3HUJA

Crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d
total genus 72
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hujA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3hujA01
1QKZH 3HC3H 4MJIE 4BSWA 4QRTB 1JGEB 4JGUA 4N8CH 2VISB 1EZVY 4ODBD 3LS5H 4U1HB 5F1KC 2BVQB 3OKLA 2YPVL 2F53E 5GS2D 1T2JA 2I07A 3G5ZA 2A73B 4GQ9H 1ETZB 3HPLA 2M1KA 4I0PD 3QPXL 2ZUUA 3HRZA 4N9OB 5JHLH 1YJDL 3KXFA 1Z9OA 2A0LD 1I7RB 2BNRB 1JL8A 3NA9H 3WUWB 2DRUA 3MLYH 4RISL 3R1GH 5I74C 2GIYA 3GI8H 4LKXB 3WFBH 5EZJA 2ADIB 3BN9D 1ZS8B 2QQKL 1KC5L 1OCWL 3MROA 4KKCD 5HHOA 3TBSA 1QEWB 1XF5B 2B4CL 4KPHH 4W4NA 4EEEA 4N90E 4M48H 2J88H 3KR3H 1LGVA 4ODVL 4WFHE 2CDGB 1KULA 4P59H 5HVHC 3AB0C 4FRWA 5TDNA 1EFXB 4WW2A 4K8RL 4CJ1A 1GAFH 3ARDB 3VXRE 1TZHA 1KB5L 3MJ9L 3VH8G 1OQXA 5HHMA 1AHWB 3GI9H 4PJBB 5GRWA 1XGYH 3QIUD 1FV1A 4JFDD 1RU9L 4PG9A 3KYOA 1FZKB 2AW2A 1L7IH 1HSAA 2DMBA 4JY6A 5JUEL 4LQFL 3MTRA 3SCMB 4POZD 3DX7A 4PJ8D 1BD2E 4HS6A 3ZHLA 2KL6A 4ZUWA 3RIAK 5F1IA 1QBLL 1FZOA 4MB5A 3TO4D 4LVHC 1BIIA 3S35L 4LQFH 2DI7A 1T21B 4ZO7A 4YHLH 3ZT6A 1KN2H 4PGCA 5E2UH 1DEEB 1CF8L 4OGAC 3S3JA 2OI9B 1ULVA 3BDBA 1FGVL 1Q9KB 4V1DE 4ZFOA 4QY8A 3MJ9H 4W70A 1IEBB 5HHPB 3QPXH 3LKOB 3RL2A 4QXUL 1F4WH 3UMTA 5C09D 1RJYB 5IV2A 5C07B 3OQ3B 2YD7A 4NUGH 4JRXB 3V0WL 2NLJA 1NMAL 1CIDA 4YGVA 1N8ZA 5AUMB 1J8HD 3BPLB 1CLYH 1R5IB 1XF2A 2VXVL 3PQYE 1NGPH 4XP1H 1TJGL 4KPHL 4FQJH 2Y5TB 2EE6A 3BD3A 3QEGL 4BUGA 5KBNC 3HAEH 1WAAF 4P2QB 1QZ1A 3W5MA 3RRQA 2UV3A 4YHOH 1IGIL 3O9WC 4FQIH 3ZHDA 3RVXC 4MA3A 5E8PB 4WU7A 2ESVE 1PY4A 3T8XB 3PXJA 3QNXA 2BRRH 4EOWL 5F88B 1TJIH 1FIGH 5IMKB 3UYRL 1HI6A 1IAMA 4Y5XB 4JY4A 3RY5A 4Y4KA 5SWSB 1JPTL 3EFDL 3KLSA 2GK0B 3VI3E 3NFSL 3VFSB 2CO6B 4KVNH 3TH3T 1F3DJ 2EEDA 1ZHLB 2R8SL 1IC7L 3VXOB 1JJUA 4X0KA 2ID5A 2AABH 4ZOEA 4DKFH 4LHQB 2QADB 3CX5K 4G8GE 4DW2H 2XT1B 4JFDB 1P4BL 5F7DB 1GGYA 2GHWB 5D71L 3ARTA 2EH8L 3PGFL 1XR8A 5ISZA 5I2IA 4V2CB 4Z7QE 4E41B 4M48L 1QFWI 5HGBA 1UA6H 1ZT7B 4OD3H 4EXKA 3QDJA 3NCJL 3JTSB 3WSQH 1TVHB 4XVUD 1YUHB 3WEXB 1IRAY 1NMCC 3QWQB 2DQCH 1I1RA 2X4SB 3MR9B 5JLZA 1LO3H 4PYGA 3NMEA 5FO7B 3U0TA 3RNKA 1FO0H 4M8QB 3CFEB 4FMKA 4D0CA 2N7BA 2BERA 3MV7B 3TNMA 5CEZL 3RDTB 2Q3ZA 1DFBH 4WUKH 1Q0XH 5FYLL 3GBNH 3Q0HA 1GGUA 1CYGA 2EDYA 2FEEI 4G6AC 5F7YC 4MNQB 3JV6B 4LPWA 1FRGH 3OKLB 4LKCA 4HS3B 4ZPTA 3JVGA 4MD5A 2H32A 1KIRA 2BOCB 1M05A 4WUUB 1L9MA 1YEGL 2EDHA 4WO4B 1U8JA 3MXWH 4UDTB 3MV01 2OYPA 1WLHA 1P9MA 4BSWB 2AJVL 5A16B 4TUJB 3VFOA 1BJ8A 2NLJB 4LARL 1N4XL 1DVFD 4Z18A 5E5UB 5HI3D 2B0SH 2Q7YB 4UTAL 1NGYB 2Y07H 2YBRB 3MUZ1 5JHDA 2A73A 2BSSB 5DA4A 2FD6H 3MUHL 3VG9C 3OGCA 2BVQA 2B2XH 3MREB 3RVWD 3BKYH 3VXQA 5B39A 1T20A 1A3LL 2YMXL 5CP3A 4L4VE 2AJ3A 2CKNA 3BEWB 4N0CA 2UZYB 1CR9L 4XHJD 5TDOB 5C0DA 3R0MA 3TYFB 4PRHE 1IQDB 2Z93A 2YZ1A 1ZGLB 1L9NA 3RGHA 2DQTL 3UTTA 3TM6A 2ZZUT 4X6CA 5F7HA 2ESVB 1SYVB 2CO7B 1OW0A 4OI8A 4I9WD 1ZV5A 1I8IA 5T1LD 4HH9A 5TQ0L 2MQ0A 5CEXA 1BLNA 3FT2B 4G8GB 5EO1A 1R3JB 1H8SA 1DQTA 4XGZA 4IRJD 4PJ8C 2MPAH 1I7UA 3SQOH 3VFRB 1F5WA 1U95A 4ZFGH 3IT8D 3PP4H 1BIIB 4JZNB 3OGOE 4FFYL 3F5WB 1YEJL 3GKWL 2ENYA 2Y72A 4HT1H 2BSRB 1TPXC 4FXKB 3SDDA 1GSMA 3P4OA 4F3FB 4EI5A 2M26A 3FFCA 2R1XA 1UYWL 4E41E 4R0LB 4HZLB 1BGXH 5FA3B 5AAMA 2OZ4L 4PG2C 2HH0L 3WL9B 4XBGA 3C8KB 2QHRH 4NKMA 1QSEA 3PABB 3FQUB 5CWSB 2ZUQB 3OL2A 4EN3B 2AEPL 3GMNA 1X5YA 2JELL 4TSAL 4NHCH 3LKPA 4AQOA 1CGTA 3V8OA 4G43A 4WU5B 5DJZA 2LABA 5IR1B 1WCBB 1YEEL 1MHEA 3SGDH 4NRZA 1TCRB 1UWXH 4FQXC 4BZ2H 1ZGLA 5GJSL 3AROA 1D5ZB 4LCYB 4HBCH 4EDWL 2R0LL 3MV7E 4JEGB 4CAGA 4GXVH 1JGEA 2C3XA 5LGJA 3HPJA 1IGFL 1VGEL 3QIBD 3HNSL 1MCWW 1OLLA 4FHBD 2F5AH 3MGAA 4O5LL 5C9JB 4NDMB 1JPSH 3P11L 3BPNC 1FAIH 2BSSA 4M1CC 1P7QA 5IHUH 3BZFB 1G1YA 4QHUB 2V5RA 4Z7VB 3KXFE 3IU3B 4Z0BL 3EYFB 1I7TA 3P9LB 4ZUTA 2GJ6B 3QDGA 1RUAH 3CU1A 3KLHD 1DEEA 4PGJA 2NTFB 2KPNA 1UC6A 3GSWA 2MPAL 3SQOL 4EUPA 2HFTA 3IDXL 1MJUH 3LSOA 3R4DA 3IGAA 2VQTA 1Q1JL 2GI7A 3JV4B 4FXGB 5CLWA 4OZIF 1U8HA 2J8OA 4R3SB 43CAB 1U8KA 5CUSH 5FHBH 5K9JH 4X5WA 4M7LH 5ABDE 3S97C 5B21A 4OGYL 5BW7A 1SEQL 4U1JA 2PTTB 4PRHB 1MCLA 1NMBL 4U0RB 4MVBA 4GXUM 5HJ3B 1EAPA 4RQQB 1MQ8A 2P45B 4JHAL 4OFPA 4WGWB 5MP6H 1VFBA 4HLZG 1JFQH 3BYTA 3NACL 1JYNA 3KJ4B 5D2NA 4M7KL 4ZPVB 1NFIA 3I6LE 4XPAL 3MRGB 3EHBD 3QRFM 4LU5H 3SO3C 3PWUB 4KXZH 5E2WH 2BHUA 3C6SB 5I19L 5E4IA 1K3IA 5CJOL 1S7XB 1GH7A 4G9FE 1E4XI 4K7PY 3I2CH 2XWJA 1OAKH 1II4E 1TIUA 3QDJB 4U1GC 4W68A 3BQUA 4K3JL 3RX8A 5I17A 1QSEE 2OTUA 3UC0L 5T33L 1QTYT 1JGDB 3GIZL 1HNGA 1VFAB 1ZWIB 4UMGA 2X1WL 5J11B 3UPAA 1MNUL 4OZHB 2Q8AL 3UYOD 4DVRL 1HKLL 4OLXH 3VFNB 3QUMH 3BAEL 1NCBL 3MRIB 5E9DB 1W0VA 2OMNA 1PQZB 5SWZA 1VA9A 1WC7A 4XBEL 3QDAA 4XC1L 3MFFA 1OAYL 2NW3B 3SKMB 4HK0B 3WO4B 3MRNA 2F53D 4ODXA 4OJFH 3TVMA 2X4UB 4LSSL 4QXTA 2G75A 5IB3B 4YXLL 1J1PH 4J23A 3I75B 3SDYH 4WHDA 5I15H 1ZEAH 4BKLA 4X83A 4MX7A 2KQNA 4WI3A 3K80A 3O8XD 4HULB 1MUJB 4H8WH 1A64A 2NW2B 4Y2OA 3A67L 1MCWM 5JXEA 3DX8B 5H37H 1PDKA 3L3DA 3PHQA 2CUMA 4U6YA 1UA6L 5IHLB 2FSEA 4RX4A 3T08A 3P3YA 2WSKA 4RFEB 4GW5B 1X4YA 4J3SA 4YFDB 4IOIB 3IF1A 3ULSA 4NKQB 4H26B 5H94A 3CXHK 3CMOH 4NKOB 4JM4L 4KHTH 2XKNA 1WZKA 4RMUA 1EEYB 3HAEG 1BEYL 4FFZL 3FFCB 4K3EL 4RGNB 5BRZE 3O6KH 5HYQB 1A7OH 1JRHI 1CLZH 3WXVH 3ECBB 4I3RH 3DROA 4IJ3B 5E9DE 1JPGB 2B5IC 3EOYG 2HFEB 4HX1B 3QNYA 1S7QB 4U33A 2EDTA 1AIFB 4NP4H 3VFRA 1I8LC 5DGRA 2D7OA 3ULUD 5E1AA 1JV5A 3G5YB 4G8GA 3HCVB 1BIHA 3T2PA 5B4MC 1NGXB 1RZJC 3BZ4A 5I8OL 2P5ED 4NQDA 2DYPD 1U91B 3GSNA 1KACB 3WS3A 4GUPA 3ZDYE 1J0KA 1C5BL 1R5VB 4HMCA 1J88A 2X9YA 2HVJB 4KRNA 4UBDD 3QDJE 3CDGA 3UAJD 2EYSA 3PQYD 4NO0A 3VXUD 1P4IL 1CU4H 2E27H 4UV7L 5IT2H 4PGDA 2CRYA 3OWEA 3SCMD 1DCLA 2W07A 4U6VH 5EPMA 5FYKU 3HRZB 3F8UB 4ZUTB 4I5BA 4IRJC 5KVFH 2BFVH 1EO5A 1JTOA 4YXHH 1HN1A 2IANA 1SY6L 5GSRA 2ESVD 3SGKA 2E3VA 2GJZA 2X6MA 1UB6B 4F57H 1FNEB 5HHNB 2ITDA 4NQVB 4I77H 1QEWA 1YYML 2R2EB 2ED8A 4YE4H 1INQA 2QQLL 2VLMD 5ILTH 1H9VA 1UENA 4XCYB 4H20L 4OSUH 5LGHL 1MRCH 1FVDA 4E42A 5FO9B 5D7SH 2CRMA 5F1NA 4CDGC 1CE6B 3UO1H 3L3IB 2AEWA 3IF1B 1DLHA 1KPRB 4K7PL 4U7KA 3WFHB 1QD0A 3NN8B 5DJ0A 3WFCL 3W5NA 2AJZA 1IAIL 5D5MA 2V2TA 4DQOH 3NCYS 3TGXA 5GIRA 2J88L 2ARWA 2VDRH 4R7DA 1FL3A 3ARPA 3EBAA 5LGHH 2AK4D 5E94A 1YC7A 1KJMA 1G6RA 1ZVSB 1MRFH 3E6FA 2P5WD 4EI5C 3QFJD 1XGPA 3HI6L 3H42L 3OBAA 4H1LA 4Q58C 1Q9WB 2PXYC 1U6AL 1HHGB 2NTSP 2Q7NA 1QBAA 3VJ6A 1CN4A 3D69B 1CIUA 2QSCL 4N0YH 4DKEH 5ID1B 1B88A 3H9ZA 1RJZA 2HG5A 5JHLL 3RWHA 5IMMB 1OTTD 1Y0LB 1KTLB 5HTSA 4NC1E 1A2YB 2PETA 5IP4A 2VAAA 2VLJE 4M6ML 5GRJL 1F4XL 1BAFH 2W9LA 1WC7B 3HUJE 1H3WM 3RTQC 2A1WH 3SE8H 1T1YB 4WW1B 3H9HB 5BVPH 2NX5D 4R2GD 4B41A 5D7IE 32C2B 4U7MA 5IVXB 2R2HB 1DTUA 3TBTB 3U0WL 1J11A 4M6OL 5T1DL 4R4BB 4Z9KB 3T2NH 5IEKB 2GQHA 1A0QH 5KW9L 1EA9C 5EC2A 5C0EA 1GYAA 3UDWC 1YPZE 3BISA 3D39D 1A7RH 2K7QA 2BZDA 5L2KA 2RAMA 5GXBB 3QO0B 4MCZB 5DJCB 1T4KB 3L5HA 4XWGL 4U2ZA 3OB0K 4MJ5B 5I16B 2A6KA 3SKUD 4AZ8A 1LO0L 1EEZB 4AIZB 5IVXF 3SDDD 3DETD 5GPRA 1T0NB 4XCEA 1UT9A 4P3DB 3GUTB 3ES6B 3P73A 5JW4Q 1KCKA 2GFBA 4U6YB 1KXTB 4RAHA 4XPTH 1A7NL 5IVNA 2XACC 4X6EB 2HTLC 1A9EB 4FQPA 4K9EL 5HVGB 5HI4C 3VXTB 3ZDZF 3NFPB 1QSED 1IGJA 1Y6NR 3FRUA 3T65B 3KNBA 4UIKL 4XMKL 4WFFE 1I3VA 4OM1L 3CX2A 4X0KB 3RVVD 4XNQB 2NY0C 3MJ6A 1OD9A 1BF8A 1I4FB 3ZSTA 1P84J 3K4DA 5MP6L 3D3VA 4AT6B 5LBSH 1BVLA 3BESR 3BUYB 3WUWA 1IARB 4JY4B 2V2TB 4O58H 3MLSH 4CN1A 1N59B 2A6JB 4HV8B 5HVHB 2BDNH 4R26L 5GGTL 5ELIA 1MF2L 3FONA 2PO6B 4MDIA 1T21A 1V3KA 3ROOB 2R39A 4RNRA 4HPOL 3KWWB 4R2GB 1MFCL 2HJFB 4WUUE 2OL3A 2WINA 1QRKA 1N6QH 3P9LA 4OLWL 1JHLL 4LLUB 3I75A 4TULH 3X17A 4AIZA 2H2PC 4KJYA 1J0ZA 5IB2A 1HXMA 1LK3H 1CFTA 3B9VA 2BVYA 4OV6F 3RZCD 4OIIL 5ERWA 1FBIL 4M93C 1XCQA 4XAWH 1XGRA 4KJPC 2NXZB 1INEL 1N0LA 4X7FC 1UJ3B 1JMZA 5I1KL 4PYHA 5K59E 4PJAB 4XBEH 3SKJL 5FM8A 1F3JA 1VEMA 4ODUB 2XTJB 4MAYA 4U0QB 5E2TL 3IXTB 3LMJH 1RJZB 4G8EA 2DQGL 1PSKL 3CLFL 3HNVH 3VCLB 4MZ2A 2CDEA 1PG7L 3QXDB 4GS7B 3CFEA 2XKSA 3Q6GL 3L5XL 1I85C 3MV9D 1H3GA 4FQXB 3C5ZB 5F9JA 1KB5A 5D7IF 4JKPL 4YUEL 1RPQA 1C12B 2QTEA 4CNIB 4JY6B 1FORH 4X7TB 4KK5C 1ZSDB 4JCLA 4POZC 5TF1H 3QIUB 2XKUA 3HNTL 35C8L 3W9DB 3LIZL 3S36X 4LAQL 4LDEB 1YPZB 2P48B 4ONGH 1NDGA 4S1QL 3SY0A 3LRSA 4RGOH 1LK2B 1AD9A 2ATKA 1GVIA 4OKVA 3KYMA 4S2SA 4HT1L 4O2FA 3U9PH 1KENH 1TDQA 2W60B 4Y5YB 4LLAA 5DS8B 5F7UA 1YMMB 2IAMB 4MJIA 2DQHH 4K2UH 2B20A 3RFZC 4IRSD 3UTQB 3MRQB 3IJYA 1UB6A 4XNUL 3PGDB 2R1WB 5F1OB 3D18A 1KF9B 3L7EA 3BP7B 2IANB 5GSRB 1F2QA 2IPKA 1E4WL 1ZANL 3LIZH 3DARA 5DD6A 1NDMB 4YAQA 2C3HA 1DLHB 3MGTA 3GEWB 3TPUA 4X9BA 1FVDB 4I0KA 4MA7H 1A6WH 4DTGH 4WV1A 2BC4B 5J6GB 3HB3D 3H9YA 1FFQA 3T77A 2P8PA 1FNSH 4B50A 5DMIH 4OQTA 3K74B 4Y16D 1G7JB 1KLFA 4MGXA 4O00A 1CD0A 5C0AA 4U3XA 5DR5L 3JV6A 5T3XD 3PJSA 5DHVH 3SE4A 5B8CB 1LO2L 5C6TH 1EJOL 3BHBA 4UV4H 2BVTA 35C8H 5D6DC 5HPMA 5F9WB 3FO1A 4P2RD 5FHAL 4HK3N 3VFTA 2KUTA 3GSNL 1CVRA 2GJ6E 1T1ZB 1G7PB 2A6KB 4JFPA 4LBEB 4PGCB 1LEIA 4U3CA 4OTXL 1N7MH 1MHEB 5JIPA 2I26N 1HIMH 3DVNA 3L5WB 4NQDB 3X12B 2IPTL 3GIVB 1FJ1B 3OAYH 2HT2D 2GFBB 1CDJA 4WCYL 3L5XH 1WBXB 5LQBL 1IM3A 4JR9H 4J2XA 1RIVL 2AEPH 1DQLH 2HVJA 4XCEB 2AJSH 3U7WL 1MWAA 2Z9TA 5L8LB 4NO3A 5C0CD 5FO8A 4OCSH 4ZO6A 1QSFB 3JTSA 3BPCA 5C09A 1EK3A 1HHHA 1G9NH 2VDKL 2XZAL 2W1NA 4R97B 1MCHA 5C0CB 1MJ8L 3GSUA 4MD4A 4WTZA 2Y1VA 2XOTA 3GSXA 5EZIH 1JGLL 3I6LD 5DD1L 5E8DH 4GH7B 4LAJH 4JGMA 5E5RB 4ISVB 1U92B 4JRXD 4TUOB 4F7CB 5K9QI 5FYJD 3O2WH 4QRQB 5GZOD 4RIRB 3ZE2F 1MY5A 3IS0X 3I6KB 3FT2A 4PIRF 3PQYA 3IFPB 1KB9K 2IQAA 4XPGH 3EYFA 3SDCB 4JHWL 5HI3C 3WNLA 4GBXA 2W0LA 3QJHA 3UBXB 1QYGH 3OR6B 3QUKA 1RZKL 1FYTB 4HHAB 4OQ1A 1UZ6F 4S1SL 5FGBA 1GC1L 1LQSR 1AR1C 3GGWB 1AHWC 1RUQL 5B3NA 3MRQA 3O81A 1GHFL 3HZMA 3BH9B 1D5IL 1U8JB 5AWNH 3IFLH 4KTEH 1AJ7H 2AABL 4RMSA 1UGNA 2DM2A 4DUWA 2ZOKA 2ADJA 2Z8SA 3JWDH 4PJHE 5C08E 4IMKA 5T1DH 3RZCC 4NQVA 4N8VB 3ARDD 3NAAH 1ONQA 5DJ6A 4AEEA 3QXUA 2UZIH 2RQ8A 2R2BA 1NAMA 2XN9D 5I8CA 4KI5D 4QGTA 3PV7A 4H8WC 1XGTA 4U1NA 3BEVB 3HG1E 4IDJH 3WUWG 3JXAA 1IGIH 2FL5B 4TUKH 1NQBA 1FDLH 4P4RB 2FIKB 2ZUQC 2BCKB 3HI1B 5BOPA 3U82B 3C9NB 4F80A 5H37G 1N26A 3QQ3B 4BSJA 1XR9A 3CGTA 4Y4FD 1Y18A 1PYWA 3BWAA 4HC1L 3ILPB 3QJFA 3WHXA 1AQKL 2VDPL 1KGCE 1PJ9A 1U95B 1AD9B 1IGYA 2VO5A 3GMNB 2E6PA 5HYFA 3B9AA 3FAXA 3MOBL 3RGVA 3O2DL 4NNPH 3H3PH 5L9DL 1KJ2L 3Q3GA 4ZS7L 5CJQH 1UCTA 3MQIA 3BMVA 5GRVK 1MWAL 4KTYA 4P2OB 5DLMH 1N6VA 3QULA 5ENWA 4RGNE 3S36H 1S5HB 4NN6C 1OARH 1RZ7L 3FN9A 2EZ0D 4PJ5A 2D7MA 2NY2D 4XCCL 3LB6C 2NY4C 4FQXD 2E7LE 4P9HL 3S98A 5DTFA 3I6GB 5FF6A 3MLXL 4X9IA 3FOLB 4Z7NE 2XTJD 2C1PB 5D1XB 5SWSD 1JPFA 1OAQH 5ISZD 4F57L 1HCVA 2A6IB 5IJVB 4UT6L 4Y8AA 4MQXD 2QJDA 1BQHA 1ZT4A 1ZA6B 1LE9A 1LQVA 3D39A 1U8LB 5HBBA 3BZFA 3EYVA 2FJHA 4NBZB 4QHUA 5CMAB 1CE1L 2OJEB 4JKLA 1CVSC 5DLML 1GGBH 4PUBH 5GGQH 1BREA 1LO4H 4YDIL 4P9MH 1A6UH 1HYSC 3QISA 3BKMH 1NFDE 3BZDA 2XQYG 5GGRA 1S9YB 3LEVH 3ECBA 1G7JA 1QSZA 3NCMA 4I0CC 3LSOB 1T0MB 3MRRA 3FKUS 2VDPH 1I75A 3F7QA 5DQJA 4P5KA 3D0VB 3E3QC 4NKIH 3EGSA 5DD6B 5I8OH 1JNHB 1MPAH 5C0FA 4L4VA 4MJIB 4JM2D 1MFDH 1BFVL 4LLVA 4QRUB 2EDRA 1RMFH 1YN6A 3HG1A 3MOAH 4U1KA 5HYJD 1TCRA 4IDJL 1IM9B 5I1AA 1IZJA 1P5VA 4ZS7H 5B8CC 3HE6C 4HF5H 3PGDA 4LSTL 5E7BA 5IQ9B 2EDEA 5GGRY 4J6RL 2X70A 1KG0A 4M61A 5A3IC 1KCRL 4IRJB 1OQOA 4XMPH 2GAZB 4I2XA 5DJYB 4PJ9B 3GSUB 4MD4B 4LSUH 4XBGB 1FSKB 4NHUE 3GM0A 3DMMD 5CHNA 3F6LA 1LEKB 1YEHL 3DYPA 5IVZA 4JFZH 1TZGH 1JGUL 3JWDL 3EYVB 2EIZB 1XGQB 1TVBA 3BJLA 4BK5A 1MH5B 1NC2A 3OZ9L 1S9VA 4RIRA 1GC1H 1T6WA 4V1DA 3WIFB 1MI5B 3LKSB 5FKPA 3ZKNC 4X8JA 5E9DA 3DIFA 2FX9L 1HSBB 3T2QA 3C6LB 4M5ZH 2VL5A 2E9BA 2HYMA 5IW6A 3G6JF 3UP1A 1SEBA 3RVTD 4XCCH 1FG2A 5FUCE 4D0DB 4ALAL 4Z8FL 1OARL 2FDBP 3UTTD 5ALCL 4PRIE 4PV9A 4JKWA 4OD1H 4O4YL 4KDVA 3VXSD 1AH1A 4BH8B 2ZG3A 1A1NA 1J0YA 5T1LA 1QLFA 3K2MC 4KJWD 4F7TA 3VI4F 3Q2CA 5GQBA 3FO0L 4K7PX 5I1IL 1MIEH 4O2EA 3VWKD 4G5ZL 4X80H 4OZHE 4HJGB 2EICA 3ULVC 4X6DB 5EZOH 1OSPL 1YQVL 3QI9D 1RZGB 3NABL 2Z4QA 1FFNB 1I7ZB 5TGBA 4YHMH 4F7EB 4PRBB 4PJ9A 5DUPL 5EU3A 2NW2A 2ZOLB 3Q5OA 4FQ2H 1OGAB 3QFJB 3WLBB 3MA9L 1J12A 1Z3GL 4RMVA 1C5DB 3BAEH 3EGSB 1ZKAA 3BP6A 1OAXL 4TVPD 3ROLA 2ZSWA 5L0QC 2YK1L 4NKOA 5KJRL 3TFKC 4LK4A 1AR2A 3QDGB 5IG7B 3MLZL 4JDVB 3VRIB 3MUJA 2PTUA 1D6VH 4L9LA 3RZCB 4NIKB 1AC0A 1NANI 1GRWA 1UJ3C 4GQPH 4PJAE 1JFMA 4RMRA 3BRFA 3IDNB 3T1FB 2W38A 2UYLA 2YPVH 3WKNA 5CJXC 3EDDA 4HMEA 3D5OF 1UFUA 4OAWA 1JWUB 2DTMH 5ANMA 3DUUA 1YDPA 2AV7B 3U46B 3CCHB 4G9DB 5FYKE 3N85L 1C08B 3GRWH 3QEUA 3GMMA 5JZ7C 1T4KA 1S7UB 2EEAA 2VLLA 1NCTA 2NXYC 2LAAA 3T4YA 3LQAC 2FGZA 3CDGB 5ITBL 3LKRA 1MFEL 2ZOLA 1YMHA 4HJJH 2FX8H 2G60L 5EO9A 4P2CG 4XX1G 3UPRA 2DI9A 3W9EA 4NC0B 3BZ4B 3N50A 3Q3GB 4MXVF 4NRYA 5SWZD 5HDQL 1MI5E 4M7KH 3IDUA 1SYSA 4GBXC 4MQXC 4AJ0A 3OF6A 3OKEB 1HSBA 2IADB 2P5EB 4X7CC 4NCC1 1UEMA 1QSFD 2CLZA 1AHWA 1YY9D 3T4AA 3WKMH 1U0QA 1S9XA 1BJ1H 2DOCA 2OMBA 2Y7QB 4Q0XH 5BQ7A 2VITB 5DSCB 4DCQA 4OIBA 3PHOB 5CUSL 1KJ2B 5CSZB 1B90A 1NCAL 1NH6A 5JXED 3MYJA 1KIUA 3Q1SH 3PL6A 1BFTA 3HZVA 4Y2DC 4NQSA 4IEFB 4CADB 5JNYA 1KUMA 2E8ZA 3BH9A 1L4IA 4JO1H 4UIMA 5IK3B 3V6OE 4WU7B 1EEYA 3VD4A 3MNWA 1CDYA 2GK0A 4JRXA 3IRPX 3L3KA 4U1KB 5I1DB 2AEIT 4GO6B 4CBPA 4R9HA 2BXZA 3KPOB 4LDLB 3WDHA 1I9EA 5JOPE 5KSUA 4X9FA 3WFHA 4WI5A 1FNSL 3OKYA 4OAWB 4RFNC 1A14L 4RBPH 4P2QA 1JP5A 3NCEB 2GEEA 3IDJB 2R0LH 1YNLH 2FHCA 2BSTB 2X4RA 2F54D 3WYRA 5FA4A 2OJEA 2NZ9D 5IESH 2B5IB 3QRGH 4KK9C 4IM8A 3MCKA 3L3GB 2CQVA 1N6QL 5CBAB 3UAJC 3N85H 4LSQL 3DBXB 3TZVD 5ID0B 2FATH 3U0PA 4PDCE 4ZFGL 3L1OH 3HLAB 5EU6D 2YPKB 3SPVA 1DVFA 5CIPH 2PCPB 1Z3GH 3KPMB 3EO1B 3FHQA 1R0AH 2FJGB 1KPVB 4XNXL 2FGWH 1UYWH 4JO4H 4CKVX 3T0XA 2VQ1A 5IB1B 3BUTA 5EU7C 5E08L 4M1DL 4NC2B 4NO0D 5D8JH 1KENL 3T3PE 4LNRB 1ZE3C 1OW0C 5C0CE 1T1YA 4WW1A 4HJGA 1A7QH 1CGSL 2R0WH 2O61B 1T2QL 5JDSA 1SMOA 4LCWE 3THML 6CGTA 3FOMA 1EH9A 2DIAA 1D5XA 1BZ9B 3HUJB 5IW1B 5JW5B 1E6JL 1K2DA 4JDZB 3I6GA 5FF6B 3ZT7A 5FK9B 2Y07L 4PV9B 4KDTA 3QPQC 3O2VH 4FXLA 1Q9WA 4ODSH 3MGOB 1OY3B 3BT2L 1X5IA 4Z7WA 5JQHC 4Q97A 3FB7B 1LNUB 3EJYD 2YWYA 2QQQA 1YEGH 2VQUA 4N0UA 1NCCL 3OX8A 4LF3B 4OZGA 2VLKD 2EXWD 2H45A 1BP3B 1S7SA 1W72A 2DLEA 4UTBL 4XPHL 5I6XB 3QWRA 1T7YA 5CEZD 1G0YR 1WIUA 2DQFA 3T0EB 2PTTA 5LKNA 3C5SB 5B8CA 4ALAH 5SWSA 1U41A 5BCAA 4FZEH 1CWVA 4DK6A 4AT6A 3TPUB 1T83C 4DFHA 5DD3L 4RAUA 4Z7QF 2FBJL 4UDTA 2C9AA 2H32H 3TWCH 2Y25A 1T3FB 3RI5F 4QWWC 1LO0H 1AGEA 2XA3A 1U2CA 3MBEC 1A7RL 3HG1B 3HC0A 3S4SB 4FQ2L 3RWDB 4P46B 4QXGH 2CGRH 1JWMA 1CZ8L 4I2XE 4YHML 5E5MB 3GUTA 2CJUH 4QRPB 3TBVB 3GSQA 4WHTA 5C0AE 4GAFB 1A5FL 4LSVL 3O4LB 2XG4A 5DJAB 5CFHA 4KZDL 1TQBC 5FEBA 5CSGA 2Z8VC 5FKAA 2APVA 3L9RA 2RR3A 3CDFA 3OKEA 3VXUB 4MNHA 2P24B 4ZAKB 4J4PA 4CNIA 3I3BA 4OM1H 5D2LF 1H8OA 1WSST 4O4YH 4JM2A 1BFVH 4TRPH 1WZLA 4PRPA 5J57B 3CVHA 3O11A 4XWOD 4QF1A 5EBLA 1FSKC 5L2KD 2VDQL 4PJHB 5C08B 5HI4D 3BPCB 4EQ2A 3HUJA 1IJ9A 1IC7H 2Y36H 5E6YA 4B53A 2APXA 5DEGB 2VITA 4MAUL 2QQLH 2IGFH 4FS0A 5IVXE 4LPCA 1ZHNA 4NKDA 1KBGL 4AIOA 4AEHH 3CPLA 3FMGH 3CJJA 3AXLB 2YD2A 1GZQA 1RJLA 2FWOA 2V2WB 3ILQD 3DO7B 5F3BA 3J8F7 1C12A 4DGVL 2YSSB 2DD8H 2BMKA 2EC8A 3H6JA 5DT1L 5FK9A 1IL1B 4R4FL 3UBXI 1PEWA 3SE9L 2D7TH 3BQUC 3LRHA 4DN4L 4M3KB 3VFWA 4KUCD 1UQSB 2A83B 4G9FB 1A5FH 5AG8A 1A6UL 1UJ3A 2WUBH 4RFEA 2KDGA 1C5CH 4XMLL 1R3HA 1A6AB 3O3EA 2IALA 2CK0L 5GHWH 4XB7A 3IDIA 4OLUL 2G5RA 3X3FL 3VXSA 5EIVA 2H2PD 3NGBC 4LCUB 5HGDB 4ZNEA 2R0ZL 3O11B 4X4MA 3U0PB 5ID0A 2OXGA 3FQRB 2VISA 4XNYH 3QEHA 1AD0A 2YXMA 1KXQE 1T5XB 2VDNL 1ORSA 2HTKD 2BNQE 4J3XA 3KPOA 2AXHA 1E27B 3KXFD 2O93L 2F54E 1B6UA 1S7WB 2VDQH 2E8YA 2AV1A 1P4IH 1IGTB 1R6VA 3ARBD 4PB0L 1BQUA 1W8OA 2XA8L 3O4LA 4YQXH 3T0ED 5IFHH 1KIPB 4GW1A 4FFVD 4LSPH 4OZIA 5HHOD 1XZ0A 4ZS6C 1Q94A 2BOCA 4WUUA 2J4WL 4PR5B 4MSWB 3U36A 3IFLL 2BC4A 1I1AA 4OI9A 2W60A 1G0XA 4CGTA 5J6GA 3VFPB 4FFWC 3C09C 1IT9L 2OL3L 4LSVH 2DAVA 2EYSB 3QDMD 3C60A 3ZL4H 1FL6B 2Z35A 2UVEA 1I8KB 3BVNB 5T3ZD 4PRIB 2R56L 1EPFA 2W0PA 4P4KB 3CPLB 4TRPL 1MCNA 3D25A 3GMPB 5IWLA 3S8WA 4P5TD 1BQHB 5I8KL 3F7YB 1HKFA 5H2BB 3MRJB 4NC1C 5CZKA 3O41B 3S7GA 5D96B 5INDB 5IM7B 1EO7A 5D7KD 1FFOA 4Y2DA 2R29L 5EFIA 1F8TL 4X7TA 3V52L 2MCPL 1AQKH 1S7TB 3U2SB 2CJUL 2HT3C 3ULVH 4XNXH 4YHIB 1EEUA 2NR6D 4J12A 3DECA 3V0AC 4PJGA 4YHNA 2X7LB 3M8OL 3VCLA 2LTQC 5EO9B 2AKRA 1P5UA 3N1FC 4GRWF 3ALPA 1N2RB 4KTDH 3BIKA 4ZFZA 1ES0A 1NJ9B 3IFNL 2DMKA 3VE0B 5IESL 2Z92B 3O9WB 5SWQB 3V6BR 3MRDA 1AR1D 1Q38A 1IC4L 3UJJH 1KELH 1W0WA 5BMFL 2R69L 4KFZC 4RWYH 3LAFA 3T0DA 5FUOL 2C26A 3WUZA 1G7MA 3NPSB 3T0AA 1ZTXL 2VMFA 5C0AD 1UXSB 3MLTA 4LASL 3GNML 1YEDB 3V6OA 2NY7L 4P57B 4AG4H 1WITA 4K3DL 3BKJL 5ESVA 2XPGA 3EYOA 5T33H 4JHWH 4JZJA 3GMRB 3VXRB 2FLBT 3T77B 2X4OA 3VFGL 5HY9B 1E6JH 5J1SC 4KI5C 5KSBB 3D0LA 1OGAE 4FQQA 4LSQH 1A9BA 4L5FL 4OZIE 1T80A 3BD5A 4MYWB 3E6HB 3U1SH 5E95B 4AH2A 1P7KA 5T1KB 3AU1A 3MJ8A 4BQ6A 5C0CA 1Q1JH 4PJDA 1JGLH 1G1CA 5AAWA 1U91A 1T66D 1XCTB 4JFXB 4N5ED 5I1GH 4L3EA 2ICEB 1QP1A 3OV6A 4GAGL 3G6AB 4OFIA 4TQEL 4YPGA 4U1LA 1G7QA 1GOGA 4N0RA 5CILL 5DHXB 5DR5H 1SEBB 3EO9L 3PWUA 3PDOB 3VA6A 5K9QG 1X5ZA 1R3KB 2F19H 1MCCA 1AGDA 2FCBA 4P99A 2H6PA 1HKLH 1MFAH 1QSFE 4Y5VC 3WHE1 1WTGT 2YRZA 1TNMA 4MXWL 3RNKB 4FP8H 3SHSA 3RGVB 1HZHL 3DRQA 4OFDA 4PJ5B 4PJGE 4FN0A 2H1PL 3NTCH 3I02A 4OCLC 5EU5A 3AXLA 1ZHKB 1KPUB 1EMTL 5B4MD 1Y6KR 2JIXB 1GL4B 2YHGA 3CVIL 4HZAA 5KVGH 3CLEL 1MCBA 1BD2B 3DXAD 4NQCD 1ZVSA 3E6FB 1AGBB 5F9WC 3MV7D 1WISA 5CHNB 5SWSE 3VFSA 2F58L 3DX8A 4XXDA 1E28A 2JF1A 5IUSA 1OP3K 3ZDZE 4JHAH 5J7CC 3X14B 4PP8C 3N1MC 4P57A 1K9TA 5GJSH 5E7FA 4KAQH 1U8NB 1CFTB 5BO1H 5DMKA 4NN5C 5H94B 2VLKA 4OUUB 5D5MB 5ADPL 1JYVA 2FEDD 4J4PC 4NCC2 3ZZ1A 3ZE1F 2B1HL 2FJFB 4JM2C 1PZUB 3PXHA 3PQYB 1V7MH 5E5MA 2FIRT 4WNQB 2VDML 1JWUA 2E9WA 4FFEX 1G6RB 3BGFC 5FO9A 4E42B 1SM3L 4XAWL 1NPUA 4P5MB 2HJLA 1JF1B 2FO4A 4TNWK 1DQJA 1F45A 1HH6A 1EGJH 5HHME 1P2CB 3DETC 1UXWA 2IH3B 3D48R 4PRPE 2EZ0C 2HFFB 3MV8E 3IB4A 1QOKA 1RZFL 4XVSL 1TCMA 1T04A 1MCEA 2PUQT 5F72S 2DL2A 1MAKA 2F5AL 4TVSa 1VGEH 3E3QE 3CXDL 4YH6A 1L7TL 5EC2B 2F74A 2BVPA 3DX7B 3PHSA 4XVJL 4JREC 2C1OA 2UUDH 3S88L 1NGZB 2VZVA 4TTDC 2WV3A 1V3LA 1K3ZA 2NPLX 1YMME 1OF2B 3MYJB 3FFCD 3B2VL 3F7RA 3GSRB 2VLRD 2R4RH 1GZQB 1RJLB 4GKSB 2VNCA 3PF2A 4LASH 5ITFB 5HYIA 4PJBA 1OAXH 3EOBA 2JELH 1DBKH 2J6EL 4P3DA 5EORL 3OKKB 3ARDA 4HMDA 1EO8L 1T89A 1MFBH 4GG8B 4OUOA 4Y88A 1KTLA 4F7TB 1KB9J 1WZ1L 3SKJH 1JZ4A 3CUPB 1YNKL 2H6PB 4PJCE 5T1MB 4HLJA 1YEHH 5C2UB 4QF1B 4UQ3B 4X4XB 1FGNL 1JF6A 4KJQD 1F58H 3CMGA 1MLBA 4LCWD 4X80L 2LU3A 1G7HB 2C3WA 1MIEL 3TH4T 1JHLH 2WWKO 2MMXA 3RUGA 3BSZH 1F90H 1K8DA 4HUUB 1LE5A 3P77B 2QSVA 2CKBA 4IHOB 3REVA 4Z77A 3ZE1E 3V4UL 4JPVH 4LPXA 4ZNCD 4L4VB 1X6NA 4YIQA 1AGFA 4Z7VF 4HXBH 3EIFA 4F7PA 3BH8A 5GJTH 3UBXG 1I1AC 3O4LE 3PWLB 3ULVL 4X6DE 2CR6A 2LFGA 4G6FD 3HG1D 3NGBB 3DPBA 1INDL 3FO9A 4ERSL 4AH2B 1G7MB 4FA8A 1NANH 4I2XB 4JANA 1Y6MR 1CXKA 4JVPA 2FNBA 1ACYL 5ANMB 3E2HC 3FO0H 2JCCF 4LLDA 4V3DB 4FOMA 3BEWA 3TIDB 4W4OA 3TN0C 5D5ME 5I30H 4X4ME 1DFBL 3VXQB 4P9ML 3GMLB 4N1HB 1HI6B 1FC1A 3AY4C 4JZJB 4Y5XA 3Q5TA 4LSUL 4H88H 2NY6D 4HWZA 4WNQA 4LGRB 5I1EL 1B0GA 5I73B 5TDPB 3EKCA 4X6CE 2NXYD 4HQQL 1T2XA 3ARBA 1S7WA 3SJVD 1HCFX 1PZ5B 4WTZG 4WV1C 4P9HH 1EX0A 4KV5E 4FNLH 3AREC 5GGSB 3DX9A 3L95B 4YXHL 5BRZD 3WFDL 4TNVF 3ULVD 1H15A 5IR1A 4OCRH 1FNAA 1MCSA 2DJSA 1UVQA 1NL0L 1VFOA 4JFEB 1ZT7A 2VXSH 4Q9CA 4XHJC 1T7ZA 4WWKC 4NNPL 1YEKL 3B5TA 5DSCA 1A21A 4EI5B 3OXSA 1FE8H 4I3SL 4OSUL 3W9DA 4BQCA 1XIWD 2H26A 5B38A 4K9EC 3TPKA 5FA3A 5HYJA 1G6RH 2Y06H 2DD8L 4NSKB 3QHZL 3L3HA 3VJ6B 3IXTA 4G8EB 1FO0L 4Y16C 2OTWA 5FO7A 1EXUB 5DYOB 4NCDA 5F8QC 4CMHB 2GUOB 3I9GL 4YHOL 5F44A 4DVBB 4TUKL 5ESQA 5ILTL 3DIFB 1SMAA 4JE4B 1ZHKA 4KK5D 2IGFL 1F3DH 3LEXA 5FUZH 1KGCD 2UY6A 4P23D 5IMLB 3MMEB 3B9KD 3MOQA 4JN2B 4F33B 3L5IA 4WI9A 3ARSA 5D93C 3GSQB 2VDLL 5SX5K 4JZJC 4NJ9L 2Q87A 4JFQB 1IAIH 1L0YA 4V1DD 4PJCF 2ARJB 1R5WB 2Z91A 4DGVH 5IB5B 1CTOA 2OM5A 2JJUA 1YDPB 2AV7A 3RNQA 4PREA 1Z6JT 3HMXA 3R06B 3MROB 4ODTH 2X4RB 2EEBA 4XP4H 3SBWC 1RURL 3B2UD 3GKZA 4MA8H 3WNKA 3EHBC 5DJAA 4KV5F 4OF3A 2GTZB 3GJFK 1NDMA 3DRTA 4R3SA 43CAA 2I5YH 5MENE 2X4QB 2NZ9C 4UU9B 5KSVA 1P2CA 3CFCL 3HB3C 1CD8A 2QQKH 4I3RL 4N9GA 3DUSA 4GG6B 1OM3H 4U6XB 1J0JA 4NUJB 4IMKC 4TOYL 4YXLH 4MXVE 2DKMA 4I4WA 4H0GA 3P0VH 3MXVH 3WNNA 5HHNA 5F70A 3V6ZA 2XTLA 4G8GD 3HFML 4HIIB 5DJ2A 5EWIH 7FABH 1AY1L 4YGAB 3QG6A 1HINH 2QV2A 5T1MA 1EUUA 4UTBH 4XPHH 1C5BH 5E8EA 4F2MB 2XWJB 2H26B 1RUPH 1QSFA 5IF0A 3QA3B 4QHLA 3ZDYF 2NW3A 3SKMA 4O51B 3C6SA 1MFBL 5L0QB 2DL9A 3WDJA 2XN9A 4JFEE 1NKOA 2HN7B 5T3XL 3MLYL 3JWOL 4Z7NF 3X12A 1K8DB 1JGVL 3VFNA 2CD0A 1MHPH 5EOQL 3TIEB 1I1FA 4XXCA 2GCYB 4AEIL 2BSRA 1XF5A 3MA7B 4FABH 4CMMB 4U1LB 2JJVA 3RGVC 1JNJA 4ZXBC 3QUYB 1QUNA 1HHHB 3O2WL 4G7YL 3WXVL 1RHFA 1KNOB 3AM8C 2PR4L 1P7HL 3QXAB 5DHYA 4ZDHA 4BFGA 1NAMB 5I8CB 5ACLA 2Y23A 4K8RH 3STBA 1NCNA 5J89A 3QUML 2DJ4A 1KB5B 4P0DA 4ZXBB 4DVRH 3RQ3A 1A4KA 3T04D 3LPWA 1NGQL 3VFPA 3O6FA 4GW4A 1IAKB 2HFEA 3GO1H 3ESVF 5L88L 3KJ6H 1ACYH 1MCRA 4WEMB 4XCYA 3WS6A 2Z35B 1PBYA 3ARUA 4MX7B 1IGCL 4APQB 2AJSL 2FH6A 2EDFA 4HIHA 3RZWA 2VIRA 1F6FB 3BD4A 3IU3A 4JANB 5F6HJ 4XTRD 4TNWF 1MJ7L 4HWNA 4RISH 25C8L 2PW1A 4U1NB 1OVZA 3O4OB 2VR4A 4OCXL 3ULSB 4XVTH 1W0YT 2AJZB 2VXUH 2ZJSL 1NEZG 1QO3A 5I73C 5JNYB 1T3FA 2JJSC 4K3GA 5ACZB 1FL5A 1A3QA 1ROWA 5ICXB 5CJOH 5A1AA 5B3JF 4X5XB 5MENB 3ARGC 2HMID 5D1ZA 4R4NC 1UH3A 3PV6A 1SVZA 3FB6A 3E3QA 1FAKT 5I1JH 4HS6B 5C3TA 5J13B 4G42B 4URTB 3O3EB 4S1DD 2XFXB 3P11H 4QRPE 1LWRA 4CVWA 1F11A 1YNKH 3OG6B 3CZFA 1DBML 3S96A 3TLRA 4L4TA 5BZDA 2D4FA 4XT1C 1LDPH 2I25N 3QRGL 1N5AA 2V9RA 3HZYA 1IILE 3MFGB 1NGXA 15C8L 1K4DA 4K94C 5F89A 3SCMC 2EXWC 5CLTA 5BRZB 2N7AA 1PLGH 1SBSL 2CR3A 4HW6A 2ZUWA 5CAYB 4GSDL 2IWGA 3ABZA 4JLRB 4U0RC 1MCKA 4UV4L 2V2WA 2XG5A 5E2WL 1CDGA 1E4WH 1BQHG 3SGJC 1B4RA 5DUML 3U9UA 2IBBA 3VI4E 3LMJL 2AEQH 4Z76B 4XNUH 1UCBH 1V05A 2XN9B 3F62A 1TTGA 4OGZA 4U05A 1X5XA 3FO1B 4GAGH 4MJ5A 5HSFA 4P2OA 6FABL 1A6WL 3MODL 3UTZB 3IDGA 1HE7A 2AVGA 2E6JA 2Y5EA 1RZ8A 2BNQD 4ZOAA 1MAMH 4YFLF 3H8NA 4RGOL 1EXUA 3H7BB 4ZUUA 5D7JA 4S1QH 2G5BA 4BSVB 3CSBA 1A6PA 1UH4A 5DFVC 4BA8A 3KPNA 1AO7A 3AY4A 4Y5XC 1FL3B 2ZUXA 5GS1C 2I9TA 4O02H 1H8NA 3RU8H 4M1GL 4GRWH 5HYEA 5GGTA 3QYCA 2K7PA 1JNHA 2D0FA 2DQHL 3SDCD 3IVKA 4EZMA 4YUEH 1Y0LA 1K4DB 4ESKA 3ARBC 5B3JE 1ETZA 3GJFB 1IM9A 4EIGB 2AK1L 4NHCL 4XWOC 5F1NB 3GMLA 5L2JA 4UAOC 1IFHH 1NAML 2D2OA 1FAIL 2ZOKB 4PRPB 4BYHA 3VWKA 4TTGA 2J8HA 3BKYL 4LAQH 4UI2A 4FQQB 3E2HB 4QTIL 4RWYL 3B6SB 3TO4C 4O2CB 3W2DL 3L3DB 3PHQB 4Y4HC 2I9LA 4OKVB 4GBXB 4JFHE 4H5SB 4AY0A 3AS3A 3ILQC 4ZAKD 4OQTL 4KZEL 4FFWD 4L9LC 1CL7I 5EBWA 2D03L 2NMSA 3U48A 3CIQA 3ARFA 4TSAH 5DVOA 4OCNC 4DUVA 1ZT1A 3QO0A 4MCZA 5DJCA 1F6AA 2QKIA 3MXWL 5CJXA 4C83A 4F8TA 2WBWB 2H3NA 3H2WA 3H3BC 3MV9A 4FP8L 1ZXQA 1T5XA 3MA7A 4HIXH 2FD6L 3MR9A 4R26H 1OSPH 3U30C 4JRYD 5A3ID 3RDTC 3B2UC 4LKCB 4ZPTB 3ZLQC 4KKNA 5IVXA 3LD8B 3O45B 3O9WD 5I1HH 3OKOA 1J87A 3QUYC 4FFYH 4NKDB 4KWUA 4WTWA 1UB5A 4OLWH 2ADGB 4JLRA 3QUZC 1NC2B 2YUWA 1BAFL 3MRJA 2A38A 4PLJC 5I1GL 1D9KC 1KTKE 4XPFH 2BNUB 1LP9A 3MRMB 2DQIH 3CDCA 3LDBB 3R8BB 1FV1B 3S5LA 3JTCA 3KYAA 3GHBH 4W6XB 2GSIB 4ODHH 5DDHA 4Z5RA 4HAGA 1H0DA 3FQNA 4ONFH 1FRGL 1I8KA 3EDJA 3HA0A 4LP5A 1DSFH 3C5ZD 1X5LA 5GS0D 1KLGB 1DJSA 2PW2A 4JZNA 1F4YH 2CIKB 1OSZB 5FYLH 4D8PA 2CUHA 1AE6L 1MHCB 1XF4B 2CKBL 3FO2B 3REWA 3B9EA 5M94B 1UWEH 1WF5A 3QIWC 4GJTB 4YPGB 5ESVB 1I9IH 4LSPL 5F7FA 1NLDL 1N59A 1DUZA 2EDJA 5LG1A 5IFHL 1ZTXH 3BO8B 2VLKE 3ARZA 5HYSB 1SYVA 2XY1A 4BQ8A 3HR5A 3FB8A 2VWEC 5MENA 3G9AB 1TNNA 1FVEA 1E4XH 3MRRB 1EUTA 2HA1A 3BVNA 3QI9C 2X4OB 3NH7H 3WJLC 4H20H 3NIFF 1X5GA 1UXWB 3MOAL 2DQEL 1YEFH 1RHHA 1ZHLA 5ADOL 3TFKD 2Q6WB 2V7HB 1FIGL 4NRZB 2FB4L 2VR9A 3MLTB 4IRZL 4U6XA 2Z91B 3GHEH 4LIQH 3KPRA 5DHVB 4LHUA 2VZ3A 5DK0A 3JWOH 5I0ZA 2NY0D 3G5VB 4YWGL 5L8KB 3NN8A 1FFPB 2BHZA 1T5WA 1FP5A 4RRPA 1FG9C 4F9LC 1MRFL 4I9WE 2CLRA 4DN4H 4DAGL 1KLUA 5D7IA 1W0WB 4YDKH 1TJGH 3G5XA 3LEVL 3MZTA 4WUKL 5I1LB 2JE8A 2VC2L 4R7NA 1EVTC 3PGFH 1AY1H 5L7XL 5KSBE 3U0TB 1RMFL 2XRAL 4NWUH 5L6YH 3P0VL 1YMMA 1IKNC 4MD5B 1C8PA 1QSEB 3AM8A 1RULH 4MS8A 4NJAL 3S35X 5BVJA 5D7SL 4KRPD 4NKIL 4HCRL 5SV4A 4DJMA 4FQIL 1IGMH 4GMTL 1OAQL 1NUNB 3D2UA 5FO8B 1O7VA 1AGFB 1RVFL 4OD3L 3EFDH 4NKMB 2OZ4A 3TZVA 1HYRC 3BWUC 1S78D 5EU6A 4QOKE 5BV7H 5SWZE 1JIBA 5J1AB 1AGDB 3DVGA 3FRPA 4JO3H 4Y4KC 3LCYA 2WAHA 1KJ2A 2B7DT 4YHIA 4KK9D 3G08A 4YC2B 3T0EE 2P49B 3A6OA 5H35B 3MYZA 4DW2L 4OB5H 1IEAA 4U49A 1FZJB 2AJYH 2BCKA 2OBGA 4ZTOH 4WI6A 3UO1L 5EZJB 5LCVH 5DEFB 2ZCKH 5IT2L 2KKQA 2QSTA 4OB5L 4DZBB 3B83A 5C0AB 4G8IA 4P5TA 4PJFB 3F7VA 4KDTC 5E00B 2BVEA 2JJSA 2RFXB 4KROC 5TDPA 1NLBL 1YY9C 3V9FA 3E8UH 4DKAA 2HLFD 5HPMB 3UYRH 3MNZA 1I8IB 3CSGA 1T7VA 1F2XK 2R0KH 2ZUVA 1X7QB 1JTTA 1DL7L 1SY6H 4KRPB 1FNLA 1T20B 2HJLB 4NNXA 5J6HB 3ROOA 1DUYA 5EBMB 1LEIB 1KC5H 1CF8H 1QFHA 3H9SD 2CMRH 4L8BB 4KK8C 4PJEA 1KN2L 2FEDC 3VFTB 4HKZA 3MACH 1OP5H 4MLIA 1HQ4A 1KJ2H 1KFAL 2FJFA 4XNZC 2A6JA 4JDVA 3OB0H 4Y1AD 3ZKXC 4P59L 1WFUA 4JFHD 2EIBA 1DEDA 2X44D 3MNWB 4JQXA 2DM3A 2OK0H 1U93B 3QWRD 1MCQA 3FFDA 4R8WL 2OXHA 2VAJA 1RU9H 1FE8L 4APQA 2WBJB 2KBGA 4XC1H 2IH3A 4LDOB 5DZOA 1OGAA 1GOHA 4HAFA 4KKAC 1BOGB 3MBEA 4QRRB 3BGAA 4L3AA 3LHPH 1NL0H 2YC1A 2ITCB 3MNVB 5E24E 5ICYB 2XQBL 4RSVA 2YPLE 3KG5A 3SE3C 3D9AH 4LCYA 3MV8B 1VFMA 5IG7A 1CL7H 1GC1C 5IKCB 4JFOB 1KCGC 3HS0A 5CS7A 5JOEA 5KAQF 1KLGA 2BY1A 1NLBH 4PRID 5D7JC 4PJ5D 1MWAB 3LN4A 1P6FA 2H8PA 3WL9A 2AS5M 1KCSL 5E2VH 4KJQC 3G08B 3DJ9A 3JTTA 2BVUA 4GG6E 4LU5L 1S5HA 3RP1A 3QEQD 4N5UA 3ARRA 4LSSH 4HFWB 2ED9A 5TE4L 3VXMD 1UKSA 2V17H 4S1SH 5CP7A 3S5LB 1J5OH 4FQHA 4MJ6A 1BVKB 3CFBA 1IQWH 4DAGH 4OCSL 3MUY1 4Z7WF 4WI7A 3T3ME 4LVNC 5L8JB 4GRLD 4L3ED 5D7LA 5C3LD 1XH3A 1D5XB 3K2UL 5AYQA 4YHPB 5BJTA 5JR1H 2XZCL 4OZGF 3SKOA 2BHYA 2J5LB 2W92A 3IKCB 3RWGA 5FGSA 4NO2A 3IU4L 1N7ML 1IGML 2FB4H 3EJYC 3RDTD 1U9KA 2IAMC 3GSRA 4K3JH 3S4SA 3ZO0A 4U6TA 4WV1B 1HXYA 1MLCA 1WAAE 4UT7L 4HUXA 4RZCA 2LU7A 1U8MA 5I66A 3VW3L 1DANU 4P49A 1U8OB 1E4XL 3RUGF 3ETBF 4FZEL 3KLAB 2R1YA 3QWOB 3DRTB 4JRWA 3BX7C 4Z0BH 4YDKL 4L4VD 3U7WH 4E9LA 1KLUB 5IBTL 4H26A 4N9GB 4XPBL 4K94L 4O9HH 3KHOA 1EHAA 2Q6WA 5EN2B 4QT5B 1U3HB 3CSPA 4XBPB 4HKXB 5FA4B 2J6EH 3V7MA 1N3NB 4M43L 4ORGB 4A6YA 4EUPB 4R96B 1SEQH 2V2XA 3RHWF 2ADJB 4OGYH 4Y4HB 5IV2B 5HYSA 1FHGA 3FL7A 4U7SA 4JVWA 3MRHB 4M6NL 5JXAH 1D9KA 5FECB 1CK0H 4ODHL 5EIIB 5AUMA 3QDHA 1MCPH 2VKXA 1FVEB 2IQ9L 4X99A 4JM2F 2QR0A 3DSFL 4MMZC 1REIA 4PJIE 4PJXA 2FJHB 2ZSWB 5CMAA 3THMH 3RWFA 5AG9A 3VD3A 5A40E 5A43C 1RZFH 4LCWA 4XVSH 5GRVL 3MGOA 1WBXA 3DO7A 2AXFB 5HHVL 1PX4A 5IGXH 3DWTA 3OAUH 3L5WA 1LNUA 5EA0L 4HUNB 5FDYA 2YPLB 1SJHA 4U2YA 3S37H 5GS1B 2FX8L 4IOSD 5FHBL 1UWGL 2HKHH 4HJJL 4TVPH 3WD5H 2H8PB 2IALB 5J11C 5FM5M 1J8HB 2BVPB 5F7KC 4UOJA 4GKNB 1EV2E 4ZS6D 4L8SA 2E7LA 3DYMA 3GMOA 5JHDE 5C09B 3FOLA 1ZOXA 1IVLA 4G3YH 4OCYL 3QI9A 3EYSH 3WJLA 3G6DH 2A2QT 1HHKB 4YDVA 3U79A 5EO0A 1BVKA 3MRKA 2BMKB 3SDAD 2FH8A 3ZTJG 3LH2H 2JCCB 3AGVA 1WV7T 2X70B 2APWA 3JWDC 4NN7C 1BM3H 1QA9B 3VGGA 32C2A 2HRPL 3MRLB 3VMNA 5EUOB 4PB9H 3DXAE 1UCBL 2DLGA 4L9DA 2XNAB 3RKDC 4UU9A 4F9LA 3P30H 1CK0L 2KQMA 1P9MC 3RWFB 2HRLA 5EN2A 1YEEH 3G6DL 5T5FH 4KVCH 5DQJB 5K9OB 2BOBA 3EYSL 3EYUH 1QLEL 4JFDE 3F58H 4UINH 3Q6GH 5TH2A 5C8JB 1WWCA 1MREH 1PSKH 3CLFH 3QQNA 2VUOA 4NO5A 3WHE0 5GGRB 4P46A 4RCAA 1V3JA 1MJJA 1DBMH 5IW3A 5MEND 3T0EC 2PYFA 3QUMB 4JRYB 1I1YA 1YQVH 3RBGA 1S9WA 2DQFB 2DQTH 3VGEA 2ZG2A 3STZB 4MD0A 3LKPB 1BHGA 3V6OC 4N8VA 3IDYB 4JDTH 4MQTB 2Z31D 2Y6SC 5IMOA 5D6CA 1KN4L 6FABH 1T22B 4RDQF 3TT1L 3IJSB 4YBQC 4UT7H 3QIUA 3RL2B 5A16A 5ISZE 3P40A 4PJ5E 4A2MA 4CW1B 3UTOA 5HDQH 4NZRH 4H0IA 5TE6L 4MXQA 4NBXB 5BV7C 1BD2A 3DURB 5D7JB 4P2RE 3PP3H 5FXCH 1N8ZB 4O02L 5BZWB 1R5VA 2G60H 2OCFD 5FGCB 2R2HA 2NY5C 4P5TC 3UZVB 1GGIH 5J1AA 3ARYA 3B5HA 5FCUL 4MJ2A 1LD9A 1Z5LA 4JPIA 4U1SB 15C8H 2JLLA 4HWEL 4BH7B 4K3DH 2V7NB 2LVEA 4KKAD 2DIJA 4CJ0A 1SJHB 3HC4L 1J7VR 5DF0A 3IETA 4NRXB 3BFOA 1ADQH 4PG2A 1KCVL 1UM5H 4GKNA 3VWJA 3OHXA 1JF5A 4H1LG 2NR6C 3M45A 2J5LC 2GJ6D 2HKFH 5D7KE 4G59A 2EDWA 4RNRB 3ARGB 4M6NH 5J12B 3HZYB 1MIMH 1HDMB 1U8IA 4Q9RL 3AC0A 3TPUE 4TYUA 4GAYB 1ND0A 1CDCA 2XV6B 4OGXL 4LLUA 3ZE0F 4OCXH 1V5JA 4Q6IA 2XQBH 1XR8B 1CGYA 1XIWA 4PGBB 4GMSH 4Z0XB 12E8L 4R90L 1S7UA 4JFDA 2ZNWA 3QH3B 4P2QD 3OPZH 4NPYB 3EO0A 3P4MA 4HKBB 3MA9H 4HJ0C 3PDDA 4C54A 3SE3A 3C60B 2OL3B 4F8QA 5IIEA 1R5IA 1KJMB 4NM8L 1GZPB 2H2SC 4M6MH 4L29A 5GRJH 5J9PB 4M7LT 1FLTX 3PG2A 5ICXA 4XBPA 4A6YB 4Z95H 5KSVB 4LCCC 1UKTA 5DJ0B 3IJYB 3RKPA 3K4AA 2KH2B 3H0TA 4MA3B 5E8PA 2F5BH 1W2KT 5I8KH 1EEZA 2R23B 4Q9QH 1PQZA 5SWZB 3HI6H 5FB8B 3NCJH 1IAKA 4PJ7B 1CFNA 4JHBA 2EDXA 2O5YH 4K8RD 1CDUA 5F7LB 43C9A 5EOQH 2AP2A 4YAQB 4EKXA 4M5ZL 4OM0L 1I3RB 1JGVH 4JO2L 4HDIB 1HHKA 1HOCB 1L7IL 4OFYD 1ZVYA 1IT9H 3WFCH 1RZJH 2AQ3A 5E03A 3MCG1 3BXNA 2AKRB 2NY5H 2J1KA 1AQDB 2DM4A 1DQDH 4WJ5A 1NCWH 1CBVH 2E27L 2X1OA 4MJ6B 1HINL 5FYJL 5I2IB 5ISZB 2IAMA 3WBDA 5EWIL 7FABL 3STLB 4PB0H 1ZLWH 3SGEH 4EJ1C 2ICWA 1Q9OA 3F7PC 2PW2B 1FPTL 1W8NA 1KCRH 4PRIA 5GRUL 4PJFE 4F9PA 4G6JL 4YPJA 4Z7VE 1BZQK 3IXAA 4D0DA 1JRHL 1MOEA 5DK2B 4NRYB 4YHYB 1FYTE 1MHPL 3KPSD 3N1GC 4YR6A 5KVFL 1CI5A 3HAEA 1IC5H 3MLVH 4WFED 5HD8D 1LO5B 3L3OB 5DVMA 5DFVD 3ARWA 4Y19D 3TP4A 1S7VA 4LVNB 3NZHL 5IM7A 1DVFB 1J18A 4QGYA 2WIIB 2APTA 4FQJL 4X6CB 5FDWA 5KOMC 1N64L 1HH9A 3NAAL 1V3MA 3BZEB 4FQHB 1CLYL 5A2JH 2R9HC 2EECA 5E4EB 3CDYA 5IOPA 2WUBL 3MJ7A 2F54B 3MBXL 3U9UB 2FECI 1MSPA 1MCOH 3HHRB 3VMPA 5C0NC 1YA5A 3QCTL 1XGYL 5D1ZD 2G9HB 3L3JA 1NGZA 3OGCB 2VZTA 1YEKH 5IEHB 1AGEB 1JNNH 1FGVH 4KTEL 3BKML 4ZTOL 5JW4N 2GY7B 5AWNL 3VFVB 3HI1A 1IBGH 1GGBL 4RQQA 1K8IB 4LP4A 2SEBB 5CEYB 1YEDA 1U8QB 5JXEC 1LEGA 1MI5D 1QKZL 3F12B 4KKLC 5ACMA 1WFNA 5EH1A 2CLRB 2R23A 1TQCB 2ORBH 1JZ7A 2R2CA 1A7PL 2NXZD 3NIGE 2QEJA 5LWYL 2XICA 4XPGL 1DL7H 2DQEH 1D9KB 4PP2B 1NGYA 4PJIA 5KSBA 1FPTH 5JO5B 4C55A 2YRPA 3PV6B 1J8KA 3NH7L 4KDWA 5ANME 2PYFB 1T1XB 4HPYL 3NA4A 3P4NB 4PRAA 2X10A 1KB5H 4G43B 1IBGL 4XP5L 1ZLWK 1GAFL 3RHWK 4H88L 2E7LC 2AERT 2BP3A 5LCVL 4UDUA 5EZIL 4OLYH 3AMLA 5DC9B 4Z7OE 1G6RL 3CSYB 3OKMB 5EOTB 1X6LA 4UQ3A 2CKBH 4AK1A 2EDQA 5IOPB 4EUPH 2EKJA 1OCWH 1FQ9C 2A6IA 3CH8A 3KYNA 1PW3A 1XMWA 4YK4B 4BJLA 1Z5LB 1MLBB 1U3JA 2FWOB 3P77A 3EFFA 2E6QA 1AO7D 1JZ3A 1RK0A 4HXBL 1U3YA 2OR8A 4OGXH 4LEOA 1X5KA 3C9NA 3KPLA 1BF2A 4JQVC 4JKMA 4LCWB 1MIML 4BH7A 4NT6A 4TSBL 1NC4D 3AREB 2YS4A 3KAAA 3QB7C 3ZT5A 3G6AA 2A9NH 2HLAA 4NOBA 4XC3H 2WQRA 2IH1A 3GB7A 4H0HB 5CGTA 1WBYA 1LP9F 3VGBA 5I8EB 2W65A 5F6HI 1NLDH 2FBOJ 1KEGL 1AGCB 4JJHA 3S5LG 4UAOB 1CCZA 5GGSA 1B9ZA 4EVNA 1G6VK 3RPKA 1P53A 12E8H 2HT2C 2BXYA 2NTFA 3DLQR 4JO2H 3NIGF 4P3CL 3UJTL 2XXCB 5C07D 5C0RL 1U2HA 1I85A 5IFAH 2ZCHL 2CRZA 2WIMA 4N8VG 5F8RC 3UTTE 2VKWA 5E6IC 5DJXA 1AI1H 4KQ3L 2XYCA 5JDJA 3QUMA 3HN3A 1EERB 3JBG7 4PBXA 4Y7MA 5C9JA 1S7RA 4L8DA 4XPAH 1K8IA 4P9HC 4HWBL 1T7WA 2Q8BL 4F58H 4R7NB 1GIGH 2Z8WC 4FG6C 1DQML 1T7XA 4HWUA 2BOBB 4L1DA 4N1CA 1NBVH 5E56A 1S3KH 1U8NA 1SJXA 3ULUE 3VWKB 1KYOJ 2XZAH 2EC9T 1XF2B 2PXYA 2JTDA 4MCYB 3GBML 3PWPA 3NCCB 3JUZA 3QXTA 4D0BA 4P23B 3FB8B 3FZUC 5FYKD 2ICWI 3RU8L 5C09E 4GXVL 5C0BD 5FV1L 4OF0A 9CGTA 2EDOA 5CEZE 4AENA 1Q72L 3LQZA 3HAEB 3BKCH 4HGWA 4I5BB 4LRIC 4ZSOE 5LQBH 1ZT4B 4Y4FB 2IFFH 5DVLA 2IPTH 5DMGD 4KVCL 5F3BB 2DLHA 3RNQB 1MHCA 1AKJB 1XF4A 2K1MA 2GTWB 1WWWX 5HGDA 3W11D 1A8JH 4QHKI 5I76A 1IAOA 1WQVT 5IW1A 1BD2D 3DXAB 3LV3B 3CXDH 2EE9A 2GT9A 3O3BB 4IBLT 5GRXG 1E4KA 4PGEB 3TZVB 1XIWC 2DQUL 4KRMB 3KDMB 4WFEE 4WJ5B 1BLNB 4YX2L 3SKOB 5JOFB 2EYRB 1FYTD 2F53A 3TC9A 4B7LA 2WZPD 5ICZA 4HBCL 4MZ3A 1JVKA 2OJZL 4BZYA 2OLDA 3CVIH 3O3AB 5LJYH 1J1OL 5DYOA 4KMLB 4UQ2A 3X3GH 3O8XA 4UOW1 1JCKA 4P4RA 5F7DA 3KHQA 4Q2ZA 3OMZA 4M1GH 3PDOA 1XR9B 4LLVB 4QRUA 3GFUA 3TBSB 1MFAL 4RA3A 3BI9X 4NZRL 3W81A 5KS9F 2EDBA 4FTVE 3P9MA 2HG5B 4FQLH 2DBLL 5IVZB 2A0LC 2AV1B 3BQUD 4FQCH 3KPSE 3D69A 4U1IB 4K2UL 3ZYZA 4IMLA 3SGDI 3GMRA 3VXRA 1JE6A 1PFCA 3WS6C 1QHPA 2APBA 2NY1D 3G6JA 2E9JA 2OX5A 3O3DB 5JMRA 1JWMB 4BZ1H 3QEHB 5EULV 4KUZL 5GS3A 2YC1B 3PWVB 5E94B 2BNQB 4JFYB 5EIQA 2YN3A 4MS8D 1KEMH 4PJEF 4XVTL 1MQKH 2A9MH 5TQ0H 4X6EA 3MZGB 5JO5A 2WWMD 5KVGL 4L5FH 1KJVA 2OI9C 2CDFA 2HJKA 4JFFE 3SDXB 3RWJB 4QRPA 3TBVA 3HNTH 4J3TA 1UWGH 2HKHL 3LN5A 1Z0MA 4TVPL 1MCIA 1KIPA 5TPWL 4LLWA 2FSEB 3WIIH 2D7PA 2X1QA 3F58L 5GS0L 1YZZA 5I16A 5DS8A 2VOTA 2YD3A 1ACZA 1J1OH 1CDIA 3BGMB 3BW9B 2P5EA 2ZCLH 4NQDD 5CEYA 4HSQA 4DZ8A 4TNVK 4TPRH 3IAQA 4NM4H 1J05B 3VXPA 4NQUA 3UEZA 1FNEA 5E8OB 1UADC 5FV2A 3C6LA 4WWID 4OLZL 4PG9B 5B22A 4PTTB 3QXAA 4ZDHB 3V4VL 5D96C 4KXZI 3GJEB 3VMOA 1RV6X 3QCUL 3GJFH 1Q0XL 2I24N 2X9WA 2VZ1A 1GPOL 1YY8B 4YDVB 1Z9LA 4YHPA 4WEBL 2VXUL 4AEIH 3U6RA 4A2LA 4PD4K 5F71A 1UEYA 2E7HA 3MV7A 1BQLH 1RK0B 4Y8DC 3TNMB 3U1SL 2ESVA 3ALWA 2VXQH 1ZLUH 2LTQB 1MJ7H 4OLVL 3DO3A 4YBLB 5DD5H 1KIQA 5HDBF 2R4SH 1YMMD 2VN7A 4UUJB 2LE9A 2X4NB 5D1QB 4M5YH 5MEOA 1ZA3A 3HKFA 4S10A 3TBYA 1TVHA 2DQDL 3GBNL 3GO1L 5L88H 4XP6H 1BFOA 1QRNA 3QO1B 5E6IB 1U42A 1D5BA 4LMQE 4JG1L 3I84A 1R3JA 2O5ZL 4EI5D 2B1AL 4OIAA 4OZIB 1BPVA 2Z8RA 1GIGL 3B3IB 4LRNH 2WLYA 3QQ9D 1TVBB 2WINB 4APQD 3Q5YA 4XP5H 1OGAD 2BJML 1PKQE 2D31A 3UTPE 3RBSA 1J9CT 2BNQA 1WUNT 3O6LL 4LSRL 1L0XA 4ORGA 5EU7E 3PIQA 2R8SH 1SJVA 3CFCH 1FL6A 3V8CA 5D93B 2PF6A 1KPVA 2DN7A 3I50H 3VXOA 5KOVC 4CDHA 3LQZB 1M7XA 1JZ6A 2ORBL 4NNXB 5C0RH 1N3NA 1Q94B 2EH8H 1DDHB 4LNVA 3BKJH 4DEPB 4DOHE 3S4SG 3VWKC 3KPSB 4D9RD 4YIQB 1I9RH 4ZD3L 2XXMB 4UZGA 1LEGB 5ALBL 1RK1B 3QEQA 1KCSH 5E2VL 2VLRA 2AJUH 4ETQB 2OK0L 3S3PA 1NMAH 2DJUA 4IOFD 2A9NL 5BMFH 2D9CA 2AXJA 3VFUA 4R4BA 4OZHF 2QQNL 4L8DB 5I71C 1N64H 4W6WB 4JAMA 4XI5C 5DEZA 2HTLD 1A9EA 5K9OA 4C59B 4WU5A 5I74B 5FUZL 4YFEA 3MACL 1P4LB 3VH8A 2CMRL 3BIKB 2CLVB 1S7SB 1PKQB 1W72B 5DRWB 3QEGH 3PNWA 1JRHH 4NQSB 1KT2B 3BP5B 1I3GH 2JB6B 3TIEA 2WUCH 4RZCB 3VD9A 3I3EA 2C3GA 2HLAB 4A6YH 5JUEH 5F9DC 5IHZB 3AB0B 4XP4L 3WIHH 3QUZA 4LVOB 4ODTL 1F4WL 5J1TC 1PG7W 3SOBL 1GJIA 3FZUD 4PRHA 2AJYL 3MX0A 2VABA 1CICA 3PWJB 5GGUA 4LGPB 4OCRL 3ZKMC 1C08A 3QEUB 4HPYH 1T5WB 4TN9A 5ETUB 2HFFA 1BOYA 3RWIB 1U8HB 2UZXB 3LV3A 1HXMB 4QHMB 3FTGA 3LN9A 4JY5H 2JJTA 1RVFH 1JMXA 3FONB 3IDNA 4XNYL 4X5LA 2VQ1B 1I3RA 3ZL4L 3R1GL 1A7BA 1U3HD 1D9KD 4DZ8B 3VXUE 5B39B 5JHDD 5L2JB 2HWZL 4GKZA 4OF8A 2D3VA 2DMCA 1TENA 4KJYB 1J86A 3RL1A 4JFYA 5CJQL 3CXHJ 3RZCA 1VKXB 1IQDA 2VC2H 2Z93B 5EG6C 3WO3B 3SE9H 3MV11 3C5ZC 4HS8L 2XA8H 3FB6B 3HRPA 4YQXL 1D5MA 3TVMD 5JORB 1JPFB 1CD1B 4GRMA 3KJ4C 3RY6C 4JRYE 1R5WA 4YBQD 5BS0D 1OTUC 4YDLC 5E99L 1R24A 2IPUG 2P5WB 1OWRM 1ZK9A 1V8HA 4PTUA 4PREB 4U6HA 4ELKA 2H9GB 4U1IA 1YJDH 3QNZB 2CK2A 3CH1B 3ZKQD 2YUXA 3EJZD 1U8PB 3C09B 3TA3B 1GXEA 4N0UB 4Y19B 4U1GB 1K2DB 4LPYA 2EDDA 1KCUL 1PY9A 1DUZB 5GHWL 1OGTB 2I60L 3BSZL 5JQ6H 1ZA3B 1MVUA 2RJMA 5DMYA 5J3HC 3QPQD 3KPPA 4GXUN 2B39A 3O8XC 5DRNA 3TV3L 1IKNA 4EIZC 2FHBA 4Z76A 5I1EH 2AI0L 1UZ8A 2MTPA 2ZCKL 5FGCE 1CGUA 1LHZA 4YHZH 3FB7A 3VXSE 4OLEA 5D1QC 1CXHA 1BJMA 2Q76A 1TPXB 4RGMB 2FZ3A 5JIIA 4YHKH 3EW3B 3RVUC 3VFMA 3VG0L 2VAAB 4XCFH 3TZVC 3A0OA 3CMOL 5F89B 1MEXL 2GSIA 1NMBH 4ERSH 4OZFG 4E5XB 4PJCB 4JPKH 2F15A 5BV7L 2BNUA 3MRMA 3QG6B 4ODSL 1PYWB 5KSAC 4JKKA 1U8KB 3DI3B 1J8HA 4OZ4B 3WXWL 2Y36L 3L6FB 5F7NC 4KHXL 5KVMC 3BJ91 2PNDA 2DYPA 3V4UH 2BSTA 4M62H 4I48A 1BZ7A 2FRGP 1I1AB 2HN7A 3JV0A 1N0XL 1S9VB 5MEQB 5F9OL 5DD1H 3G6JE 5E8DL 1I1CA 5CBAA 5HHOB 2YA1A 5CSBA 5CZVH 5MHSE 4JB9L 3VXUA 3G5VA 5HGGS 1TZIA 2ED7A 3HS0B 7CGTA 4GG6F 4O5LH 1INDH 1JNLH 2HFGL 5DJ6B 4V3EB 2Q86A 4WWKD 4V2BA 3SDXA 2J3SA 3ULUL 2PTVA 5KANI 1CQKA 4WENB 1RIVH 4HD9A 5D1XC 4J3WA 5JW4M 2YD1A 1FZMB 2YRLA 5TF0A 5TE6H 3EYUL 3H9SA 4WEBH 3VXRD 2BRQA 3GJFA 4JQXC 5F88A 4AMKL 1HHJB 2FBJH 5K59F 3BZEA 2ITDB 3TJEL 3MLUH 4PLOB 3QQ9C 4APQC 3V5DB 5E00A 1OAKL 1L7TH 3K46A 5EOCH 5DC0A 3QH3A 3PE9A 1U92A 3A6CL 4AM0B 4F7CA 1O0VA 2VERN 1WWAX 3QIBB 4X9GA 1F6LL 4WEUD 5F1IB 2XN9E 3HC4H 3VWJD 1E0OB 3AAZA 1QPPA 1CGWA 4P46D 4Y19E 4GAJL 3SGEI 1GGCH 1MLCB 5EORH 5SV3A 1F4YL 3KYKH 4MNGE 3MRDB 3PP4L 3BPOB 1FNFA 2NCMA 1YYLL 5CBEA 3C8HA 1IAII 5HHPA 4ENED 5DRNB 5FYLD 2GITA 2CLVA 4XH2A 1TXKA 1WBYB 3UXFA 2APFA 1ZGLP 4KI1A 2NY2C 5DVNA 2F8XC 2A9ML 5DHYB 3HE6B 3T1WA 1Q0YL 4Y5VB 2HP4A 4ZO9A 5K9JL 1AP2B 3MJGX 4NZJA 3O6FD 3K8KA 4DGIL 4YFLI 4JAMB 3VXNB 1JV5B 3G5YA 5A2IH 2YEZA 3SO5A 4U1SA 3FRPG 3QUZB 4TSCL 1KN4H 3OKOB 1CGXA 5CD3B 3RPIB 5EC1A 3T4YB 4LKXA 4G6KH 2XKNB 5F6IB 3IETB 3BEVA 5INCA 3WE6B 5HY9A 1JZ2A 4PJ9C 4B0MM 2JB6A 4OI7A 1LP9B 1D5MB 4PRNB 3T2OA 2QADC 4Y89A 2WBJA 3P0GB 1FFPA 1ZS8A 1F42A 1IGYB 1VESA 1QACA 4PJXB 1G7LA 3QDJD 2W9DH 3HNSH 4ELMA 1MFEH 3BIBX 4QXWA 3X3GL 4KKLD 3F65A 1S5IH 3ARVA 1DBJH 2GJ6A 3Q1SL 4HG4J 8FABB 2DLFL 4GRLC 4MXWH 4PJGF 4RA0C 4K94H 4O9HL 4KQ4H 3RI5K 3NIDE 3ZKSD 2DTML 4MA1C 4QTIH 4HUWA 3MLWH 5HYSG 5IBLC 3RIFK 5IHBA 1VADA 1BM3L 4L4TE 4XAKE 3RGVD 3MLUL 5DUMH 3CZJA 2HAZA 1E4JA 1EHXA 3UYPA 3BP6B 3ROLB 2YUVA 2VN4A 1B0RB 4OT1L 4PJGB 4UIMB 3RWEA 4M8QA 4I0PB 3VFVA 4TULL 4NGHL 2HTKC 1DLFL 1U8MB 2EXYC 1UH2A 4KTDL 3UJIL 5C2BH 1FZKA 3O6FB 2ADFH 4MNQA 3LRGA 4JRXE 1JNLL 5LXGL 2MHAA 5B38B 5IQ7L 3QZWB 3UTSB 4YHYC 4JREB 4JFFB 3V6FA 4XGZB 3RWGB 1A6AA 1G9EA 4RGMC 1RZIB 3IDGB 1J5OL 1A1NB 1EHLL 3GRWL 1BBDH 4PGDB 1KNOA 2V5TA 4IIQC 1QQDB 5TE4H 1H5BC 1I8MA 5F3HA 2Q8BH 4F58L 4DKFL 5E4EC 1GOFA 3KPLB 4BFIB 1ZGLM 1IM3B 2PR4H 5CGYD 1M6OB 1I1FB 1XGRB 4LVOC 4DGIH 5CIPB 4MMXC 1CG9A 3PL6C 4F15C 4Y4KB 4L4TB 3N06B 1M71A 4OD2A 1P7QD 4KJPD 1FYHB 3FB5A 3MLZH 5JHDB 4J8RB 4G7VL 2X1PA 3CCHA 2BRRL 4JVUA 3UTPD 1SBBA 3TYFA 5KJRH 1S9KC 1EHNA 1TQCC 2AJVH 1XCTA 4JFXA 4ZTPL 5TE7L 3RA7H 1NEZA 3VD5A 1BVLB 3BUYA 5GSVB 3MBEB 2AXFA 2W9EL 4L3CA 4PR5A 1RUML 3B6SA 1J05A 4XP1L 4JGJA 4EN3D 2JK5B 1ZLSH 1M7IB 3BRGC 1P7QB 3ZKND 2AAVA 3V0WH 4GRMB 2F9BT 3QUKB 3QFDA 1FVCB 3AMKA 1U3HA 1FH5H 4MVBD 3TJHC 2X4QA 1NGWA 2P5WA 1VCAA 3LD8C 2AJXH 4PJ7F 1FN4A 1DVFC 2DB8A 4Z7WE 1D5ZA 3W0WD 3F12A 4CVXB 5E9DD 4UILL 5HGAA 4L8CA 4D0CB 5LGJB 3O9WA 1XGUA 1NBYB 3P9WB 3UTQA 4LLQB 2X4TB 2IPUK 1J0IA 2BSED 4UUJA 3P73B 2C5DC 1QBMH 1Q9LA 3MRPA 3KJ6L 1G9NC 3RAJH 4HS3A 2IH1B 2RCSH 3GB7B 3QCVH 1RZGA 1B6DA 2D7TL 4OCWL 4QNPF 5IB4B 5BS0A 3DHJA 3I02B 2AGJH 4OLYL 3WMSA 3GI9L 3NFNB 1XF1A 1B4JL 3TT3L 3SEPA 3QHFL 3TF7A 3DI2B 3QDGD 2FZ3B 4YDJB 2GCYA 1QFWM 2B4CC 3E0GA 1T1WA 2Z0BA 5F93C 4LEOB 3WFEH 3M1BA 3VI3F 4GW4B 2AK4B 3TBYB 4MXQD 4UT6H 3U7YH 1C7SA 4ZUUB 2R56H 3FQTB 1CL7L 1NDGB 1QG3A 2A6DB 3ISWA 2MQ3A 2X41A 5KG9B 2CDEB 3QI9B 3BHBB 3BGMA 4EOWH 2IG2H 4WHCA 5JPMB 4P2YA 4AL8L 1IMHC 3GSOA 2NYYD 3AU1B 3MJ8B 4NQEA 1RULL 5EZLA 3CVHB 3P4LA 3VWJC 5IWLC 1NC2D 1SQ2N 3VXPB 2RBLA 3CAFA 2MSPA 3NIFE 5CBEB 5CP7B 3QCTH 4LLQA 1TZGL 5C0JA 3INUH 4NZTH 3CC5B 4PTTA 3UTTB 5C0GB 4A6YL 2UYLB 3VG9B 3M07A 2P44B 3TV3H 1GCFA 1J10A 4PJBF 5HVFB 1INQB 4EUPG 1W72H 3GK8H 4IMLB 1RFDL 2NY1C 3NFNA 4LSTH 1YEIL 2G75B 5IB3A 3ZYIA 1A47A 1IC5L 3IFOA 3MLVL 4WHYG 3V0VB 3TYGH 1MVFA 1YQ2A 3JVGC 3FCTA 1DBAH 3LS4H 4DKDC 3TH2T 2I5YL 4PY7A 4NJAH 3KLDA 5JIHA 1HHJA 1BBJB 2QLVB 1KJVB 1KXVC 3QHTC 3GDBA 4GBXD 1NBYA 5I18H 4NWUL 5L6YL 3QT2A 1QBLH 4QNPE 3VRJA 3BE1L 4U31A 4IS6B 4PJ9D 4ZYKB 4QO1A 5FYJH 3PWPE 1G7LB 5FOBB 4R6UA 1NCWL 1CBVL 4LLDB 3CK0L 4R4FH 5AYUL 4ZD3H 4Z7VA 3PABA 5EZLB 4F37F 4LFHD 4QXTB 3SJVB 3U4EA 1FYTA 3OX8B 4FFZH 4K3EH 4OZGB 2RIKA 5DZLA 3ZKXB 1E6OL 1D5IH 1I3UA 3JSSA 4LIQL 5MEPA 2YWZA 1ORSB 4OM0H 4D3CL 3EOTL 5CD5D 3H7LA 3FMGL 3I6KA 4RMTA 4PJ7E 3OSKA 5CGYC 3QDME 3VWJB 4GRWB 1IAOB 4UNUA 4X7DC 1CLOL 3R0NA 4UB0L 1X5HA 3O3UN 2GJJA 1NBZA 1VACA 2B4CH 3RUGB 3UZQA 3O6LH 4LSRH 3U7YL 3KPQA 4HCRH 3D39E 3AS2A 5KTEH 4Q6IB 2VLME 2ZUSA 3MJ9A 2IF7A 3OTTA 4NQEB 1EAPB 3A6BH 2FEEL 3ET9F 4GAYA 1T2QH 2ADIA 2XRAH 3GSNB 1MWAH 4NRXA 1KPUA 2UZIL 1U36A 4N0UE 3WNPA 2FO1A 3GIVA 2BX5A 5I76B 5I30L 2YPKA 2BY0A 2P46B 4F9PC 3QQ3A 4PGEA 3TCXA 2UVFA 3TBWA 2VXSL 2EXYD 3QZWA 4OBSA 2I07B 2ZPKH 3G5ZB 4NQXA 4RMWA 3WHXB 3NZ8B 1V7NL 4HC1H 1JF1A 2FO4B 2IMMA 5EU4B 3QUXB 1SJEB 3K0WA 4PJEE 4FMFA 1UJTA 2XQYK 4JM2B 1MCDA 4OBRA 1RIUH 2VDOL 1YY8A 3N9GH 3KPSA 2FIKA 2OR9L 2DQIL 4DK3A 2VLJA 2DQJL 2P24A 5GS0C 5GZOC 4JPVL 1VKXA 3D2UB 4OQTH 4KZEH 1IC1A 2VLKB 1F90L 2J8UB 2C4XA 4OZFH 4G7VH 4WHTB 1NCDH 3DNKA 5IIEB 1PKOA 2NY4D 4HGKC 3DURA 5FOBA 1S9WB 2ICWJ 2EIDA 2ENSA 2VLRB 4HIXL 4RAVB 4QOKB 4P5MA 1WZ1H 5IFJA 3C60C 4HC1A 5DGQA 1G9MC 3G6JB 4LPUA 4KGLA 2EKSB 4N0FA 4P2RA 3TNNB 4QRTA 1JGDA 2RFXA 4NZUL 4G80B 1GGIL 1H5BA 1L6ZA 3M17B 2IAND 4PJCA 4LHJB 2MKWA 5CGMA 3S88H 1E27A 1IL1A 3B8YA 1Z9SA 4G6MH 1MJJB 1TJHH 2UWEE 4XVJH