3HUJA

Crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1d
total genus 72
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hujA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3hujA01
2ILLA 4IHOB 4L8DA 4NKQB 5BVPL 4HCRA 4LAQH 4NUGL 1BREA 2XTJB 1CD9B 3GRWH 3D9AH 4TNWF 5IVXF 1QPPA 2XA8H 2EDHA 3TESA 2FECI 4YC2C 1E6JH 1OAZH 3SE8L 5CJ8A 2AK4D 4O58L 3TA3D 2YD1A 1A7RH 1FVDB 4MXQD 2D31B 1QLRA 3UROR 1YNTB 2XA3A 3T3MF 1A47A 3LVEA 2MKWA 1MVUA 4AEHL 3MBEA 3MZTA 1MIML 5BW7C 1RUQH 3O2WL 1FLRH 1U93B 1WFTA 1A9EA 4ELKB 4EI5C 4HS6B 2JLLA 1JPST 5E95B 5TFSL 7CGTA 1KLUA 2M2DA 1DEDA 4XP5H 1GGTA 2V5SA 3DO7B 1MJ8L 3QDAA 2NPLX 4OI8A 5C09B 3U4AA 3AGVA 3I85A 2VWEC 4N9GB 3G5ZA 4NKDB 3TVMC 2VE6B 4OV5A 1B2WL 1S9WB 3L5IA 4PV8A 1KIQA 4OZIE 3C5ZC 1OP5H 4RBPK 3UXFA 3ULUD 5EBMB 2Q76A 3V52H 3UCRA 4KZDH 1PGRB 1Q0XL 3ARSA 4J3SA 4O51B 4H8WL 4KJQD 3H0TB 2FL5B 1AFVL 1UM5L 2VR5A 2VDKH 1WBXB 4OFYA 3QH3A 3WDIA 4MA8H 1I8KB 3OKLB 5F1IB 1J1PH 5C0GB 1I7RA 3ULUH 2OZ4H 3T8XB 4MMXC 2BVPB 1OSPL 3RWJA 5L9DH 4WWKA 4WU7B 3FO2A 4JKLA 5HTSA 2GSIA 2H6PB 3V8CA 4Q9BA 1S3KL 1UACL 5HPMA 2AEPH 5C0BD 1I9IH 2DJSA 2R29H 5E8OA 5GISL 4A6YB 5ADPH 1T1XB 4R90L 5M94B 2V17H 4XNYH 5I71C 1NGWB 3HC3L 3WV0A 1BFVL 5C07B 5TDPB 2Q8AH 1N0LA 4WEMB 5H2BB 5FOBB 1CTNA 1QO3A 4JJHA 3TPUB 3U0WH 3T3PF 5I1EL 3DUUA 1T5XB 3GMRA 5H35A 3ZYZA 5T1MA 3DETD 1JWUA 4Z77B 4NGHL 3P77B 1XCQA 4I3RH 2HAZA 4ISVA 5FYJE 3TIEB 3MACH 1IC4H 3F58L 2AW2A 2JCCE 3EO9L 4M7KH 4Y16D 2HFEB 1VSCA 2CO7B 3BISA 2EYTB 3RI5K 4TSAH 2GQHA 4K23H 4B50A 1JUFA 2I60H 2UYLA 3Q6FB 4H25A 4GRLC 4DTGH 3RGVB 4KGJA 1IE5A 3BXNB 1FAIL 4XPBH 1CD1B 1HSAB 3W9EB 3VXSB 3H3BC 4ZXBA 1C08A 1UJ3B 3O3BA 3UBXB 2N56A 2X4SA 5KG9A 4X9GA 4OLXL 1H8NA 3PJSA 4M1GH 3VFMB 1JGUH 3OB0H 4UIKH 2AKRA 3VA2C 1QLRB 2AXGB 3D0VB 4A2MA 1XGTB 1LDPH 4ODXB 3V95A 1QEWA 4S1SL 1REIA 4S10A 5ICZB 3RFZC 1R5VA 2A6DA 1SY6A 4QF1A 4S0TD 5D1XA 4UQ2B 5F8RC 1QKZL 5IJVA 4Y5VC 3NFNA 4KHXH 1X5KA 3VWKD 4FQPA 1ZEAH 2LTQC 4Q6IA 1LK3L 3L7FA 1NMBL 3G9AB 3H0TA 3EYOB 5F7DA 2NXZC 4HPOL 4OM1H 1Z0NA 1MWAB 3TBWA 1MJUH 2H26B 1XH3A 4QRUB 4NGHH 2BERA 5FYLH 3TVMA 1FZMB 4XVTH 3P0YH 5B22A 1RIVL 4PYHA 3S34H 2R2EA 3UEZA 12E8H 2PTUA 2ADFL 4ZO7A 5FEBA 4GKOA 2HRPL 3BWUC 1ZT7A 3MCG1 3QWOB 4Z7NE 4UU9B 5F1NB 5I18L 5BO1L 5GRXG 2CLRA 2F8VA 3F7YA 4IRSD 3R0MA 4NDMB 3JV0A 5MP6L 1LO0L 5HGBA 1M6OB 1J0YA 3CDGB 4LVOC 4JAMA 3VFUA 4QRSB 1G6VK 4R7NB 1CN4A 1EJOH 4PJAA 3LKRB 3D87B 2WP3T 4UMGA 4F7MA 4BH8B 3SDDC 2NTFB 2ZWLT 2B4CH 3DVGA 4AY0A 3LZFH 3UTPD 1QHOA 3DRTA 3O45B 3QISA 1J7VR 1Z2KA 1ZA6B 3L3DB 2CIKB 3KPRA 4NHUA 5DWUL 5EU6B 4D0CB 4HXBL 5FYJL 4K94L 3MUZ1 4X6BB 1AKJA 5EH1A 1VFAB 3T77A 1UH3A 3KYAA 5IKCB 4NZRL 3VXMB 3O41A 4KRMB 3WNMA 3MC0A 4P46D 3ULVC 4Y4HB 1KJ2A 1NC2A 1WTLA 3MLZL 1P4LB 1WCBB 4K8RH 5IB4A 3EYQD 1Y18A 2Q7YB 2NY2B 3PHSA 4OCYL 4PJ5E 4M1GL 3BKYH 3E8UL 4OGXH 4XVTL 4D0DB 3RWFA 1HYSC 3HPJA 1PLGL 4M62H 3HLAB 1KPVA 5HSFA 3QEUB 4CU8A 4LSTL 4LNVA 4XTRC 5IEKA 4KJPC 5J6HB 3MQIA 1IC5L 1A1NB 1BF2A 4OZIF 4OB5H 3KPLB 4BFIA 4F9PA 1HNGA 1UM5H 1ZGLM 4V3DB 5J57B 1P6FA 2BY0A 3SBWC 2P1YA 3TA3A 2X4NB 4FQXB 5SWZA 4GRWE 3MJ8A 4LIQH 4MAYC 3MXWH 1NGYB 1J1XH 1K3ZA 3LKOB 4X4XB 4KK6C 1EUTA 4MNGA 5TDNA 4YHLL 1DZBA 5DJ6A 3NA4A 3S36L 1DBKL 4OFYD 3G6JB 2EO1A 4PRPE 3TZVA 5CD3B 1AD0B 5F7DB 4XHQA 1WBZB 5M95B 4LCWA 4PJXA 3VD4A 4Z0XB 5INDA 1X3DA 2VIRB 1GOGA 5FUOH 4I5BB 1OSZA 5FKAB 2YN5A 1I1FB 2NW3A 4X7SL 3K1KC 1ZLSH 1QZ1A 5K59F 3BKML 4D0DA 3MV8A 1ZVYA 2CQVA 1JNNH 2A6DB 3BESR 4XWGL 2LVCA 3QR2A 1A0QH 4HZLB 2W07A 1EHLH 1C5BH 2IG2H 4RMWA 1BECA 3BZFB 2YWYA 1VKXA 4KKBC 4PD4J 5EZIL 5I30H 5EIQA 4M6ML 2VJXA 3PGDA 5I9QB 3VFRA 2IMNA 4FFVC 3O2DH 4PJFF 4DQOH 1F58L 4OCRH 5D7LD 3QIWB 3RJQB 1T20A 5IW1B 5IGXH 1I9RL 4LASH 4PJCA 4PJDB 5HDQH 4WJ5A 4HQQH 1A6WL 1MI5A 2APFA 2D9QB 5BJTB 5CHNA 5DI8A 1FYTA 1I8LA 4F37K 3ARDA 3M45A 1OW0C 1ZV5A 2VMFA 4M93B 1CFTB 3LKOA 1CFQA 5DQDH 1KTDB 1SYVA 4OLYH 5B39B 2HG5A 1M7IA 2GK2A 1TNMA 3QUZB 3VH8A 1LP9B 1JJUA 1TVDA 2Q1EA 5SWZE 1SEBB 3QDMA 2IANA 4P3CL 1EEQA 3DUUB 3D25A 4Y19B 5ICYB 4AEIL 5DUPH 1JGEB 1NANI 4JKWA 4A2LA 2WK2A 5B3JF 3QZWG 3M17B 3X11B 4FRWA 4XBPA 1DBAH 2C7UA 1AR1C 4AH2B 4MVBD 5EDXA 3G5XA 1CL7L 4LCUA 5IROC 3L3OB 1BIIB 3VXUE 3E3QA 2QEJA 3HPJB 4GAGL 1ZKAA 5I1JL 4K2UH 2XG5A 3AXLA 3LRSB 1GH7A 2OI9C 1KN4H 4KY1L 5BS0D 4XPAL 5BCAA 3T4AA 1G7QA 3VXME 1JWSA 2Q7NA 2V2WB 1NFDA 2B7DT 4EVNA 1K5NB 4MD5A 3O3DA 5DJZA 1YQ2A 4JFFD 1P4IL 1QBLL 4LPUA 2GAZB 5BZDA 1LILA 1RZKH 3QH3B 5ADOH 2BNUB 3QHZL 2HYMA 3OAZH 4HGMA 1AI1L 3RPKA 4EI5A 1NDMB 3DXAB 3G04B 3DRTB 1HWHB 3OHXA 2A73A 1IQDB 5F7MC 5CEYA 1TETL 2HWZL 3BP5A 4JO3L 3BP7A 2ATKB 2Y23A 3NTCL 5DRZB 3PL6D 3MRMB 3Q3GB 4V1DD 1D3CA 1OAYL 3BW9A 4PRPD 3VE0A 1S7RA 2PR4L 4GRWB 3RX8A 1RZ8B 1CYGA 4JHWL 1OL0A 3CSPA 3GJFA 3FQRB 4KK9C 3GSRB 2LE9A 5F1NA 1YPZF 2XICA 4POZC 4RDQF 2NXZD 1SBBA 2P5WB 2ZSWB 5J12B 5T3ZL 5ISZB 4Y4FC 4YE4L 1AKJD 5KSUA 2DYPD 4OCNC 2VR9A 1CFBA 4PLNC 1UACH 3RTQC 5JXEC 5IP4A 1AGEA 1ZSDA 2GJ6D 3RZCD 2EE6A 4QCIA 4U1LA 5EBGA 4FNLH 4HV8B 1BQHB 4OTXH 1I7TB 3WFBH 2BOCB 5DR5H 5TDPA 2ZCKH 4Q9RL 1A4JA 3T04D 1AIFB 1R3IH 1LHZA 4OT1L 1DFBH 1TTFA 4Q0XH 1FZJA 2W38A 2AJYL 1F4XH 3FFDA 4RRPG 4WFHE 3PDOA 2NY3C 1RZ7L 1NKOA 4MLIA 3QQ4B 2OI9A 4LCIL 4NKMA 1HQ4B 4UB0L 1A7QL 2NQCA 3OAYH 5LBSH 5IEHB 1MWAL 5C9JA 1SEBA 4MJIA 4QXUH 1VPOH 3T0BA 5KS9A 3K4DA 1QTYT 3IFPB 1XIWD 4HH8A 1UVQA 3VGBA 1EEYB 4LSRH 4RA3A 3FHAA 2X89A 3EO0B 4LAQL 4NUGH 2OR7A 3QUZD 3MJ7A 4UIMB 2O93L 4TVSa 4EI6B 3DV6A 3U2SB 3CUPA 1RZIA 3EYUL 4KQ3H 3THMH 3VFNA 5I8OL 3F12B 4ZTPH 3V7AE 1NDMA 3DXAA 4PLKD 4YHZH 5HDBE 5DTFA 1QSZA 3CXDH 2DI8A 1I85A 1AI1H 5I17B 3SKOA 2BOBA 2VN7A 2WAHA 3UTSB 4HKZB 4TVPH 4HIJB 2V5TA 5F7NC 3IAQA 1T7YA 1A8JH 5IHUH 3DO7A 1BAFL 4JFDE 1U8OB 2VITA 2Q86B 5CSZB 5C6PB 2K9UA 5C0RH 4Q2ZB 5L2KD 4KUCF 2J8UB 4BZ1L 3V5HA 4ODXA 5CWSA 3L7EA 1QQDB 3OKEA 4K9EL 3C5SB 5EOCJ 2R9HC 1RJYA 5DRWA 1I9RH 1AGDB 2F9BT 4LASL 2J8HA 3EYQC 1ZE3C 5EC1A 3RX7A 3S34L 1NCUA 3O3AA 1FNHA 3LSOB 3PWVB 3TZVB 1OLZA 4XGZB 5HHMD 3ARWA 3EBAA 2AV1B 3FN0H 3NMEA 5DK2B 3ZHKA 4AENA 4GG6F 1F8TL 2QHRL 2NLJB 1N6QL 4MLSA 4KHTH 3SGKA 4ODTL 5I1GH 2V7HB 1LP9A 4R4BA 2IEPA 4GRMB 4PJBE 3ROOA 2GITA 5EU5A 1CGXA 2DTMH 3PQYD 3K0WA 1VDGA 1Z3GL 4P2OA 2FYYA 3DVFA 3G5YB 1GXEA 1JN6B 1A21A 5E6ID 5C8JA 1KYOK 1NBYA 3OGCB 1NUNB 4NQCE 3OF6D 4XCCH 2MHAB 1TZHA 2PW1B 4UBDD 1HH9A 3I02B 3GHEL 3QT2A 3TZVC 1ZLWK 4XCFH 3IFOB 3L95B 4C83B 4X0KA 4UV7L 4DFIA 3ARGD 1LWRA 1NGXA 2HT4D 3WD5H 5DRNA 1T1XA 5HJ3B 2F53E 3KYOB 1WIOA 1CICC 2YUWA 4GW5B 4Z7WE 1QSFB 1UADC 4UIKL 4AL8L 2AV1A 2GEEA 4HMDA 4AENB 2YUVA 3G6JE 4K9EC 4PJ9B 3V0VB 1DDHA 4LHUB 3LQAH 1B3JA 4XC1H 3O3UN 5HHQB 3B9VA 3C60A 5C0AA 3GSNA 1MCOL 1EVTC 1IEAA 4N1CA 1OSZB 4KJWC 1YDPA 1SM3H 2DKSA 4JM2D 2NR6D 2JTDA 1IM9A 1QFWH 2R1XB 4XAKD 1EEZA 2H45A 3KPSE 2AGJL 3CK0L 5JPNB 3ULVF 2XZAH 1UG9A 1UZ6E 1R3HA 5EA0L 3HC4L 2X41A 3NFPA 1EX0A 1MHEB 1UFUA 3CSYB 3I6GB 4IRJC 3LHPH 2WBWB 3TBTA 4P23B 3QBTB 3QUYC 1VERA 1PG7X 5E24E 5IFHL 1KIPB 2CJUL 2ADFH 2X9XA 4NQVA 2W9EL 2Z8RA 4YGAB 4S11A 3BPLB 5ID1B 2NW2B 2VYRE 1QA9B 1JZ6A 1QRNE 3HC0B 4RFOL 3N1PC 3QJHB 3MBEB 1GL4B 1OTUD 3KPMB 3VRJB 4PJ7E 1ND0A 2RHEA 2IFFL 5SWQA 1T2XA 4JEGB 2NY6C 1LK2A 2R56H 1U8NB 2PO6A 1BVKB 2PUQT 2VABA 3IFLH 5HYJD 2FB4L 4C57C 2XN9A 2VXUL 3GZKA 3S9DB 4JREB 4MJIE 5GGQH 1AR1D 3SCMA 4Y4HA 5I6XB 4WUKL 3O41B 4MB3A 4U2YA 2Y5TB 4XNXL 2DIJA 1HOCA 3ILPA 4YBLB 4K7PL 3UAJD 2UWEF 4OF6A 4PV9A 1WWAX 2NZ9D 1GGYA 2BMKB 2FEDC 1IAIM 2DBLL 3VG9B 5C0AE 1KIRA 2IAMC 2R15A 2ESVE 5L6YH 5GRUL 4XP9H 5HHOA 5GJTH 3S4SA 5ETUA 2LU7A 1CWVA 1ZXQA 4ZFFA 1ADQH 1CDJA 1YN6A 3BIBX 3HNSL 2AKRB 1RIUH 4PJEA 4HWZB 5C6WH 4NM4H 4PR5A 3IS0X 5D5MA 4HIIA 1HHKA 3TJEH 5DQDL 2BHZA 3L9RB 1VEMA 5I1HL 3QRGH 4PJAE 1KIUA 4LMQI 4OCWL 4WI7A 5DSCB 4XH2B 1WISA 5BS0B 5D70H 3H2WA 2C1PA 4I0PA 3EDKA 1G9NL 3BDYL 1IGJA 3FOMB 1R3LB 5D1XC 5AD0B 4WUUB 1A64A 2J6EL 4YX2L 1KTDA 1O7SA 1SYVB 2VR4A 43C9A 1NGXB 1MSPA 2BVQA 3M1BB 2XTLA 4ZS6D 3ZE2E 4P57B 5KVGL 3ZDYE 3JWDH 2P8MA 3BJLA 4R0LA 4K2UL 3S35L 3TV3H 2YHGA 5F97E 2EDTA 3TT3H 2HP4A 1N5YL 3MROB 5DLMH 3OGOE 4N90D 4N5UA 4DW2H 3QFJE 2UVEA 4GRLA 1ORSA 4ZAKB 3P40A 1J1PL 1MCWM 2P5WE 5L2JA 3FCTA 4OZ4B 3SKMB 1FDLH 2NMSA 1QVOA 5DJCA 2B5IB 4TQEH 1F3RB 2H6PA 5HBBA 4N8VB 4U1MA 3S5LB 1TITA 1BFOB 4WENB 3OJMB 5GJTL 4P2QE 4YHML 1AY1L 1TZIA 1PKOA 1QG3A 2P44B 4U6TA 5GGTH 3MYJA 4KDTC 2QADC 1S5HB 4WFED 1FVCB 1RFDH 4JFYA 4Y5VA 4OBRA 5KZCB 3HB3D 1K8IA 5AWNH 2YEZA 3PWPD 2HTLD 1FJ1A 1P4BL 3GHEH 1A3QA 3G6JA 5LAXB 2VXSL 3DNKA 4APQA 5E6IA 3MRPA 4FQCL 4X9HA 4UDTA 1AD9A 4HIJA 4F2MA 3D48R 3QUZC 5F7KC 3T1WA 3IXTA 4HUVB 3MV9E 2D0FA 2I27N 3WNPA 2MFNA 1G7HB 4XPHL 2PCPB 2PETA 3K8MA 3RP1A 4K7PX 5F96H 1A7OL 3U6RB 3L5WA 2ZUSA 3MR9B 1N6UA 1XFPA 4G8FA 2J8UE 1ADQL 4TULL 5JQHC 2X70A 3AS3A 4G6FD 2AK1H 5LQBL 5IBUG 2E7LC 4I0PC 4N0UB 1JHKL 5CJXA 4XP6L 2P48B 3B3IA 1LDPL 5DT1L 1G7LB 1ODAA 3SGJC 3HKFA 3QIWC 4AM0A 3L7EB 1RJLB 5D7KD 2D7OA 3QXUA 3OF6A 4OZGF 2VWEE 4K3DH 4GRWH 4O4YL 4L4JA 4UT7H 2GFBA 1NUDA 1FGVH 3PDOB 3S35X 3OR7B 3VXOB 2P8LB 4I18C 2BVOA 4H1LH 3NAAL 4J3OC 3CCHB 1S9YB 3FL7A 4XNQA 5FHAH 4OZGE 5DA0B 3WJJA 5GRJH 3WFDL 4KTEL 4JFOA 4K8RC 4XVJH 4F7CA 1Z9SA 4DW2L 4RWHA 5I2IB 1UWXH 2ZUQB 4WUUD 2P5EB 2VABB 2OR9L 1FNEB 2VDRH 35C8H 4WEBL 4OV5B 3HTLX 4ONOA 5MEND 4YHKL 1IC7H 3AREA 2FD6L 5MENE 5EU4A 4DCQA 4YHNA 3DX7A 4DKAA 5A43C 2DAVA 2GIYA 3CD4A 4JN2B 4NRYA 5E0QA 5KAQF 5IHUL 3ZTNH 4MXQC 4J12A 3PV7A 5HYJA 5D1ZA 4K3EH 4Z7UE 1IAMA 2IQ9L 4MHHI 3R06B 4HS8H 3BEWB 4A6YH 4IRSA 5DHVH 4M9PA 1JPFA 4Q7DA 3ZKMD 4X9FA 5CGTA 4JO4L 4ZUTA 3CFCL 1X5ZA 3MOBH 4HAGA 1ZVSB 5DUBB 3ZYIA 2FX9L 1F3DH 1FGVL 2MJWA 4JO3H 3JV4A 1HQRB 4M6OH 4PJHF 4X6CE 5JW5B 2X4RB 5ID0B 4Y4KB 2IH1A 3PXHA 4BSVB 2AI0H 5EOCH 1F4YH 3C60B 4Z7VA 5DEFA 1NAMB 4K8RL 4YDLC 3D5OF 3V6ZB 4FFYH 4OCYH 1AQDB 2Z92B 1QFHA 4P3DA 2QTEA 4X7TB 1G7QB 3GSRA 1W0YT 3ARRA 3PXJA 1J5OL 3I50L 4PGZA 3QDGE 1J05A 4WO4A 2AP2A 4CW1A 4TUJA 3DXAE 5EPMA 1I7UB 1MH5A 4HF5L 3EJZD 2ITDA 5IROA 1PYWB 2VLLB 2RR3A 2OXGA 3IU4H 5IK3B 2EEAA 4WIQA 3RPIB 2HT3D 1AXSB 5TQ2H 4P23D 4LDLB 3O4LA 4NQVB 3HAEB 3OTTA 4X9BA 2Q20A 1KEMH 3L5HA 3VI3F 5DQJA 4JJ5A 2RCSL 1II4E 3BP6A 4P9ML 5FOJA 1V7NL 2XZCL 3O6LH 5CINH 3WJLC 1E28B 1EIBA 3OR7A 2QR0A 2YPLA 1EERB 1D5BA 4U3XA 3RY6A 4PRHB 3KS0J 5EU6E 3RL2B 2FBOJ 4OGYH 4JPVL 3WHXB 5C6TL 2NY3D 1RURH 5IMOB 3STBA 3N1QC 5SWSE 3H9SD 1DQJA 4BZ1H 5H94B 3GKWL 4O02L 5KTEL 3RDTB 3BZ4A 3VRLF 5IB5B 2PYEB 4MA1C 2IBBA 2YRZA 4JPWL 1LO5B 2YC1A 4N90E 4PJ5B 1G7PB 4U31A 3O81A 5E8PA 4NZDA 4LPVA 1MHPH 5TGBA 1WF5A 4JDZA 2DM2A 2BHUA 3L5XL 5AUMB 2OQJB 3T4YB 2EEDA 4YUEL 4LLYB 3ESVF 1J10A 3UTTB 4FZEL 4AG4L 4QOKD 1YUHA 3H7BA 2BOBB 4M5YL 4OCXH 3T3PE 4O2FB 5FHBL 5DTFB 5IESL 2F5AL 3F7VB 4ZXBC 5J3HC 3D9AL 4OD1H 4QHNA 3RGVC 1HDMA 4LKXB 4DVRL 1GIGH 3QIUB 4QY8B 3WIHA 4YK4B 2XKNA 4GAYA 5GGQL 2GUOA 4CDGC 5ESVB 1KTRL 2OTPA 43C9B 5B38G 1T6VN 4HH9A 1JWUB 5DUPL 2V7HA 3N06B 4R4BB 1W0VA 3JV6B 1OF2A 4OZHE 4XCNA 5IVNA 3U46A 2JB6A 3LCYA 4NNXB 2PN5A 3D69B 2LVEA 1BFTA 4KHTL 3RUGF 2R0WH 3D3VD 2J88H 2VDQL 1ED3B 2PYEA 5JHLH 3GSQA 4Y2DB 4XBPB 4JFEB 5D2LA 5A2LH 4LQFH 5C0EB 4JFFA 2V6HA 2J8UA 3UTSD 3ZT5A 1I7RB 3G5VA 3NFSL 2W60A 3MRGB 4LHJB 3P9MA 3KNBB 3FAWA 1UB6A 4O2CB 5DF0A 1G9NH 2E6JA 3HUJE 4NBYB 3JWNC 4U6XB 3SJVE 3WO3B 2FJGA 1NGYA 4ZO8A 1CXFA 3L3GA 4XNMA 1R3LA 4ELMB 5MI0C 4G43A 1U95A 2KQMA 1FLRL 4RNRB 3UAJC 3QSKB 1INQB 2ICWB 3QEQD 3DX8B 4XRCB 4O2EA 3MRLA 4X6EA 5KSAB 1S9WA 3TV3L 4YJZL 1GC1H 4EQ2A 4WHTA 3DROB 1I1YA 1UA6H 3HE6B 3QIBC 5AYUL 3IFPA 5F9OL 4WHTB 2QQNL 3PNWB 1MI5E 2XA8L 3BDXA 3VGAB 1YY9D 2WIIA 3CXHJ 4WU5A 1N59B 3TO2B 5IEHA 1JV5B 1IQDA 1FL3A 3QG7L 5GS1B 4X8JA 2F53B 3HAEH 4LOUD 4CJ0A 3MRRA 2VO5A 2Z93A 3MV7A 4KQ4H 5MENA 1DVFC 4N0UE 3G6DL 5D7SH 1JTOA 2RJMA 4LLAA 3RWGA 5DUMH 1QFWM 1HHJB 2BSRA 3EJJX 4YR6B 5IMOA 1KB5L 3WN5B 2NNAA 4U1LB 4YHZL 1QFUL 1UM4L 4FFWC 4XC1L 3RVVC 1U8NA 3RWIB 3TIDA 1FRGL 1OM3H 1RUMH 1W8OA 3IRZA 3Q6GL 2GCYB 3VRJA 2ESVD 2UUDK 1G0YR 4KRPD 4JJ5B 4EQ3A 1BFVH 1ZWIA 2EIZB 1DBML 1T0PB 5A3IC 3RA7L 5ICZA 5DMGC 3TO2A 1JF1A 5SWSA 2ZJSL 4HZAA 2Z8WC 2WBJC 2Z35A 1RULH 1PG7H 2XPGA 4HFUH 4QWWD 4N5EA 2OSLA 4P23A 3IDUA 2OX5A 3C60C 3RVUD 3DURB 4OLVH 5FCSH 3ARBD 4X0KB 4MJID 1W0WB 4PGEB 4PGDB 3MLVH 1PAMA 1JHKH 1NJ9A 4UQ3B 3RWFB 3VXSA 3IJYB 4I2XB 3OXSA 5ENWB 3K4AA 2VLJD 3IVKB 3TBWB 2AERT 1ZHLA 3C08L 2E7LA 4DTGL 4KKBD 1SY6H 2O5ZL 4ESKA 1H3WM 4HKBB 4GW1B 1S7QB 4X4YA 3U0PA 1HKLH 4DZ8B 3U83A 5JW4M 3B2UC 4I1NB 3NZ8A 3BIAX 4QRRB 3AUVA 4D0CA 3IDMB 1CGSH 4QTIH 2GW5A 5T3ZE 3I3BA 3VRLE 3OL2A 4Z95L 5JXAH 2HTKD 4EKXA 1MQ8A 2NTSP 1WUNT 3FQNA 1IM9B 1M1SA 1H8SA 2J8OA 3GMMA 5CBAA 3K46A 4LVNB 5HGDB 5F9WC 2L4OA 1NGWA 3KYMB 5FHBH 1UGNA 2VDRL 5C0AB 4E5XA 3ARGC 5I8KL 5EZLA 1IFHL 5J4MA 3HRPA 4J4PD 3UPRB 2I60L 2NYYC 3QXAA 1U8KA 1J1OL 1NFIA 1PKQA 4Y19A 5ICYA 1MJUL 4KRNA 5JDJA 1UH2A 1WQVT 2YA0A 4G59A 1NBYB 1WWWX 3O6KL 1T7XA 3BQUC 1MCWW 1OB1B 1FZOA 4YHIA 3V6OE 2J5LB 4QHUA 5EU4B 1GAFL 3ARBC 1IILE 2VDML 1EO8L 2FX8L 5IM7B 1FZOB 1ZAGA 4K7FA 4M8VA 1KF9B 2A9MH 5FK9B 4JZOB 5DA4A 5EO1B 4Q6YA 1FPTL 3MREB 3C87A 1FGNL 3MV11 5LKNA 4XVUC 4XWOC 1CZ8H 5IR1B 3A0OA 4KPHH 1HK6A 4QHNB 3NIDF 2DM3A 4PJ7F 3N1MC 5DJ8B 3CX5K 3KPLA 3OJ2C 4URTB 1HYSD 3JTSB 5CP7A 3LEYL 2IADA 3ULUC 1I1AB 4JLRA 4ZD3H 2H2SC 4Q6IB 3ALWA 1I7UA 4JFDB 4M6OL 5JQ6H 3LKNA 3CZJA 2VQ1A 2P8LA 4NWUH 4JFXB 4NPYA 2GI7A 3IF1B 2GY7B 4MXWH 4MQXC 2NLJA 3ARGA 2MWCA 3SDCC 4PRIE 3QO0B 2DQJL 3FRPA 5HHVH 4NFCA 1R5IB 2B4CL 4LLQB 2BVTA 4NRZA 1U8LA 2E8YA 3GNML 1ZWIB 3FQWB 4JG0H 2M8XA 5HDLA 1FDLL 4Z7VB 5C0FA 4CL7A 4DUXA 3R1GH 3DTXA 3W81A 2IBGA 4LSUL 3CJJA 5J13C 4HKBA 3UTQA 5IUSA 2HN7A 4JHBA 3FTGA 1AP2A 1GOHA 4FZ8L 2NYYD 5T33H 3WXWL 4PD4K 1Z9LA 4WO4C 3D39E 3B43A 4HEPG 4KRPC 4JZOA 4XXDA 2NXYC 3BZEA 3ULVH 2C3VA 4NQCB 3AM8C 2PYED 4LDOB 2ATPA 3V5DA 3TWCH 4KGLA 5L2KE 5MEOA 1S7QA 4FOMA 2Z0BA 3FT2A 1FGNH 3V6BR 1LP9E 5SWZB 1A9BA 2EKSB 1UYWL 3QQ9C 3FQUA 4ODUA 3BD4A 3IVKA 2E7LE 3DHJA 3WHE0 2G5BA 2DKMA 4RX4D 2XY1A 2F74B 1V3KA 1Q72H 2PO6D 2AXFA 1MCLA 4R4NC 1EGJA 5BMFL 3KHOA 3VXTA 2A74B 3E2HA 1CGVA 3CFEB 3SJVA 4PUBH 5A40E 4RQQA 3FMGL 2EZ0D 1S5IH 4W70A 2FO4A 4LPTA 3DX8A 3EJZC 3BP5B 1Y18B 5JXEA 4Y5YA 1MREH 4NN5B 4MQXD 1JK8A 3QQ4A 4OGXL 4L5FL 3W9DA 5H8DA 4LSSH 3WIFB 5HDQL 4GH7B 2Y07L 4KROC 3MLYL 3TA3C 2FD6H 4G5ZL 3KPSB 2FLBT 2JKXA 2ZSWA 3QDJD 3QUXB 1JFQL 4ZS6C 4M5YH 1CL7I 1J8HB 1T80A 5DO2C 1FNFA 2RBLA 3CVHL 5CJOL 4ACPA 1X4ZA 1FNAA 4PB0L 4Y1AB 2N7AA 3ES6B 3ARFB 3DWTA 4GFTB 4X5XA 1FH5H 1F3JB 2IG2L 3DX9A 1LEKB 4G9FE 3FONA 4QHMA 4J3TA 4HJ0C 3EDFA 4LCUB 3PV6B 3GMNB 5B8CA 4JZJA 1C5CH 3FOMA 4X5LA 1BOGB 2V2TA 3V4PH 2FEEI 3HNTL 3U0TB 1F6AA 2YUZA 2R2BB 3GIZL 4DGYH 2A83B 1FFRA 2WIIB 1DL7H 5E00B 1NDGA 3RTQB 3C6SA 2CDFA 1M7IB 5ILTL 1T6WA 5ISZE 1RFDL 5D7LE 4NC1C 2B4CC 1R5WB 3O6FB 4U1HA 5IT2H 1GGBL 4HWZA 2G9HB 5E6YA 3E6FA 4P4KA 2A6KB 4BA8A 5JHLL 1IEHA 4LOUC 1X5HA 2H26A 3H8NA 1CF8H 1U8MA 2V9RA 4RFEB 5EBWA 1A14H 2WUBL 3UJIL 3GO1L 1QD0A 3HE7B 3PL6C 4V1DE 2EC9U 4G8EA 5DJ0B 1PZUB 5A3ID 1KBGL 1A7PH 5IBTH 1MCJA 5DURB 4KI5F 3GSOA 3NCBB 1EMTH 5JORA 1A7OH 3D85D 4I3SL 4U6VH 1GCFA 3VXUA 3DPBA 1MF2H 2OQJA 3T4YA 1UM6L 2XWJA 3KPOA 5DMYA 3SQOH 5BQ7B 2ZCHL 4HG4J 4IIQA 1MHCB 5FDWA 2WIMA 1IGTA 3E8UH 3NZHH 4NJAL 4HWUA 5DDHB 3S8WA 1KNOA 3O6MH 3JZ7A 3A6OA 3WCYA 2OJEA 4EIZC 2HMID 2WWMC 1IBGH 3QHFL 3WFHA 1BF8A 1N6VA 1AJ7L 3ORJA 5DT1H 5JR1H 1X7QA 4CGTA 1P2CA 1D6EB 5INDB 3HS0B 2WUCL 3RAJH 4X6EB 5BS0E 3B9KD 5KSAA 1Z5LA 2CXGA 5E08L 5HHNA 4ERSH 1IAKA 3VWJB 1JMZA 2DLHA 1RZJL 1I3RB 1MQKL 3GIZH 4KDTA 1FC1A 4GMSH 1D5BB 4JCMA 1J1XL 4FQIH 2DLIA 4HH9B 4X9IA 4RWYL 3KPNB 2ATPB 4OTXL 4P46C 4HF5H 1R5WA 3O6FA 3UTSE 3DYMA 4APQD 3QQ9D 4WV1B 2RFXB 3GSXA 5GS2D 1OOAA 2AV7A 4FN0A 5E2WL 5DI8B 2VLKE 4JHZA 3H3PH 3KWWB 4PJCF 4YWGH 1QR4A 3C5ZD 1GSMA 3UTZA 1G7MB 5IV2B 2DQDH 5ESQA 2V2XA 2R1WA 4H8WC 5D2LB 2DQUH 5IFJA 4R2GB 4HD9A 2J6EA 5FKAA 3DRQA 4LU5L 1K4DA 4GT7A 3V5KA 2FECL 3LKQA 3F7RA 3QAZB 1BD2A 4ZFFB 3ZHDA 3HA0A 4O00A 1P7QB 4OGYL 4LKCB 1VENA 3FO2B 2OTUB 5EUKB 3GRWA 3OKDB 2VSCA 3CH8A 2B39A 2VLJB 2WWKT 4F57L 4KI5C 5DFVC 2FEEL 4IJ3B 4TSBL 4TPRL 1BLNA 1ACYL 1UXSB 4EOWH 3QB7C 4JRYE 4PRDA 4BSVA 1CGYA 3GI9L 4GAYB 4LLUB 1NMCC 3CFCH 5INCB 5EU3A 4Y4FD 4M7ZB 3WMSA 4KUZL 3ABZA 4YEFA 2DWDB 5F9AC 2AJZB 1IGFH 5GGSY 1ZLWH 4QRPB 3ULSA 4U1JB 4QHUB 4OKDA 3HLAA 4JFZL 2XPGB 2NZ9C 2VXVL 2KUTA 2HT2C 4OF7A 1EBAA 1HEZA 2IPKB 5DJXB 4KKAD 3CFIC 3HRZB 3MRQB 4FP8H 4KKNA 2W1NA 3BFOA 1W72B 2FSEB 4M6MH 1U93A 1EFXD 4PJ5A 5KS9E 1JP5A 2I9LB 4LLWB 1XCTB 4N68A 4Q0XL 1JHLH 1N4XH 4MA3B 2V7NB 1BJMA 1L7TH 1JGLL 1FFQA 3MOBL 3O8XC 4OFIA 3KGRA 1LEKA 3KPRB 4NHUB 1H3XA 3IFNL 1RU9L 1S8DA 2XWBA 2CH8A 2X42A 1FH5L 4P4RB 4JQXC 4N0FB 4F9PC 4P23C 1F3DJ 1VADB 3RVWC 5K59E 2IAMB 2B1HL 3MLPA 1SBSL 2DYPA 4XCFL 2CDGB 4EDXB 3VU2A 3NCJL 4Z7VE 4RGMC 3OMZA 5ID0A 4GG6E 5D6DA 4IM8A 2XACC 2CD0A 2DJ4A 5M7QA 4Y4HC 3RU8H 5AAWA 4ZFOB 3NCMA 5ENWA 1BOYA 4JG1L 5FA3B 3DXAD 5E4EC 3ZKND 5C71A 1UKTA 2L7UA 1T1WA 4Z0BH 1B6UA 2JJVA 4LSVL 4OQ1A 4WTZG 4TVPL 3KYKH 1MFAL 4XP4L 1DUZB 3FRUA 2NR6C 4N0UA 5TQ2L 5JMOC 4U1GB 1OAKH 1FZMA 4QHKI 5C08B 3IDGA 4NM4L 2PW2A 2ID5A 5I1LB 1RUPH 2CKBB 1KB5A 5FCUL 3VD7A 4X7TA 4TSBH 1I8IA 4M1CC 3NIFE 1ZHBB 3GB7A 5J7CC 2B1AL 5EC2A 1MCIA 1V3LA 2BNUA 4GKNB 3CCHA 1U3HC 3TBTB 5C0BE 5JW3L 4IDJH 2LFGA 2D2OA 1TXKA 3K81A 3ME0A 2X89D 3WLWD 3Q1SL 4Z77A 1HQRA 3H9SA 4JR9H 4P9HH 4ZYKA 3GI8L 3CX5J 3QJFB 5CZKA 2BSED 1IGFL 1VFMA 1OTUC 3IU3B 2RGSA 3BN9C 4XNQB 3LKQB 5T1LA 1UXSA 4LGSB 1ED3A 1MCOH 5EFIB 3RNQB 4G6JH 1NFDF 3KDMB 3ULVE 1PSKH 1OAQL 2JB6B 4U49A 1RHHB 5IW3A 4PGCA 3E3QE 4HDIA 3TYGH 1JUFB 1A7RL 2BDNL 4Y1AE 1XGTA 3D3VB 2WINB 3IDMA 1P7KB 4AM0B 1AFVH 1FSKB 1CE1H 1U2HA 3NZ8B 1NMAH 2X4TB 1BGXL 4RRPA 4DKEH 1LO0H 4MCYB 4RGOH 5E9DD 4XPTH 4GW1A 3RGHA 3DV4B 3RA7H 4MHHG 5E99L 4L4VD 1VACA 2A73B 3F7VA 5JTWA 1EJ6A 4JZNB 4KJWD 4OZHA 3WXVL 1CGTA 1P2CB 3VFSA 5E1AA 3X3GH 1A6TB 2ZUTA 3GMOA 1L7IH 1QR1B 4XAWH 1B0RB 4U7MA 4NZUH 5A16B 1G7JA 1KNOB 1OARL 4MJ5A 1T66C 1NFIB 1PKQB 3C08H 4P2QB 1QSEA 4EOWL 3S5LA 5IQ9B 3RBSA 2VXTL 3HS0A 5TF1L 1K8DA 3LN4A 5D4QA 4S2SA 3L3OA 4NCC1 4LLMB 4ZAKA 5IFHH 2OJEB 2EXYD 4Z5RA 1U8IA 2Y5EA 2X1PA 3OG4B 1FVDA 4N1HB 1G7MA 3HMWH 1LD9A 3WSQH 2KH2B 2NY5H 3WNOA 1NEZA 3UTTE 2HA1A 1DTUA 3X14A 5DC9B 3V6OC 3ECBA 1ZSDB 5D7JB 2DL9A 1CE1L 5C0AD 5JA9A 3SKMA 4XNZC 5D71H 4LIQL 4M93C 1DQLL 3VFSB 5I75C 3BP6B 2FHBA 3C6SB 3NPSC 1JIBA 3VFOB 3MLXL 3RZWA 3KLSA 2YD7A 4PJFB 3L6FA 4I8DA 2E7MA 4RBPH 1BFSA 5E2TL 3OXSB 3N50A 2V2TB 1YYMH 3UDWC 1XZ0B 5ALBH 4HKJA 2DD8L 4PJEE 3T2QA 1IT9L 1PLGH 5DFWH 3ESUF 5J0BA 4X7FC 1KC5H 3RY4A 1WGOA 1CFVH 4P4KC 1GGCH 2R4SL 5D7IF 5AD0A 4HWEH 1QA9A 2Q6WA 3QG7H 5GS0D 3P4OB 3OZ9L 3JWDL 2XRAH 4U0QB 2DQFB 2NXYB 2F19L 1P4LA 1WCBA 2KDGA 4FZ8H 1PX4A 3LEYH 5E8PB 3VXUB 1FNSH 3B5HA 4DKEL 3QA3B 3VGGA 5FYLL 3GIVB 4U6XA 4TSCH 4UOW1 5E94A 3I75A 4P0DA 3SGDH 2DI7A 3WJLA 4YDVA 3LS5L 3MPCA 4KI5D 5ETUB 3DSFH 5CSBA 1NCBH 3WFEL 3VWKC 2EO9A 4X83A 4F7EA 4I0PD 4ODVL 5BXFA 3VXPB 1MFAH 2OL3H 3RI5F 3P4MB 4P9HC 2DWEB 5MENB 1X44A 3MGTB 4PBXA 5E4IA 3U30C 2OK0H 3OR6B 1DDHB 2DJUA 3P9WB 4LSPH 5A2JH 2UWEA 4Z7WA 4MQ7B 3O2DA 5K9QG 3I84A 5GS1A 3U46B 1KENH 4P48A 3MJ9H 1PG7L 3JSSA 2H3NB 2P8PB 4EBQH 1X5IA 2XG4A 2FO4B 1HIML 1D5IL 1OY3B 4Z7UB 3MJ6A 2HRLA 4K94H 5E1AB 5I19H 4JKPH 3NFPB 5ISZD 5DRZA 3V7MA 2FX7L 3HUJA 3HFML 4Y1AA 4PY8J 4XCYB 3QNZA 1OGAE 4UUJA 4HUMB 4YEEA 4TSCL 1AGCA 5T1LD 4G8GB 3BRFA 3GO1H 4M62L 1IKNC 1YPZB 1MELA 3EOTL 4G7YL 5JOPE 4L4VE 4YDKL 3HZVA 3CSYA 3I6GA 4YO0B 3OKKB 4FTVD 5IJVB 1HXYA 1E4XI 1MIEH 3MRJB 3QXDB 3UC0H 3H9YA 5BRZB 4DVBB 3RVTD 3LMJH 5I76B 4F7MB 4M7LH 1I9IL 2R29L 4MNHB 2ERJC 4RA0C 4ZD3L 4GRLD 3IRPX 4KAQL 5KANG 3TFKD 1YEJL 1NBQA 5DVMA 3BZ4B 2AJ3A 5HHME 1N2RA 4Y19D 1EBPA 1NCAH 1HILA 1U91B 4WHYH 2EICA 1MCNA 3LPFA 1FNLA 2AQ3A 5I1HH 1CICA 1DQQB 3RHWK 4G9FB 5F88A 3BUYA 2XN9E 4H25B 3U82B 3D25B 1IQWH 1UZ6F 4NQXA 3DX7B 1L7IL 2RFXA 3EO9H 3GSXB 3K1DA 4M7KL 1KCVL 4OLEA 4GMSL 4P99A 5E8EA 1CFQB 5DD1L 3DSFL 3WFEH 1OB1A 4YHIB 4HG4K 5JO5A 2ENSA 3IAPA 4UDTB 1XGQB 1QSVA 5CMAB 1XF2A 1VACB 5CD5D 1X5GA 1DL7L 5IK3A 1JZ3A 1MCKA 3QDHA 2XQBL 3GUTA 4R3SA 4P46A 2EDBA 2PTTA 3TGXA 4ONHA 3GHBL 3BGFB 1RVFH 3FKUS 3QAZC 4YDKH 4U0RB 3QUMA 2VAAA 4ONGH 1I8MB 4P59H 3FQWA 2CDEB 2AEQH 1E4XH 4HBCL 4NKMB 3BN9D 4Y2DC 3SDXB 5FB8B 4TNVF 5EOQL 2VH5L 3TO4C 1DCLA 5IBTL 4X80L 4ETYA 4H0IA 1NCDL 2CDGA 4EDXA 3LDBC 4R9HA 5KG9B 2X4RA 1T83C 3BGAA 1P4BH 5CWSB 5FM5O 1T04A 3ARPA 4H5SA 5ESQB 2XXMB 1CLZH 3NH7L 1D9KA 2CSPA 5DJ8A 4GBXC 4PJGF 1D5ZB 1C1EH 3QCUH 3BVNB 3IDNB 3ROLA 4HXAL 4YDLB 2NY4B 1YEEL 5CJQH 4YBLC 1YMMB 1G6RL 4JFHD 1AJ7H 3STLA 2NY1B 5JMRA 4MVBA 5DHXB 1ORQA 2UVFA 3QCVH 2APWA 3QFDB 1G84A 2XV6B 4DUWA 2I9LA 3O9WA 4LLWA 4P5KA 3VWJD 1KG0A 5I1JH 4YFLI 5FYLD 1W72A 2FSEA 5E8NB 1ZHLB 2P8PA 1KLUB 5ESAA 3O8XB 1Y0LB 2NY3B 4AIZA 5LQBH 2R4RL 1CLYH 2CLZA 4HIXL 3RVVD 4Z7OF 1EPFA 3SDAA 5JZ7C 5C07A 4RWYH 5L0QC 3F8UB 3JTTB 4JDTL 2VQTA 5TJWK 3RWDB 5GS2H 3ARED 3LV3A 4OUUA 1T7WA 1OP3H 4KI1A 4POUB 4X99A 2AEQL 2P43B 3FQNB 1DBJH 4OKVA 4AT6B 4HUWB 1GC1C 1I1RA 1BQUA 3AC0A 1R3JB 5FM8A 3PP4L 3SN6N 4MWFB 4X6CA 3GGWA 4PY7B 3P73B 3SGEH 32C2A 5I6XC 4NNPH 3V7AG 1EO5A 5KVEH 1DQMH 4NRXA 3VXQB 4BH7B 1V7ML 1SBSH 1CLZL 5HY9A 5FGRA 4ZUSB 2V2WA 3GBMH 5SX5K 4L1HA 5F3HB 3IDJB 3U1SH 4NNYA 3GBLA 4OAWB 4ONFL 3JWDC 3QEQE 1MEXH 1HHJA 2AXGA 2BSRB 4K3JL 4PV8B 2Z31A 4YIQB 3OKOA 5B3NA 3VXMD 2IBZX 1UVQB 1EMTL 4UAOC 1M6OA 3SO3C 3DGGA 1DQTA 5ISZA 4HKJB 5E70A 3TT1L 1IGJB 4NO5A 2F74A 4QT5B 5DHYA 5IMLB 4YXHL 1QRNB 5LGJB 3HMXA 2CLRB 3ZTNL 2GJZA 3O2VH 4OD1L 2GY5A 3FO1B 1KIPA 4P4KD 3SQBA 3EHBC 3RIFF 2HVKB 4ORGA 1YEGH 3QUXC 5GS0H 5HYSG 4Y5XC 2KL6A 1C16B 3NFSH 4MNQB 4NQEA 1HCFX 2IGFL 2VLKD 1CK0L 2AJYH 3C9NB 1A6AB 1A22B 1DBJL 4HK0A 3IJSA 4GUPB 2ADIA 4UTBH 1NCCL 1JNLL 1TNNA 1EEZB 3LS4L 2I5YL 1T4KB 1N64L 5F72S 1N8ZB 4R97B 1XF3B 3DX6A 3LD8C 5DD5L 1EDQA 4OF8A 1U8IB 2BC4A 1U36A 4Y4KC 4OIAA 1JHLL 5IJKA 2QSTA 5ITFB 4NHCH 3STZB 4LLMA 4EIGB 1J8HE 2O5ZH 3G5XB 4RISH 3RY5A 4AEHH 1VESA 1ZANH 1U6AL 1EZVX 1KPUB 2JE8A 5CGMA 2ZUUA 4FQJH 2D0GA 3HB3C 4WEUD 3RWJB 3BQUA 5IB3A 2CJUH 3OKDA 2VLRE 3PDGA 2XWJB 3KPOB 3VG0H 3WIHL 5D9SA 4I4WA 4PJIF 1MPAL 1BJ8A 1YEDA 1NLDL 4JY5L 4LU5H 1HI6A 2CIIB 3V5KB 4D0BB 5I73C 4HCRL 3NCJH 1T3FA 3RKPA 2CKNA 5GHWH 1WK0A 3ARDB 4R3SB 3UBXA 3BD5A 1T7ZA 4MVBC 1BGXH 1SJHB 5EUOB 1NH6A 2G5BB 4QOKE 1RZFH 5F7LB 4C4KT 5CEYB 1GVIA 1OP3K 3TJHA 1ZT4A 3WFCL 1MFCH 4G43B 5D8JH 5I8CB 5E8DL 4WWKC 3EFFA 3L1OH 1ACYH 2FJFB 3K3QA 1G7HA 4LNRB 3JUZA 5FF6A 3SKNB 2GK0A 4QRRE 2ZG1A 4N9GA 4HMCA 4HGKC 1R24B 4I3RL 4WW1B 3AU1B 3QEGL 4F2MB 4QTHB 3VDAA 2EH7L 2XKNB 1VCAA 1UWGH 4C56B 4E41B 1CICD 2YA2A 5K9OA 3TN0A 5DJ2A 5FM4A 3T4AB 4Z7QE 4X98B 4PGCB 3TLRA 5GZND 1I3RA 1EK3A 5CJXC 4PLOB 1P7QA 4ZS7L 4JFEA 3BN3B 3VH8G 1BIIA 5F70A 2EDWA 3H7BB 5ADPL 3K74B 5IFJB 4DFHA 2Y4SA 2GT9A 5F8QC 5T1DL 2ARJQ 3MRKA 1ZGLA 4OUOA 4BFBD 3JWOC 4QKXB 1XIWA 2IH3A 5IF0B 1EAJA 3VD5A 4XPFH 1W0VB 2IANB 1W8NA 2QADD 4LSDA 4N8VA 5F7FA 5TDNB 5GZOC 4M7ZC 4TUKL 1B0RA 5DQ9A 1IM9D 5FGBC 2X7LA 2HJLB 2HLAB 3P0VH 2VAAB 3MLUH 4BZ2H 1G9MC 1YNLL 1I8MA 3FB6B 2VAJA 4G6JL 2ARJB 3FB5B 2QLVB 4FQXC 4LLDB 3WDJA 3GB7B 4M7JH 1CLYL 1DQLH 3W9DB 2XT1B 1UWXK 5SX4H 3D2UD 2DQTH 3BT2L 5BRZD 4HK0B 5HHNB 4KQ4L 3GBNH 5E5MA 1S9VA 4FFZL 1YC8A 2P45B 1QFPA 2MPAL 4HC1L 1A3LH 2XNAB 5K9KA 4PJAF 5FECA 3BZFA 4YHPA 3DO3A 5IVZB 1VFBA 1MHCA 2HRPH 3P30L 4KFZC 4BQCA 3ZDZF 4RIRB 2AJSL 4OCWH 3QRFM 3AS0A 5HVHC 3BHBA 5I16B 3KDMA 3HR6A 2VLLA 3NPSB 4JY6A 3O0RH 1JTPA 1MHEA 1GAFH 3WKMH 2DICA 3GMMB 4XXCA 1HHGA 4HV8A 2A6JB 5D8JL 1ZVSA 5DUBA 3WBDA 3EZ8A 3WUWG 1NBZA 3WHXA 2F8OA 3QZWA 3S35H 3LS5H 5JLZB 1ZS8A 3S98A 4WI9A 3JBG7 1QRKA 3P9LB 1FZKB 3BGMA 5C0IB 3VFUB 3NCYP 4HJGA 1OD7A 4U1NA 1ZLUH 5A2KH 3EFFB 5JW5A 1KN2L 3KPRD 5LBSL 1Q9WA 4MNGE 3L3KB 3MRNA 4QGYA 4IRJB 2OK0L 3LIZH 1JK8B 3W5MA 3UJTH 5D72H 4M02A 1FFNB 4HJJH 3BPOC 2Q6WB 3IDGB 4YHMH 1GC1L 3FQTB 2X9YA 5FKPB 4MJ4A 5TE4L 1WIUA 3EO0A 4R96A 3BW9B 5J6HA 5GGSB 1YMME 1Q1JH 3VFMA 3PIQA 4JG0L 2DDQL 1BEYL 4XB7A 1JZ2A 3UZVB 1JPTH 3OAUL 3O3BB 4R97C 1N64H 4NP4L 5D7IB 5D9SB 4IDLA 4OAWA 1IGIL 1VEPA 4ZOEA 3ARFA 1FORH 2PW1A 1AHWC 1WFUA 2J2ZA 3PL6B 3HE7C 4OB5L 2JJTC 3SGDI 3VD3A 2A77L 3MREA 3MCLL 5TH2B 4C56E 4TN9A 5EBLA 4HUXA 1SMAA 4WY7L 2V17L 4MCZA 2DWEA 4JR9L 4P9HL 2WMPA 3MGOA 32C2B 3VXPA 4J23A 3X14B 1LO2H 3QDGD 1U8QA 4U1IA 4N8CH 3NOIA 5DZNA 1WT5C 4JFOB 4F7CB 2NTFA 1Z9OA 1MCRA 3L3IA 5HYQA 1T04B 4H5SB 5EZLB 3VGAC 4NQEB 2VXQL 3KJ6L 4Y5XB 2APTA 4BQ6A 4EDWH 2E3VA 2AQ1A 4S2SB 3G6AA 3ZDXE 4PJHB 2AJXH 1UXWB 1A1MB 1WJ3A 2FCBA 5H37H 4C58B 4K23L 2DN7A 3U7WH 5F7UA 4NZJA 4WWKB 2EDYA 2H9GA 2X40A 3WS3A 2W92A 4PTUB 5DGRA 3JWOL 3X3FL 4UU9A 5GRUH 5J11B 4PJDF 4GBXA 4E42A 1U8OA 2F5BL 3LD8B 5IMLA 4O4YH 2GTWA 3QWOA 1JPSH 4CUCA 4XCEA 3AMKA 3C2AH 2XN9D 3O4LE 5TQ0L 3QFDA 4PREB 3WYRA 2DQEH 5DVOA 5KW9L 1T1ZA 3SKOB 1CQYA 4Z7UF 3DI2B 3MLYH 4WI5A 3HMWL 4AIOA 4HBQA 5CCKH 1HH9B 3I02A 5LGHH 4WJ5B 2YN3A 4OQTA 5HI4D 1KTKE 3BDYH 3LEXA 1P7QD 4XNMB 4P2RE 3FB5A 4LLDA 1PFCA 4U1KB 4LL9A 3R1GL 1BLNB 1QBMH 2BVOB 5F9WB 3ULUF 5I1KL 3I6LD 4WI6A 3MYJB 2Z35B 1CE6B 4PY7A 4U33A 3QQNA 4OM1L 3ARDD 5T1MB 1EJOL 1JF1B 5SWSB 4X7DC 1R3JA 4UINH 3PWJB 4KDVA 2X1WL 1FV1A 4OQTL 3VWJC 3WS3B 2BNQA 4K71B 1E4XL 4G8IA 5LJYH 1I1FA 2HTKC 2ZCLL 5DJCB 5BW7A 3MLVL 3K2MC 2NY4C 3PGFL 2VDPH 3STZA 4I5BA 3EZJB 1QSED 3LN4B 1ORSB 5KSVB 4OFPA 3V52L 4G3YL 2V2XB 1UZ8A 1QP1A 1JGEA 3EYVA 2F19H 1OD9A 2KZ1B 1XF2B 1MJJB 4RX4A 1AY1H 4J4PC 5HHMB 3T2NH 2EE2A 4AK1A 4XPAH 4Y8AA 1AGEB 3AU1A 1M05B 1KULA 1ULVA 3HZVB 3A6BL 1XGRB 3A67L 3QIUD 3VRIA 1KEML 1H15B 5AZEH 1NGPL 1VEOA 1I9EA 1T21A 3Q5TA 4MNQD 1YEFL 3SDDB 3GI9H 5CBEB 1EAPB 1FC2D 5EUOE 4JCLA 3UPRA 4PFEA 1A1MA 3MUY1 4XWOD 3HNVH 4P57A 1K8IB 4Z7OE 1CFNB 3KR3L 3QI9A 4OCSH 3EFDH 4KI5E 4K94C 4QNPE 4ALAL 5J89A 3X13B 5F7YC 1TPXB 3OB0K 1QLEL 3DLQR 3HE7D 3LH2L 4OLWH 1CIDA 3V79C 1MVFA 1KB9K 3CU7A 4HX1A 5CJBA 2DMBA 4LCCC 3ES6A 1KIRB 1QYGH 4JDZB 5DD6B 1DLFH 3O11B 3MRJA 3QXDA 5DC4B 3NIGE 5C3LD 3CVIH 2J7LA 4MXQA 2GJ6A 3HZMB 2P49B 3SDXF 4JKMA 1DVFB 3ELAT 4KRLB 4PP2A 5HYJE 1C5CL 4IS6A 1GZPB 3IDXH 5D2NA 5BZDB 3GJFH 3TH4T 3QUXD 3N0PB 2X2YA 4NSKB 4FS0A 4LCCB 4P4RA 2EDFA 3HI6H 2HWZH 4PRHA 4ELME 4G42A 5TE6L 3CFBA 5DJYB 5KSBA 4ORGB 3MLZH 1F97A 5CGYC 4WGVB 5BS0A 1WAAE 4KTDH 1JNHB 2R1YA 2HFGL 4XCNB 2OL3A 3MFFB 4LVNC 4EZMA 4WY7H 4ELMF 5BOZG 5D93C 4OCMC 4JM2F 4GKSB 2ZZUT 4JPIB 4YC2B 1T1YB 4LSUH 1T0MA 5E2VL 4LFHD 2HKFL 2PO6C 2X10A 4QHMB 1YN6B 1IVLA 4WO4B 1R3HB 4MD0B 3S96A 3TNMB 5E2WH 3DBXB 4ZFOA 1DUYB 1BWWA 1X5JA 2ZUVA 3L3JB 4HIXH 4KK8C 3BP4A 3SKUD 2OCFD 4LARH 2Y36H 2DLEA 4ONFH 1EHXA 3BH8B 4KV5E 4PRPB 4WW2A 1H8OA 1IKFL 1AGCB 1WV7T 1HZHL 3G9VA 5D7JA 2C3HA 1WZKA 3BGMB 1B9ZA 2EC9T 3O3DB 4CVXB 3O9WC 3HCVA 2I9TA 4OIIH 5IF0A 2NZIA 3PP4H 2VXVH 5I74B 1F90H 5LXGL 2XWBB 2GSGA 3MUJA 3MO1A 4E0RB 4ALAH 4APQC 4FTVA 2XIDA 2FIKB 4YHOL 2A2QT 5C1MB 5GZNC 4Y89A 4P9MH 1R3KB 4PP1C 2J88L 2VDQH 4NQCD 1V7NH 5F9JA 4ZSOE 3MRCB 4WCYH 5IVXA 4MSWB 1WBZA 3LZFL 5D7IE 1INQA 2ICWA 2KBGA 4NOFA 4XRCA 2PTVA 5DWUH 4G8FB 3UMTA 4QRPD 4MJ5B 4KROD 3IFNH 1TETH 4JQVA 5LGKA 5L8KB 2HH0L 3DECA 5DD5H 1E4KA 2ZP0T 2QHRH 1I75A 4Y0GA 2PCPA 3EDJA 2FYYB 4H1LB 5C0BB 4JKKA 2C3VB 2W9DH 1XCQB 1S9VB 3P9MB 1S9XA 2OYPA 4WFFE 5GRZA 2ERJB 3MBXL 2QSVA 3BKYL 3GRWL 3HAEA 3K8LA 4H0GA 5C08E 4BK4A 5ANME 2FZ3A 3C5ZB 3QO1B 3SE3C 5I71B 1YEEH 5CJQL 3MTRA 1A2YA 4PG2C 4MX7B 1PYWA 4YFDB 3LEVH 1RUKH 3VDCA 4PRDB 4FZEH 1OTSC 4JFDD 3MRFA 5ALCH 2B0SH 1RUML 2ORBH 3T08A 2A6IA 2R0KL 4AEIH 2QQNH 4M5ZH 5K93A 1JF5A 5FDWB 3VFWA 2D4FA 2JELH 4AQOA 2H8PB 4NZUL 4R2GD 3PWVA 1EXUB 2F15A 3QDME 3NTCH 4YDJB 5J6GA 3O4OC 1JE6A 1Y6NR 2VC2H 5A16A 1N6QH 3PWPB 5MEPA 4EUPA 1JYWA 5IHZA 2LQRA 1VGKB 3LKPA 2VISA 1CTOA 3T77B 2QQQA 1Q9OB 1CD8A 1YEKL 1XF1A 7FABH 1AH1A 4S1QH 4OI7A 3MA9L 2A38A 1AD0A 4RMQA 1WWBX 3EUUA 3DOSA 5DZOA 4ZNEE 5L2KA 1A6UH 1IRAY 4X98A 1XGUB 4J3WA 5EUOF 1MCCA 1AGFA 1ZHNA 2EDKA 4RCAA 2ADGB 3EOYG 2NY5L 3MJ7B 1JZ8A 4K7FB 1ES0A 1U58A 1QLEH 2DI9A 1UKQA 1B4JH 1N7ML 4OIIL 5J8OA 3Q6GH 2HVKA 3SQOL 1IGYA 4K7PY 4NQXB 1RU9H 3H3PL 2VERN 3U7YH 1ZHBA 3C8KB 3P4NB 3FT4B 5HHMA 1RUPL 4KXZI 5EZIH 5I30L 4X6DF 1VFUA 5GJSH 1MEXL 1Q9LA 3VWJA 1OAQH 3L1OL 3CFJB 2IQ9H 5SX4I 4DUVA 2XYCA 1EO7A 1T3FB 3V9FA 3HZYA 2VNCA 3OKMA 1A4JB 2R0KH 1RZJH 4TNWK 4OLVL 2J4WH 4WW2C 1MCBA 4FQXD 4L29A 1PX3A 1WT5A 5FDYA 1JYVA 2Q3AA 1WZ1L 4JG1H 1MWAA 4CN1A 5T3XD 5GS0L 3FFCA 3BSZH 3NABL 5DEFB 2BY1A 1GHFL 3VFVA 5E94B 4HHAB 1QHPA 3SCMD 4DN4H 4X6BA 1A6ZB 4LHQB 1QACA 3REWB 5TQ0H 2Z93B 1ZLVH 1GZQB 3HE7A 3MFGB 4J3VA 1YMHA 3DSNA 1EO8H 2FX8H 4O51A 3WL9B 3O11A 1T4KA 1PSKL 2A9ML 3TYGL 3AROA 4W6YB 4NO5B 5ERWA 4M8QA 3QDJB 4BFEA 2AEWA 3JUYA 4LSQL 4F7PA 4ODHL 1T1ZB 1N7MH 2NXYD 1DLHA 1WITA 5E1HB 3QULA 3LQZB 3SDAB 3CPLB 3EYFA 3MMEA 5DMKA 3UX9B 5GGVL 4NWUL 4OGAD 3EJYD 4ZODA 1QBLH 3SDDA 2L7JA 4P3DB 2HT2D 3SPVA 1H0DB 4YXLH 1KTLA 3RUGE 5C09E 4ENEC 3PWNA 2FJGB 5CZXD 3I9GL 1A3LL 4HCRH 3WS6C 1YY9C 1IL1B 5FYKL 5DS8A 1B0GA 5CD3A 2IH1B 1MCSA 1FZKA 4W4OA 1FNEA 3MUHL 4H88H 1P5VA 1W72L 4AZ8A 4N0FA 2BDNH 4K55A 3EOAB 4OI9A 1P9MC 5D7JD 3MOQA 4YDVB 4X99B 1QLFA 3KPSA 4KKLC 4JPWH 1KJ3H 3SCMC 4B0MM 4IOFD 4JY6B 5AAMA 2VISB 2YZ1A 2GAZA 1Q0YL 4EDWL 4GG8B 4N1EA 5IW6B 1BWMA 2Y06H 1P6AB 3QEQB 4BKLA 3ZO0A 3ZT6A 4AIZB 4QLRA 4XBGB 1HSBB 4LHUD 2XRAL 3FN9A 1K6QL 2NY0C 4XX1G 1RJLA 4RAVA 3S88H 1NC4B 2Y6SC 3BQUD 3KPMA 4ONHB 3PGCA 1WZ1H 1OPGL 5KAQG 2HLFC 2J1KA 4BUGA 1G0DA 1PW3A 2B2XH 3MV7D 2CLZB 1AGFB 5D2NC 3ULUL 5D96C 4PJEF 1OSPH 3QFJD 2CXKA 3VGFA 3OKNB 2XFXA 4ZFZA 3WO4C 2Z91B 5E8EB 3TIEA 4M5ZL 1T5WB 1EGJH 5J11C 5D1QA 5JHDD 5I8KH 2GTWB 3PE9A 5AEAA 5SX5H 1HHIB 4DAGL 1NGQH 3MA7A 1YC7A 2VLMD 2WP3O 2BX5A 3OAZK 4PTUA 1Q0XH 5C0JB 1B88A 1ZK9A 3FTGB 3GSWA 5BO1H 2E5EA 1TTGA 5JHDB 4HS3B 4FQ2H 1BZ9B 4J3UA 2YRLA 4Y2DA 4QGTA 1K4DB 2XQBH 4ZAKC 4B7LA 3QXVA 2FGWH 2XQYK 4ZSOB 2NY7L 4ODSL 2ZCLH 2N7BA 2FIKA 1O5DT 4M3KB 4P2YA 1Q9LB 2VTFA 1XR9A 2X70B 1MJ8H 4NQEE 4OF0A 1BFOA 3MRHA 3MJ9A 4LCWE 3ARBA 2E9BA 3H9SB 1H3PH 4R8WL 4ODVH 4LPWA 1CE6A 3PWLA 4GQ9H 4XC3H 4NO2A 4NC2B 4X4XA 1ITBB 1YPZA 3LB6C 1FQ9C 5ESVA 1IZKA 3D39B 2F54A 4MDIA 1I1AA 3IFOA 3L95A 1MAJA 4JLRB 5B4MC 5GRVK 2DWDA 1AO7B 2XFXB 5I8CA 5CHNB 3RVTC 4ZQKA 1I3GH 5I1EH 1U8MB 1AXIB 4R0LB 4RFEA 5EBWB 4MXVE 2BP3A 4MAUL 5F88B 2XN9B 4XI5C 1QKZH 4L8BA 5IHBA 4M7LL 3REVA 5JIHA 5F9JB 3PWUA 3W39B 2D03H 4R96B 4BZYA 4IEFB 1G6RH 3HE6C 3QPXL 4JPIA 4WEBH 5JIIA 5JOEA 1BZ7A 4UOW0 4YDIH 4YDJA 1JWMB 1IKFH 4BUHA 4LVHC 4P2RB 4MXVF 5FUZL 1MRFL 1OT2A 3B5TA 1G0XA 2XWTB 3TBSB 3P0GB 3HCVB 5GS1C 3H9HA 2IFFH 2YD2A 2XY2A 4WDIA 1RMFH 5CEXA 4PR5B 1IQWL 5I1KH 2X4UA 3P2TA 3VI4F 4PRIA 3TIDB 1NGPH 5E7FA 2MQ3A 1TJIL 2YUXA 5CBAB 4GKZB 5C2BH 1S78C 4PJ8D 2EYSB 5E2UH 4HPYL 4ERSL 1MJ7L 5K33A 5LG1A 2A6KA 1KYOJ 3OQ3B 2QR0B 2YPLB 3SDXE 3T65A 4D9LL 3R06A 1UWEL 5MHSD 3C5JA 1PEWA 2GK0B 4Q97A 1IEAB 4QYOA 1S7UA 3EFDL 3U48A 3SE4A 1MCHA 3HI5H 3WIFA 3MRIA 4FQQB 5HI3D 1EVUA 4YHYB 3FOLA 4XTRD 1UEYA 1UM6H 4MAUH 3I3DA 3CVHB 4PDCE 2JJWA 3CSBA 4BFIB 2WM0A 1YYML 4ZOAA 4ZTOL 3IJYA 4F15C 2E7HA 4EUPH 1RZ8A 3T0EA 3DURA 1SM3L 5HD8C 1TIUA 4PS4H 3PWUB 3W39A 2CR6A 4TVPD 2Q8BL 1TDQA 3AS2A 5CIPB 3P4MA 3DMMD 3LQMA 3VFGH 5E5MB 2AJZA 4HWBA 4WI8A 2DBJA 1OP5K 3CH1B 2F53D 2LV4A 3IDJA 1EAPA 4NQTA 2VDKL 4HUUA 4PB0H 4OD3H 4K8RD 1A6WH 1AO7A 5TE7L 1INEL 2H1PH 1L9MA 3REWA 4FTVE 5KVGH 4HXAH 1UENA 3G5YA 2VDOL 5EOCL 5IIEA 4V1DB 1P4IH 3PWLB 5E56A 3FFCB 3GMLB 2CMRL 4HWBL 3VFPB 2VQUA 2BVEA 5BVJB 3MA9H 3JVGA 3RVWD 4NN7B 3O3AB 5BV7B 2OJZL 3EYOA 4JFPA 5FYJH 3QDJE 4OLZH 2VH5H 4ZSOA 3W0WA 2BCKA 5HPOA 2DS4A 1ZA3A 1Q94B 2CLVA 4TVPE 3X11A 4GAFB 3MRRB 2P5WA 3SPVB 4Q6IC 5FYJD 1NL0L 4DEPC 5L8LB 1FV1B 4JGJA 4WCYL 2W59A 5IHLB 1CF8L 1JWMA 3EYFB 1L0QA 5C0DA 1H9VA 5KJRH 4HIEA 1RVFL 3CFBB 1FO0H 1CDYA 3GDBA 3VRIB 1CFTA 2A0LC 4XNUH 3B9EA 4G6MH 2QJDA 4OZHB 2HJFA 4HPYH 2D7TH 5CUSH 5MHSE 3I2CL 2VZ3A 3N1FC 4APQB 3RNKB 1HDMB 4LKXA 2ZUYA 4JY4A 4D9LH 3GSVA 3QPQC 3OHXB 1WFNA 1Z5LB 1B0WA 3L3GB 1OCWL 4WRLA 3L7FB 4QRQB 4Z7QF 3Q48A 1NAKL 4FHBD 2O61B 4PREA 1PQZB 1FO0B 3LOWA 3PHOA 1ZMYA 5FB8A 1ZGLP 4LLQA 1E27B 4D8PB 5HYFA 4Y5YB 4L8CA 1U8KB 2VLRB 2OJZH 1CXLA 4L29B 5IW6A 3RDTC 1UZ8B 5GGUB 5HXMA 1FFPB 3ULUE 4HWNA 2FBJH 4H0HB 4NNPL 2O5YL 8FABA 3DYOA 1DQML 1RD6A 4RDQG 4K3DL 1S9KC 1YJDH 3OB8A 1YJDC 3TFKC 2X09A 1QPXA 4FABH 1MFDL 1SJEB 3GSWB 2NY5C 1X5XA 3PABA 4NNXA 3U79A 5IFAH 2GKIA 1EFQA 2BVPA 2VZOA 2BY3A 2FZ3B 4NJAH 1INEH 2H1PL 2WLYA 3RNKA 2Y6SD 3FO9B 3FT4A 5DFTA 1KJ2H 5GGVH 1X5YA 1RK0A 1C12B 3FN3A 5J1TC 4P5KB 3V5DB 5DD1H 2ICWI 3UTSA 3U9UA 1DBAL 1X5FA 3BIKB 3V6OA 4KVNL 5FM5M 1ZHKA 3U0PB 5EORH 4NHCL 1KUMA 4V2CB 1MAMH 3MJ8B 3TVMD 5E00A 1VFOA 1N3NA 1KT2A 4Q74A 4JN1H 5LCVH 4JY4B 5EULV 1F6AB 5MP6H 4IMLA 2P46B 3OXRB 4H88L 1RZJC 4HS6A 4OLZL 1F2XK 3QXWA 5EZOH 4F57H 4GXUN 3GJEA 4R2GC 3CDFA 4YPJA 3V0WH 5AWNL 5EIIA 3ZKXC 3MJGX 4ONGL 3QEHA 2F54E 1KXQE 4OBSA 4TUJB 2B5IC 3BUTA 4KMLB 4NWTH 5C9JB 4HZLA 3F62A 2HFGH 5FUCC 3ZE0E 3H42L 5F3HA 3WNNA 5HHPA 4E41E 3K8KA 2J4WL 2C5DC 3LPWA 3WL9A 4NN5C 3FZUC 1OTTD 1P53A 3MV8E 1U8HB 5T5NG 4OCRL 3RL1A 2XXCB 2B1AH 5EFIA 5IIEB 3JVGC 2EDQA 3RY6C 4LEXL 4OZ4A 4JO4H 1AIFA 1UJ3C 1NC4D 2ICWJ 4P46B 5EC2B 1GOFA 5D2NE 3IU4L 4YBHA 2BRRH 4N8VG 4XZUB 1RZIB 3MV01 4GMTL 2C4FT 1GPOL 3WN5A 5C0NC 1R6VA 3C6LD 2CKBA 1XGQA 1MCPL 4Y4HD 5FA4A 1UC6A 3SE8H 3MGOB 1MNUH 2R2HB 2X1OA 4PPTA 3OKMB 3CDGA 5E9DE 1D7FA 3E2HB 2EXWC 2V5MA 5D1ZB 2YKLH 3ZZ1A 3CFJA 1NBVL 3CC5A 4MZ2A 1A1OB 1Y6KR 1KB5B 4L8SA 1AR2A 3BUYB 1AGBA 1G9ML 3UZQA 3VW3H 2FBJL 3ET9F 2EDLA 3IJHB 4MDJB 4NO0B 2YR3A 3V0WL 3QUYB 2EYRA 1LQSR 1FAIH 4XPBL 4Q9RH 3TEUA 3B6SB 4Y5XA 1TJHH 4Z7NF 2FH6A 4NO3B 3P0VL 4NOBA 5SWZD 5I66B 2UZIH 5HGDA 2R8SH 1Q1JL 3VWKA 3BDBA 1ZHNB 3ROLB 4L9LB 1SVZA 4E9LA 5IB4B 1A4KA 4OZFB 2BMKA 1KB5H 1DSFH 1HN1A 4YR6A 3VGDA 1GZQA 3OKKA 5I74C 4PV9B 3UBXG 4JREC 3TYFB 1S7VA 3MUGB 2D7NA 3G6JF 4QRRA 3CGTA 1JGVL 4MCZB 3T1FA 1S7VB 3VXOA 4M43L 5T5FL 4LCWD 3F65A 2F5AH 4NFBA 1CDCA 1I3UA 2ZNWA 3C6LC 3CMGA 4I0KA 5DYOB 5F44A 3VFWB 1U3YA 5AZ2L 1P5UA 3AREC 4YK4C 3LKRA 2PO6B 3ZL4H 4DQOL 1D6VL 4IRSB 4NKOB 1I3VA 3OBAA 2PYFB 5EIVA 1ND0B 2IBZY 2JIXB 3T0EC 2DQGH 5KVFH 4PJGA 4XMLL 4C59B 5I1DB 3VXTB 3NCEB 4I9WD 2W0LA 1HXMA 2IADB 2EXWD 4M3JA 1IAII 1CD1A 3W9EA 2JELL 4M7JL 4XX1E 2R56L 1LE9B 1L6XA 5E9DA 4GQPH 3MRNB 4JN2A 2CO6B 1CXKA 4MQ7A 3SDYL 4LSVH 5FECB 2NY4D 4IRSC 1R24A 2HG5B 4MD4A 4WW1A 4P2OC 3TO4A 1P84J 3BIKA 4QRPA 3AREB 5DFVD 1U58B 2XTJE 4NYLB 4YAQA 3C8DA 3LQAC 3E0GA 3S37X 1XMWA 1LDSA 4QTIL 1KN2H 5IMMB 3PQYB 3ARQA 5SWSD 1XR9B 1SJHA 4NSKA 4LKCA 1A7NH 5HDBF 2VDNH 3Q5OA 5I0DA 1N2RB 3T2PA 1ONQA 2YSSB 5B38B 4D0BA 3PGDB 3VFRB 2PYFA 1CQKA 4HXBH 1ZANL 1OGTB 2H41A 4NQSB 4PJHE 4X6CF 1TZIB 3FZUD 4HUKB 2EXYC 3D69A 1NSNL 3FAXA 1JPTL 2R0LH 3OAUH 2FIRT 1U8PB 4OZFG 3FJTA 3WUZA 3P4OA 2I9TB 1P7HL 1IEBA 1MLBA 4R0LC 2DQJH 5HHVL 3SDCB 3LN5B 2VQ1B 2XNAA 1KFAL 4B41A 5FO9A 3QI9B 3BZDA 4ZDHB 3B2UD 2P5EE 4MS8A 1C8PA 1K9TA 1T7VA 4YQXL 1WAAA 3CUPB 3NBNA 4J2XA 2FRGP 4PJFA 4S1DC 4F9LA 2K1MA 1FG9C 4KPHL 3FO0H 1J11A 3QNXA 1K3IA 1IGMH 4M4PA 1S3KH 2ZJSH 2FNBA 3WXWH 1H3TA 2PR4H 2VE6A 1NMAL 5KVMC 4LLVA 5C0CA 4CADA 3P0YL 4G9DB 4Y8DC 4ZAKD 3X12B 5K9JH 4NDMA 3WNLA 4XCCL 3G5VB 3EOBB 3WIIL 5CD5C 4FXGA 3TJEL 3FO9A 4XBGA 1AGBB 4XH2A 2W65A 1IAOA 1IGIH 1XIWB 1CVRA 2IH3B 1HHHB 4CVZB 1L8JA 5GRVL 3L9RA 4GJTB 4ELKA 4P5TC 4L9LC 4OGZA 4RMRA 4UNUA 3MACL 3B9DA 1MH5B 3D6GA 4CBPA 4L4TA 1AQKL 5T1DH 4Z0XA 3LB6D 5FUOL 2M26A 5C9KA 3DX9B 4JFPB 4JKPL 5HD8D 1GIGL 5D6DC 1MRDH 1I7TA 4B5EA 2VN4A 4P2QA 4PBWD 1W2KT 3QJFA 4N8CL 3LH2H 4J7RA 4OLWL 5E7BA 4Z18A 4YXLL 1MFEH 4C56A 3MNZB 2P7TA 4L3EB 1QVOB 1TQBC 1B0GB 2DD8H 2Z8VC 1RIVH 2R39A 2JCCB 4RZCA 1J88A 3LRGA 1NPUA 3IKCB 2CDFB 2GJ6B 3H9SE 3HZMA 4FFEX 3FFCD 4D94A 1F58H 3NACH 5T5NF 3S37L 1UM4H 3ILQC 3U2SA 1TVBB 1J9CT 1OM3L 1QEWB 2NY0B 1WVZA 2EKJA 4KJPD 3VXSE 3LQZA 4XP4H 1Q38A 1YN7B 1AO7E 2DIBA 1Q72L 1ZEAL 2X4PA 4PJGB 3U4BL 3BWAB 1J0IA 3PV6A 5DK0B 3O3EA 1MCQA 1YUHB 1OCWH 2E9JA 3EHBD 4YIQA 1BPVA 1KTLB 4Y88A 1FAKT 3ARFC 5HGGS 4ETQB 1UCTA 4MAYD 5HDOA 2DM4A 2R1YB 4M1DH 3I9GH 2XKUA 5TDOB 2E6QA 1OQOA 4KTDL 4Z78A 4Z7WB 4WO4D 3OJDA 2FWOB 5GISH 2NY0D 12E8L 1CDIA 4U1GC 3VGHA 1WBYA 5GS0C 4DN3L 1AQKH 2CRMA 1CFVL 4G7VH 3AFLA 2DQHH 3IU3A 2SEBB 2FB4H 3MNZA 4LGRB 2CUHA 2G2RA 1T5XA 4JQXA 3X3FH 4NNYB 5D6CA 3HMXL 2YD4A 3QRGL 4QHLA 1D5ZA 3SOBL 3H9ZA 3WFDH 1LO4L 3LKSB 1J0KA 1CS6A 1TENA 4C4KO 4MA8L 4BH7A 3BE1L 1CDGA 2X4UB 2E7BA 3BPOB 1NCWL 2BSTB 3QXTA 2Y5TA 3GHBH 2VZTA 1DVFA 3WJJC 4HUXB 5CEZH 5FFLA 3FN0L 4LHUA 4RMSA 5I19L 5HYJB 4MDJA 1FE8H 1UEMA 5ADOL 1Z0MA 1KV3A 1Y0LA 3RPIA 4JQIH 5DJXA 3IF1A 2ZOKA 4JRXA 5KSAD 3QULB 5MEQB 3DGGB 1F90L 1MLCB 3WLBB 5GGRY 3UP1A 3O3EB 2RAMA 4L3ED 1I8LC 5A1AA 5I73B 2IQAB 4EN3C 2GUOB 1N0XH 3QDJA 3GJEB 4O9HL 1BBJB 3ZSTA 1U0QA 3LEXB 4PG2A 3OXRA 5I8EA 1HNFA 2V9QA 3MLSH 4QXGH 4WFFD 4PJDA 2D7PA 4IRZL 4PJCB 1T21B 1KIQB 4CDHA 2H2PD 2C1OB 5DRXA 3KXFB 1S7WB 3TBVA 3TFKA 2O5XH 2R23A 4WNQA 3S6CA 3CFKB 3LKPB 3ZDZE 1J0HA 1MLBB 5J3HD 2YK1L 5KVEL 3TBYB 2ADGA 3V6FB 4OLYL 4C54A 3V2AR 1MJJA 1PY4A 1YQVH 4XHJC 5I1CL 1F4WL 1QYGL 2MMXA 5JIPA 1SJEA 3DI3B 3PABB 2VXSH 4GKZA 4TRPL 4Z76B 5C0EA 3AXLB 5EWIL 1WTGT 2BFVH 3VJ6B 2DRUA 1IBGL 4GG6A 3KJ4C 3ZTJG 4YQXH 5DJDA 1MNUL 1C08B 1UJ3A 1T22A 4G8IB 1UB5A 4NRZB 3TJHC 1VHPA 3ZE1F 3DVNA 2VZSA 4GXVL 3BO8A 3BPCA 4ZUWB 4NPYB 3QIWD 1WZLA 4XMKL 2FH8A 4KK5D 4NQDD 1ORQB 4FXLA 2O61A 3I3EA 4QOKB 3D1MC 1I1CA 4EJ1C 4HPOH 4X7SH 3HMXH 4TPRH 3EDEA 3OKNA 1CFSB 4LSRL 4CVUA 1CK0H 4M00A 4P2CG 2XOTA 5I8EB 5L2KB 4NQDB 1J0ZA 3BMWA 5TPWH 5I75B 2F54D 3QWQB 4UIMA 5LWYL 2APVA 4I77H 1NQBA 2ZNXA 4KK6D 1AXTH 1RURL 4I48B 3BGFC 4LK4A 5B21A 1FO0L 1S9YA 1DUZA 2AEIT 3ZKXB 5GSVB 5DURD 8FABB 1KCLA 4X5WA 1MRDL 4XP1L 1IMHC 2O5YH 3ROOB 1NUGA 1U92A 3SO3B 3VXRA 4U3HA 1M4KA 5CLTA 5FAAA 4JQIL 4UINL 2F5BH 3MRHB 3CVHA 3NPZB 3O6KH 3IT8D 4XVJL 3MCKB 4CN4A 2H9GB 3BYYA 5ELIA 4PRHD 4M9OA 4PRID 1CLOH 1G6RA 3PWPE 1BD2B 1NAKH 1OHQA 4PJ8A 1A7PL 3OX8A 4GG6B 2ESVA 2PXYB 3IAGC 4PJXF 3BEVB 4P5MA 3TYFA 1F5WA 3K7UA 5HI4C 1VA9A 2DQIH 3P9LA 2IANE 2DQGL 3MO1B 4MNHA 1AHWB 4E0RA 5IMKA 1JI2A 2FLRT 5GHWL 4CKVX 3PQYA 3C5ZA 3QO1A 1QRND 2Y7QB 5I1AA 4ZUVB 4UOJA 5GSRA 4QCIB 4W81A 3BPLC 4ENED 1XGYH 4ZOBA 5C92A 2G9HA 4I13B 2ZOLB 3FHQA 3GIVA 3KXFA 1XF4A 4BFGA 2Z31D 5BV7L 1F4WH 4DJMA 3VFNB 3IJHA 4N0CC 1WIPA 1FL5B 2EE9A 1ZT4B 4Y2OA 3TBSA 1F4XL 1BP3B 2GJZB 5L88H 4PJDE 1N59A 1UWGL 2Y36L 2OR9H 4LBEB 4GSDH 3HHRB 4KVCL 3CMOL 2C4FU 2IF7A 1NAMH 2E8ZA 2AQ2A 3BRGC 4LVOB 1TCMA 1BJ1H 3TCLA 2C26A 2BSSA 5HYSA 3HG1D 3TCLB 3FQTA 5FKPA 1YEDB 4U6HA 1URLA 2NXZB 3T0ED 1TJHL 1DQDH 1U8JB 1GRWA 4MNQE 5F89A 3RKDD 3GMLA 2VDOH 4DZBA 4OFKA 2PYEE 1E4WL 1PZ5B 3EIFA 4WHYG 1FZJB 4UTAL 4R26L 5HVFB 4NCDA 1LEIB 2D7TL 5CUSL 4S0UC 1XF5B 4NO0D 3S36X 4IDJL 1ZS8B 5EU7C 2QQKH 1NFDB 4MWFA 4XVSH 5T5FH 2FX9H 35C8L 1D5XB 3HR5A 2GYSA 1A6VH 3I6KA 5I66A 4N0YH 2R0WL 5GIRB 2RCSH 3GSQB 5JOFB 4N5EC 1T0MB 3PJSB 1JGDB 2VKXA 5ABDE 2R1WB 4P3CH 2IPTH 3UTZB 1RJZA 4FQ1L 2XWTA 2NX5A 3HRZA 3MRQA 1SEQL 5HVHB 3WIIH 1S7XA 1TZGL 3CPLA 4HFWA 1G7JB 3P30H 3UYRH 1IJ9A 1FHGA 4XNUL 2WNGA 3VE0B 2WUCH 3RAJL 4CADB 1F2QA 5FF6B 4NQCA 1J87A 5GSVA 3BWAA 1XGRA 1MRCH 3CXHK 3C09B 2OR8A 3OKOB 4TOYL 4XB8A 1I7ZB 1TQCC 5I1CH 2PNDA 1PKQE 2P4AB 4Y16B 1XGYL 4XPTL 2GJJA 1TVBA 3WKML 3IFLL 3ZKMC 2UZYB 4PJBA 2DQTL 5IMKB 3X17A 5INCA 2ZG3A 3VI3E 5IW1A 3BRDA 2FGZA 1OVZA 1QUNA 2J5LC 4BELD 3OX8B 4NO2B 2IJ0C 1FRGH 1RUAL 3LN5A 4X7EC 5EORL 4L1DA 3RL1B 5GXBB 3TF7C 2R8SL 4ZUWA 3ECBB 5GGUA 1JGLH 4PJ9A 4IOIB 3GSUB 5J6GB 4UQ2A 4ZPTB 2WY3A 1JPGA 3MCKA 4FQHA 4MB4A 5EOTB 5EO0B 4AMKL 1G9EA 4PTTB 2D7QA 1F8TH 4GAJL 3SE9L 4GLRH 1EHAA 4L3CB 4O02H 5KTEH 5EC1B 1I1AC 5D72L 2DLGA 2OP4H 3EYSH 25C8H 3CFEA 3SJVB 5SV4A 5BVPH 2FO1A 5CP3H 5ITFA 4DN4L 2X4SB 1H5BB 1X5LA 1XZ0A 4HS3A 2MTPA 4PJFE 4FQ1H 4D9RD 3VG0L 3WIHH 5CKAA 2OLDA 1UCBL 3UYRL 5K9OB 5CINL 1A9BB 5D5ME 1PEZA 5FK9A 4AG4H 4YNYA 1H15A 3M8OH 4LSQH 1BJ1J 3SJVD 2AS5M 5EG6C 1FFOA 5DEGA 4OF5A 4WUUA 4XCEB 5DQJB 4Q9CA 3FO1A 4FQXA 3GMRB 4MJ6A 1NMCB 1JF6A 3MRBB 1NMBH 4HK3N 1MFCL 4K3EL 2EIDA 5EUOA 3DIFB 5DMKB 2CUMA 3A6CL 4HJJL 2W9EH 1IGCL 1GHFH 4PRHE 4OZIA 5I1DA 4I18B 1ZA3B 3CX2A 4RSVA 1KPVB 3PQYE 4U6YB 3S88L 3IB4A 1K8DB 5KS9B 1J12A 2VL5A 1IEBB 4X4MA 3Q1SH 3PHQB 3HAEG 1B2WH 4UDUB 4AIXA 1JHTA 2CGRH 2CUIA 1GGCL 2R4SH 5CILL 5A2FA 3UYOD 5E5RB 2V5RA 1ADQA 2Y1VA 5HHXH 4WW2F 1P1ZA 2L0DA 1FYTD 1G7PA 2A77H 3CSGA 3JWOH 4KTYA 2ZSVA 1J0JA 1I8KA 3OKLA 1O0VA 4KMTH 4NJ9H 1KJ3L 2BRRL 2W0FB