3HUJA

Crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hujA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3hujA01
2AJSH 3C08L 3GSOB 4L3EB 3JV5A 2LQRA 3WS3B 1YEDB 3QUYC 4PPTA 3QQ9C 2CIIA 2CDGB 3UPRA 2H41A 4HZAA 3TNMA 2FB4H 1JHKH 1RZGB 3B5TA 2JJSC 2EDEA 4X9HA 1JWSA 1G0XA 1KENL 3BPLB 4I1NB 3C08H 2APTA 3R8QA 4Y88A 4V1DE 4R4BA 4J2XA 3MRHA 1U92B 1WWBX 3T0DA 2XICA 3U0WL 3S37X 3MRLA 2V7NB 3KPMB 1OAUL 2XKUA 2VQTA 4K3GA 4H1LA 1KENH 3FO2A 3VFSA 5CSZB 4ACPA 1EXUA 4NO0A 4IOFC 4YFLI 4PJHE 1UWEL 1EFQA 4PV8A 4OCRL 3I6KB 1C1EL 3U0WH 4JQXC 3TPUE 4Y16D 1OAUH 2FBOJ 3WKML 2DAVA 1VENA 1IVLA 2M2DA 2R1YA 3IKCA 4LQ1A 1RVFL 1U8IA 1FC2D 1A6PA 2W59A 1UWEH 5D71L 3NABL 4WFGD 3UEZA 1G7JB 2FJFB 4OCRH 4X99B 3S6CA 4HD9A 1C1EH 4GRMB 1JHTB 4V1DB 3NCYP 5H2BA 4MDIB 2HFFA 2YBRA 1OAZL 1RVFH 3V6OA 3NIFE 2VLLA 4G8IB 2ADIB 4ZUVB 3RNQB 4PLJC 5I74C 4H1LH 1JF6A 4XP5L 2UY6A 2IFFL 2WV3A 4PJHB 3MRDA 1OAKL 1XF1A 3QXWA 4LGSB 3KLDA 4PDCE 1OAZH 4DVBA 3KWWB 1HK6A 2E27L 3SO5A 3TPUB 1XFPA 3SN6N 1QLFB 2X4SB 2YKLL 3NFNA 1G9NL 4XP5H 5B3JF 2IFFH 4QWWD 5F97E 4NWTL 5DJYB 5HYJD 4LMQI 1IAIM 1OAKH 1CD0A 5D7IE 4M03A 5LKNA 4GO6B 1B6UA 1CLZH 2YKLH 1G9NH 3HAEA 3BFOA 2B5IB 4ERSL 3QDJB 1A02N 3VXPB 4F7PB 2WAHA 2BSRB 5DJXB 2FX7L 1GH7A 4NWTH 3Q6FA 5DVNA 2HN7A 4JANB 4LSVL 4MAUL 3BAEH 4GH7B 4DJMA 3RL1B 1TCMA 2DQJL 1G9NC 1YN7A 2CLVB 4OFYA 5DUBA 1Y6MR 2E9JA 4RGND 2GCYA 2RHEA 4DGVL 4X7TB 1KSRA 2FX7H 3MACL 4LSVH 4IJ3C 4MAUH 1KIRA 4TNWK 5E1HB 1MNUH 1T21A 4LVHC 1JWMA 1WSST 5F70A 5I9QC 1DBBH 2DQJH 5AZ2H 2YC1A 1A4JB 1AJ7L 5D7IB 5FCUL 5C0DA 2AJ3B 2A6KB 4MLSA 1G6VK 4DGVH 3RVTC 1HHKA 4GXUM 3MACH 2YD2A 3MTRA 43C9B 4YO0A 4HS6A 3TZVC 3IF1B 3CH1B 3HAEH 1Z2KA 4NFDA 3VFTB 3UYOD 5DRXA 3A6OA 1AJ7H 5FCUH 1MCHA 1DEEA 5HGDB 1IL1A 3WNKA 3U6RA 2P7TB 1CTOA 3TBYA 2EEAA 2VSCA 2DI9A 4AENB 3BISA 5DWUL 1KLUA 3B9DA 3LEVL 3V52L 4JY5L 4GMTL 4NQED 5ILTL 1ZS8B 1CXHA 3MLRL 1LK2B 4JAMB 1YYML 4ELME 2JJUA 2UWEE 2K7PA 1X4YA 5D5ME 3H3BC 3D39D 4F7MA 1KXQE 3DPBA 2Y4SA 5IFAL 5DWUH 1KEMH 4JHWL 5DMYA 4DCQB 3LEVH 3V52H 1IRAY 4JY5H 4F8TA 1T0MB 4M9OA 5ILTH 3FRUB 3MLRH 1CL7L 2R2BA 3QNXA 4Q74A 3QI9A 1DJSA 2YD1A 4JG0L 2CO7B 4JHWH 1T2XA 1XGTA 3PWVA 2BX5A 2WLZA 2WWKO 3KPRE 3VD9A 1JZ4A 4FQ1L 4L9LB 4LCUB 4LKCB 3LDBB 3QDGD 3LEXA 3PDOB 4JG0H 5FUCE 2X4TA 4ELMB 4HWEL 1TVBA 2UWEB 1LQSR 3P9MB 5D93B 5FO9B 5D5MB 4YR6A 2BSED 4X6CF 3TBTA 4WTXA 1Q38A 3HG1A 1F6AB 4QTHB 3VGGA 1A7RL 2GSIB 1LO4L 2NY1D 4FQ1H 2EIZA 4MXQA 1DQJB 3O9WD 1SJVA 2GY7B 1TITA 3SDDD 4NO5A 4PJ5E 2AXHA 2DMCA 2ID5A 2R1WA 2LU4A 1A7OL 4XVUC 5CINL 5KZCD 2F8OA 1FCCA 4ONFH 1A7RH 1LO4H 1WIPA 1HN1A 4X4ME 1X5IA 3KPRB 1LO0L 4HEME 2ZSVA 4KROD 2XA3A 3OJ2C 2FZ3B 2QV2A 3VXSD 2HRLA 5C92A 5ICYB 2VLKA 1A7OH 4YPGB 1KCRL 1VESA 1WEJL 3L9RB 5CINH 3LQZA 3QI9C 1EO5A 2CRMA 5ISZB 3BXNA 1J7VR 1INQB 2YXFA 1OAQL 3WNOA 1LO0H 2OL3B 3B9KB 1WZMA 5TDNA 2FBJL 1R3KA 5ADPL 1TETL 1G0DA 3CC5B 2FLBT 3KLSA 2B20A 1AP2A 1KCRH 1WEJH 3G6DL 5DMIL 3P0GB 1DEDA 3VGBA 2FSEA 5EBWA 1NEZA 3ECBA 4PJ5B 4RGMB 1PY4A 1WAAE 5CLWA 1OAQH 1V7ML 2IBBA 3MROB 3ZT6A 5SWQB 2FBJH 1TETH 5FKAA 3DSNA 3FHAA 5HVFB 4L3EA 3GSOA 5GS2D 5DMIH 3G6DH 4M7LT 4MXQC 4WVRA 3WS3A 3VI3F 1HHJB 1JTTA 1YEDA 3GBML 2CDGA 3IDGB 4M6NL 1NBQA 2IAMD 5KVMC 2BRQA 1RZGA 1FHGA 1V7MH 4XP4H 4FS0A 3BEWB 1ZTXL 1QOKA 1QPXA 4MLIA 2IALB 1U92A 3EOTL 3GBMH 1QSED 4M6NH 2V7NA 3KPMA 5I1KL 4ESKA 4YFDB 1QSVA 5HVGB 1ZTXH 5CSZA 1EEZB 3ARDB 2NZ9D 4JG1L 3EOTH 4TOYH 3I6KA 1CDUA 4DEPB 1J18A 3V4UL 1I7TB 1ULVA 4L4TD 1F00I 3KG5A 3T0EE 1ZLWK 1X4ZA 4KQ3L 3C9NB 3MV01 1MY7A 1G7JA 4BQ9A 2FJFA 4JG1H 2C5DC 4X99A 2IPUG 4EKXA 2ZUWA 3V4UH 1JGLL 1WTLA 4GRMA 1JHTA 4V1DA 1CD9B 4MDIA 2FJGB 3TBSB 4KQ3H 3BVNB 4OF7A 4G8IA 3VWJB 2ADIA 4ZUVA 1ADQA 3RNQA 4YXKH 4Z8FL 4OCLC 3GMLB 4IIQC 4Z76B 1JGLH 3BPLC 4PJHA 3ZKXB 2CQVA 3T0BA 2HFTA 3KWWA 2ZUYA 3TPUA 3DMMD 2VXUL 3T0EB 1QLFA 2X4SA 2ORBL 3ARFD 4Z8FH 3K1DA 3I50L 1J1XL 4O2CB 1Q9LB 2EIEA 1MCLA 5GZOC 3BN9D 4WWKD 5SX5H 3QHZL 4LSRH 2ZPKL 2VXUH 4DK6A 2ORBH 4P99A 5IMLB 1DP0A 3QDJA 3QO1B 3VXPA 3I50H 1J1XH 4F7PA 5DJXA 2BSRA 4ZTOL 1IM9B 3QPQC 2YUZA 4JANA 1CLCA 3PGFH 4R26L 1YY8B 2N56A 3QHZH 5DHXB 1ADQH 2DQCH 1LEKB 5DA0B 3SE8H 3RL1A 2CLVA 3CCHB 4OLWL 3VGAB 5EOTB 4ZTOH 1JIBA 4YBQC 2EC9T 2AJZB 3SDXE 5LQBL 3KGRA 5C0AE 1S78C 4Y0GA 5EZIL 4OLWH 1JZ7A 1A4JA 5D7IA 3SGJC 3DLQR 5JIKA 2AJ3A 2A6KA 3MNZB 8FABB 1SVZA 3AC0A 4HGWB 3ULSB 4ZOCA 1FJ1B 3STBA 1EA9C 4U6YB 2CRZA 2WY3A 1NKRA 43C9A 3SGKA 4EOWL 1SHMA 3IF1A 4JFDD 3CH1A 5E9DD 5LQBH 4RWYH 3I6GB 3VFTA 4MA8L 5EH1A 3B4NA 2LAGB 2HFGL 5EZIH 4IM8A 4ZQKB 2FD6L 4AH2B 5K9KB 5BZWB 1U95B 5C3TA 1D6VL 5HGDA 3PGDB 1T5XB 1PKOA 4I8DA 4N68A 2YRPA 2P7TA 3LOWA 4QLRA 4Z0BL 3HI6H 4EOWH 1AQKL 3EYUH 2B5IC 4MA8H 4ZD3L 2HFGH 5AEAA 2FD6H 2ZNXA 4AENA 1EHXA 2J4WL 2NY3D 1TMCB 3ARZA 3SDXB 2DQTL 1KB9J 2UVEA 1IGFL 5C0AB 5C0GB 1D5ZB 4Z0BH 4PGZA 1AQKH 1F90H 3MMEB 1ZS8A 4EIZC 4I0PB 4ZD3H 1LK2A 3ISWA 4JAMA 3BKCH 3SOBL 4GS7B 5FF6B 3IXAB 1P84J 3BYYA 3MFFB 3KLHD 4HIIB 1LGVA 2J4WH 3WHE0 4C59B 2DQTH 5CP3A 5DURD 4NGHL 5CMAB 1IGFH 4DCQA 2V2XB 1P1ZB 1ZWIB 1T0MA 2ZKHL 4NQXB 4WI3A 2R39A 3TVMB 3FRUA 3K8LA 2XN9E 3PQYD 4JB9L 1JYWA 4YEEA 4GLRH 4JQVA 3SGKC 1MCWM 3B83A 2FH8A 3BIBX 4NGHH 5IESL 1RAMA 1N8ZB 2ZKHH 5EPMB 3CFKB 5C0FB 3IB4A 1A6TB 5CIPB 3SGEI 4JB9H 4L9LA 4LCUA 4LKCA 2PYED 2EDXA 3PDOA 5IESH 1A7QL 2W92A 4ELMA 4NCC2 2UWEA 3P9MA 4QOKE 5FO9A 5D5MA 1IC4L 4C58B 1BP3B 5ELIA 1MJJB 4QTHA 1F6AA 2GSIA 5F7FA 4D2NA 5CP3H 5I2IB 1DQJA 1I8MB 3L3KB 3NFSL 1A7QH 2XN9B 4XPFL 5HHMD 2R1XB 3QEUB 4Q97A 2CH8A 3ZKMD 1IC4H 3T0XA 1HHIB 3QISA 3OR7B 3RJDA 3H9SE 3KPRA 2AJYL 2W9EL 3NFSH 1S9XB 2FZ3A 4XPFH 5ICYA 2ICWB 4YPGA 3L9RA 3OKYA 1EBAA 4JQVC 4EDXB 1INQA 3DV6B 3SDCD 2DYPD 1YJDL 1JVKA 2OL3A 3B9KA 4GRLB 2AJYH 2W9EH 5BO1H 1Y6NR 3CC5A 4OFVA 4PRNB 1EDQA 3LDBC 4PJ5A 4NPYB 2CDFB 4QGTA 1YJDH 2X4UB 3MROA 4OD3L 4S1RL 2FATL 5SWQA 2WIMA 5FECB 5D93C 4NRXB 5DD0L 4XBEH 1UYWH 5DGRA 3ZO0A 2D7NA 4NCDA 3H9SB 4X4MA 2P46B 2B4CH 5I16B 1HHJA 3B2VL 4JRYE 2OL3L 1GSMA 3IDGA 5FYKL 2VAAB 3BO8B 1YJDC 5HGGS 1Q0XL 4S1RH 2FATH 3S88H 2IMMA 1EEYB 1UM5L 2EDOA 3BEWA 5DVOA 2EH7H 4LFHG 1CG9B 4ETQB 2OMBA 3S96B 1GGUA 3CIQA 1NCDH 2IALA 3B2VH 2OL3H 2O5ZL 3WFEL 3NIGF 4IOIB 4KK9C 3FB5B 4P4KB 2EYSB 1PGRB 2CRIA 4XNUL 3LKPB 5IOPB 4XPGL 2W1NA 1WAAA 5FUCC 4OCMC 1EEZA 3ARDA 1MFBL 3EIFA 3HKFA 1VDGA 3B9KC 5TGBB 2O5ZH 3WFEH 3Q5TA 1I7TA 2R69L 1BJ1J 2QEJA 2VISB 1TLKA 2DJUA 4XNUH 4JRYB 5KSBE 4LAJH 2J8OA 4XPGH 3C9NA 1MFBH 1TTGA 4RGMC 3DHMA 3SGDI 4O51B 4H1LG 1SQ2N 2XTJB 2R69H 4HW6A 2DTSA 3GJFB 4YHKL 1SY6L 4HIXL 1K5NB 2FJGA 3HZMB 3TBSA 1UQSB 3BVNA 4PJCE 3FFCE 3VWJA 5SV3A 2XWBB 1RUKH 3EJYD 3GMLA 4Z76A 1MPAL 3QCUL 1SY6H 4HBQA 4HIXH 5B3JE 4UV4L 1JJUA 3DYOA 3QAZB 1MHHB 3ZYIA 3T0EA 1B4JH 1PFCA 5HGBB 3KPQB 1HSAB 1MPAH 2J2ZA 2VXQL 4O2CA 3HCVB 3ARDC 3OAUL 1KULA 5BQ7B 2PN5A 4LDEB 4DEPC 1A1MB 1A2YB 2K1MA 4BK4A 5IMLA 4HXBL 3ZDXF 3T2OA 2X1OA 5DZOA 3QO1A 5AZEL 4U1MB 2VXQH 2X42A 5D7JD 1IM9A 3FFCB 3EOYG 3K46A 4HG4K 2HTLD 3OAUH 1YY8A 4OGXH 2ZUXA 3RKPA 1LEKA 2Q20A 1WK0A 1FNSL 4X0KB 4KMLB 4KQ4H 4D3CL 3CCHA 2UUDK 5EOTA 4HXBH 5AZEH 1FQ9C 2W0LA 1VFUA 1ZHKB 4PGEB 5CKGA 3HAEG 3L95B 3VWJC 1DANT 5A2KH 4G8FB 2AJZA 3QWOB 4M6ML 1FNSH 1JYVA 1FNEB 4D3CH 3VXMB 5CJ5A 3TH4T 3MNZA 5HI4C 8FABA 4HGWA 3ULSA 3OAYH 1FJ1A 4U6YA 2W0PA 4QY8B 3WNPA 4Y5VC 5EU6E 3L7FB 1H3TA 5TDPB 3QFDB 4YDJB 3I6GA 4M6MH 5M7QA 2BVQB 4ZQKA 1WGOA 1UB6B 4AH2A 5K9KA 5BZWA 3ZKQD 1U95A 4PBWD 2ZUSA 4OGZA 3PGDA 1T5XA 1Q9OB 1LO3L 3ALWA 2GUOB 3UTTD 1WBYB 2G2RB 3OX8B 5F9WB 1L7IL 2NNAB 2OSLB 4MD4B 3BZEB 4PB0L 1TMCA 3SDXA 5IB2B 1LO3H 5C0AA 5C0GA 1D5ZA 3MMEA 3VGAC 1L7IH 4I0PA 4NUJB 3HB3D 5FF6A 3IXAA 5EU6B 1GAFH 3MFFA 1E4XI 4HIIA 4PB0H 3HZYB 5CMAA 2V2XA 1P1ZA 1ZWIA 4YX2L 1TNNA 1U3ZA 4NQXA 4BZ1L 3TVMA 3AUVA 2EE2A 4O2EB 1MCNA 4KTDL 3MLZL 2F8XC 3D18B 1GOFA 1KYOK 3SKUD 2MFNA 5E95B 1JPSL 3LQAL 4OI8A 2RGSA 1AGDB 3U79A 4YX2H 1N8ZA 3Q3GB 4WFGE 4N1EA 2NY0B 3TWCL 5DZNA 4BZ1H 3LV3B 3CFKA 5EPMA 2E7HA 3S3PA 5C0FA 3VXUD 4KTDH 4HUUB 3MLZH 1A6TA 3FN3A 5CIPA 4X6CE 3LQAH 4PGCB 1D9KB 2BXZA 2AERT 4Q9RL 3K8KA 1EVTC 5ETUB 2NXZD 3TWCH 4N8VG 1QYGL 1MJJA 1A6WL 2EXYD 3WS6A 5DDHB 3MGOB 4YDLB 5I2IA 2UZIL 25C8L 1M7XA 1I8MA 2BDNL 3LQAC 2P45B 3FAWA 2HVKB 2KZWA 3L3KA 2XN9A 1PY9A 3MUY1 2R1XA 4I0PC 3QEUA 5EG6C 4GS7C 3WXWL 1QYGH 1HHIA 3EDKA 1F3DH 4N9GB 1MSPA 1A6WH 3OPZL 3OR7A 5DEZA 2N7AA 4JPVL 2UZIH 5HYJE 2BDNH 5JW5B 5C2BL 1FZJB 1S9XA 4OLUL 3HC0B 3N85L 1QHOA 2ICWA 4X6CB 5CIPH 3OPZH 1N6VA 5I17B 4EDXA 3TLRA 1DUYB 4JPVH 1DDHB 3DV6A 4CDHA 1MF2L 2F19L 4M43L 5C3LD 4GRLA 4LKXB 1E4KC 2ICWI 3I3DA 4TN9A 3N85H 1RY7B 4BUHA 4YPJA 1RIUL 1MCOL 5FYLD 4PRNA 3O8XD 1VEPA 3Q1SL 5JXED 5J56B 4RGNE 5FYKU 3RKDC 5I66B 1DQDH 4NPYA 3BUTA 2CDFA 1MF2H 2F19H 1DLFL 1IM3B 2X4UA 4M43H 4ORGB 5HD8D 3U1SL 3VI3E 5FECA 3SKOB 2A74B 2KQMA 4NRXA 3Q2CA 2I9LB 5CGMA 1RIUH 1CXFA 2W91A 3H9SA 2QSCL 4GKSB 5HYJB 4XHQA 2PO6D 5GGVL 5I16A 2NY4D 1K9TA 3MBED 4FOMA 4P23D 3VI4E 2VAAA 3BO8A 4FP8L 3R1GL 1EEYA 3EOAB 1MUJB 3MXWL 5HY9B 1K6QL 1BM3H 1CG9A 3DVGB 4ETQA 2EICA 2QSCH 2N4IA 4WHYH 3S96A 5GGVH 4HPYL 2YD7A 4IOIA 2DL2A 5F7UA 4XWGL 3FB5A 4P4KA 2EYSA 5J13B 1T04B 4FP8H 3MXWH 4OSUL 1K6QH 4RGNB 3LKPA 5C09D 5IOPA 4P5TD 1DFBL 3PV6B 1JNHB 4HPYH 4UTAL 5TGBA 3KR3L 5E24E 4XWGH 3L3JB 2LE9A 5DRWB 3LY6A 4MA3B 2VISA 2V5TA 3CFCL 4OSUH 1J0KA 3BH9B 4NQEE 4JRYA 1DFBH 2D7TL 4KAQL 4CRPA 4O51A 1QNZL 3D39E 4UTAH 4C83B 3QWRA 3KR3H 3GJFA 3QEHB 1K5NA 3HZMA 4L3CB 1UQSA 1F8TH 4KAQH 1IKNA 2BK8A 3DX8B 4M9PA 1MCRA 4EBQL 1B9ZA 2XWBA 5BJTB 1N0LA 2JLLA 4HZLB 1BQUA 1Z9OA 2O26U 4BFGA 2I07B 1MHHA 4EBQH 5HGBA 4P4KC 4NDMB 4NQEB 3QDGE 4BQCA 3KPQA 4AJ0A 3W0WD 1HSAA 3DRQB 3ZL4L 3AS0A 4BJLA 3HCVA 4FQCL 3BD4A 1CD1B 3D39B 1WLHA 5BQ7A 4OF8A 1HKLL 1A1MA 3WXVL 1A2YA 4P9HL 1DBKL 1ZAGA 5LG1A 4YUEL 3L3GB 3GJFH 4BH7B 1AGCB 4PRID 4U1MA 1BPVA 3ZL4H 3BOVA 1PG7L 1K8IB 3FFCA 4FQCH 3PV7A 4S2SB 2GJ6D 3WNMA 3VH8B 3SKNB 5T1MB 3WXVH 2XTJC 4P9HH 2EKSB 1DBKH 3AMLA 4X0KA 5C08D 1IE5A 4YUEH 3VXSE 5DJCB 2VDPH 1ZHKA 4PGEA 1IKNC 3L95A 3QDGB 5D1XD 4G8FA 1A6ZB 2GKIA 1UKSA 3GUTB 3QWOA 4P9HC 1FNEA 3VXMA 5SWZB 3MOQA 2G9HB 5D7KD 3N1GC 2DDQL 5TF1L 2NY1B 4UNUA 4I4WB 4QY8A 3O9WB 3SY0B 3NCBB 3QAZC 4HC1A 3L7FA 4H88L 3SDDB 5TDPA 3QFDA 1HIML 2VDML 4YDJA 2BVQA 3F65A 4WI4A 5KZCB 1UB6A 4DW2L 2EDWA 1ZLSL 2DDQH 5TF1H 4N8CL 3BW9B 1Q9OA 3ZHDA 2GUOA 4KRLB 1WBYA 3PP4L 1W0VB 2G2RA 3D85D 3P9LB 4KROB 3OX8A 4H88H 3VXSB 2NQCA 2NNAA 2VDMH 2OSLA 1FGVL 1EGJA 3IAPA 5I1HL 1CFTB 1NQBA 4MD4A 3BZEA 1F3RB 1ZLSH 1P6AB 4N8CH 4KK8D 5IB2A 1MCEA 4HC1L 4ZTPL 4WW2F 1MI5B 1TDQA 3WN5B 2VZ3A 3PP4H 4OB5H 4V3DB 1U8JB 3QIUD 4GAJL 3JTSB 3RIAK 1N6QL 1QSEE 4LRIC 4XGZB 1FGVH 4NUJA 5I1HH 2QSQA 1M4KA 4DWHA 2VDLL 1C8PA 5EU6A 4I77L 4JREB 2AEQH 3GHBL 3HZYA 2F54D 4HC1H 4J3UA 4ZTPH 3D3VE 5FAAA 5KS9F 1Q94B 3DX9B 1EGJL 1KTRL 5KVEH 3LD8C 4OBSA 4O2EA 4W81A 4XTRC 1N6QH 4OFIA 3RIFF 3GDBA 3MGAA 4L4TE 2VDLH 4RA3A 3IT8D 3D18A 4I77H 2X70B 3E6FB 3GHBH 2R4SL 2IAMB 4P9ML 1AGDA 2E6JA 1A7NL 3Q3GA 4M62L 4OKDA 1BX2B 1EGJH 3LV3A 2DM7A 3MUGB 4FFZL 4HUUA 4HIEB 3GBLA 4LGRB 2VZVA 3D69B 3PP3K 3PWUB 2C4XA 3QG7L 2R4SH 1QSEB 4PGCA 5F9WC 1D9KA 4P9MH 5IBTL 2XWJB 1MCDA 3PXJA 1A7NH 5ETUA 4FFZH 3RA7H 5DDHA 3MGOA 3D3VB 5I1DB 1NAKL 3SDYH 2RFXB 4JFXB 2BHYA 2HVKA 3QG7H 5IBTH 4Y16A 4L4TB 5DRZB 3GSXB 1TFHA 1QFUL 4N9GA 4CU7A 1NAKH 3DXAD 3HUJF 5JW5A 1S9KC 5CJBA 1FZJA 3HC0A 1B0RB 4HKXB 1T3FB 1ODAA 2NR6D 4X6CA 4LLDB 5IVXE 3GIVB 4OM1L 3JV6B 2P8LB 5I17A 1DUYA 1DDHA 4LKXA 4U1IB 2NY0C 2NW3B 2EDYA 5DFTA 5GISH 4LCIL 4QRSB 2XA8H 4M7LL 4OM1H 4D0CB 5DI8B 5I66A 1GGYA 3WIHA 3DMMB 1AI1L 1D9KC 4TUOB 1IM3A 4ORGA 4OUOA 3ARFB 3SKOA 2A74A 1CXLA 2I9LA 5JPNB 4LCIH 5HYJA 4GKSA 4M7LH 4WWKB 2DM3A 2ADGB 4QT5B 4RMTA 1AI1H 3A0OA 4PLOB 4UT7L 3P9WB 2ZUTA 2UUDH 2KUTA 1MUJA 3EOAA 4JFDE 5HY9A 1A7BA 1RI8A 1MJUL 5E9DE 3DVGA 1I75A 3IDMB 3N1QC 4H5SB 2OR7A 4LOUD 3WIHL 4WV1B 2V2TB 4J3XA 2OTUB 4P2QD 4UT7H 4XCFL 1T04A 3RVWD 1B0GB 1U91B 4YK4B 1MJUH 2Q8BL 1NSNH 4M00A 2EDKA 4KDTC 4OZHE 3QHFH 3WIHH 5JO5B 3PV6A 1SYSB 4OZFB 1JNHA 2Y6SC 4Z0XB 3W39A 5EB9A 2C26A 3L3JA 5ITFB 3GMOB 5DRWA 4MA3A 4LSQH 3MJ6A 3DGCR 3WMSA 4L29B 3BH9A 3B9AA 2EYRB 5K9QG 3O0RL 2Q8BH 2HA1A 5F7LB 2LFGA 3JWOL 1UWXK 1JZ6A 4JFDB 4C83A 5E9DB 1FSKB 1JV5B 4QRPD 1PSKL 4ZFOB 3FCTB 4IRSD 4ZMAT 3QEHA 3QR2A 2A9NH 4HX1B 3I85A 1JZ3A 3O0RH 1FLRH 4L3CA 1YEKL 3JWOH 4JN2B 5E6ID 3DX8A 1KBGL 1KF9B 3PQYE 3MV11 2DOCA 5CD5D 1DSFL 2ZOKB 1JPFB 4PJGF 5BVPH 1PSKH 4OZHB 2YD9A 5DO2C 5BJTA 4OZIF 3H42L 1ZEAL 3AROA 3W5NA 1LQVA 2YMXL 2NY3B 5J11B 4HZLA 3JWOC 1YEKH 2D7MA 1KBGH 2I07A 5JOFB 2PYEE 4NDMA 4K2UL 4NQEA 5J13C 1DSFH 5CBEB 1MFCL 3NCCB 5D2LF 3DRQA 2Y36L 4FFYL 4RGNC 4XC3L 1YDPB 4R7DB 4YBHA 3CSYB 3H42H 3RWJB 1CD1A 3D39A 3FL7A 3TFKD 4KXZI 2BY1A 4OIIL 5DURB 2D0GA 3S9DB 3VXTB 1I8IB 1BD2D 1EUTA 4K2UH 3L3GA 4BH7A 4HSQA 1MFCH 1AGCA 2CXKA 4FFYH 2Y36H 3K4ZA 3PQYB 3LRGA 5HHME 4BK5A 1K8IA 4PP8C 3UPAA 1S7XB 3DJ9A 1J0YA 4OIIH 4S2SA 5GJSL 4W6XB 3VH8A 3SKNA 5T1MA 2VWEE 5IR1B 1M7IB 2EKSA 1VGKB 1H8OA 3H9HB 1T6VN 5J1TC 5BMFL 3RWEB 5DJCA 2DIJA 1CS6A 2RBLA 2VDKL 1AXTH 3QDGA 5AG8A 3TJEL 4KXZH 5GJSH 1A6ZA 3GUTA 1U8QB 3UBXB 5SWZA 2BVOB 2G9HA 3EYVB 5BMFH 3GSVB 3FQRB 3G9VA 2P24B 4UTBL 2X5PA 3Q48A 4I4WA 3O9WA 3SY0A 2VDKH 5FIEA 3C8KB 3SDDA 4XNXL 3GSNB 2CJUL 2EE6A 4I48B 4ZPTB 5HHMB 3ROOB 1U8KB 1R6VA 4HIJB 4ZG1A 4YHOL 2AEIT 4UTBH 3BW9A 3IGAB 4RFEB 1CVSC 3WEXB 5E56A 5DVMA 4FFVD 2Z31D 1W0VA 3BPCB 5A2IH 3F58L 3G9AB 2NTFB 4XNXH 3VXSA 1X5HA 2PXYD 2CJUH 2FGZA 1CFTA 5IEHB 3RWGB 4LQFH 5DMJB 1QEWB 4YHOH 3IDXL 1NDGB 1KT2B 1OTUC 4XMPL 3SDCB 2DYPB 1MI5A 3WN5A 5J7CC 1U8JA 2GEEA 3WNLA 3JTSA 3MRMB 4XGZA 3NZHL 4OUUB 1JYXA 3FQWB 4L1DA 4XMPH 4LCWD 1LEIB 1Q94A 3DX9A 1ACZA 4F7EB 4O4YL 3GHEL 1ACYL 3NZHH 1AR1D 1CF8L 1HHHB 2NY1C 3DYPA 3OHXB 3LEYL 5F7NC 2X70A 3E6FA 3OKNB 5IFHL 2IAMA 1EHLL 5I1GH 4DAGH 4OFDA 1BX2A 5IBUB 4O4YH 3MUGA 1DL7L 3F7RA 3GHEH 3BPOC 1CF8H 4HIEA 5GSRB 1C5BL 3D69A 4O58L 3KXFD 5JW4N 3LEYH 3PWUA 3TC9A 4KROC 5IFHH 1OAYL 1QSEA 1EHLH 2XWJA 2FHBA 3MFGB 2WQ8A 3JZ7A 5I1DA 3D3VA 4DKDC 1C5BH 4NFBA 3MX0A 2RFXA 4JFXA 1NCNA 3WN5C 5E8PB 1OAYH 3VWKD 1NFDF 5E2UL 4QRRD 4L4TA 3CLFL 5DRZA 5GS2H 3GSXA 1TJHH 2O93L 3RGVB 4GKNB 4H0GA 5HHVH 5KJRL 4JREC 2AGJL 1R3LB 4F9PA 1RZJH 5GGSB 1IKFL 1B0RA 4HKXA 1T3FA 4OIBA 5EU4B 1ZT7B 1OTSD 4U6XB 3CLFH 1UXWB 5I1AB 2VAJA 4LLDA 3GIVA 2D9QB 1EJOL 3JV6A 3U4AA 2P8LA 5KOMC 3ARUA 5KJRH 2AGJH 2IAMC 4HWBA 4U1IA 4UT9L 4E5XB 2APXA 1F11B 4LK4A 2VE6B 3GO1H 2NW3A 1IKFH 3U82B 4QRSA 1B0WA 3VFOB 1DVFD 1QFHA 1PYWB 3IDYB 4D0CA 1I8KB 3QYCA 5DD5L 5DI8A 5CHNB 3DMMA 1HKFA 4TUOA 1FFOB 4UT9H 5L0QB 4JKMA 3ARFA 3GKWH 3QJHB 3HPJB 3FMGL 4WTWA 5JPNA 3STLB 3I9GH 3V6FB 1BREA 1FG9C 1DQTA 3ZKSD 4OGAD 4WWKA 3LAFA 2ADGA 4N90D 4PS4H 4QT5A 4RMWA 5DD5H 4M8QB 5EU3B 2VABB 4HWBL 3RFZC 4TQEL 5TE7L 4DQOL 5IVXA 3VE0B 5JORB 3FMGH 4IOFD 5D7JB 3QQ3B 3IDMA 4H5SA 1GGBL 5DQJB 4WV1A 2V2TA 4A2MA 4HWBH 2F8VA 2OTUA 4F9PC 2EDLA 4JZJB 4TQEH 5TE7H 3D5OF 3UTTE 4XH2B 1V3MA 1F02I 1B0GA 1TENA 1UENA 1U91A 2B1HL 2BVUA 4LFHD 4YDKL 1LK3L 1GGBH 3DIFB 1X5FA 5HHOD 5IJVB 5JO5A 1SYSA 4OZFA 1GXEA 4Z0XA 3D87B 3ZKNC 5MERB 3ARGD 3O4LD 3P2TA 3GMOA 5ITFA 3HRZB 4AM0B 2OTWB 3RY5A 4L29A 1BMGA 4PJAF 2EYRA 5KAQF 2CKNA 2HTKC 4YDKH 1LK3H 1QSFD 3MYJB 4LL9A 3DMMC 5GIRB 4MA7L 4JFDA 1EH9A 5E9DA 1JV5A 5J12B 4ZFOA 2XKNA 3H9ZA 3FCTA 1IT9H 1UFUA 4F33B 3NFPB 3BN9C 4HX1A 2AXGB 3UJIL 2ENSA 4JN2A 5GS3A 3UTTB 4BYHA 1VEOA 3MRRB 3ZE0E 3X13B 2UYLB 1IJ9A 4X98B 2ZOKA 1JPFA 1VACB 4OZHA 4MMXC 3KJ6L 4KRNA 4F37F 4L8BB 1F6LL 4OZFH 4XCCL 5DK3A 3ESVF 1U93B 3VXUE 2E9WA 4HWUA 3UJIH 3FO9B 3RNKB 5HDOA 1G7LB 5JOFA 1WFTA 4ZFOL 5CBEA 4YK4C 1YDPA 1WBXB 3KJ6H 4R7DA 3CSYA 3RWJA 1IC5L 3BE1H 2EC9U 1C5DB 3HNVL 4XCCH 4UV7L 3P73B 2UVFA 3SCMC 3VXTA 4MJ2A 1I8IA 2NX5D 2DIBA 1S3KH 1X44A 1RURL 4ZO7A 3IS0X 2EDFA 2D7OA 3PQYA 4LNVA 4P57B 1JFMA 1FE8L 3PP3H 3HNVH 2GHWB 4HWZB 4HHAB 4DUWA 4G42B 1J5OH 1FSKC 1XF5B 5IR1A 3RBSA 3WSQL 1M7IA 3P4OB 3VFGH 3H9HA 2Z35B 3MRBB 1RURH 2VTFA 2OLDA 3VXUB 3RVTD 3RWEA 3P0VL 3LN5B 4KJWC 2FGWL 3TZVD 1FE8H 1FPTH 3KYAA 1U8QA 3WSQH 3UBXA 3NPZB 3FONB 2BVOA 3EYVA 2DQGL 3GSVA 3FQRA 2NY3C 2P24A 5J11C 3P0VH 4XX1E 4JN1L 3OAZK 5FYLE 2FGWH 2W60B 3CXDL 2ATKB 1L7TL 3C8KA 1SVCP 3H7LA 4TTGA 1S7WB 3GSNA 3ALPA 4I48A 5HHMA 4ZPTA 3ROOA 1U8KA 4HIJA 1MY5A 4MJ4A 2DQGH 5HYQB 3IGAA 4JN1H 1X7QB 4RFEA 3WEXA 3C5JB 3CXDH 3BPCA 3VFVB 1L7TH 2NTFA 2YUVA 1WC7B 2ESVD 4UDUB 5IEHA 4PUBL 4X6FB 3RWGA 3WLWD 1NLDL 1QEWA 1NDGA 4CVXB 1KT2A 2LABA 3SDCA 2DYPA 3CDGB 4XI5D 3RAJL 2HKHL 3MRMA 5KS9E 3BYTA 4OUUA 1HXYB 4NKMB 5JA8B 5GRVK 3O8XB 4JVWA 4PUBH 3FQWA 1NLDH 5C09E 3MUJA 3TCLB 1LEIA 5FUOL 4KVNL 3GSNH 1NCBL 1NUFA 1KCSL 3RAJH 4XPHL 4F7EA 3OF6D 4KKAD 4KZEL 1HHHA 5J8OA 3LPGA 2PO6B 3OHXA 5EOQL 4WW2B 3MBEB 3OKNA 4P23B 3CFBB 5FUOH 4KVNH 1NCBH 3DECA 3GMMB 1KCSH 4XPHH 3EO0B 3WFBH 1I4FB 5DC0A 1RIHH 5GSRA 2VWEC 1CWVA 3ZZ1A 3QUXC 5EOQH 5C6WH 3BSZL 4M5YL 5KS9B 4JKWA 4XVUD 4Z95L 5GRUL 5C09B 3R8BB 2ARWA 4P5TB 2Y06L 3SDCC 3OB8A 1CXKA 1KTLB 2A0LD 3BSZH 4M5YH 5E8PA 3DX6B 1CR9L 4U4BA 3HUJE 2OQJB 3H6JA 3SJVD 3RGVA 2IBZY 4GKNA 4Q0XL 5GRUH 3W0WE 4LLVB 1CLOL 2DLIA 2Y06H 3F62A 4MJID 1R3LA 4D9QD 4EDWH 5D70L 5GGSA 1CR9H 2KBGA 5DMGD 5DYOB 1ED3B 3GIZL 4BFIB 2GQHA 5EU4A 1ZT7A 4U6XA 3ZSTA 1UXWA 5I1AA 3QIWD 1CXEA 1I7ZB 4Q0XH 1CLOH 4PRIE 1RK1B 4IRZL 1TZHB 4G6AD 4KKLD 1IEHA 5BV7B 3O6FC 3WO4B 4E5XA 5D70H 3JSSA 1F11A 2GJ6E 2VE6A 3GIZH 4U7SA 4NO2B 3NIDE 1ITBB 1JRHI 3S4SG 3VFOA 5C08E 5E03A 4BSJA 3AAZB 1PYWA 1I8KA 4DGYH 4U49A 1MWAB 4IRZH 5CHNA 3OQ3B 3HUJB 1FFOA 5F6IB 4ETYA 5DJAB 3QJHA 4NFCA 3W0WB 1QRND 3HPJA 5KOVC 2QSTA 2GIYA 5IIEB 3STLA 3V6FA 1EO7A 4BFEA 4CVZB 1LD9B 4M8QA 1F58L 5D7KE 1JGUH 5EU3A 2VABA 5C7XL 4IBLT 5HHXL 4GW1B 3VE0A 5JORA 1NFIB 4PRIB 2IFGA 3RGVC 3HMWL 5D7JA 3QQ3A 2ENYA 1QA9B 1X5GA 4Q7DA 4LSTL 5DQJA 5DEGB 1F58H 2GJ6B 5J0BA 1R5WB 2QTEA 5C7XH 4RRPA 4JZJA 2DQFB 5F9JB 5HHXH 1UM6L 5IVNA 5C08B 1A0QL 1V3KA 4XH2A 5D1QD 4R3SB 2RIKA 3HMWH 3BDBA 3DIFA 4LSTH 2IF7A 5IJVA 4J8RB 5D1XB 2EDQA 4TRPL 1PEZA 3WYRA 1LP9F 1G6RB 1UM6H 5MERA 1TPXB 1A0QH 1QTYT 3HRZA 4AM0A 2OTWA 5C86A 4IDLA 3IDYC 1P5UA 2F74B 3I2CL 5HGHB 3MYJA 5KTEL 2BJML 5GIRA 2EECA 3VD7A 4TRPH 5L0QC 2F54E 1WICA 4PJXF 2ZOLB 2GTWB 4F33A 3NFPA 4PJGE 1TQBB 3I2CH 4OZIE 1M71B 1TVHB 3GEWB 4XB8A 5KTEH 1WIUA 5FB8B 3UTTA 3MRRA 2R23B 4RWHA 3X13A 2BJMH 3D85B 3FO0L 2UYLA 4W4OA 1LVEA 4X98A 1KPRB 1VACA 4WNQB 5GZOD 4KKCD 5D7JC 2P5ED 4NRZB 3ERYA 4L8BA 5D2LE 5JIPA 2HKFH 1U93A 3FO9A 1FO0A 2F15A 1Z5LB 3HC4L 3RNKA 1G7LA 4Y2DC 4QXGH 3FO0H 1H5BB 3QIUB 1LO5B 1HH9B 1L6XA 3HI5L 1VHPA 1WBXA 4MB4A 5HI5C 1DANU 1N64H 4QKXB 3U9PH 1C5DA 1UT9A 2F54B 3P73A 5K9JL 3HC4H 4QHKJ 4PJGB 5IW1B 1OB1B 4OZIB 3HI5H 3SBWC 5I6XB 3CH8A 4P57A 1MLCB 4JO1L 4JR9H 1KCGC 4HWZA 1Z3GL 4HHAA 4G42A 4R97B 5K9JH 1S78D 4Y1AD 3O3BB 1XF5A 2V17L 3P4OA 5J12C 3MLSL 5C6PB 3DXAE 2Z35A 5D2LB 3MRBA 3VXUA 4J4PD 3LN5A 4JO1H 1Z3GH 2IEPA 2IPUK 3ROLB 2V17H 3MLSH 5F8QC 4LVEA 3FONA 4UOJA 1IBGL 3VH8G 4FQLL 2VERN 4CADB 2W60A 3ARPA 2ATKA 2I26N 1NPUA 5D2NE 3MUZ1 3QDJD 1S7WA 5F96H 4TNVK 5HGAB 5H94B 1A1OB 1AGFB 2R2EB 5JDSB 1YEHL 2R9HC 1PG7W 4CU6A 1IBGH 1CIDA 5I75B 4D9RD 5HYQA 2DTML 1N59B 1X7QA 4FQLH 4S0UC 3C5JA 1X9QA 3VFVA 4RCAA 5J6HB 1NKOA 4HKZB 1NJ9B 4X5LA 5HXMA 1WC7A 4UDUA 4KKNA 1RUPL 1UJ3B 4X6FA 3WFDL 4CVXA 3JWDL 2DTMH 3UJJL 3EZ8A 3CDGA 2VDOL 1YNLH 1AGEB 4GG6F 4HDIB 5SWSD 3B9EA 3VFPB 3CSGA 4ZO8A 5DGQA 4J3OC 2AV1B 5I1JL 4R8WL 4P2QE 1RUPH 1HXYA 1YQ2A 4NKMA 3O8XA 3FN9A 3WFDH 5JXEA 5D2NB 2X4RB 3JWDH 3TCLA 2I5YL 2VDOH 5T1DL 5LBSH 3A6BL 4Z7QE 3V7AG 2EE9A 2GI7A 4R8WH 2EXYC 5I1JH 3F6IA 4JPWL 2CUMA 1A6AB 1OTTD 3VG9B 2PO6A 1T03L 2GW5A 1BBJB 3JWDC 1VGEL 5EU5B 4WW2A 3MBEA 3IXTB 4P23A 3CFBA 2I5YH 4MWFB 5T1DH 3GMMA 2NMSA 2R4RL 3EO0A 3ZDZF 4D8PB 4QRPE 1I4FA 4JPWH 3BKJL 1G9ML 3TYFB 3VD5A 1VGEH 2N7BA 5KS9A 4P2QB 3MA9L 4LDLB 3ZT7A 3L5IA 2R4RH 2W9DL 5K59E 5FYLH 5C09A 2DI7A 4P5TA 3BKJH 4S0SD 5EORL 3OL2A 1AC6A 1G9MH 1RQ5A 2H32B 1KTLA 4L5FL 3DX6A 3VFUB 2OQJA 3O8XC 1PJ9A 4M1GL 1QPPA 4CNIB 4LLVA 2DF3A 5JXEC 1GL4B 4U7MA 1G9MC 1MAJA 2VRAA 5HD8C 5GZND 4L5FH 4QRPB 5DYOA 4BFIA 1ED3A 1Q9WB 5I15L 4IRSB 4F37K 3QP3A 1BD2E 1I7ZA 3FT3B 3PIQB 4G5ZL 2PO6C 4M1GH 2W07A 3ET9F 1RK1A 4WW2C 1TZHA 3MBEC 5E6IB 4P23C 1MJ7H 3IAQA 1EVUA 5DD3L 1NFDB 1N6UA 1NGZB 3FB7B 4XVSH 5I15H 4NO2A 4G5ZH 3AAZA 2FEEI 3HRPA 1NUNB 4OCXL 1MWAA 3PF2A 3T8XB 4FQHB 1TXKA 3HUJA 1N0XL 5DD3H 5EN2B 5DJAA 3RI5F 3W0WA 4OJFH 6CGTA 3RVXC 5IIEA 4P5TC 5MP6L 4CVZA 1LD9A 1J10A 3AFLA 2GAZB 4HFWB 4OCXH 4WTZG 5BV7L 1GCFA 1L0QA 1LMKA 3SDAD 4GW1A 1N0XH 5GSVB 1NFIA 5ISZD 4PRIA 1A3RL 5KG9B 3DURB 1QA9A 5TE4L 5MP6H 1MWAL 4JCMA 3B9KD 5DEGA 1QBML 3GMQB 5FYKD 4JM2F 5BV7H 2GJ6A 1R5WA 2QHLA 2B2XL 2DQFA 5F9JA 5C08A 5TFSL 3X3GL 4R3SA 2HFEB 1A3RH 4LSSL 5TE4H 4AK1A 1MWAH 2MCPL 4GAYB 4PJAE 2C7UB 3OAZH 1EFXD 4J8RA 5D1XA 5BV7C 1T22B 1UCBH 2B0SL 2B2XH 3KPSB 1G6RA 5TFSH 3WNNA 3OKMB 3X3GH 1I1RA 5M94B 1UH4A 4QXUL 2F74A 5HGHA 4LSSH 5ICZB 5DK2B 5F6IC 2I24N 2B0SH 2QQNL 4LCWE 4WHCA 2ZOLA 4PB9L 2GTWA 3UYRH 5FK9B 5GRVL 5DJ6B 1IC7L 4QXUH 3JV0A 1M71A 1TVHA 3G5YB 5FB8A 3CMGA 4YC2B 2R23A 4M7JL 5L88L 2Z31B 5M95B 1G6RL 3D85A 4F58L 1KPRA 4PB9H 4WNQA 4PJAB 3QCTL 3NA9L 4JPKL 4NRZA 2H45A 1PVHA 3OZ9L 1IC7H 5A40E 5HBBA 3MR9B 3D9AL 4R4ND 3QDHA 3BGMB 1S7SB 1Z5LA 2MCG1 3WKNA 5L88H 1G6RH 3UTOA 1KN4L 3KXFE 1H5BA 3QIUA 1LO5A 4F58H 1HH9A 1KXTB 3QCTH 1OD7A 4JPKH 2YWZA 1IGTB 4R0LB 4ZDHB 5D1XC 3D9AH 4LCWB 2F54A 3T2QA 5E6YA 3VGHA 1TPXC 1JNLL 1KN4H 1T1ZB 2X4OB 4TSBL 4PJGA 5JIHA 5IW1A 4ZO9A 1OB1A 4XWOD 5F7YC 4OZIA 4QRRE 1JPTL 3LH2L 5ALCL 4R7NB 2C3GA 1E28B 3DO7B 2BRRH 1ERNA 1MLCA 2K7QA 2Z0BA 3RZCC 4XCYB 2JJVA 3O3BA 3TT3L 4Y5YB 2ZJSL 5IMKB 1JNLH 1N2RB 1UB5B 4TSBH 2DQEL 5D2LA 2YD3A 5MEOB 2VKXA 5ADOL 4JKKA 1F4WL 1JPTH 1TQBC 3LH2H 3VFRB 4X9FA 3CD4A 3KXFB 4KI5F 1HXMB 1B2WL 3H3KA 5B8CB 5B21A 3ROLA 3TT3H 3QWQB 1NAMB 1KJVB 3L5HA 3I3EA 2LV4A 2DQEH 5HHNB 3DI2B 5ADOH 1F4WH 1SBBA 4HK0B 4N0CD 4CADA 5DMKB 5IT2L 3RVVC 4CN1A 3VWKB 3IJSB 2IGFL 3OKDB 3QIUC 1B2WH 4QRRB 2FECL 1K2DB 2OK0H 5HGAA 1FNGB 5H94A 4NIKB 1A1OA 1AGFA 1D6EB 2R2EA 5CUSL 5JDSA 2BC4B 4RGOL 4QHKI 1SM3L 4S1DD 5E2VL 1QBLH 3FN0L 1N59A 3UBXG 1BLNB 3JUYA 1IGML 4I0CC 4NCC1 3V8CA 5IT2H 4N90E 5J6HA 4HKZA 1WFOA 2DL9A 2IGFH 2QJDA 3PL6B 1NJ9A 4YDVB 5CGYC 4NKDB 1A9EB 1IGYB 4Z78B 1T0NB 4DUXA 4NHUB 5I6XC 1GOHA 1UJ3A 1BHGA 5FM8A 4AEHL 2VYRE 1SM3H 1ZKAA 1YYLL 5E2VH 1V5JA 3FN0H 1ZOXA 4NOFA 2MQCA 4R97C 1AGEA 4HDIA 2X6MA 3VFPA 1D5IL 1T66C 1A6UL 3UCRA 2AV1A 4JCLA 1DVFB 1MCSA 2QLVB 2WQRA 5D2NA 2X4RA 4MCYB 4BA8A 3GSWB 5HHOE 1CDIA 1U3HC 2HWZL 2H1PL 4FTVD 1A6UH 1QR4A 4JFPB 2VH5L 4OF6A 1CE1L 4XCEB 3O4LE 1JCKA 1A6AA 3BT2L 1X3DA 2VDQL 1FNLA 5CSGA 1BBJA 3DGGB 5EU5A 1J1OL 3IXTA 3UPCA 1QSFE 4MWFA 3AU1B 5I73B 2VL4A 4DKAA 3BH8B 2HWZH 2H1PH 4OZGF 4MD5B 1CGUA 4D8PA 1JF1B 2VH5H 4JDTL 5HDLA 5I75C 4LP4A 3BT2H 4WUUD 4WFEE 3TYFA 2VDQH 1J1OH 5KANG 4P2QA 1BBDL 1FRGL 3MODL 3S36X 3BDYL 1UJ3C 4ODUB 2VDNL 4JDTH 1CFVL 3CMOL 1FZMB 3CK0L 3TH3T 4L4JA 1CDYA 2H32A 5T33L 5DRNB 4MA1B 5GQBA 1BBDH 3ARGB 1FRGH 3O4LB 3MODH 3VFUA 1CXIA 4A2LA 1CN4A 2HT3D 3BDYH 3JXAA 2VDNH 4OT1H 4CNIA 4P3CL 5D2NC 3CMOH 1QSFB 2MJWA 3CK0H 2HT4D 3G5ZB 5T33H 5I74B 4PLNC 4J3VA 4QRPA 1KJMB 1Q9WA 1DZBA 4IRSA 2NX5E 3FT3A 3PIQA 3VG9C 3BUYB 4AEIH 1S8DB 1QG3A 1WWAX 4P3CH 4S11A 4JFQB 2XZQH 5E6IA 3V5HB 2WP3T 3LKNB 4RX4D 1NFDA 1NGZA 3FB7A 4XZUB 4QNPF 1KFAL 4P4RB 4LOUC 2AI0L 1YMMD 2H32H 4HMEA 3T8XA 4FQHA 1TTFA 1EERB 5EN2A 4K23L 4NQCD 3P3YA 3RVWC 1LO2H 2GITB 3CGTA 1KFAH 3BKMH 4EN3D 1MAML 3TFKA 4Z7UF 1T1XB 2GAZA 4FQXB 4HFWA 4Z7OE 4POUB 4AIOA 1MCQA 1KLGB 2NX5B 5GSVA 2FX9L 32C2B 3MRGB 2X7LB 4K23H 3F12B 2VQ1B 1NCCL 3C6SB 5KG9A 3HE6C 1NDMB 3DURA 4JQIL 2R0ZL 1HINL 2E8ZA 3V0WL 1KGCD 2E8YA 4HWNA 4KTYA 3GMQA 4XPBL 4AEFA 3TNNB 3O41B 5HDQH 1UCTA 2FX9H 5C9JB 4IRSC 4IRJD 4Z6AT 4CUCA 2HFEA 1NCCH 1LP9E 2YD8A 4JQIH 2R0ZH 1OT1A 1HINH 2ESVE 5EUKB 4YZFF 1FG2B 1ZE3C 4GAYA 2C7UA 4PJDF 3TZVB 1BFSA 1T22A 5CD5C 5IMOB 1NMAL 2BY2A 4N0RA 4OD1L 5HDBE 2QADD 3KPSA 3OKMA 4G80B 5IVOA 4NT6B 4ISVB 4PJXE 1CK0L 1RFDL 4RRPG 1H3VA 3WDHA 5ICZA 5DK2A 2EO9A 1LE9B 1NMAH 1KJ2B 2X05A 4OD1H 2PR4L 5FM5O 5FK9A 5DJ6A 2YA1A 4RDQF 3TFKC 1RFDH 1TJIL 1XMWA 3TO2B 4P46D 3G5YA 2Z31A 1VERA 5GS1C 5CSBA 1LP9B 3T3PF 2X9YA 2PXYA 2ESVB 3MLWL 3ZHKA 1EZVY 4PJAA 3LSOB 4NC2B 1TJIH 1MCJA 3MR9A 2VLRD 3BJ91 4OCSL 4WDIB 4BKLB 2CIKB 3BGMA 1BIIB 3QZWG 1S7SA 1RHFA 1KJ3L 3VRLE 5F8RC 2H9GB 1NGXB 4ELKB 4PJXB 3WDJA 2BY3A 4JO4H 3MLWH 3DTXB 2M8XA 3C09B 4MSWB 1IGTA 4R0LA 3CLEL 4ZDHA 3QWRD 3TPKA 4LCWA 4OCSH 2XTJD 2Z8VC 3NBNA 1KJ3H 4NM8H 4RMRA 4LU5L 2AK1L 5L8JB 1T1ZA 2X4OA 3BWUC 4R7NA 3DO7A 1E28A 4AYFA 1GGIL 4U3CA 3CLEH 3SJVE 3GM8A 4XCYA 2AQ1A 1P7KB 4U7KA 5F7KC 4MJIE 4Y5YA 4ONGL 5IMKA 2AK1H 4D9QE 1N2RA 1UB5A 2EXWD 4R6UA 1JWUB 4X6EB 5MEOA 3W9EB 4Z9KB 2P49B 3H2WA 3HTLX 3VFRA 3UAJD 4LARL 1W0WB 1OP3K 3U4EB 4YC2C 3KXFA 4FFVC 2Z31C 2X1WL 3H8NA 1P4BL 3GNMH 1HXMA 5B8CA 2XY1A 1RJYB 1NAMA 4M7ZB 1KJVA 4ONGH 4AIXA 4Y8AA 5HHNA 3QQ4B 3CPLB 5CBAB 3LQMA 5E2TL 3E0GA 4HK0A 4N5ED 4LARH 5DUML 1FVCB 1NCUA 5DMKA 2YUWA 5EFIB 4HT1L 3BZ4B 1VFBB 2XQYG 3VWKA 1P4BH 3IJSA 3OKDA 3T08A 4QRRA 2MOVA 5CP7B 1K2DA 1FNGA 3CU7A 3WJJA 3SJVB 5E5RB 1D6EA 4N8VB 4U1HB 2BC4A 1L9NA 1QRNE 4H26B 3DNKA 4R0LC 4WU5B 5E2TH 3BIKB 3NCEB 3D25B 1XGPB 4ZO6A 4MJIB 5DUMH 1BLNA 3RTQD 3O6LH 4HT1H 2QL1A 1NAML 2BOCB 2AJUH 3PL6A 4YDVA 1OCWL 4NKDA 1A9EA 1IGYA 4Z78A 1T0NA 3IFPB 4GG6E 1BZ9B 5IFJB 1AR1C 4NHUA 3QIWB 3BPNB 2DIAA 5KVFL 4QO1A 1MREL 2QQLL 1N26A 5F71A 4YXLL 1R3JB 4Y5YC 3VXMD 5CCKH 1NAMH 2G5BB 3RI5K 1OCWH 1C12B 1QFWI 1CBVL 1OLLA 1DVFA 5B38B 5KVFH 4MCYA 1MREH 2QQLH 3K0WA 1WWWX 5B8CC 4YXLH 1AFVL 1R3IH 1QRNB 4JFPA 4OGYL 1CBVH 5GRZA 1NBZB 3L3DB 4XCEA 4WO4D 3TIEB 1FH5L 1G1CA 4WFFD 3FOLB 3EKCA 4YQXL 3DGGA 4ZS7H 2CKBB 4HJ0D 4OTXL 4EI6B 4GG6B 2QQKL 3IS1X 3AU1A 1OARL 5I71B 3BH8A 1H9VA 4FMFA 4MD5A 3WJJC 4OGYH 1JF1A 3RY4A 1FH5H 2VMFA 1FVEB 1NEUA 2EIBA 4YQXH 1JZ5A 3HC3H 3PL6C 5JHLL 4G59A 3MA7B 4P49A 4WY7L 5D8JL 3O81A 5D1QB 1B90A 4ODUA 3O3EB 5GS0D 1FZMA 2P5EE 1LEGB 1MIEL 4MQTB 4U2YA 3EDJA 5DRNA 2HG5B 1IAII 5JHLH 3ARGA 2BVYA 3O4LA 4WY7H 5D8JH 5J3HD 1DVFC 5L8LB 5D96B 1PKQE 1QSFA 1QHPA 3G5ZA 2BMKB 1MIEH 2NY0D 4IIQB 5MEPB 1EJ6A 2VXTL 1ES0B 4YHML 1KJMA 3P4MB 3CUPB 1IAIL 5C0CD 1KTKE 2AK4D 4OGAC 3BUYA 3TO4D 1S8DA 1D9KD 1XGUB 4JFQA 3RHWF 5JQ6L 1MRCL 3LRHA 1CE6B 4JDVB 3V5HA 3LKNA 5I73C 2QKIB 3C60D 5E1AB 3L6FB 4Q9BA 2VXTH 4YHMH 1UM4L 2F5BL 4C4KT 1IAIH 4Y1AE 1FIEA 3E8UL 2OBGA 2P5EB 4P4RA 2BOBB 1IC1A 3ORJA 5JQ6H 1MRCH 5C6TL 2GK0B 1PKQB 1UM4H 2F5BH 2GITA 4Z7VF 2APBA 35C8L 5A43C 2B1AL 3V0VB 1T1XA 4FQXA 1DBML 4LSPL 1RZKL 2PW2B 4MA1C 1KLGA 2NX5A 3ARGC 5IB5B 5C6TH 5EOCL 32C2A 3MRGA 2X7LA 5ECJE 3F12A 3WKMH 2VQ1A 3C6SA 3QDJE 1NDMA 3BRDA 3W2DL 5D71H 3NABH 35C8H 3SE9L 2Y6SD 2B1AH 3K4DA 1YPZF 1DBMH 3TNNA 3O41A 4D9RE 1RZKH 4Y1AB 3D2UD 3AMKA 1BFVL 5EOCH 2UZYB 5C9JA 2WSKA 4JFFD 1D3CA 2X41A 3MLUL 4GSDL 1G7MB 5EUKA 1FG2A 3SE9H 2X4NB 3TZVA 4PLKC 5IMOA 1KPVB 1Z9SA 1RZKC 5T1LD 1LDPL 2EE3A 1BFVH 4G80A 5SWSE 4NBYB 4NT6A 2ZWLT 4ISVA 5DJDB 5IB3B 2E27H 3MLUH 4GSDH 4M8VA 1LE9A 2D31B 5ACMA 1UKQA 1KJ2A 3BX7C 5DO2D 3MNVB 3OJVC 4G8EB 2I60L 5AUMB 4WHTB 4XB7A 3TO2A 4IOSD 4FQXC 4JPIB 1LILA 2SEBB 3RWIB 1IGJB 1LP9A 4ERSH 2DM2A 2ESVA 3AB0B 4MVBC 3UTQB 2ZG1A 1UKTA 4V2BA 3LSOA 3L1OL 5E70A 1P69B 2L4OA 1HILB 4WDIA 4YFLF 3TEUA 5D7LD 4BKLA 5C0IB 2CIKA 1BIIA 1KJ2L 2FEDC 4P59L 2ZG2A 5SWSB 2H9GA 1NGXA 4KDVA 4ELKA 1NGWB 4PJXA 1MHPL 1CFQB 5T3ZL 1HQ4B 2X10A 1PDKA 3CX5K 3DTXA 3L1OH 4MSWA 1GGTA 2OYPA 4MHHG 5DFWH 5B4MC 5I8OL 3HI1B 1KJ2H 4FQ2L 3MYZA 4TUKL 4P59H 1YMHB 2ARJB 2AEPL 3P11L 1MHPH 3OF6A 2H3NB 4U0QB 1HDMB 1AY1L 2JF1A 4NHCL 1YEIL 3V95A 1XCQB 3QSKB 1I9RL 3CZJA 4GXUN 4QTIL 2YUXA 5I8OH 1P7KA 5DJZB 4FQ2H 4TUKH 4C54A 1LE5B 3P11H 2NY2D 4XPAL 1JWUA 4X6EA 3W9EA 1AKJD 4RZCB 4K71C 4X9BA 1AY1H 1YEIH 1W0WA 2O5XL 1W72B 3BDXA 3U4EA 5I1CL 5EO0B 3PABB 1I9RH 1CL7I 1RJYA 3T2NL 2WBJD 3C8HA 4QXTB 3WLWC 3QQ4A 3CPLA 5CBAA 1OW0A 4GMTH 3ZE1F 1FVCA 5I1CH 2O5XH 1X5JA 4XI5C 5EFIA 2A73B 3BZ4A 1VFBA 2VL5B 4QHMB 3ARTA 3RY6A 1MVUB 1UZ6F 3QRGL 1YYMH 3DRTB 1QP1A 3T2NH 5CP7A 5GRYA 3O4OB 4IDJL 3SJVA 4RISL 4NWUL 4U1HA 4N8VA 1OTUD 3C09C 5IFAH 1CDGA 4H26A 3EYFB 3IRPX 1KC5L 4WU5A 3BIKA 2UY7A 3D25A 4OCNC 1XGPA 4NBZB 5E8EB 4MJIA 3I3BA 1EEQA 4XPTL 2BOCA 3WIIL 4NOBA 3UXFA 5I0DA 1CL7H 4KKAC 3IFPA 5IFJA 3CJJA 1BZ9A 3GFUA 1OOAA 3QIWA 5IMMB 3B8YA 4M3KB 5LCVL 4NWUH 5ISZE 4MXVF 1KC5H 4MQSB 3K74B 3BP7B 2X09A 4Q6YA 4PY7B 1R3JA 1SYVB 2G5BA 2KL6A 4XPTH 5FYKE 5SWZD 1N5AB 1YY9C 1C12A 1U8LB 3MJ8B 5LCVH 5GGVY 5B38A 2NPLX 2V9RA 4HWEH 1J88A 2VZTA 4HUMB 4DTGL 3VRJB 2V6HA 4M7ZC 1JMZA 2P8PB 3QXAB 2XWTB 3OAYK 1QRNA 1OQXA 3PE9A 5ID1B 3P0YL 1G0YR 1NBZA 2DBLL 3L3DA 3TIEA 4OZGE 1OW0C 4LPVA 2GJJA 3KPNB 3FOLA 4CKVX 5I1EL 3MLPA 2A0LC 2CKBA 3SDAB 3RY6C 4EI6A 4GG6A 2HRPL 4DTGH 1MHCB 2WNGA 5ID0B 5F88A 1NL0L 4PGDB 4X4YB 1GHFL 2DBLH 1MI5D 1FVEA 5CEYB 1KXVC 4PJ8D 4PJFF 3NAAL 3I6LD 4XHJD 5I1EH 4U1JB 3RWHB 2DB8A 4I3RL 5DMGC 3MA7A 4KJQD 4X7FC 5D1QA 1DUZB 3QIWC 4FQIL 1U3JA 1S5HB 1LWRA 1R5VB 5L2KD 3BPNC 3O3EA 1GHFH 5F1OB 4G6AC 2CKBL 4KKLC 1EFXB 1LEGA 3NAAH 4EUPB 5ADPH 1ZXQA 2HG5A 4I3RH 4Z7NF 1MIML 4OZGB 1NMCB 2A9ML 3T09A 3FJTA 1QACA 3DUHA 2AW2A 2AQ2A 2CKBH 2BMKA 1OGAD 5HPMB 2ILLA 1QR1B 4IIQA 5MEPA 2GFBB 3R4DA 1ES0A 3P4MA 3CUPA 2A9MH 1C16B 5MEND 4C57C 1TZGL 4JZNB 1XGUA 3VDCA 3KAAA 1CE6A 4JDVA 3B5HA 5HSFA 1CICD 2QKIA 5E1AA 5I71C 3L6FA 3CU1A 1P7QD 3K81A 5IHZB 3D3VD 2Y1VA 4KRPD 1TZGH 2P5EA 4PR5B 3ETBF 1JN6B 1M7DB 4ZPVB 2BOBA 4G6JL 3VJ6B 2WWKT 1CDCA 5I30L 5I1KH 3IJHB 4Z7UE 5DK0B 3WD5L 3G6JF 5D1QC 1OF2B 2GK0A 3MJGX 1IGIL 1PKQA 3QA3B 4UILL 5GRJL 3VFNB 1V7NL 1KLFA 1H15B 2ZUUA 4XNYL 4GT7A 3V0VA 2IC2A 4G6JH 5C0NC 5I30H 1I3VA 2PW2A 5IB5A 3GJEB 4G9DB 2AXJA 1IGIH 5D72L 5GRJH 1ND0B 1V7NH 5D96C 5F3HB 4XNYH 2FIKB 1OP3H 2O61B 1CU4L 3ZKND 4YZFE 4Y1AA 4XXCC 4PJDE 2AABL 2YZ8A 3SGJA 2V5RA 3MCLL 5D72H 4N5UA 2HTKD 5MHSD 4J4PA 1J0HA 5ENWB 1G7MA 4Y5VB 4RMQA 4Z7UB 1B3JA 1SJEB 2X4NA 1CU4H 2QBWA 1KPVA 4P2RD 4JKLA 5CZVL 3MBXL 3MRJB 4KWUA 2AABH 1SEBB 5FHBL 2EDRA 5DJYA 3MCLH 4KKCC 4GQPH 1TZIB 3QH3B 1ROWA 5IB3A 4ZSOE 2Z91B 4MNQD 3LN4B 1N7ML 2CLRB 2D31A 4NUGL 5CZVH 3MBXH 5J57B 3MNVA 2DKMA 5TH2B 3T3PE 4G8EA 4FTVE 2CK2A 2CR6A 5AUMA 4WHTA 1B4RA 4PJDB 4JPIA 2P5WD 2ZPKH 1N7MH 2SEBA 3RWIA 1IGJA 4JDZB 4NUGH 1F6FB 4X7TA 3UTQA 1K4DB 4KV5F 3N1PC 3OG4B 4R26H 1HILA 1F4XL 5HHQB 3C2SA 3SCMD 4PY8I 3T0VA 5C0IA 1KCUL 4KPHL 4ODVL 4WUUE 3IDUA 4XAKD 1FYTD 5SWSA 4F2MB 1NGWA 1CFQA 1FGNL 1HQ4A 4ZSOB 2B7DT 2WBKA 3GBNL 1LHZA 4J4PC 3REWB 1X6LA 2VSDA 1JHLL 1I7UB 3QUZC 1F4XH 4OLZL 3HI1A 1KCUH 5TQ2L 3VXOB 4KPHH 2XXMB 1YMHA 4HUVB 5KAQG 2W0FB 2ARJA 2A83B 4FTVB 3UTPD 1FGNH 2H3NA 3GBNH 3VXRD 1F3DJ 1HDMA 4KJWD 1ZGLM 4B50A 3T3MF 3THML 4TVSa 1JHLH 1XCQA 4JM2C 4WI8A 4OLZH 5IEKB 5DJZA 4FHBD 1RD6A 1CD8A 4B53A 4M1CD 4GLRI 1LE5A 1D6VH 4K7PL 4AQOA 4RZCA 1J0JA 4WUUB 1HQRB 1A14L 4JJHA 1AE6L 1W72A 1S5IL 5EO0A 3PABA 1UWGL 1AC0A 4WEMB 3AB0C 4KUCF 2HLFD 4K7PH 4QXTA 3QNYB 4CJ0A 4AT6B 1F97A 2MQ0A 1T7YA 4LVOB 1A14H 4M48L 1AE6H 4M6AA 1S5IH 4AL8L 1X5AA 4AEEA 1UWGH 2A73A 1NMBL 1YMME 5HVHB 2VL5A 4QHMA 4FFWC 1MVUA 4LLQB 3MRIB 3DRTA 4HIHB 3SOBH 2EEBA 4JFYB 4NQCE 4M4PA 4MDJB 3EYFA 3RHWK 1W72L 5E8EA 4M48H 4XRCB 1HNGA 4AL8H 3GJFK 3SQOL 1GIGL 1N4XL 1W8OA 1GRWA 3NIFF 2ICWJ 4P3WA 4YBLB 4ZAKD 3DARA 5IMMA 1KIQB 5L7XL 1OTTC 2EEDA 3VG0L 4ENED 1W72H 5EUOE 2EIDA 3BP7A 1NC4D 2ARJQ 3BKYL 1KGCE 4PY7A 4C56D 4UDTB 1SYVA 3SQOH 3UROR 1GIGH 3DSFL 4ALAL 1N4XH 2OP4L 1N5AA 4YH6A 1AD9B 4JRXD 1U8LA 3MJ8A 5CZXD 3KVQA 5L7XH 1NCTA 3VG0H 4U3HA 4B5EA 1YMMB 5TF0A 2R0LL 4OD2B 3KS0H 4HK3N 3BKYH 2ATPB 2LVCA 4U6VL 3VRJA 3HA0A 4NJAL 4NQCB 2P8PA 3QXAA 3DSFH 2XWTA 5E2WL 3SHSA 5ID1A 3N50A 4LHUD 3QEQD 1YC7A 3QUXD 4EN3B 2V9TA 1A1NB 5CEZD 4ZFGL 4GOSA 5EZJB 3KPNA 3QO0B 1OGTB 2R0LH 4YDIL 3SDAA 1U2HA 3HPLB 3ILPB 4U6VH 4YLQT 4FFEX 4NJAH 1MHCA 3VU2A 3O4OC 5ID0A 5E2WH 5ISZA 4PGDA 5EUOB 4X4YA 2IH1B 5DA4A 1XEDA 5CEYA 4ZFGH 4KI5C 3GSUB 4U1JA 1MCCA 4YDIH 5GZNC 3RWHA 3SE3A 4UINL 1CDBA 1DUZA 2WIIB 4IRJB 5B39G 1S5HA 1R5VA 1XIWD 4MQ7B 3V6BR 1EZVX 1DE4B 3O3AB 1QFPA 2ZUVA 1EFXA 1RJCA 5E94B 1LNUB 4EUPA 2FR4B 4IEFB 2FYYB 2VLRE 2QADB 4UINH 4OZGA 3QPXL 4CL7A 4CN4A 3ARBD 2KKQA 2J88L 3RQ3A 2OI9C 1FDLL 3O6FD 4OD3H 5HPMA 5DD0H 1QR1A 2GFBA 2XTJE 1C16A 3T0WA 3QPXH 2KDGA 3RU8L 4X9GA 4JZNA 2J88H 5F1NB 4P46B 5IWLA 5FYKH 3OKKB 1FDLH 5A2LH 1Q0XH 3SDAC 3F7VB 1OD9A 5I18L 5T3XL 1UM5H 3NZ8B 1J1PL 3P4LA 5IHZA 5K9QI 5ESVB 1SY6A 5SV4A 4OI9A 4PR5A 3RU8H 3K2MC 4AZ8A 5CEXB 5IGXL 4Z7VE 1JN6A 1M7DA 4ZPVA 2VLRB 2DWDB 1MVFA 1AD0B 4EUPH 1V3LA 2EDDA 2UWEF 2MNUA 3IJHA 5FDYA 5DK0A 3E1F1 3SE3C 3L5XL 3EDFA 3BGAA 5D5MF 1BAFL 3TN0C 1OF2A 5K9OB 3BQUC 1W8NA 3RGVD 1AO7D 1J1PH 3QA3A 3VA2C 3VFNA 1H15A 1B88A 3HNSL 2D0HA 5IGXH 3IDJB 1IAOB 4LPXA 1RU9L 4OF0A 3L5XH 2HVJB 1YPZE 1IAMA 1NMCC 1BAFH 3GJEA 4G9DA 5FKPB 1OP5K 4MJ6B 1ND0A 4K3JL 2E7LC 5F3HA 3HNSH 5KW9L 1CGVA 4JHAL 1OM3L 3EZJB 2FIKA 5IJKC 1NFKA 1FORL 5BCAA 2O61A 1RU9H 3LZFL 4PRPD 3WE6B 2VO5A 1MFNA 3NPSB 1ZMYA 4YHKH 3ELAT 4Z7VB 3DHJA 1V8HA 5SX4H 3LS4L 2YXMA 5ENWA 5GRWA 5IWLC 1NH6A 4Y5VA 4Z7UA 5KW9H 4UQ2B 4JHAH 4MB5A 1OM3H 1SJEA 4U05A 5DHYB 1FORH 4JHZA 3LZFH 1JP5A 3MRJA 1Q9LA 1SEBA 1HE7A 3QCUH 3VXME 1TZIA 2DQHL 4X83A 4UV4H 3QH3A 5EC1B 3BRFA 1DR9A 2Z91A 4N0CA 1EAJA 3LRSB 3LN4A 3S3SA 4R4NC 1YPZB 1T83C 2CLRA 2HJKB 4M61B 4DN4L 3L3IB 1C7TA 4NC1E 5TH2A 4G7VL 2DQHH 2NY5L 4PJDA 2EDNA 4Y2DD 4WFFE 4NZRL 3RTQB 3C5ZD 2NZIA 4JO3L 2JKXA 4JDZA 4DN4H 3F8UB 4XWOC 4Z7WF 4Y4FD 3S7GA 5HI5D 3SKJL 4NNPL 1K4DA 4K9EL 3BP5B 2NY5H 5IG7B 5F9OL 2LAAA 4NZRH 5TDOB 4JO3H 3LD8B 4F2MA 3ALXA 2AEWA 3SKJH 4ZSOA 3DVNB 2KZ1B 3DROB 1RZFL 4NNPH 4RNRB 1BF2A 5EWIL 3REWA 1WCQA 4K9EH 3U48A 5E6ZA 4B7IA 3LKSB 1I7UA 2NY5C 5F9OH 2COQA 3VXOA 1RHHB 5A1AA 4HUVA 4PP1D 2JJWA 1UEMA 2W0FA 4FTVA 2A83A 3PWNB 1XR8B 1ZVYA 2KPNA 1FNFA 3C87A 1RZFH 4WO4B 4K9EC 4N0CC 4GQ9L 1WZLA 5IEKA 2VC2L 3MV8D 4WI2A 3AREB 3CXHK 4S1DC 5C0CE 4WUUA 4GQ9H 1HQRA 2R2HB 2AK4E 4HJGB 1F2QA 5EZOL 3GZKA 5DJ8B 2J8UF 2VC2H 1RZ8B 2VB5A 1QFOA 2J6EA 3V79C 2R9HD 1UZ6E 3QNYA 4AT6A 4G43B 5EZOH 2YPLD 1HZHL 4LDOB 2A2QT 4LLQA 5I19L 3MRIA 4NM4L 4HIHA 2FWOB 4URTB 5BOZG 1V3JA 4KDWA 4MDJA 3S35L 4HG4J 1PQZB 3U4BL 4RFNB 4XRCA 1E4KA 3N0PB 4MXVE 1HZHH 2J6EL 4HXAL 5I19H 4NM4H 3CVHB 1IEAB 5C0CB 3NOIA 1KUMA 1KIQA 2AK4B 4S1QL 4P2OC 3TO4B 1JPSH 3S35H 1H3WM 3MLYL 3U4BH 1WITA 3P4NB 3NACL 3FRPA 5EIQA 4RX4A 3C60B 3LPFA 4UDTA 1AH1A 2J6EH 4HXAH 5ACZB 4KFZC 5DXWA 1AD9A 5KVGL 3VA6A 4HV8B 5FFLA 4S1QH 2A6JB 4JFFE 1YMMA 3QHTC 4WFHD 1FAKT 2NY6D 3MLYH 4OD2A 4Q9RH 4ZS6D 5HYIA 3NACH 2ATPA 3BESR 5KN5B 4NQCA 4HUNB 2BNUB 3U7WL 5KVGH 3S4SB 4LBEB 25C8H 1A1NA 4EN3A 4LVOC 1RPQA 5DUPL 3HLAB 5BXFB 5EZJA 3QO0A 1OGTA 4UBDC 5HVHC 2WWMD 3ILPA 3HPLA 3WXWH 5B38G 3O45B 2CXGA 2HT3C 1QRKA 5EUOA 2IH1A 1OY3B 3VDBA 2HT4C 5DUPH 3GSUA 5C2BH 4OLUH 4ONHB 1EBPA 2OMNA 3D2UB 3OXRB 4YBLC 2WIIA 4IRJA 2XZAL 4JFFB 1U0QA 1FFRA 5ANME 4Z7NE 3KPTA 4MQ7A 1DE4A 5AWNL 3O3AA 2XTLA 1JNNL 4XVTL 5E94A 3MSPA 1LNUA 5IVZB 2FR4A 2FYYA 5D7LE 1H3UA 5T1LB 1BJMA 1GOGA 1MCOH 1FV1B 3S34L 5FM5M 2XZAH 3MGTB 3Q1SH 3IAGC 3R0NA 3ZLQC 3IJYB 5AWNH 1KYOJ 2ZSWB 1F45A 4PJFB 1DLFH 3U1SH 1JNNH 4XVTH 4WCYL 4FXGB 3TM6A 3S34H 2VITB 4I0KA 4EN3C 3GMRB 2X1QA 3J8F7 4H8WL 1JI1A 5F1NA 4P46A 3FQNB 4NO3B 3OKKA 3F7VA 5FGBA 3R1GH 3QDAA 5ANMB 3NZ8A 4WCYH 3RVXD 3G6JE 4OF5A 5ESVA 1SMOA 5CEXA 1TJGL 5JTWA 1XH3B 4H8WH 1N5YL 2VLRA 1KCLA 1PEWA 1X6NA 2DWDA 5D7LB 1AD0A 5F6HI 2AJXL 1XF2B 3NCFB 5K9OA 4IRJC 2HP4A 4KUZL 1TJGH 3EGSB 4H8WC 2WANA 1S9YB 5F7DB 1N5YH 3IDJA 1IAOA 3WCYA 2QADC 2AJXH 2HVJA 2XV6B 1XAUA 3CFCH 5FKPA 4YHNB 1QKZL 4MJ6A 3S37L 3F7PC 1O7SA 2D7TH 1CGWA 1QNZH 2R2CA 4PRHD 2M26A 3TESA 1BJ8A 3WE6A 3G6JB 4OLXL 1DQLL 4P5MB 1OVZA 5CJXA 2NY2B 4Z7VA 1AKJB 3S37H 2WK2A 2VLMD 4P46C 5KBNC 4UQ2A 5DHYA 1RMFL 5FGBC 5FA3B 1S7TB 1J0ZA 4OLXH 1R3HB 1DQLH 2WBJB 1UACL 5CWSB 2PF6A 5SWZE 1LDSA 4M1DL 5EC1A 15C8L 4N5EA 5FV1L 3LRSA 1DTUA 1YPZA 1RMFH 2HJKA 3ZTNL 2Z9TA 4M61A 3L3IA 1ETZB 5C70A 4UOW0 2MTPA 1UACH 3M17B 5BVJB 1VCAA 4RA0C 4XP1L 2VQUA 2ZUQB 3ARVA 1MELA 4L8DB 1HKLH 1CFNB 2DWEB 3KHOA 3O2WL 3RTQA 3RJQB 3ZTNH 1OPGL 4LRIA 2YD5A 1INDL 3BIAX 1U36A 1PG7H 5E7BA 1SJXA 4EEEA 4XP1H 3BP5A 3KYNB 3MOAL 4OAWB 3V7AE 3NCYS 5A3ID 5IG7A 1MI5E 3O2WH 5TDOA 4LF3B 4F3FB 1OPGH 3NPSC 4LPTA 4XVJL 5T1KD 2EXWC 3I6LE 1INDH 5CJXC 3DVNA 3D6GA 3DROA 4RNRA 9CGTA 4OFKA 3UAJC 4LHJB 5IKCB 3LKSA 3MOAH 3RZCD 5L2KE 3IETB 4K55A 3T3ME 3IU4L 1RHHA 1QUNA 3B8SA 4PJ7F 4XVJH 3PWNA 5E5MB 3BPOB 1XR8A 2VKWA 2FCBA 3ZE2F 1NLBL 4HPOL 4WO4A 3C2AL 3MXVL 1ORQB 4N5EC 2CO6B 1ZA6B 5I8KL 1HIMH 3ILQC 5F1SA 3IU4H 3AREA 1OGAE 4TSCL 3VD3A 4DW2H 5E08L 3ME0A 1MH5B 4UT6L 1NLBH 4HPOH 3C2AH 1QFWM 3MXVH 4O00A 2XFXB 5MENE 3AY4A 3RVVD 2R2HA 4HJGA 4PJ8B 5DJ8A 3RTQC 5GPRA 5I8KH 1E4WL 1RZ8A 4MNHB 4F7CB 4TSCH 4ZOAA 1MCFA 1F4HA 5L2KB 5E08H 2YRZA 4UT6H 2BVTA 1WZKA 4MQXD 4MD0B 1T0PB 1FCGA 3DX7B 4G43A 2PTVA 4GAJH 5CGYD 5KSBF 1E4WH 2E5EA 5DLML 4U2ZA 1T4KB 2FWOA 1VKXB 4P2CG 2GK2A 3ULUD 4U1GC 1T1YB 4JFHD 1PG7X 4NC1C 5J1AB 1PQZA 1UC6A 1OGAB 1H0DB 4KK5D 1T66D 3CNKA 2AXFB 3GB7B 5FOJA 2DS4A 3CVHA 1IEAA 2C3VB 4PJCF 5DLMH 5C0CA 5L8KB 5MENB 4WO4C 2AK4A 5GS0L 4OV6F 4DOHE 3TO4A 4YAQB 1CLZL 4HJ0C 1U3HD 3LMJL 3P4NA 4M62H 5GGSY 3V2AR 5LVEA 1CICB 3C60A 3AREC 4I3SL 5JDJA 5LAXB 1DQML 3JBG7 1P7QB 1P9MA 4BSWB 5ACZA 3M07A 4KRPB 1UVQB 4HV8A 5GS0H 2A6JA 3LVEA 3T2PA 2J5LC 3AY4C 1P6FA 5H37H 5FGCE 3BAEL 5ITBL 5MHSE 1ZLVK 3LMJH 1EEUA 5C2UB 2UV3A 4I3SH 3CVHL 5KN5A 2UZXB 5E5UB 1DQMH 4P2RE 2BNUA 1OP5H 2JJTA 5GS0C 3S4SA 3OV6A 3CZFB 4LBEA 5JQHC 3HLAA 1MNUL 1II4E 5BXFA 1G9EA 5ITBH 1YUHB 2KQNA 1DBBL 4ZOEA 5AZ2L 4MNQE 2VZ1A 4BQBA 3CVHH 4JZOB 4DOHB 4OLEA 4PFEA 5J3HC 3O45A 1QFUH 1WTGT 3CVIL 1DBAL 4W70A 4KDTA 3W11D 3V6OC 4JLRB 4HEPG 4RFNC 1I9EA 2WMPA 3TT1L 4ONHA 2XKSA 2XZZA 3EYQD 2P5WE 3D2UA 1MFEL 3FZUC 3KYKL 3OXRA 4J12A 3EYSL 2IQAB 3VGEA 4JFFA 4U1NB 3CVIH 1DBAH 4A6YB 5FGCB 2MPAL 3TO4C 2VZUA 2R8SL 3WV0A 4LHQB 5IVZA 3C60C 4P2RB 3TT1H 1P9MC 5T1LA 1MFEH 1FV1A 3KYKH 5GGTA 3EYSH 4XAKE 1FYTE 3MGTA 2MPAH 3FB6B 3IJYA 4MNQB 2ZSWA 1BWWA 4PJFA 4XMKL 2GY5A 5DHVB 2R8SH 3NIGE 5FXCH 1W2KT 4FXGA 4OFPA 4GRWF 2JJTC 2VITA 4LLWB 5IQ9B 2VJXA 3GMRA 1QBAA 4EUPG 1KEML 3UTPE 1U58B 5HVWA 3FQNA 5DD6B 3L5WB 4NO3A 1G7PB 5CJQL 2P5WB 3VXRE 4XMKH 1FP5A 3U30C 1Q0YL 5I0ZA 2IPKB 2H8PB 4N1CA 5ANMA 2DQIL 3EW3B 5GGTL 3S5LB 4F57L 4B41A 4Y4HD 2E3VA 3QIBD 4MX7B 4NN6B 3CFEB 3OJMB 1XH3A 5BS0D 3VD4A 3SCMB 5D7LA 5CJQH 3T04D 1UZ8B 4XCFH 1Q0YH 2C4FT 1FYTB 1XF2A 1E6OL 1WQVT 3H9YA 1A64A 2DQIH 5GGTH 4F57H 3V4PL 3HE6D 5IHUL 2NXYD 3EGSA 3NN8B 1S9YA 5F7DA 3CDCA 4MZ2A 2AQ3A 2E6PA 1SEQL 4AIZB 4ODSL 1E6OH 1YEJL 2OM5A 4YHNA 3V4PH 1T2QL 4X8JB 1PZUB 5IHUH 3VXRB 2W65B 3JVGA 4NZDA 4BFBD 4FZ8L 4QGYA 2C9AA 1SEQH 3G6JA 4GAGL 3UYPA 4P5MA 4ODSH 2W9LA 1YEJH 4ONFL 1T2QH 1K4CB 3MUHL 1AKJA 4KJPD 3ULUF 3N1FC 4JJ5B 1ZHBB 3B6SB 4FZ8H 5FA3A 1S7TA 1QBBA 1BEYL 5LWYL 4GAGH 2Q76B 1R3HA 1T6WA 1S7QB 2WBJA 3IDIB 3PDGA 1ZEAH 1R5IB 4MYWB 5CWSA 3ZDXE 4C56E 5JHDD 2YMXH 4GG8B 4L8CB 5K33A 4DN3L 4G8GD 4JRXE 4OF3A 4ZOBA 3B2UD 3TBWB 5T5NF 4Z77B 3MLTB 2X89D 2OR8A 1BEYH 5LWYH 1ETZA 2Y72A 3U7AA 4XC3H 3ABZA 3M17A 5BVJA 4Z7WE 3S8WA 2NCMA 4DN3H 4L8DA 3QEQE 1CFNA 2DWEA 5CEZE 4OQTA 1WZ1L 1F2XK 5ERWB 4ZAKB 1BZ7B 2NYYD 2D9CA 3FKUS 3JVGC 4GW5B 3KYNA 4X8XA 4OAWA 5FHAL 3KPSD 1NC4B 5ABDE 2ITCB 4XP4L 4NKQB 3SKMB 4LF3A 4C56B 4F3FA 2APWA 4QF1B 3QJFB 1WZ1H 1CQYA 3VCLB 3NGBB 4DGIL 3K4AA 2NY2C 4JRXB 2HMIC 4NN7B 1EMTL 2E6QA 5E8NB 4OCWL 5IKCA 3KPOB 3TJEH 5GHWL 5FHAH 1JL8A 3IETA 4OQTL 4U3XA 3TH2T 5C0JB 4UNTA 2WBJC 4Z7WB 3EDEA 4M7KL 2V5MA 5E5MA 4DGIH 3H0TB 2DLFL 3VI4F 1EMTH 4LHUB 3QEQB 4LP5A 4G6FD 3QUXB 2PTTB 1ORQA 4OCWH 4TOYL 3P9LA 4Q6IB 5GHWH 1ZA6A 4N8PA 4OQTH 5FA4B 4FG6C 5JW4Q 2C1OB 4RDQG 3RZWA 1BIHA 2J8UE 4M7KH 1MH5A 2DLFH 2ZUQC 1MCWW 2RCSL 1C5CL 3UJTL 1EHAA 3OKLB 2XFXA 5BZDB 3DWTA 4YHYB 3AM8A 4PJ8A 3F58H 4TVPL 4MNHA 3CFIC 4F7CA 4NYLB 3IFOB 4CVUA 5IM7B 3IDXH 5L2KA 1XIWB 3ZDYF 2RCSH 1C5CH 3UJTH 4MD0A 2C1PB 1ONQB 3DX7A 4YXKL 4TVPH 4ODXB 4KTEL 1D7FA 4X6BB 1T4KA 3W5MA 1VKXA 3ARBB 1AO7E 1T1YA 2DKUA 5J1AA 4HH8A 1FL5B 3O6FB 4NJ9L 1OGAA 2CSPA 2J8UB 1H0DA 4OV5B 2IWGA 4KTEH 3WFCL 3QEGL 5FV2A 2AXFA 1ACYH 1YQVL 3GB7A 2C3VA 1KB9K 5MENA 1A7PL 3X11B 4LSRL 4YAQA 4NJ9H 2CDEB 3N9GL 4NKIL 1CICA 1PAMA 4PGJA 1P84K 3WFCH 5LAXA 4AY0A 1DL7H 3QEGH 2Y5EA 1P7QA 4PRPE 4FA8A 1YQVH 4BSWA 4LIQE 1UVQA