LXD A;  2NR2 A;  2KWV B;  3QK0 A;  1S3S G;  3FKY A;  4ZHP A;  1OQR A;  2M8S A;  1UGM A;  3MFG A;  5L95 C;  3UQB A;  2DYM A;  2J0K A;  4YSY B;  4RFB A;  3BZD B;  4MH8 A;  1SXT A;  4GDL B;  1C4A A;  1N63 A;  1Q1O A;  2IDY A;  2MRP A;  3RUL A;  3ZTC A;  1L4D B;  1TKY A;  4YXD B;  5HHD G;  4MGY E;  5LLI A;  3ZXV A;  1FXA A;  3Q6B A;  2QEJ C;  4YSX B;  1TKE A;  3GP7 A;  2MSE D;  1ZXI A;  1EWY C;  1MHX A;  3JVZ X;  4B9K A;  3TIX A;  5EE0 A;  4BKS A;  1JWB D;  2KDB A;  4P7I A;  1GB4 A;  2V4I B;  2RR9 A;  2PVG C;  2HJ1 A;  4FHK A;  2N7E A;  3WAP A;  4GDL A;  3WAM A;  2FCM A;  3RI7 C;  3TEY A;  4ICV A;  1ZUD 2;  5IOI A;  4FA6 A;  1VD2 A;  2WHI A;  3H8H A;  2Z8L A;  4KIK B;  5HFY A;  3CSF A;  3OLM D;  2GBN A;  1SGH A;  2KC1 A;  3PO0 A;  3U4E G;  2KJH B;  1YOV B;  2MBH A;  4EFO A;  3APF A;  4IDI A;  1FRR A;  3N9Y C;  5J17 A;  4L23 A;  2KLC A;  3AB5 A;  1KTK A;  2C5L C;  2O6V D;  3A1Q B;  1N62 A;  1WGY A;  2K3U A;  4HCN B;  2WXF A;  3A33 B;  4IM3 A;  4MT5 A;  1E9M A;  3V6C B;  4ZRJ A;  1LQB A;  2SEB D;  1XLQ A;  2J0J A;  3Q8E A;  5IKC M;  3QWZ B;  2R2O A;  3M63 B;  4YL8 A;  4M8N A;  4RGM A;  4WAA A;  2E6X A;  5G5G A;  2LVO A;  3HM3 A;  3P42 A;  3ZRC A;  1KJT A;  3MJW A;  4S17 A;  1ZDV A;  2WX0 A;  4RH6 A;  4XWW A;  3RNF C;  3VUX A;  1SIJ A;  3AE2 B;  3VUW A;  4HLE A;  2JYT A;  1T0Q C;  2BB5 A;  2CHX A;  3AEB B;  4DXA B;  1N5X A;  3FC4 A;  2MX2 A;  1KOT A;  1WGH A;  2G9H D;  3NG0 A;  3SD5 A;  2JF5 A;  2PPH A;  4EEW A;  3VR8 B;  4NJC A;  1D5Z C;  2JSV X;  3LYY A;  1DOX A;  2BPS A;  2DNF A;  2FUG 1;  2V3S A;  1WXV A;  5C3J B;  1YQ3 B;  1I7H A;  2UU7 A;  2ZVN A;  4S0R A;  1F2R C;  4KGS A;  3C8Y A;  2AQ2 B;  3AE3 B;  5CHW A;  3SEB A;  4A55 A;  1YMH E;  5IAA C;  1E0Z A;  1FCC C;  3DQV A;  2CHZ A;  4AJW A;  1J7C A;  1KLU D;  2KZR A;  1VZ7 A;  4MGZ E;  2UYZ B;  5LXH A;  4GDK B;  1HZ5 A;  1K52 A;  3W1Y A;  2LHE A;  4OVU A;  4DDG D;  1OQQ A;  3AU4 A;  2ZVO A;  1GOZ A;  2WLB A;  3TEW A;  4PS7 A;  1LGR A;  3K9P B;  1MG8 A;  3V62 A;  4KGT A;  1YN4 A;  3B2F A;  4YWG G;  3UIN B;  4AJY B;  3ZDM C;  4BAX A;  2WXI A;  3RMK C;  3GS2 A;  3Q8F A;  2HE7 A;  4FJY A;  2LVQ A;  3N32 A;  3KWV A;  3DBR I;  1UGJ A;  4TSS A;  2L8J A;  1C3T A;  3QHT A;  5H92 C;  2LXC A;  3Q14 C;  4K7S A;  1FNW A;  1YN3 A;  2FBW B;  4XDD A;  2B3A A;  5J2R A;  4BKT A;  1S1Q B;  4ANX A;  4WWN A;  5BMI A;  3ZRF A;  1I4G A;  4XYC A;  2BYF A;  3AE5 B;  3EHV A;  3L16 A;  4HK2 A;  3IFW B;  5D3D A;  2BT6 A;  1WXM A;  3EUB 2;  1TY0 A;  2VZK D;  2DYB A;  3U2S C;  1PDX A;  4K3C A;  4N58 A;  4F7Z A;  2MEK A;  3QCA A;  3NJT A;  4IWO A;  2IO2 B;  2KN4 A;  3Q3O C;  3Q3F A;  4P1B C;  2QMT A;  2VH2 A;  2V4L A;  2WGS A;  3L0W B;  2A4Z A;  3BY4 B;  4EKU A;  1JAL A;  3I57 A;  3SFE B;  2CS4 A;  1ZPS A;  2KDF B;  1CMX B;  1XLP A;  1I4H A;  3NY5 A;  1ZDX A;  1SEB D;  3AEC B;  5D94 A;  3I63 C;  1JWA D;  2JXT A;  2KK8 A;  3PRZ A;  5H8Y E;  4HKZ E;  3IHP C;  2ZJD A;  2CKH B;  1V6E A;  4HRO A;  4RF0 A;  3MC8 A;  3A9K A;  4W9D A;  3DVG Y;  4K7W A;  4E3C A;  2K25 A;  1T3Q A;  3RNG C;  1C1Y B;  3W2D A;  1JWU D;  1TZO A;  1N60 A;  3MHS D;  4MDK E;  4AQ7 A;  1WSP A;  3VRA B;  3RZF A;  1GC7 A;  1C77 A;  4XWT A;  3DWM A;  2HJ8 A;  1UNS A;  1WH3 A;  2L52 A;  1K53 A;  2LUE A;  4CO7 A;  4LNO A;  4HJK A;  5FKA C;  1Y56 A;  2W3R A;  1K51 A;  1WWT A;  4LNI A;  2O6V B;  1WFY A;  1QLB B;  4IUM B;  1OEY J;  3L10 B;  1WXS A;  1ET9 A;  1E7P B;  2QHO A;  3IXS A;  3PRP B;  1YNT E;  3VH3 B;  1EU3 A;  4FUL A;  3RD2 A;  5DCN A;  4MH0 E;  4II2 B;  4GGQ A;  4GDK A;  3PGE A;  5BO4 B;  1V97 A;  3L08 A;  1QOF A;  3NZ3 A;  3H1U A;  1TTN A;  2MBO A;  1MI0 A;  2V3N A;  1IP9 A;  1JWM D;  2JWZ A;  5JH5 C;  1UBQ A;  3HIZ A;  1XT9 B;  2IGD A;  3E9S A;  4XC2 A;  1V5O A;  5C23 A;  2K8H A;  4B95 A;  4N9F 4;  4A6Q A;  4DHZ E;  1HA5 A;  3SFD B;  1I35 A;  5CHV C;  2DZM A;  2L1A A;  4YTN B;  3TEZ A;  1TGZ B;  2JQR B;  4RM8 A;  1FEH A;  1BXT A;  3AE8 B;  3MTN B;  4MAC A;  1IBX B;  1DGJ A;  3QA8 A;  4KV2 A;  3LJ3 A;  4GIV A;  1ZW7 A;  2G4S A;  1IPG A;  3PV1 A;  2HTM E;  2VRR B;  3AE7 B;  3OJ4 B;  1L4Z B;  1I4Q A;  4FJV B;  1C76 A;  4WAF A;  2AQ3 B;  2BW2 A;  3GE3 C;  1RWS A;  1WJ4 A;  2MP2 A;  4XDC A;  3JSV A;  3ENE A;  5JZE B;  2WX1 A;  3AN1 A;  2ASQ A;  1JWS D;  4X57 B;  4C7Z A;  4IWQ A;  2SAK A;  1C79 A;  1R4N B;  1ISN A;  1NDD A;  3Q2A C;  1GJZ A;  4EUT A;  2NBU A;  3UQA A;  3GZN B;  4OZA A;  2KD0 A;  3PLV A;  3NVZ A;  2IY1 B;  4RF1 A;  1QOA A;  2WS3 B;  3BYY B;  1T0Y A;  2IYD B;  1P7E A;  3RNC C;  1CJE A;  3CF6 E;  1YIW A;  3N1X C;  1C4C A;  1D6E C;  1N6Z A;  3W9C B;  5D3I B;  4G3X B;  3DVN U;  2FCQ A;  2LFI A;  2PVO D;  4BKS D;  4ZHO A;  2GBR A;  3S2A A;  1UD7 A;  1WJN A;  2ZNV C;  5D7G A;  1L5P A;  3HRD D;  4XE0 A;  4K3B A;  1YQ4 B;  1FNU A;  3MC0 B;  1QOB A;  4JWS C;  3R7Q A;  3ONS A;  1JML A;  4C56 C;  3UIP B;  4K1R B;  4MGI E;  2N7D A;  2CJN A;  1WJU A;  3AU5 A;  2INC C;  1P1A A;  2JYE A;  4YSZ B;  1J7A A;  2RPV A;  2RPQ A;  1B9R A;  4CYE A;  5DPT A;  2Z0E B;  5AEK B;  1D4B A;  3JSV B;  5G2N A;  3JYU A;  2KAJ A;  3P1M A;  1WX9 A;  1E10 A;  2JT4 B;  4PYZ A;  1QF6 A;  2EMS A;  3DHI C;  1D3Z A;  5FK9 C;  2PW9 A;  1K8R B;  1TIF A;  2C9W B;  4RM9 A;  1F1H A;  4JWU C;  5E6O A;  2CR5 A;  1PQS A;  2DEN B;  2EMT A;  4ZRI A;  2RSU A;  4TQ1 A;  3DBL I;  1J19 A;  3B2G A;  3BIN A;  4FBJ B;  1L6U A;  3AE1 B;  3ZKJ C;  5TSS A;  1HTO A;  3N20 C;  2CU1 A;  2L0T A;  3NOB A;  1YQB A;  1C78 A;  2KTR A;  4KIK A;  2XBB C;  4ANU A;  4OW0 A;  2CU3 A;  3ZO5 B;  2M19 A;  3AMZ A;  4P16 A;  2BYV E;  2KTR B;  2XK5 A;  1R4M I;  3RNA C;  3DWG C;  1WXA A;  4RGO S;  2ZCB A;  3R8B A;  3OJ3 A;  4GU2 A;  5AZF A;  5DPS A;  3WCQ A;  3O13 A;  3VRB B;  2DHZ A;  4JL9 A;  1KLV A;  1I4X A;  1WM3 A;  3V6E B;  3BWU D;  3IVF A;  5IO9 A;  3U8Z A;  1FMA D;  1WF9 A;  2KJR A;  2ON8 A;  2IJ0 A;  3DVG X;  1DOY A;  1E7V A;  1MJD A;  4PT5 A;  3KQ4 A;  3M62 B;  1F52 A;  2JZ3 B;  1YN5 A;  4ICU A;  1JRP A;  4NJ6 A;  3LB8 C;  3M95 A;  5GXG B;  1L7Y A;  3CMM B; 
#chains in the Genus database with same CATH homology
 2M0A A;  4YTM B;  1CZP A;  2JZP A;  3W1S A;  3UI3 A;  2WXI A;  3ZGZ A;  1RYJ A;  1FIQ A;  1ET6 A;  1KLG D;  1PYW D;  4ITK A;  3AEF B;  2R61 A;  3GS2 A;  3Q8F A;  4YT0 B;  1YJJ A;  4C7Y A;  2W82 A;  2AQ1 B;  1QT9 A;  1WYG A;  1FFV A;  1N5W A;  3KWV A;  3BII D;  2I38 A;  2IGH A;  3FAH A;  5E6J A;  2ACZ B;  1UGJ A;  3FIL B;  2LEK A;  4TSS A;  4HKQ A;  1T5X D;  2NTS A;  4WWM A;  1HQR D;  2K9X A;  3IAS 1;  1NVI D;  2QSD A;  3AEG B;  3AEA B;  1JRO A;  1VZ8 A;  5H92 C;  3P4S B;  2WXK A;  5FR3 A;  1E6E B;  1FNW A;  1YN3 A;  2DLB A;  2FBW B;  3NVY A;  1M4V A;  1I4R A;  2QIL A;  4NAW B;  4XDD A;  4D2K A;  3KWL A;  4OHJ A;  1KRH A;  1SJE D;  1AWD A;  1EM7 A;  1BUI C;  3MJ5 A;  5BMI A;  2XNA C;  1I4G A;  1PGB A;  1B1Z A;  4USA A;  1SBB B;  1N61 A;  1FO4 A;  3AE5 B;  4OZB A;  2BTE A;  2KMM A;  1V1O A;  1V1P B;  5D3D A;  3E56 A;  2LJI A;  3AE4 B;  4ARI A;  1NEK B;  2BT6 A;  3EUB 2;  1TY0 A;  4ARC A;  2VZK D;  4H2A A;  4WH4 A;  3RPF C;  4WUR A;  3U2S C;  2L83 A;  2WXP A;  1PDX A;  4N58 A;  2MEK A;  1YJI A;  3NRZ A;  3FIL A;  3MHZ A;  5EE1 A;  4CQN A;  4DQO C;  2KN4 A;  4R3D A;  2QMT A;  3AED B;  4ZOH C;  2QJL A;  4A9A A;  1JAL A;  3I57 A;  3SFE B;  5BYQ A;  5I4D A;  2KWD A;  1ZPS A;  2VZK B;  2Y5C A;  4RNA A;  2RDG A;  1XLP A;  1I4H A;  1ZDX A;  3W5V B;  1CK1 A;  1SEB D;  2INP E;  1CQV A;  2J42 A;  2WXH A;  3AEC B;  3TEX A;  4B0M A;  4A90 A;  1JWA D;  1FRD A;  1K50 A;  2JXT A;  3CIR B;  5H8Y E;  3AE9 B;  4HKZ E;  1TYG B;  2PTL A;  2PLP A;  2KAC A;  4ZYS A;  4HRO A;  2XN9 C;  4RF0 A;  1XCT L;  2PIA A;  3PZ8 A;  4Q2J A;  1T3Q A;  3W2D A;  4US8 A;  1JWU D;  2MJD A;  2OED A;  1TZO A;  1N60 A;  3BVM A;  2K0P A;  2WXM A;  3Q8C A;  1I4P A;  1WXQ A;  4AQ7 A;  2N7J A;  1WSP A;  3ABV B;  4TMA B;  3VRA B;  2I2Y A;  5HG2 A;  1IGD A;  3EGR A;  4NZL B;  2H89 B;  3U52 E;  1TS4 A;  2WXJ A;  2WXN A;  1C77 A;  3Q69 A;  5MPO A;  3IAM 1;  4XWT A;  1UUP A;  3T3O A;  3DWM A;  3SR6 A;  1TS5 A;  1UNS A;  1L0Y B;  2L52 A;  4WIP A;  2LMC A;  1ESF A;  3IT4 B;  4B0E A;  3P4R B;  2EKI A;  2JU6 X;  1SJH D;  3CWI A;  2YEP F;  1K53 A;  2Y3A A;  1ZP0 B;  2IPK D;  1JQ4 A;  5HI1 A;  5FKA C;  1GPX A;  2ICI A;  1ZE3 D;  1Y56 A;  2W3R A;  1K51 A;  1WWT A;  3Q8A A;  4ZRQ A;  1AW7 A;  4RCO A;  1V8C A;  2BS2 B;  2X38 A;  2K5P A;  1FCL A;  4KKI A;  1QLB B;  2G1E A;  3MP9 A;  3U7Z A;  1ACC A;  2B76 B;  4IOI E;  2WU5 B;  4HJG E;  1ET9 A;  1E7P B;  3IXS A;  1YNT E;  3NS1 A;  3TUO A;  1EU3 A;  2J52 A;  1HXY D;  3ETR A;  2BYT A;  4MM3 B;  3V3X A;  2WXR A;  2PMV A;  4O1N A;  1FXI A;  3Q8B A;  1WRI A;  2EEL A;  1FFU A;  1L0X B;  3HVD A;  4M0W A;  4FXC A;  4JE3 B;  1AN8 A;  2L32 A;  1XO3 A;  3AE6 B;  3AM9 A;  1V97 A;  4DXF A;  1DOI A;  2W54 A;  1QOF A;  1EWC A;  3NZ3 A;  4IKG A;  3TSS A;  1VZ6 A;  3IT6 B;  4OVZ A;  5T8I A;  1MI0 A;  4UDU C;  5BYS A;  2JX5 A;  2V3N A;  2WXL A;  2K22 A;  2KDM A;  1JWM D;  1SE4 A;  2ZW0 A;  1XXG A;  1QKZ A;  1FD6 A;  4JPS A;  2MJ3 A;  2IGD A;  1SE3 A;  4C80 A;  3LXF A;  3E9S A;  2DBY A;  5EE9 A;  3VR9 B;  1QOG A;  1PGA A;  3GB1 A;  1ENF A;  2INN E;  4KX6 B;  1R7S A;  3ZQ4 A;  2BBC A;  1OFF A;  1V1P A;  5BMH A;  1DYQ A;  1XLO A;  3EA6 A;  2WDR B;  2TSS A;  4A6Q A;  4AS1 A;  1HA5 A;  3SFD B;  4L2Y A;  1F77 A;  1FNV A;  3AV8 A;  4OZC A;  2L1A A;  4YTN B;  3TEZ A;  3P4P B;  1ROE A;  2JQR B;  2WNM A;  4NAM A;  1QIL A;  2M56 B;  1J7B A;  2QIE B;  1FEH A;  1L0V B;  1BXT A;  3AE8 B;  4MAC A;  1IBX B;  2Q5W D;  1DGJ A;  4ZRP A;  3BYT B;  4TQ0 A;  1RM6 C;  3ZJV A;  1VJK A;  3B9J A;  2ZW1 A;  3URY A;  2NMQ A;  1VLB A;  4JX1 C;  2W3S A;  2HTM E;  4ZHP A;  1OQR A;  3AE7 B;  3MFG A;  1L4Z B;  2MH7 A;  2DYM A;  1I4Q A;  2HDE A;  3L4P A;  1C76 A;  5JXV A;  4WAF A;  2AQ3 B;  1P7F A;  1RFK A;  4YSY B;  1VR9 A;  2BW2 A;  3R2T A;  4DXG A;  4RFB A;  3BZD B;  2AX5 A;  1RWS A;  4MH8 A;  1QQR A;  1SXT A;  5C2T B;  4GDL B;  1C4A A;  4XDC A;  4KKJ A;  3ZYY X;  1N63 A;  1NYR A;  3J9C A;  2IDY A;  1L4D B;  4EE2 A;  1TKY A;  4YXD B;  5HHD G;  3AN1 A;  1JWS D;  2J53 A;  1KH0 A;  4C7Z A;  1FXA A;  1EU4 A;  2SAK A;  1C79 A;  2QEJ C;  4YSX B;  3RFZ B;  1TS2 A;  1SSN A;  1TKE A;  1C4P A;  1NEN B;  1BML C;  4OZA A;  1TJE A;  2GRI A;  3NVZ A;  3GP7 A;  4RF1 A;  1QOA A;  1ZXI A;  1EWY C;  2WS3 B;  3BYY B;  2DWQ A;  1MHX A;  2N9L A;  5EE0 A;  1T6B X;  1JWB D;  1P7E A;  1SF0 A;  2WQY B;  3T3N A;  1GB4 A;  1XF5 L;  2V4I B;  1LO5 D;  2PVG C;  1CJE A;  1IUE A;  1VDV A;  1VRA B;  3BK1 A;  2KQ4 X;  1XEE A;  1C4C A;  3AH7 A;  1D6E C;  3I9V 1;  2Y5P A;  1NI3 A;  1TS3 A;  1F0Z A;  1D5X C;  2GI9 A;  3W9C B;  1UWM A;  5D3I B;  3TEY A;  1ZUD 2;  1PFD A;  2LFI A;  3HVZ A;  3BVG A;  2V0G A;  3H8H A;  2PVO D;  2Z8L A;  2FE8 A;  2LHD A;  4ZHO A;  1IGC A;  4LTU A;  4WQM A;  5HFY A;  2W55 A;  5D7G A;  1L5P A;  2YEP B;  3HRD D;  2CJO A;  4XE0 A;  1YQ4 B;  1FNU A;  3BK2 A;  3MC0 B;  3PO0 A;  1QOB A;  4JWS C;  3U4E G;  1F2R I;  1JML A;  4C56 C;  1KF6 B;  1ZXH A;  4IDI A;  1FRR A;  3N9Y C;  1AYF A;  4P6V F;  4LLG M;  1GB1 A;  2BS4 B;  4L23 A;  4RGN A;  2CJN A;  5LNK 1;  3AB5 A;  2H88 B;  2JYE A;  3OWE B;  4YSZ B;  1KTK A;  1J7A A;  2RPV A;  1L6V A;  1MPE A;  1B9R A;  1N62 A;  1D4B A;  2K3U A;  2WXF A;  3HUI A;  2LUM A;  1XLN A;  2KAJ A;  1Q10 A;  4MT5 A;  5G5H A;  1E9M A;  3P63 A;  5EE3 A;  2D5G A;  3P1M A;  1E10 A;  2PKO A;  5AUI A;  2SEB D;  1XLQ A;  3Q8E A;  1WGK A;  1QF6 A;  2ONQ A;  3P4Q B;  4RGM A;  2E6X A;  4A8X C;  4YTP B;  5FK9 C;  2PW9 A;  5G5G A;  3KLS X;  2WU2 B;  4HRS A;  3W5U B;  1NYQ A;  3P42 A;  4JWU C;  3AEE B;  1FM0 D;  2WDQ B;  1IBX A;  2WDV B;  4LK0 M;  1A70 A;  1ZDV A;  2GB1 A;  4RH6 A;  4XWW A;  1JW9 D;  1PGX A;  1GAQ B;  4REZ A;  1MHH E;  1SIJ A;  2WP9 B;  1HEZ E;  3AE2 B;  3V05 A;  4TQ1 A;  2JYT A;  2BB5 A;  2BB6 A;  3AEB B;  1MVK A;  1SE2 A;  1N5X A;  3B2G A;  3FC4 A;  1L6U A;  3AE1 B;  1SB3 C;  5TSS A;  3BVZ A;  2G9H D;  4J3O D;  2DYO A;  2RDH A;  5BMG A;  1C78 A;  4L1B A;  3VR8 B;  4NJC A;  1D5Z C;  1HZ6 A;  4OW0 A;  2CU3 A;  2JSV X;  2IGG A;  5AUK A;  3LYY A;  1DOX A;  2FUG 1;  2M19 A;  2WXQ A;  1ZOY B;  5BYR A;  1YQ3 B;  5C3J B;  1I7H A;  3AMZ A;  1PUT A;  4P16 A;  4KGR A;  2RMM A;  3PZ7 A;  1F2R C;  1TY2 A;  2BS3 B;  2JWU A;  4KGS A;  4HEA 1;  3C8Y A;  3DWG C;  2AQ2 B;  2LGI A;  3NUH B;  4RGO S;  3AE3 B;  1C9F A;  3R8B A;  2N9K A;  1JCK B;  2WXO A;  3SEB A;  3R2I A;  1YMH E;  4A55 A;  2J4X A;  1E0Z A;  3WCQ A;  1FCC C;  4GLS C;  1D5M C;  3O13 A;  4RGT A;  3VRB B;  1J7C A;  1KLU D;  4N59 A;  1I4X A;  1VZ7 A;  2WXG A;  3NVW A;  2MJE A;  3BWU D;  1STE A;  3VQI A;  2OHF A;  4GDK B;  1FMA D;  3ZJT A;  1XCQ L;  1HZ5 A;  1K52 A;  2ON8 A;  2IJ0 A;  2LHE A;  2V3P A;  3NVV A;  3ZJU A;  1DOY A;  1OQQ A;  4PT5 A;  1GOZ A;  3KQ4 A;  2WLB A;  3TEW A;  1UWX A;  2N0S B;  4N6E B;  2E3T A;  4KGT A;  1YN4 A;  3B2F A;  1YN5 A;  4YWG G;  1JRP A;  1TKG A;  1KFY B;  2NTT A;  3LB8 C;  5GXG B;  4US9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...