3HUJA

Crystal structure of human cd1d-alpha-galactosylceramide in complex with semi-invariant nkt cell receptor
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
275
structure length
275
Chain Sequence
b'RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell surface glycoprotein CD1d
publication title Differential recognition of CD1d-alpha-galactosyl ceramide by the V beta 8.2 and V beta 7 semi-invariant NKT T cell receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 275
sequence length 275
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hujA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3hujA01
1NBYB 1HSAA 2PR4L 4WU7A 5EU7E 2VZOA 1VFBB 4C56A 5C0GB 2QQNH 3NFSH 1MCLA 5HHQB 1E4XH 2AQ1A 3TVMA 2MNUA 3HZMA 3K3QA 4HSQA 4GG6E 4D3CH 4R4ND 3V5KB 1S9KC 3FFDB 4XPAL 4YC2C 4ZOEA 2NY0B 4XBPA 1F90L 1U8QB 1GOGA 3JV6B 4LCIH 3LV3B 4NN7B 5DURB 2YD3A 4OLVH 5DJDA 5IB2B 1CS6A 2IAMA 4CN1A 2VDML 1E4JA 1ZTXL 2ESVB 3ZHLA 5GS0H 1CDGA 5D4QA 5GS1B 3WNMA 1BVZA 3AFLA 5H94B 2P8PB 2W1NA 1JMXA 5KW9H 1U58B 3K4ZA 5DC9B 4BUGA 1FFOA 3UTTD 4G8GE 1HEZB 1DUZA 3BQUC 1CDUA 4CDHA 3BN9C 2OX5A 4L8SC 5EOCH 4NNPL 4G6ML 3T0EA 3IKCA 5I1AA 3E2HA 1H0DB 5DK0A 1LP9F 1EH9A 2XKSA 2HJLB 5DZNA 2CMRL 3LZFL 4CRPA 3BSZH 4HJGB 4NKIH 3P9MB 4OLXH 2PCPB 4JQVA 1IC5H 5KSUA 4HKXB 5GSRA 3QO0B 1YEEH 5FO9A 3CUPA 4NHUA 5HHOE 4I4WA 4YHIB 2AJVL 4OGAC 2Y06L 1CQKA 2PTTB 2DM7A 3ARDA 4HEPG 1RZJC 5KAQG 2C4FT 5CIPH 2V7NA 1UM6H 2FX9H 1EGJA 1D5IL 4FQLL 5GISL 5HHPB 3SE3C 2WUCL 35C8L 1XIWA 1A02N 2A77H 3QI9C 1QHPA 5A1AA 32C2A 5DUPH 4NM8L 5FYLD 2OK0H 4WI4A 3EJYC 4HPOH 2FEEL 3PWLB 4ORGA 1IAMA 2VAAA 2VLRB 4WNQB 2DLGA 2NY7H 4YQXL 3VRIA 5JHDA 5FECB 1FAIL 1PJ9A 4HW6A 3LHPH 3FN0L 4JPWL 2BJMH 3O8XD 1UZ8B 2XG4A 3VWKC 4U1GB 1NSNL 2IG2H 3GRWA 4YWGH 4O00A 2WQ8A 1XCQA 1NGQH 2VZ1A 1DP0A 3X14A 3P0GB 3W5MA 1OOAA 1CD1B 4EI5C 4MJ5B 2A1WH 2HT3C 3ARQA 3B5GA 3WLBA 3QHZH 3MFGB 3ZTJG 5D70L 3LN5B 4HG4K 2VZTA 2ESVE 4JM2D 1A1MB 5CINL 3I9GH 1NC2D 2ATPB 3L3HA 4P2OD 1K8IA 3T0DA 3MRDA 5T3ZH 5IFHH 1LE5A 1OT1A 4Y88A 1M05A 3O9WD 3WFHB 3KLAA 5LGHH 5EU4B 3P4OB 3VXSA 1MRCH 3G5YB 1XGTA 3LIZL 4TUKH 4R0LC 4XCEB 5TE4H 1AQKL 3DVGB 5DQJB 1B3JA 1G9MC 5EU6D 4ENEC 5T1LA 4WI3A 3GIVA 5CJXA 1TTGA 4M7LH 4TQEH 2Y25A 3A67L 3MRPB 3CFBA 5FAAA 2DTMH 1KCRH 4LCCC 1IEAA 4JB9H 1J18A 5I75C 4MJID 3BPNC 1VFAB 3FO1B 2NY4D 3VGHA 1R24B 3G5XB 2E7CA 1ZLSL 1AP2B 2BFVL 3UPAA 1NBZB 5D6CA 3OKEA 1GOHA 3DMMD 1A9EB 5TQ2H 5HDQL 3C6LC 1A22B 4LVOB 4POZC 1BVLB 3L7EA 2DQHH 1SJEA 1DBBH 1EEUA 5HGHB 4ZFFB 2JK5B 3WHE1 2DQDL 4X7FC 2P24B 3MV7A 3BD4A 4HIEB 1KNOB 3DVNB 1CCZA 1JYVA 1KOAA 5GGQL 1MCCA 1UJ3B 1N26A 5BOPA 4YHNB 5DFTA 1FZOB 2VLRE 1RQ5A 1NAMA 3U9UA 2F15A 3PNWA 3VH8B 3MSPA 4DGIH 4ODUB 6CGTA 4JE4B 1UFUA 5ITBL 5E4EC 5B8CB 3T4YA 1N0XH 2VXVH 1ZK9A 3IU4H 2Y07L 3BPCA 4LCUB 5FOBA 3PABB 3PIQA 4KK9C 4PJ9C 4Y16B 1LO0L 4KROB 4AL8H 2DQIL 2GQHA 1G84A 1NCTA 1IGFL 5H2BB 2VN7A 5BO1L 4Y1AB 1BHGA 3UO1L 1UM4L 3BKYL 4PB0L 3C6SB 3TH2T 2AXJA 3TBYB 1S7UB 2BY3A 5EZIL 4WW1A 1OAZL 2WNGA 4J4PC 5I0DA 3T77A 1J1PL 1RZ7H 1CLYL 2FBJH 5CZVL 2A6IB 2HRLA 5DYOA 3FCTA 1HNFA 3DIFB 1CG9A 1OB1A 3KLDA 2HFFA 3TVMC 1DE4B 1MFBH 3E8UL 3WE6B 3HPJB 4WO4D 3BZFB 5M7QA 2R15A 1I7TB 3RTQB 5IW6A 1OAQL 1Q9KB 3B2UC 4PRDA 1ZE3C 4O02L 1S7WB 1SBBA 3T0WA 4Z78A 5ERWB 2C4XA 5ISZB 5D7JB 1RUPL 2J5LB 4PGDB 4AM0A 4KK6D 4EN3A 4LNRA 1AIFA 2EDLA 5DEFB 4X6CB 3MCKB 2EDXA 5JIKA 3RGVA 1JHKL 3EYUL 2F53B 1BF2A 4RAVA 3PL6A 5I8CA 4OZFH 1TDQA 1DN0A 3KPPA 4FQIL 4HIJB 1S7VB 4XGZA 1SYVA 3WFDL 2A38A 1ITBB 4U6VL 4XTRC 1BVKB 4LRIC 1PG7H 3T0EC 1CIDA 4MXVF 3QDGD 5SWSA 1A7RL 2LU4A 3E2HC 3L1OL 3L3OB 5TF0A 2HTKC 5HDOA 1CFNA 3VGDA 4KHXH 1EXUA 2F74A 4ZNEE 1S7QB 4Y5VA 3ZKXC 4GQ9H 4NQDB 2NY5C 2C1PB 1HQRB 5C0DA 4OQTH 3F5WA 1U95A 1B0WA 1ZVSA 2EC8A 3KHOA 3U6RA 4HJJL 4QHNA 2DQEL 3CDYA 3CXDH 4G8EB 4PTTA 1FN4A 1XIWC 3RVXC 4Y1AE 4U1IB 3ZSTA 1MCFA 3PGCB 5LGKA 3DURB 5KBNC 3QUKB 1S7SB 3U30B 1C16A 3S37X 5K93A 5JXAL 2EIZB 5IHUH 2UZYB 2EDHA 3P0VH 4MLSA 1LO3L 4WJ5A 1A6AB 5LAXA 4QRUA 1PLGL 1U8JA 4HAFA 2RIKA 3KPRD 1JV5B 1NFDA 4K3EH 1E27A 2F8VA 3GKZA 3H0TB 3V4PH 3AB0B 5HVHC 2BRRL 3SE9H 5JMOC 4L3ED 3L95A 4JFZL 5FYJU 5J6GB 5DMJB 3NOIA 3S96A 5D1ZC 3MCLL 5TJWK 2N4IA 3UX9B 3QIBC 4X6CE 3MYZA 1LK3L 4NWUH 2VNCA 3MLYH 2V9RA 2F53E 4IJ3C 5DZOA 4YE4L 3TBWA 1LVEA 4U31A 4D0BB 5D1QA 1YNLL 1YYLL 2WBJB 4GW5A 4MDJA 3O6FA 1NANH 3HG1E 1T04A 4OCNC 3QRGL 4K3GA 2VERN 3QEQA 1UENA 1XF4B 5GGUB 2IFFH 3F65A 5KG9A 4X4MA 5CJXC 4BSWB 2DD8H 5I74C 3OSKA 1YQVL 4L3AA 3OKNB 1UXWB 4JDTH 1CLOL 43C9A 3CH1A 3EHBC 3RDTD 1QUNA 4FZ8L 1HOCA 4NQDE 2VXQL 3IFOB 1OHQA 5J11B 2PXYB 4NRYB 4WFGE 1QG3A 1NMAH 5FGSA 1KIPA 2YEZB 3W9DB 4QTIL 4W4NA 1FV1B 2EC9U 4DQOH 4PJAA 1JNHA 3IB4A 3TA3B 5LJYH 1MREL 2R2CA 2YMXH 5I19H 2O5YL 3L3KA 4NM4L 3V0WL 1SEQL 1RJYA 2OLDA 3QFJE 3NCEB 5F88A 1JFQH 5E94B 3VXQB 1WZMA 1VFMA 2V5TA 1AGCA 3MLTA 1P4IL 1QFWL 3VD5A 1HHJB 4KI1A 4OKVB 4H88H 3DTXB 1TLKA 3ZDXE 2DICA 4P9HH 1Z5LA 2X5PA 2OP4H 1TVBA 4P5TD 2Q8AL 3UJIL 4PG9A 4KZEL 4HG4J 5HY9B 1BMGA 4OCLC 4Z0XB 4JAMB 1B9ZA 3G6AA 4OZGF 2EICA 5KVFL 2IANB 1EUUA 4UIMA 1AGDA 1Y0LA 2XA3A 4JKPH 3UTTA 5TE6H 4LLVB 1FORH 3KXFD 1TETL 1TJGH 1NCCH 5CP7B 4DKEH 4YFEA 3N1QC 1R5IA 2ITDA 1RSFA 1ERNA 5GGRY 5BVJB 1DFBH 4I2XB 2JCCB 4MS8D 4I48A 2VDOH 4NRZA 2M26A 4W6WB 4YK4B 3UYPA 3ZDZE 1KV3A 2DQUH 1OM3L 3OKLA 2F19H 4F7EA 5IB4B 3I6LD 5GRWA 3C60C 2Q6WB 4PLJD 4MA1C 4AZ8A 1KLGB 1SMOA 2LE9A 5D96B 2UV3A 2VUOA 5DJCB 5I1HL 3OXRB 1XF5A 2OQJB 3W39A 4QHKI 4OGYH 3ZE1F 1T2QH 4HHAA 4Y4KD 1BQHB 5IF0B 3TBVA 2IADA 4H25A 4LNVA 4ODHH 1BIIB 2YHGA 5AUMB 3NH7H 2VZ3A 1N2RB 4WI7A 5L8LB 3VFGH 5HD8D 1WC7A 4U7MA 4JN2A 4NWTL 3RNKB 4U33A 5EZJA 5CGYC 1NGWA 3RHWF 4RFNC 3U36B 4EN3C 4HF5L 1MFDL 4JZJA 4M1DL 1XH3B 1UB6A 5I8EA 3RGVC 2PYFB 2B1HH 4LVNC 5INDA 4JDZA 3PL6C 5E70A 4FQPA 2P5WB 5J1SC 2EKJA 5HYQB 3RWHA 1AD0A 2EE9A 2BOCB 1ZHLB 3V4UL 3BH9A 3FQTA 5GZOD 3R0MA 2H41A 1VADA 3C5ZB 4X80L 1YUHB 3UEZA 2EXYC 3RI5F 1T1ZB 5IHLB 4MQTB 4E41D 3BP5A 3DX7B 4JM2A 3NZ8B 4L8DB 3E6FA 2Q1EA 1T0PB 5DHXB 1NC2A 2FATH 1I8MB 2A83B 2OL3L 3NCJL 4P2OA 1N6UA 3TZVD 3S7GA 5T3XL 4Y5VC 2APFA 3QCUL 5HGBB 1MPAL 4ZXBC 3EGSB 3REWB 4M3JA 3O9WA 4JQIH 4Z7VF 1FO0B 2IGFL 2QKIA 1NDMA 2AJSL 2X4NA 4GJTB 1FDLH 1NGZB 1F8TH 2BVPB 3N85H 3DRQB 4BQ6A 1A7NL 2IQ9H 4W81A 3LKRA 4LBEB 3VMOA 3DGGB 4I2XE 3BWUC 1R3LB 3WNOA 1AC6A 1MFAL 4KAQL 1KXVC 5HGDA 3UTSB 1JNJA 1UZ6F 3VXNB 4OV5B 2UUDK 1SJHA 3HNTH 4MJIA 1Q38A 3GSNA 5IR1A 1P69B 1MJ7L 4YC2B 2CRMA 5LQBL 4HMEA 5EBMB 1YNTA 1FYHB 1KTLB 1T0MA 2A6KB 3QUZC 1BEYH 3DMMA 3C8DA 5D7SH 1DBJL 1MFEL 1JNNH 4MZ2A 3QQ9C 2OTWA 1CDIA 1V7ML 4HXAL 4QT5B 1DSFH 3RVUD 4JHWL 3QIWD 1XGPB 3MGTB 3BKML 3HE6C 3P73A 1EO5A 4F80A 3D3VD 4OGZA 4KY1L 2PUQT 3VFSB 5CZXC 4YHYC 2ZUTA 5DJ6A 2ORBL 1B4JL 5DSCA 2NTFA 5DRNB 2NX5B 5E8OB 5ITFB 2ZOKB 3B3IB 2OSLA 3BQUB 3MLPA 1JTPA 2XQBL 2GK0B 4L8SB 2WQRA 3AAZB 5CSZB 1X5IA 1L0YA 2RHEA 3CVHB 1VACA 1UKQA 2P5WE 5GGSB 1MJ8L 5I73C 1RUQL 2XY1A 2ZCLH 3TJHA 5DDHB 1FL6B 2VR9A 2X70A 4NPYB 2D7TL 3DX6A 5H37H 2X89A 2XWBA 5AD0A 1A3LL 3KDMB 1KIQA 2PYEB 3OPZH 4X7TB 1M4KA 2BCKB 4LMQE 1V7NH 4XP5L 5ADPH 5DA4A 3VXRB 3IAQA 4CVZB 5IFJB 4KPHL 5F8RC 4D8PA 1B4RA 5ETUA 4F7TB 4N1CA 3V79C 5TFSH 1HH6B 3OR6A 3NPSC 4AIOA 1P7KB 5F1NA 3L3DA 5HGAB 2BK8A 5C0AB 3NA9L 5TE7H 3QI9B 3LPWA 2AXGA 2X4RB 1P4BH 2FIKB 2WIIA 4Z7QE 4KDVA 3S97C 5J1AA 4M6ML 5IV2A 1DBAL 3OBAA 5ACZB 5TDOB 1MHCB 4P46D 5I1GL 1CGYA 2UWEA 4K7FA 5I17A 4OCSH 4O2CA 3G5ZB 4BA8A 3QSKB 1DQQA 1JGEA 4WO4A 4F58L 4R4NC 5T1MA 3A6OA 4Z7UA 5IJVA 3DX8A 3BXNB 5DR5H 3ARRA 4AK1A 5B38G 1FNEA 3T1WA 5DJXB 4I0CC 3SOBH 3WJJA 3O4LD 2B4CH 3W0WB 1HHHA 3MRRA 5JDSA 4ZUVA 5K9KA 1NL0L 1E4KC 1HN1A 3PWNA 3H9ZA 5B38A 4EI5B 2OZ4A 3WUZA 1JGVL 1JRHL 1PFCA 4QEGA 2XKNA 3VD7A 1N5YH 4R6UA 1S9YA 1KCSL 3GMOA 2QR0B 2QQNL 5ALCH 3NFSL 1YNKH 1GGIH 3MGAA 3CFJB 1HILB 1S8DB 2A6DA 1TTUA 5ECJE 3I02A 3QEGL 4NQCB 4EUPH 2NX5E 3FAWA 4M93C 3QDGA 4MA3A 3RY4A 1NUFA 4R0LB 3VD9A 4PJDB 5ICZB 4P9ML 3QIUD 4OLVL 4KQ4H 5ICXB 3R4DA 4KKAD 4IDJH 2F5BH 2BVTA 4FQHB 4A2MA 3LVEA 2PYEE 2CXKA 1NDGA 4X98A 3SGEI 4LCCB 2MFNA 4ETQB 5BQ7B 5I75B 3O45B 5E99L 3BPNB 2R1YB 3HI5H 2EDBA 3NAAL 3VXRE 12E8H 1Y6NR 2ZCHH 1R3JB 4LIQH 4LSPH 3IVKA 1DEEA 1G7MB 1HH9A 1I4FB 4R9HA 4PJ5B 1MWAH 2R2BA 3CZFB 3LEXB 4JPVL 4OTXH 3S36L 3C6LB 1TNMA 4FS0A 1KIRB 2D31A 5C0AE 5ALBL 3O6KH 5F3BB 3R1GH 4LCWE 5DEGB 5E8DL 3RJDA 3BSZL 4IIQA 5JOEA 2Z92B 1DUYA 4TNWF 3BKCH 3O3AB 2WLYA 4JZJC 3KWWA 3NCMA 2DI7A 5E2JA 1MVUA 4P48A 3P77A 1VEPA 3TYGH 1FHGA 4N9GB 2PW1B 2XNAB 3KPRA 1NKRA 3O8XC 2BOBB 3ARFD 3T4AB 3OG4B 4YXKH 3EYVB 3MGOB 4NBXB 2L0DA 3T8XA 1QO3A 5F89B 2R2EB 5DD3H 1F02I 4L3EA 2J2ZA 1CFSA 4MAUL 5E4EB 3GSWA 1RU9H 4OD1H 4PGEB 3V6BR 3W0WE 3RA7L 4PJ9B 1BD2E 3PWUA 5HYIA 2OK0L 2DLTA 3O3EA 4HPOL 4P99A 2I9LA 3SHSA 3DX9B 4HIHA 1B88A 2ID5A 2QL1A 1F3DJ 1ZSDA 3VFTB 4P2OC 3VGGA 5CBAA 2EH8H 3BO8B 3C5JA 5C09A 2NW3A 1X4XA 1XF2B 3CAFA 3R06A 3O9WC 4J1UA 5F9AC 2P1YA 2BJML 3HA0A 4XXDB 1ED3B 3VJ6B 1CFQB 1DN2A 4WHCA 4Y7MA 4S10A 5C8JA 2IPUK 1NGQL 4NQXB 3GBMH 4PJDE 1HSAB 5JHLH 1Z3GL 2FO1A 1YY8A 3QHZL 2DKMA 3DUUB 3IKKA 3RDTA 4H1LG 2FL5A 4I18A 3ORJA 5E2UH 3TVMB 5C9JA 5DUBA 3HZMB 3KYKH 1BLNA 2WWMD 3WFBL 2YUWA 2D7PA 2DQCH 3QCTH 4H1LA 4WEBL 1JGLH 3DMMC 5J8OA 3WN5A 5DJ2A 5LGHL 4HLZG 2ZG3A 5DJDB 5EU3B 4PJ5E 4XP1H 5TE4L 4V3EB 4P23D 3PP4L 4NQSA 1SEBA 1TZGL 4J3WA 1OF2A 3HN3A 4TQEL 4X4XA 3BW9B 3JWDC 1RZKL 4FN0A 3ZLQC 1V05A 2DTML 4WV1C 1DUZB 1G1CA 2HVKA 4HWBL 4HFWA 1EV2E 3T0EB 3IKCB 5C0RH 1GGYA 5I1AB 3E2HB 4P5TA 5DK0B 2FEEI 5TQ2L 3OQ3B 2J8OA 2DQHL 1B6UA 1N8ZA 1B2WL 2G9HA 2ZJSH 1OGAD 5BV7C 3INUH 4PJHE 5D2LF 2EE6A 2X9XA 3ZKXB 4GRWB 5GSRB 5KSUB 4PGZA 3KXFA 4H20H 4HK0A 4I4WB 5KANG 1EFXD 4RBPK 3MLZH 3GO1H 2Y36H 4HUVA 5LVEA 3ARDB 1JPFA 5E8EB 5EO0A 3VA6A 2AJ3A 3HUJB 4L8CA 2DRUA 2NXZD 4JO1L 4MS8A 5E8NA 2OYPA 4BZ1H 4I0KA 5C70A 1XIWB 1WISA 5F9OH 3MNVA 2VXVL 32C2B 4J3VA 5GPRA 5IM7B 4CADA 2WY3A 3IU4L 5FA4A 2Y5EA 5D2NA 3RZWA 5J12C 4WENB 3S3JA 1UEMA 2A9NL 4ORGB 4QWWD 2N1KA 3CFDA 5AAWA 1RZIA 2PO6A 2VAAB 5GZNC 4AL8L 1GCFA 4Y4KA 1K9TA 1PG7W 1EFQA 3V6OA 1RUAL 4ODXB 5I1EL 5L2JA 5EIIA 3U46A 3OHXA 5HVHB 1CD9B 1U8KA 1XCQB 2OJZH 5DRZA 2W38A 3WIHH 3X14B 4AENA 1G6VK 3QO1A 4L4VD 3WLBB 1RZ7L 4F33B 4MXQD 5D1ZB 3S35H 3V0VA 1CFBA 2FBJL 1JHLH 3LMJL 3QNZA 2APWA 4IJ3B 3L3HB 1MFBL 3FQNA 3MRDB 4MCYA 1H3PH 3FO0H 4OZHE 1LE5B 4OCWL 3KLAB 3OR7B 3VXSB 1XGTB 5F1SA 4E41A 3BUTA 4ZMAT 3T0EE 1UYWL 4LPXA 4QYOA 2QV2A 3C09B 1TZIA 4Y5XA 5T1LB 4FFVD 2VQTA 5I74B 4Y4HD 1U8OA 1FE8L 3CFBB 1AD9A 4TPRH 1R3IH 4RDQG 1EBAA 4MA7H 4ZTOL 2X4OA 3LQAH 5K9QI 1X5GA 3GSOA 3D87B 2AVGA 4N9OB 3IXAB 3B9EA 3GMQA 3HUJE 5FYJE 3FZUC 3OKEB 5E6YA 4GW1A 1PG7L 1FNFA 2VIRA 5D1XA 1T89A 1SJEB 2P42B 5BW7A 2WWKO 3VFMA 1JK8A 3PV6A 2VITA 3MV7B 4N0CD 1T22A 3OKDA 5DVLA 6FABH 5BRZD 2DI8A 2FSEA 5MHSE 4FG6D 4TSCL 4OQTL 1VHPA 2IFGA 1NAMB 1A6VH 2VRAA 1DANT 2KQMA 1EUTA 1F4XH 5IWLC 3TH4T 3TJEH 3U0TB 3V5HA 2VXSH 1Q94A 3QIWA 3IXTA 3H9SB 1P6FA 3T4YB 4I3RH 3ULUF 4RCAA 3D3VA 5CSBA 1MQKH 3BPCB 4OUOA 3EOTH 4N8CH 3PIQB 1JTOA 3CJJA 1SY6H 2WWKT 1OPGL 4AT6A 4ORZC 5IHUL 1YN7B 3P0VL 1OGTA 4Q58C 5I2IA 4M7ZC 2V9TA 5C0CD 2RGSA 5T1DH 2HVJA 4UB0L 2F58H 1P1ZA 1HSBA 1ND0B 4K3EL 3Q6FA 5GRJH 1AKJD 2HJFA 3FB5A 3V4PL 3JTTA 2H3NA 4HUNB 7CGTA 1DLHA 4WW1B 2HKFH 3SKNA 3OZ9H 3T77B 1X6NA 5IMOA 3C60B 1IKFH 3CK0L 3ZDXF 4MA1B 3QNYA 4PJCA 1KUMA 2EEBA 3FCTB 1J0HA 1OB1B 3MBXH 2HFFB 5ID1A 4KJYA 2A0LD 3FT4A 4XX1G 4UQ2A 4WTXA 2DL9A 4NO3A 2R0LL 4PRDB 1ZHBA 4QRTA 5FCSH 4UTBH 3FQRB 2CDGB 1FFRA 4XWOD 4YAQB 2P44B 4P46A 4P3CL 2IPUG 1FVDA 2IFFL 1JWSA 4NQED 4F7CA 4AM0B 4EN3B 4M3KB 4LNRB 1AIFB 3MJ8A 4FQCH 3RGVB 1IBGL 2VSCA 5CLWA 3N50A 4L4TB 4EIGB 3IDIA 3QDMA 1CL7L 4RAVB 3PL6B 5I8CB 3MV7E 1JNLL 1R5VB 1ZLWK 3RX5A 3KPPB 4HUUA 5D72H 1NCBH 4XGZB 2X44D 1CBVH 3O4LA 2ENSA 4ZO7A 2Y23A 4Y2DC 3A6BH 4ZYKA 4OBRA 5SWSB 2YD4A 5GHWH 4P5TC 3EBAA 1WFTA 4NN5C 4DQOL 3PXJA 1T7VA 1N4XH 1S5HA 4U1NA 4U3XA 3H9SE 4JKLA 5T3XD 5HYFA 4IRJD 1EXUB 1TPXC 2F74B 2V5MA 2YMXL 1OP3H 5I19L 4G42A 4Y5VB 3C5SB 4WFHE 3V5DA 3QQ3A 1JFQL 5IQ9A 5C0DB 3TNMA 2HFGH 1XCTA 4KGJA 1O5DT 1U95B 3U6RB 3OKMA 4QHNB 5KVMC 2V2XB 2QQQA 3QIUA 4OIAA 3SDCC 4Y4FD 1FN4B 3VWJD 3P9LA 3HC4L 2OP4L 2CLVA 2YPKB 3O2WL 1LD9B 2YKLH 3C2SA 4PLJC 1C16B 1MRFH 4MX7A 2NXYC 4WJ5B 1H3GA 3DECA 1VENA 3MJ9H 1KLUA 4LSTH 4Y4KC 4Z7WE 3N1FC 5LAXB 4KRPD 3QUZB 4ZAKD 1NCCL 3V6OC 2IBZX 1NFDB 1CFTA 1E27B 1KPVA 2XZQH 3O3BA 2FGWH 1CGSH 3Q3GA 2VDOL 3TV3L 5K9QG 5E2WH 2KUTA 1U8MA 3L9RA 4HWNA 4U3CA 2F19L 4MD5A 5SV3A 1A6TA 3S96B 4L4JA 3PDOB 2JCCF 4S1QH 5I1LA 2HN7A 4KK8D 3SGKC 4L4TE 3ARFA 5TGBA 3IF1A 3FOMB 4HGKC 4QKXB 3ULSA 5J13C 2VXUL 2W0FA 3TBWB 2EIEA 5I73B 5MI0B 5GZOC 1X9QA 2FB4L 4ODHL 3L5IA 5JPNA 4GW5B 4GLRH 4MDJB 3O6FB 2AJUH 1T04B 3NH7L 4NO0D 1LDPL 3WNLA 2EC9T 1EEZB 4Q74A 5SWSE 2VLMD 2W0LA 2G5RA 4KKLC 4Y5XC 4N0UE 5KG9B 1AXSA 4H8WL 2X05A 4CMMA 3TZVC 1QD0A 3ZKMD 3G6JE 43C9B 3NFNB 2B1HL 1Q9LA 1QFWI 3NPSB 1PKQA 1PZUB 4HIIB 1JYNA 1I3GH 1ZHKA 3WEXA 1CVSC 4G8IA 1KIPB 4Z8FL 4YHKH 1QACA 4JFDB 3OJVC 4JANA 4PJAB 4HULB 1T89C 3DROA 5BW7C 5K9JH 3DVFA 4QHLB 4MCZA 2R29H 3L3KB 5IVOA 5EOQH 4EI6A 1KPUB 4GBXD 2YK1H 1RJYB 3D5OF 1M7IB 1AXIB 1LEGB 4LPYA 4QXUL 4ZPTA 5F88B 3WHXA 2OS7A 4OGXL 5D7IA 5SWZD 4S1SH 1LEKA 1RPQA 3MBED 3JUYA 1CXHA 1A5FH 2ZZUT 1AGCB 2VLJD 1TMCA 3T3PF 1FDLL 1AXTH 2JIXD 3ULVD 5CEXA 3NIDF 4P23A 5H8DA 1NFDE 1Z5LB 2IQ9L 1A21A 5T5FL 4HJ0C 1TVBB 3K8MA 4PG9B 5EBLA 2D03L 3IRPX 3MUGA 2AK4E 4DFHA 3TH3T 4UIMB 1AGDB 1Y0LB 3Q1SL 4Q0XL 5IFAH 3UTTB 3IDJA 4DZ8B 4LAJH 3MRGA 2YRPA 3TNNA 4M93B 1R5IB 2ITDB 5E4IA 2C1OA 3VXTA 3MV11 5D7SL 4F9LA 4NRZB 3I3EA 5HPOA 5DHVA 4MHHI 4OLYH 1U6AH 1BAFH 1DSFL 3OKLB 4FFEX 2QHRH 4F7EB 5FKPB 3RRQA 1WIOA 1EFXA 3PWPE 3LEVH 4P3DB 4WWKD 3TT1H 4P57B 2Z31D 5J89A 2C26A 3W39B 4TNVF 3DSFH 2YPLD 4WFEE 4HHAB 3TBVB 4KVCH 2EDTA 1KIUA 2AABH 2ZCLL 2KZ1B 3IDNB 1HNGA 5IT2H 4JN2B 5CEZE 1AFVH 5EZJB 1XT5A 4P46C 1NGWB 4JFDE 2IQAB 5KS9A 4JZJB 3CSPA 1V7NL 1UB6B 5KVDH 5ADPL 2RR3A 5INDB 4JDZB 3MFFA 1EHLH 4Q2ZA 2R4RH 3O8XB 3RWHB 3QULB 3MRJB 3QH3A 1A2YA 1S9XB 3BH9B 3T65B 3QUXC 1IM9D 4I1NB 4JFXA 2XRAL 3GSXA 4L4VA 5JIIA 1HI6A 3QXAA 1G0XA 1P4BL 3FO9A 5J0BA 1U41A 3PHSA 1TITA 5DJ0A 2H6PB 1MF2H 3HNSH 3BP5B 4FNLH 1SM3H 4JM2B 5CS7A 3E6FB 2E7MA 4XPTL 3SDYL 2CLZB 4K7PH 4ZQKA 1NC2B 4OCSL 1KJ3H 1WBZB 4P2OB 4M1CD 3THMH 4XNZC 3MOBH 1Q8MA 2D0HA 5L2KD 1OAXH 3O9WB 5L7XH 1EEYA 1MEXH 2QKIB 4YEFA 1U8PA 3KYNA 1WCBB 3GMLA 4JFHE 3SOBL 3LKRB 5EU6B 4KKAC 2NPLX 4FQJH 2AJYH 1FL3A 1TVHA 4G7VL 3T1FA 5I6XC 3AM8A 3DV4B 2IBGA 5DI8A 1SJHB 4MJIB 5ALCL 1G7PA 1GGIL 1YNKL 5FHAH 5IR1B 4KJQD 4MWFA 1D5ZA 4YFLF 4B7IA 5JQ6H 5LBSL 1AR2A 1T0MB 3EOAA 3IFLH 3DMMB 1D5MA 4WRLA 3E1F1 3DO7A 1TFHA 1YMHB 1H15A 2OTWB 5FIEA 5IKCA 2I07B 4KQ4L 2Q76A 3GSVA 5DTFA 4HZLA 4PREA 3UPRB 3O2DH 4YDIH 4N0CA 5FYLE 1ORSA 4OIBA 3ULUH 2MPAL 5C71A 3QPQD 4JFPA 5BRZA 2JELH 2ICWI 2MJWA 4PJDF 5DSCB 2NTFB 4WV1B 1INQB 4TULL 1ZT4B 1O7VA 1RZFH 1OCWH 1BIHA 1I1YA 4BFIB 3HI5L 4XRCB 2ZCHL 3KPSD 4TRPH 1AR1D 1MUJA 4DN4H 2X70B 3ZYOA 4OTXL 3DX6B 1KN2H 2XWBB 2VH5H 2HP4A 1KIQB 5C0NC 5EG6C 4GKNA 3O6KL 2R2HB 5BV7B 3R1GL 2V9QA 1XGRA 3MRQA 3QQNA 3STZA 4EXKA 1LK2B 3HZKA 3Q6GH 3QDHA 4OF8A 4YNYA 1JUFA 5KVGH 1MI5D 3KPMA 4D8PB 5ETUB 1BM3H 3AVEA 1WZ1H 3OR6B 1YEJH 1D5BA 5F1NB 1A7OH 3P4NA 3L3DB 1AKJA 3HRZA 1VEMA 4XVTH 3TYFA 4X6BA 5DD3L 2DM3A 1JRHI 2AXGB 2YWZA 3BZDA 5ESQA 3WUWG 1RU9L 5IMKA 4W70A 1V3LA 5IV2B 5CJOL 5EU6E 4GRMA 5B21A 5C0JA 8FABA 1E4XI 4K3JH 2UWEB 3KPOB 4K7FB 4O2CB 1UT9A 4MHHG 3WUWA 5T1MB 3DX8B 1C5CH 1PSKH 4RAUA 4MJIE 1FNEB 2X41A 1N0LA 3QHFH 1JF5A 3DWTA 4JFOB 1WZKA 3WMSA 1GL4B 4KHTL 1HHHB 1F4AA 3MRRB 4MAYD 1HWHB 4NJ9L 4ZUVB 5K9KB 2EECA 3D85A 3PWNB 4NQEA 4P23C 5B38B 4DUXA 2BRQA 3GBML 3EJZD 1BJ8A 5E2TL 3MV01 1Q9OB 2XKNB 3WO4C 2ZPKL 1S9YB 3MRLB 3GMOB 5GJTL 3MOAL 3H9YA 4OUUA 2ICCA 1X3DA 4X83A 1CLZH 2DDQL 4TVPH 3ARGC 3SKJH 1IQDA 1U3HD 3OB0K 1PBYA 1DBKH 4ERSH 2D7MA 2XN9E 5KN5A 4HH8A 3IDMA 5AWNH 4DGVH 1FBIL 3BD3A 2BERA 1FJ1B 3QDGB 4MA3B 4HS6A 5E7FA 1DQDH 1JGLL 5JOFB 2OL3A 2DI9A 4IRJA 3BP6A 1KGCD 5F7EH 3WFCL 1WUNT 4DW2H 3MR9A 4X8JA 4X98B 2MCPL 3DETD 4NZRH 2CJUL 1P84K 5IP4A 2NXZC 2BP3A 4URTB 5CIPB 2FYYA 1FNLA 1F2XK 3IVKB 3IS1X 1HH9B 4Y4FA 4AEIL 4DTGH 3VWJA 5C0RL 1WEJH 4F7PA 3RWEB 2BVUA 4YIQA 5L88H 3FRPG 4R7NA 2VE6A 5ILTH 3L3JA 5IROA 4N0FA 3FQWA 4QWWC 1DUYB 3INUL 1QEWA 2GTZB 5GGTH 3AS3A 4Z6AT 1MVUB 5GGVY 3FRPA 2UWEE 4Q9QH 3MLZL 3P77B 4ZAKA 3GO1L 1YEGH 4IM8A 2E6PA 2Z0BA 3KPRB 2OR8A 2ADIA 1YQ2A 5FDWA 2IWGA 2R69L 4JEGB 3T8XB 1QO3B 5AG9A 2WINB 4P5MA 1CTOA 4GRWF 1AO7D 4BZ1L 4L3EB 3V4VL 1FAKT 2B4CC 4B41A 3KVQA 1CFSB 1L7TH 5IB1A 4S2SA 5KTEH 3OAZH 3FTGA 4K2UH 3NIGF 3CDCA 4MXQC 4G3YL 1KTDB 2VDPL 4I5BA 3SGJA 3K8LA 2BMKB 2P8LA 2I9LB 3OKOA 3IDXH 3KYMA 3SDDD 4G6JL 2E8ZA 4HIHB 2ZUUA 4HXBL 5KAQF 4M7ZB 5IB3A 1LO2L 3HNVH 1J1OH 3R06B 5C0FA 4XP9H 4J6RL 2X1WL 4U0QB 4XNMA 4WY7L 4NO0A 1S7XA 3WIHL 5BMFL 4DZBA 5FUOH 4LP4A 1UQSA 5CJQH 4Y4HC 1YY8B 4NKDA 4LSRH 2ICWA 4PJIA 1AQDA 2X40A 3AM8C 2IMNA 2J6EH 3RDTB 2FL5B 5JNYA 3F58H 1U8NB 3LS4H 3MLVL 2EXWD 4RNRA 4UBDC 2X4UB 4JRWA 1EVUA 5DMIH 4MA8H 1BLNB 3W2DL 4DCQA 3VFOA 4C58B 4R8WL 1VGEL 2KZWA 3FO0L 3NZHL 4H1LB 3N1GC 2FD6H 3GMPA 3F12A 5DJ2B 3D0VA 4NQSB 3WXVH 5C7XH 1SEBB 4ZFGH 5E08L 1SJVA 2CKBH 4GBXA 3MLWH 3S3PA 4N0CC 1FO0H 4X4XB 4E5XA 1ES0A 5SWZA 3MBEA 5B4MD 2BNQB 4TPRL 1R3IL 5DD1H 5IW1B 4FG6C 2ICWJ 4IEFB 5TPWH 4JJHA 1CWVA 1OY3B 1V5JA 2VLJA 5IK3A 3CXHJ 3EYSH 2JIXA 5DS8A 4WI2A 2HVKB 3UYRH 3KPRE 5ENWA 1A9BA 5CMAA 4KXZI 3VI4F 1IGTA 4XMKH 3V8CA 4P5TB 1ZA6B 4NN5B 4LRNL 1J5OH 4TSBH 4L3EE 4Z7NE 4OV6F 1ZT7A 1N8ZB 5JTWA 3KS0H 1TPXB 4RGND 4F57L 4LLQB 3WDIA 4CBPA 2HLFD 4PG2C 3KXFB 4HK0B 1KT2A 4HUVB 4K94L 5EO0B 3VW3H 1Z9OA 2AJ3B 4MLIA 4U1MA 2YC1A 3VFNA 4MQSB 1A6VL 1QBMH 2HT4D 5HJ3A 4ZFOB 5T3ZE 2ZSWA 4K8RD 4X9BA 3TJEL 2VXSL 1IGCH 1J8KA 3MNVB 4KI5D 1IRAY 4I3RL 5JXED 4HT1H 2AW2A 4WWKA 1MQKL 4IOIA 5D2NB 4N8CL 1A8JH 3FFCB 1RZIB 3SBWC 2NXYB 3CVHH 3VRLE 1SY6L 1CE1L 5FGCB 3O6MH 2CIIA 4NJAH 1KLFA 4Y4KB 2WANA 2A0LC 1QKZL 3AXLA 3PGFL 5T1DL 3P4MB 3HPLA 5EIIB 3U46B 4M1GH 2F58L 1BJ1H 4QRPD 5GRJL 1OP5H 1U8KB 5ADOH 4XWOC 5DRZB 4AENB 3L6FA 1ZT1A 3S88L 3QO1B 1RZJH 3OZ9L 2RBLA 5CD3A 3V0VB 1QA9A 5MERA 2X4PA 1WTLA 5I1KL 1IC7H 4HBQA 3QNZB 2VZVA 5J13B 4X0KA 3Q48A 2BNQE 3BP7B 1RMFH 4MCYB 4YX2L 1IM9A 1LNUA 3HS0B 3MRMA 1NAKL 1FFNA 5C6TL 4FQXC 1MCKA 1NKOA 4E41B 3IT8D 1V3KA 4I0PA 5F7YC 3MRCB 2ZG1A 4OCRH 4QYOB 2CR6A 3VFRB 3MRIA 1TZIB 4GAFB 4Y5XB 3T2NH 1GHFL 2HRPL 2W9DH 4IRJC 2QQLL 3TZVB 4N68A 4NZTH 4IMLA 1U8OB 4R4BA 1AD9B 4FFZH 1UCBL 2X4OB 5GS3A 4K3HA 3TWCL 3KXFE 3WV0A 1CR9H 2JJSA 5EULV 5D72L 4HUXA 4U1HA 5BS0D 1CBVL 3BZ4A 3CPLB 4MD0A 4A6YB 4QHMB 2E27H 3A6BL 2ZUXA 5ICYA 5JPMA 3UZEA 4YGAB 4WI9A 5I1CL 1D6EA 3PV6B 2VITB 3I6LE 4ZO9A 1T22B 3OKDB 2YPVH 3FFCE 1I8LC 2FSEB 3HMWL 4GMSL 5C0BD 2Y5TB 2E3VA 4ZAKC 2O5ZL 1G9MH 2HFGL 5E1AB 4LFHG 1X5XA 1QFPA 1T5XA 3GZKA 3V6OE 3DYOA 4YHOL 1RZ8A 1Q94B 4JG1H 3BOVA 4U6XA 3IXTB 5DHYA 3V9FA 2C7UA 3L5JA 1HCFX 3PXHA 43CAA 3D3VB 5L8KB 1QRND 5JW4R 1KCUL 3ZYZA 2R39A 1T1WA 2YKLL 3VFPB 3SGJC 3U2SA 5A2IH 4QXWA 1MRFL 2YD8A 4HWBA 2P8MA 1YMME 4KK8C 4N8VG 2ZSVA 4AT6B 4EXPX 2N56A 3WLWC 2WW8A 1C5DA 1OGTB 1BOGA 1UM5H 2VDNH 5I2IB 3IAGC 2GJZA 4DUVA 1QVOA 2J3SA 1NANI 1LMKA 1P1ZB 3SO3C 1HSBB 5C2BH 1FCGA 1IGJA 3Q6FB 2HJFB 3FB5B 2CSPA 3JTTB 2EEAA 5C9KA 2H3NB 4QF1A 1DLHB 4BH7A 2Q86B 1BJMA 1XGUA 4LQ1A 1YEHH 3SKNB 2X7LB 4E41E 1CL7I 1VB9A 1WT5C 1FNSL 5IMOB 2R1WA 1GZQB 1P84J 3RVWD 3QNYB 4PJCB 4KMQA 1MI5A 3ZKMC 1KJ2A 4QHUA 1CF8H 1U3ZA 4KJYB 4XVUD 3IJHA 1NUDA 2BNRD 3LQAC 3FT4B 3BRDA 2G75B 2DS4A 3WFEH 4UQ2B 1ZGLA 4NO3B 3OXSA 4M7LT 1TTFA 4Q9CA 4QRTB 1JPTL 4MDIB 2E6JA 3GSRA 5EFIA 1B0RB 4G9DA 2GJJA 3MRBA 4P46B 1FVDB 1JWSB 4F7CB 5A16A 1T20A 3MJ8B 3QP3A 1TQCC 3RWJA 4GBXC 1J0KA 3OGOE 2AEWA 1JI1A 4LEOA 4OJFL 3IDIB 4JO4H 4OLUL 4QXTA 3S37H 3TFKC 3UPCA 4FQQA 3V95A 3BDYH 3MBEC 3BUYA 4GXUM 4P2QB 4HUUB 1S9WA 4OLWH 3F7VA 1XEDA 1FZMB 1XGQB 3O4LB 1T83A 5E7BA 3WNNA 5HHXH 1JI2A 4MAYA 3ULVC 1YN6A 4LCYB 4YHKL 1ZS8B 2BSED 3BJLA 4U1NB 4IDLA 1C7SA 5DQDL 2FHFA 5C08D 2ZOLA 3D3VE 1JPSH 2R29L 4G42B 4XNZB 5IESH 1KEGL 3V5DB 1A4JB 4PJAF 4ISVB 1XCTB 1QP1A 3OKMB 2APXA 3QIUB 5F7DA 4HQQH 1AXTL 3P9LB 1GH7A 2RFXA 5F71A 5HPMB 3NCBB 2NZ9C 5I6XB 1LEIA 2OR9L 3VXOA 1PX4A 5FYKL 2Z31C 4KTDH 5ID0A 3JWNC 4MSWA 4UOW1 1RIVH 4MX7B 3G6DH 2O5XH 2XTJC 3V6ZB 1KLUB 1QR1A 4KC3B 5INCA 2YUZA 4NO2A 1I9JH 3VCLB 1CFTB 2B0SH 3QA3A 3O3BB 1I7ZB 2R4SL 4GRWH 4AQOA 2MHAA 4N0RA 2NY5H 3TPUA 4R97C 5D7KD 1X4YA 2QHRL 2GTWA 3PDGA 1JZ2A 4MD5B 1A6TB 5JUEH 4OQTA 5TQ0L 5FYJH 5JW4M 4XX1E 5A3IC 1A14H 4X7SH 2FNBA 4P5KA 3TT1L 4G5ZH 1BFSA 2HN7B 4ZDHA 3HFMH 3ARSA 3R8QA 1FNAA 4NZDA 1CXLA 2VDRH 3ARFB 3GJFK 3IF1B 1AGBA 3ULSB 4L29B 4CVXA 1AO7A 5FDYA 3UZQA 4HC1A 4P2QE 3FB8A 4X99A 3ELAT 1G0YR 4JFYB 3ARUA 4M4RA 3J7HA 5IT2L 1C08A 2CDFA 1IGIH 1ETZB 5D71H 2IPTL 1AFVL 4JHAH 1I1RA 1FSKC 3SDDA 1AXSB 3S5LG 1YEKL 4CMMB 1TZHB 2NLJB 2RB8A 5F21B 1CGUA 4NN7C 2ITCA 3GRWH 3KAAA 1EHLL 2R4RL 2G5BB 1ZV5A 1ZHKB 5KSAD 1KC5H 2JJSC 4Y19E 3OV6A 3S5LA 3SEPA 2P5EA 1J0ZA 4XAKD 3ABZA 5LWYH 5B39G 3FMGL 4GXVL 2E7HA 4ETYA 1WBYA 5E2VH 3JXAA 4JANB 1OLLA 1U8LA 1CD8A 4I8DA 4O4YH 3DROB 1MF2L 3CFIC 4MCZB 3HNSL 4ONFH 4KKCD 4EI6B 3ZTJH 5B39A 2Y9RT 4K7PL 4NBYB 3VXPA 5IBLD 4QRRD 4MNQD 2DL2A 3THML 1MHEB 4ZPTB 4KJQC 3WHXB 3MOBL 4PJ7A 5D7IB 3L3IA 4RMQA 2GT9A 1LEKB 4PLNC 1EJ6A 9CGTA 1OAYH 1U2HA 1OAXL 5IJKA 3BAEL 5L7XL 1TMCB 1UCTA 4JM2F 25C8H 4UUJA 4X4YA 4M6OH 5HI3D 3IJSA 2FWOA 4PRID 1J8HD 1U2CA 2XXMB 3I3DA 4UNUA 5ACMA 2VR4A 4JDVB 4P23B 5CEXB 4P59H 4FRWA 3MJ6A 2G60H 4O2FA 5EBLB 4Z0BL 4K9EC 4JCMA 1C1EH 4X6EB 3WO4B 3QPQC 3MUGB 4XPGL 4N5EA 2GFBB 4CU6A 1FVEA 4U49A 3K1DA 3IDJB 4Z77A 3MRGB 2Q8BL 5GRYA 2C3WA 5FHAL 3QRFM 2UYLA 4PUBH 3TNNB 5I76A 2AJZA 4PJEA 3E0GA 4LKCB 5JQ6L 1AR1C 5AG8A 2C1OB 3CSYA 3VXTB 3IFLL 1RFDH 2AJXL 1D9KC 2X1OA 1I9IL 2G2RA 3I6GA 1RUKH 5DHVB 3QWQB 2EYTB 1EX0A 1OGAB 3FN9A 3BIKA 3O2DL 4YDIL 1JL8A 1EFXB 5HDBF 1FL5A 3U7WH 2Z8SA 1NAMH 2DBLH 1MJJA 2OBGA 1OTTD 1BWWA 2NXZB 4JO2L 5JOPD 2DB8A 3UJTH 5CUSL 4RWYL 1ZOXA 4NRXA 1RZFL 2H9GA 1YYMH 1PKOA 3SJVD 4TRPL 3WD5L 4RFEA 1U9KA 5JXEA 4BUHA 2VH5L 4LLDA 3CU7A 1EA9C 4X9HA 5KS9B 2VABA 1WBXA 2KKQA 5C6WH 3LN4A 3Q6GL 3TP4A 5I66B 5I1DA 3MFFB 4XPFL 3X11A 4GO6B 3WKML 1WZ1L 1YEJL 1A7OL 5D7IE 5F9JB 4QRPA 4HGWA 3SGDI 1T83C 3ZKQD 2DYPD 3D39D 3QEUA 2VQUA 4L4VB 1HI6B 2E7LA 3QXAB 4WFFD 1Q72H 3FO9B 4C56D 5F44A 1FIGL 3EJZC 3B2VH 4QXGH 5DJ0B 1RK1B 3M8OH 4CW1A 4X6DA 5GRVL 1M7XA 1GC1C 4K3JL 5CILL 1RUML 1XZ0A 4LLMA 3P40A 1U3HC 3UTOA 4OSUH 3TCXA 4O58H 2EH7L 1QYGL 4GSDH 1C5CL 3O6LL 1J87A 4RAHA 4JZOA 3GIZH 2UWEF 2WMPA 4XPBH 2IAMD 2DJSA 4XH2B 3UJJH 3GMLB 5FUZL 4S1DD 3T0AA 2K3TA 4Z7UF 1CICD 3L5XL 1MCSA 4M8QA 1FL3B 4KGLA 4AIXA 4Y4HB 3KLHD 5GRXG 2XY2A 1NJ9A 1ZA3A 3REVB 1OGAE 5IGXH 1BF8A 1U8HA 3DETC 4U7SA 5DI8B 1DQLH 4K55A 5E5UB 1G7PB 1CLZL 4POUB 3SKJL 4L1DA 4XC1L 4MWFB 4HWUA 5BS0A 4JZNA 1YDPB 1D5ZB 5A2LH 1DBKL 1OQOA 4ERSL 4OCYH 5AWNL 3EOAB 4S11A 4BQ9A 1MWAB 4V1DD 3MQIA 1D5MB 1I3VA 3GM8A 5HI5D 4GMTH 3DO7B 2FRGP 1J10A 3K1KC 3AROA 1JIBA 2AERT 5IKCB 4LU5H 5EA0H 4KROC 4PYGA 1RURL 4XVJL 2ICEB 5DTFB 3QB7C 4PREB 2AQ2A 15C8H 5F7EL 3TN0D 1JWUA 4DW2L 1J11A 4JFPB 4PLKD 5C0BA 4XVSH 2F8OA 4DOHB 2AXFB 4NZRL 4FQ1L 1MCWW 2DLHA 1I1YB 5FGBA 2SEBB 2F9BT 1MUJB 1JBJA 1RIUL 1QRNA 1X5KA 4O9HH 3MRNA 2F8XC 5HHMA 2UY6A 1XGRB 3MRQB 3STZB 5CHNB 5JHDD 5KSBA 1ZEAH 3AY4C 3DYPA 3HZKB 3EO9H 2VLKD 2GJ6A 4YNYB 3SDDC 3ZKSD 5LXGL 1LGVA 1EJOH 5GGTL 1IEBA 5C0CB 5FEBA 1Q1JH 1YEGL 2PKDA 4OFDA 4JR9H 1AKJB 5IVZA 3HRZB 4PJXA 3TYFB 5C3TA 2XZAH 1JN6A 2E9WA 3JV4A 1NBQA 5ESQB 1X5LA 2R9HD 3GJFA 3H7BB 5I8KL 1NCAH 4EOWL 5IMKB 4QGTA 4K2UL 1VPOL 1WWCA 4GRMB 1U92A 5JW4Q 5C0JB 8FABB 4L9LC 2EXWC 4WVRA 5FO7A 1FLRH 3HC0A 5KVEL 4ZOAA 1A1NA 1J0IA 2DKSA 3LD8C 5DJAA 2DMCA 1BFVH 4LSVL 1DQML 3RU8H 4OD2B 2DKUA 4XP9L 2QSVA 4J3XA 4LIQE 4KVNL 5FM8A 4NQEB 2H26A 4YPGA 2PW2A 1F4HA 3JV5A 2Y6SD 2B20A 2LFGA 4YBQD 3NACH 3UBXI 5DK2A 3ULUC 5CJQL 3ROLA 2J4WH 4LSRL 4N1EA 1NLBH 1SYSA 4WEUD 5F7MC 4OZGB 4ZUWA 5B4MC 5I30H 3BEVA 4OUUB 3EYQD 4ZSOB 1U36A 3LS4L 1IQDB 5CEZH 1X5YA 3BHBB 3RZCD 3ILQD 1TCRB 5HHOD 3IDMB 4DUWA 4RGMC 5C07D 1WF5A 3DUSA 2FD6L 3ZT7A 3HC3H 3U30C 2OL3B 3QWOB 5SWQA 4LPWA 2ARJA 4IRJB 3BP6B 5C08A 3WXVL 3WIFA 5C7XL 4ZFGL 2HLFC 1ZHNB 2R8SL 4P2RE 3E6HA 3MR9B 2VXTH 2XWJA 4C57C 5C3LD 3IDYC 4XNXH 3LSOB 5DD1L 5T5NG 4V3DB 1FYTE 1X5ZA 4OZIA 2ATKA 2FYYB 2IBZY 4MNGB 5C0CE 4YXLL 3OAUH 4Y4FB 3I2CL 4PY7A 4K8RC 4G6AD 4Y8AA 1J12A 3BVNA 4EUPG 1I9EA 4ODVH 4YIQB 1MIEH 3MZTA 1J5OL 5HHNB 4R7NB 1X7QA 5JXEC 2A74A 4RQQA 3L3JB 5LCVH 2DIBA 1K4CA 2GIYA 3FQWB 1OWRM 3BMWA 2BX5A 2C5DC 3GBNH 4HS3A 4UIKH 4YDVA 3KR3H 5J9PA 1QEWB 4EUPA 5AYUL 4UTAH 4OIIH 1ORQA 1S7RA 2C3XA 4GAJH 2NNAA 4KRPB 4ZAKB 2WBJC 2EKSA 4DK3A 5FF6B 1X4ZA 3MV9E 2ADIB 5BZWB 4Y2OA 5FDWB 1RIHH 4P5MB 4L5FH 2JJVA 3B4NA 1UJTA 3QBTB 4S2SB 1L8JA 1IGCL 3FTGB 1GZPA 4S1RH 2Q7YB 1CDCA 1I8IA 4HT1L 4I5BB 4CUCA 2WSKA 1WAAA 4HBCH 3OKOB 5DMYA 3KYMB 3ZYIA 2PXYC 1N64H 4Z76A 3O6ML 5IB3B 4XWGL 4OZGE 3D9AH 1HZHH 5C86A 4ZSOE 5FYLH 1I9RH 3SO3B 3KHQA 5C0FB 4N0YH 4Z7VB 4NO0B 2QQKH 2FECL 3V7AG 3RGHA 3SE8L 5ADOL 5L6YH 3RWDA 4DZBB 1OQXA 1ZVYA 1QQDA 2LVCA 1RZJL 2VISB 1MCEA 3FT2A 1G0DA 4NKDB 4LASH 5L0QB 2ICWB 1HHIA 1AQDB 1MLBA 3IFNL 4UQ3B 5LGJA 4RNRB 4W4OA 5F9DC 2RAMA 2X1PA 4DCQB 3BYTA 3VFOB 4ODTH 3TCLA 3GEWB 2DOCA 1RMFL 4U6TA 3GMPB 4MNGE 3NTCL 3D0VB 3ARBD 2FZ3A 4OCRL 3PQYA 4M43H 4M4PA 1TQCB 4PYHA 4GBXB 3LRSA 2BSTA 4QRRA 3I50L 1HXYA 4MNQA 5FM4A 4KUZL 4E5XB 1ES0B 1K4DA 2VYRE 5SWZB 4HGMA 3MBEB 3LDBB 3OJ2C 3EFDL 4MB4A 3CVIH 5TF1H 2VLJB 1Z6JT 2AV1B 5IK3B 1Q0XL 2DBJA 4CN4A 1CQYA 2JIXB 4PRIA 5DS8B 1J8HA 1BWMA 3HAEG 5FGBC 1EDQA 2I60H 2E27L 5EORH 2AQ3A 2ZUQC 1KBGL 1MCPH 5JO5A 2V7HA 1ZT7B 5E6IA 3HAEA 4G6FD 4X5XA 2X6MA 2VZUA 1UACH 2OM5A 4RDQF 3T0VA 1KT2B 1OP3K 2CIKA 2CLRB 4BFBD 4F9PA 3NIFE 1G9ML 4DKFH 3VFNB 4UV4H 4BH8A 4NP4H 3DUHA 2ZSWB 3JWDH 4Z7VE 1U93A 5DVMA 5F6HI 1MHPH 3MREB 5FYKD 4EZMA 2NR6D 1REIA 3TO4D 4Y8DC 5DVOA 1F4YL 3DXAD 4WWKB 2VLME 3RVWC 2Z31B 1FQ9C 3GBLA 1T21B 4U1SB 3ZMRA 2XTJB 4RFOH 2YPLB 2VAJA 2CIIB 4E0RA 4XVUC 1JJUA 3PJSA 1F3JA 2V2WA 1BQLH 3SJVA 1UM5L 2VDNL 4XCCH 3X3GH 4NQVA 5SX4H 3AXLB 5EIQA 3HPLB 3QEQD 2KPNA 5BV7H 2I9TA 5C2BL 4G8FA 1EBPA 4DAGH 4R97B 3SE4C 3GI8L 5JLZA 5I8OH 3MNZA 3L6FB 1ZT1B 5DD6A 3MO1A 2O61A 1M7DB 5E5MA 1F6LL 5CD3B 3LN9A 1QA9B 5JR1H 2P7TA 4LK4A 1V8HA 3UAJD 1A4KB 4BKLA 2DLIA 1CF8L 4X0KB 5SWZE 3SDXA 1OARH 2DYPA 2UZXB 3D39A 1IM9B 5BVPH 1LNUB 2VLJE 4PJCF 1OVZA 2DQGH 1FFNB 5ESVA 2EDRA 3S4SG 3MZGB 3ULVE 2OTPA 4MNHA 2OJEB 3BEWA 4PS4H 1T7WA 2NY6C 1FSKB 3U4BH 2NY3D 1WIPA 4Y1AD 4B50A 3S4SA 4IMLB 4UT6H 4YDKH 4JO4L 4R4BB 5L2KB 3BDYL 2FH6A 5CJBA 4HMCA 3WIHA 4HUXB 4U1HB 5DMKA 4PJBA 2CR3A 2OZ4H 3BZ4B 4MD0B 5HHXL 2UZIL 3VXMB 3O3UN 1UB5A 4G7YH 2XZCH 1CICA 1MFCL 5IEHA 3QPXH 1N7MH 3RTQD 4CMHC 2H45A 1D6EB 2WP3O 4BZYA 3RVVC 1MSPA 3U1SH 4DK6A 2DQJH 3RUGA 1WWAX 5JZ7D 1B0GA 2GW5A 3S8WA 1BZ7B 3ARWA 2XTJE 1CZ8L 1JGDA 2YPLE 1HWGB 4KQ3H 4V1DA 5FKAB 5C0IA 3WS6A 4MD4A 2A9ML 4PDCE 1T5XB 3W5NA 1C5BH 4P49A 4IHOB 1GJIA 4NSKA 1RZ8B 4HQQL 4UT9L 3E3QA 4U6XB 2C7UB 4UU9A 2YXMA 3TN0A 3MXVL 1DR9A 3LKNA 43CAB 4XNQA 3GMMA 1PY4A 3HG1D 3QG6A 5F1IA 1T1WB 3FB6A 3GK8L 1OSPH 3ZO0A 3U2SB 4R26H 2WP3T 1ZLUH 2ZSVB 2YSSB 1RIVL 3SQOL 3RVTC 3G9AB 1C5DB 1BOGB 3KPSB 2GJZB 1CFVH 1QVOB 3AREA 4FZEH 4LSSH 1A6UH 4OFVA 1W72A 1I9JL 2DLFL 1KPRA 1D9KB 4MJ4A 1IGJB 1K6QH 1I8KA 1F3DH 3BT2H 4NQDD 4OM1H 2B0SL 4WFGD 4PB9H 5DWUH 1S7TA 4BH7B 1N5AA 5GJSL 2OI9A 1EO8L 2IC2A 2R1WB 2VLKA 5EO9B 4HPYL 3SKUD 3ES6B 4JRYD 5FYJL 1OTSD 4X7SL 5MEQA 1KJ2B 1IVLA 3HFML 4GAGH 1BFTA 4YBLC 2VDRL 4W4OC 2APVA 5L2KE 5KSAC 4GG6A 1IM3A 5KSVA 1JZ7A 3QFJD 3IETA 1T1XA 4MYWB 3OXSB 1NBVH 1TQBC 4FHBD 4Q9RH 2GK2A 3GSRB 3Q5TA 3CC5A 3U0PA 4G9DB 2YD2A 3VXME 5K59F 5AZ2L 4GW4A 5A2FA 3IFPA 1T20B 1MNUL 4XBEH 4RGOH 4TUJA 4LEOB 2HA1A 4KKBC 4QXTB 1I1FA 4FQQB 2ZCKH 1MCNA 3BUYB 1MCHA 1QLFB 2CRIA 3UMTA 3ZTNH 1E4WL 3F7VB 3KNBB 3RPKA 3S34L 1JPGA 4MAYB 4W6XB 1XAUA 5I18L 1YN6B 3V6FA 2NY1D 4U6HB 1HHGB 1OAKH 5E2VL 1MH5A 3I75B 2WZPD 4O4YL 4QTHA 1QSVA 1Y18A 4APQD 3P0YL 5H35B 2ZOLB 4ONFL 4E9LA 4XXCA 4WW2F 5D2LB 1U3HB 4K23H 5MP6H 5E24E 3RZCA 4H1LH 3FHQA 5HHOA 3RL2A 4P4KD 4GUPA 5CLTA 5E6ZA 5C07A 4F9PC 3VFUA 3QDJD 3KPSE 3F8UB 3OAYH 4NZUH 3QUML 2DQFA 2IH1A 4J2XA 2MKLC 2RFXB 5D7IF 4TVSa 4J3UA 4EBQH 1Z9LA 2A73A 5C6PB 1P5UA 1CGTA 3VXOB 4AEHL 3K74B 1FZJA 4LVEA 2Z9TA 1MAML 3HR5B 2HJKA 4MSWB 1OTTC 5AZEL 3MLRH 4JGMA 3MLSH 2UUDH 3BYYA 4LSUL 3TJHD 3VDAA 4ELMA 4PUBL 5INCB 3P3YA 2X89D 4NO2B 1J88A 3GMRA 2Q87A 3ROOA 4JM4L 1RFDL 2WLZA 3QA3B 3FFDA 5EC2A 3BIAX 1BX2A 3G5VA 3IRZA 3TPUB 1GPOH 4UT7L 3JV6A 5ANMB 1QNZL 4O2EB 4AG4L 3K2UH 2GTWB 3JTSA 5CFHA 4XB7A 4P5KB 3WSQH 2DBLL 4CNIA 2EZ0D 4CU7A 3VDCA 4KJPD 5B3JE 3KPTA 2FR4A 4PP1D 5A43C 1AGBB 1NLDH 1N3NB 3UJTL 4CVXB 1AO7B 5EBWB 1CVRA 2VKWA 3FB8B 4X99B 1U58A 1IZKA 3KJ6H 3LKSB 1NGPL 5FK9A 2Q7NA 5HHVH 3U79A 4CVUA 4R96B 2BHZA 1E6OH 5HYSB 5FO8A 3SDDB 4BELD 1JHTA 3MA9H 4KMTL 1NCUA 1P5VA 2ITCB 1UG9A 3C2AH 4DGYH 5D2LE 3ILPA 2PCPA 4HKXA 1IC4H 2VC2H 5KS9F 5HDLA 2IAMC 3S5LB 4ZUTA 2PTTA 4S1DC 5FCUH 2AGJL 3ZKNC 4BZ2H 3SGEH 1WBYB 1CICC 1J0JA 1YEDA 3KLHC 1CK0L 1Q72L 4H0GA 4EVNA 3B2VL 4L9LB 4QXGL 1KGCE 3M8OL 2D7QA 3N9GH 4PRAA 3H3PH 1MCOH 5B39B 5GRVK 2F5AL 5BZDA 3LD8B 4LGSB 4PJ7B 3OTTA 3PWLA 3L3IB 2GT9B 4GSDL 2DMKA 4XP6H 1MOEA 4PRHD 2I25N 4YLQT 2VLRA 4WNQA 3GIZL 1LILA 4UUJB 4UILL 4OF7A 4X4YB 2C4FU 3ARBA 4NUGH 4XPBL 2ZUYA 3IJSB 2FWOB 3BESR 4LAQH 3V0AC 2HYMA 5IVXA 4JQVC 1RULL 4KK5D 4D9RD 1FH5H 3MMEA 3E3QC 4O2FB 5KOVC 1T6VN 1K3ZA 3TN0C 1P7HL 1S9VA 3ARDC 3TPUE 4FMFA 4HKBB 5ANME 1HYSD 4JHZA 3O0RH 1XR8B 2LAAA 4HV8A 1KTKE 4MJ5A 4A6YH 4Z77B 2PR4H 3T2QA 5MENB 4YGVB 2N7BA 5I1IH 1OT2A 2UYLB 1AE6H 3MRFA 2AJZB 4PJEB 4RGMB 2EDFA 4OCYL 3CSYB 3RY5A 2X4QB 4ESKA 3NFPB 4LSQH 4UV7L 2G2RB 3I6GB 4XPAH 3B8SA 4RMRA 4LPCA 1F90H 1QBBA 3WFHA 5EA0L 3N0PB 1G6RL 3BIKB 5I71B 3PG2A 1BGXL 4BQ8A 1FL5B 4O5LH 3DVGA 2VDMH 3HCVA 2BSSB 1MJJB 3IDYB 2CO6B 4JO3H 3UCRA 4N1HB 3RWGB 4NRXB 2H9GB 2EYSA 3MRPA 5FHBL 3OX8A 5J06A 4U1KB 1R3HA 5ISZE 1WJ3A 1F00I 2QBWA 3TO4A 2R9HC 2P49B 1R24A 2KQNA 3DXAA 1AP2A 4G6MH 4IMKA 4AIZA 2M1KA 4O9HL 4UNTA 3CMOL 2VABB 1WBXB 3LN4B 5C09D 1T5WA 1ZEAL 3TC9A 3EO9L 2JK5A 5I1DB 4JRXD 3VGAC 4ZS6D 3CFEA 1F6AA 3GKWL 4NNYA 1KNOA 3P4LA 4OFYD 4XPHH 4PJ7E 3VH8G 1GGBL 4JR9L 2IALA 3C09C 3VRJA 5JIPA 3DGCR 2EEDA 2F54D 1ZWIA 4M48H 4M7KL 1FZOA 3QEUB 4Q7DA 2XZAL 5GISH 2Y6SC 2FIRT 3JWOL 2WUCH 4YBQC 1NCAL 3VH8A 5DO2D 4N90D 4ODUA 4CW1B 5BJTB 2VMFA 1AH1A 3EYQC 3ULUE 4NM8H 4XXCC 4ZNEA 1FCCA 3PABA 3MXWH 3ILQC 4JG0L 2OMNA 4FP8L 4RSVA 3BMVA 3CFCL 1ZGLP 5MENE 4JZOB 3MACH 1FAIH 3RU8L 2BY1A 1AGEA 2HH0L 3W11C 4PJEE 3FN0H 2K1MA 4JPWH 1E28A 1HDMB 3VI3F 1A0QH 4IOFD 3BX7C 4Y1AA 4M8QB 2ZWLT 4XP4L 4WI8A 1YC8A 1NJ9B 1ZA3B 2J7LA 3NACL 1MIML 4LCWD 2IEPA 4UDTA 3H42L 2A6IA 5BS0B 4JZNB 3N1MC 4QRSA 1YECH 1KENL 2YUVA 5CINH 3RL1A 3BDXA 3VMNA 5D7LB 2W9EL 1P4LA 1I7TA 5DRXA 3RTQA 5AYQA 3VWKD 4OCXL 3LIZH 2YD1A 4Q97A 5EPMA 3ESVF 2FHBA 4HDIB 1JWUB 4XCNA 2AS5M 5ERWA 1BD2D 5D7JA 2B5IC 5C0BB 1QLRA 2VXTL 1KJMA 1FRGH 4R90L 2ILLA 2R0KH 4X6CA 5DEFA 4XNXL 1ULVA 2VDQL 3A67H 3ARVA 4OCMC 2ADGA 3UC0H 3IDGA 4X7DC 4KJWD 3ET9F 2ZUQB 4CN6A 1NCDH 3PGDA 1H5BA 1QRNB 2BFVH 3HG1A 1MIEL 5J6HA 1BFOA 1KB5B 4PLOB 2PO6D 1YA5A 3IJYA 4AMKH 1OW0A 2JB6A 5KSBB 4KU1A 2GI7A 2Z91A 5A40E 2WV3A 2DQDH 4UTAL 4OIIL 1IEBB 3MOQA 3RAJH 1C7TA 4FXKA 4TVPE 2ZG2A 3EAKA 4ODSH 5GGQH 3VXUB 2YRZA 4JVWA 4NQDA 4GOSA 5IVZB 1T0NA 4LDEB 4TNVK 4PJXB 4FA8A 1EPFA 4L5FL 4X7CC 4P2YA 1JN6B 4TSAH 1ZLVH 1NPUA 3L3GB 4GKZA 1U8IA 3GJFB 1DL7L 1NFKA 1L0XA 4JRYA 4G8EA 1P6AB 4S1RL 1M6OB 1QHOA 2XPGB 4U1IA 4FTVB 3MCG1 2Y07H 2JJUA 2BNRB 3HC0B 3AMKA 4LMQI 1K2DA 3DURA 4HFUL 3QUKA 3QFJA 1HZHL 3MV8D 2EIZA 2GUOB 5FYLL 2Z4QA 2HTLC 3ARBC 2QQKL 3IU3B 2JB5L 3LEYL 3NIFF 3ALWA 5J1TC 4YPGB 1UM4H 1JV5A 3BKYH 1OP5K 5L6YL 5D7LE 2CKBB 3GGWA 2IANE 5DK2B 5EZIH 1D5XA 1MCQA 3ROLB 4LASL 1JGUH 1SYSB 4ZUWB 1J1PH 5J6GA 3BEVB 1YC7A 3FOLA 1NUNB 3DBXA 1CLYH 3X13A 1WWWX 4BJLA 2X1XR 2GY5A 1R5WA 2JCCE 2VL5A 3A6CH 2LV4A 5D1XD 4PJIF 3VG0H 2J88L 3ZYJA 2E8YA 2NY6B 2ARJB 4APQA 1L6XA 4O02H 5C08B 3WIFB 2ERJC 2IPKA 1KEMH 1RUPH 3E6HB 4J4PD 4P4KA 5KSBE 1WIUA 2FDBP 4CVWA 1MHHA 2GITB 1JHKH 1T4KA 3QDJA 4UDUA 1PQZB 4ZPVA 3MJGX 4EDWH 2ATKB 4OZIB 1KCVH 1UXWA 2VDLL 4OAWA 4FQIH 4PY7B 4X9GA 3VXUE 3WFDH 3BVNB 2FJHA 5EORL 5IB5B 3TO4C 4J12A 4PJXE 1X7QB 2A74B 4CMHB 5F72S 3B2UD 1A7RH 1K4CB 1FV1A 1UEYA 4HS3B 3ULVF 1I3UA 5J9PB 4G80A 3FQXA 4UAOB 4KWUA 2QSTA 1ORQB 1S7RB 1DJSA 5K9OA 2NNAB 5D1QC 5MI0C 3TA3A 5T33L 4FTVE 3WXWH 4JLRB 2MCG1 2XICA 3RFZC 3O6FC 5DHVH 3B6SA 2YN5A 5CCKH 1AI1L 2BNRE 3GFUA 4PJ8D 2FECI 1SVZA 3FRUA 2W91A 3CH8A 4DKFL 1JVKA 4OM0L 3VXQA 3I6KB 1R3KA 1UWEH 4NP4L 1SMAA 5IW3A 2E6QA 1KCKA 1KJVA 1MHPL 3SO5A 3T3PE 1GSMA 4DFIA 3D25A 4HWEL 1GZPB 1I8IB 3NIDE 2GSGB 3PUCA 3UAJC 1S3KH 5HY9A 2J8HA 4Z76B 4JAMA 4RFOL 5CAYB 3PV7A 2Z8RA 1KXTB 1U0QA 4XCCL 3F7PC 3S98A 1WITA 1FC1A 5BV7L 3OB8A 2D9QB 4MVBA 4LQFL 4GT7A 5GS2D 5B22A 1PZ5A 4TYUA 5GGTA 3UTSE 2NY3C 3QDMD 2LQRA 1S5IH 1QQDB 3ECBB 3H3KA 4LARH 3QEHB 3FT2B 5EC1B 1HHIB 1MLBB 4JY4A 1MCBA 5JR1L 4OB5L 4OF3A 4F3FB 5LGJB 4YBLB 5IB4A 4XCFL 5KSAB 2Q6WA 4X4ZA 3WNKA 1IAKA 1CU4L 3KPLA 3KYOA 2OTUB 1OARL 2CUMA 1TQBB 3OXRA 5DLMH 1V3JA 2M8XA 2KH2B 2DQGL 1GIGH 1YNLH 3GHEH 1E4XL 4X6FA 3QJFB 1MRDH 1BZ9B 4WHYG 4D3CL 2GSIA 1P7QD 3QRGH 1N2RA 1W8NA 5GXBB 3LRSB 2BSTB 4QRRB 4MNQB 5TDPA 5JZ7C 4Z9KB 4YDKL 5BXFA 4LCIL 3U36A 4PRHA 3FAXA 3LRHA 4JHBA 1EO7A 1CLOH 2FBOJ 4PRIB 4LHQB 1J8HB 5KJRH 4FZ8H 3QIBD 1JWMB 4V2BA 2P5WA 5GS0L 5HYQA 2VXQH 2BOCA 4G7YL 2XZCL 4HLJA 2Y4SA 1U3JA 5JO5B 1H5BC 2V7HB 3WDHA 4D9QD 4QTIH 3QPXL 5KW9L 4Q9BA 3HAEB 3C5ZA 4QHKJ 1YUHA 4X5XB 1OW0C 1T1ZA 4X9FA 1F97A 4RMTA 5EOCL 1HHKA 1MLCB 2ZKHH 2O5YH 4BK5A 3DX7A 4NM4H 3DI3B 1G9NC 4BSJA 1YJDC 4NKOB 2ED8A 5HGBA 4NKIL 4BH8B 3K2MC 1H3XA 4OLXL 1T3FB 1C5BL 3CD4A 3REWA 3TF7A 1IC5L 1U93B 2H8PA 1P4IH 1QFWH 1YEEL 1QOKA 2FJGA 4GRLD 3DRQA 1X5JA 2NW2A 1FNGB 1OTSC 3UJIH 3EUUA 3ZSSA 1UM6L 3LQZB 4R26L 1YEIH 2FX9L 4UMGA 1A7PH 4E0RB 1FFPA 2YBRB 5IBUG 1F3JB 3DV6B 3V7AE 5KVFH 2V2WB 4QOKD 3SJVB 2A77L 1J9CT 4LDOB 1CFVL 2D0FA 3RPIB 4NQVB 4FZEL 4LSSL 1G7JA 5DUPL 3ZE2F 1TETH 4G8FB 3BT2L 4JM2C 2XYCA 4OM1L 4X5WB 3O3DA 5ESAA 4PB9L 5DWUL 3QQ4B 3MNZB 1IQWH 2NY7L 5DD6B 3MO1B 2O61B 4G9FD 4LF3A 5E5MB 3EIFA 3LHPL 4JRXA 1OM3H 5EZOH 1OSZB 2IG2L 3MGTA 2YD7A 4NQCE 4BKLB 1J7VR 4OFYA 4MNQE 1X5FA 5I1JH 4YWGL 2EYRA 1D6VH 4GAGL 4C59B 5DVNA 5EO1B 2F54A 2DYPB 3D39B 4WFHD 2A1WL 5E95B 4WU7B 5ITFA 2DJUA 2NY1C 3F7QA 3B3IA 4C56B 4PRIE 1J8HE 3ME0A 3AAZA 5CSZA 3FB7A 3BEWB 5GGSA 3I9GL 5DDHA 4APQC 2NY4C 4RGOL 4NWTH 1Z0NA 2PYEA 4XBPB 4ZUUA 5T3ZL 3TM6A 5IFHL 3O2VH 2ZCKL 3DOSA 3RIFK 2K9UA 4AEFA 1MRCL 1MFDH 1L6ZA 4TUKL 2IAMB 5DMKB 4TOYH 5DEZA 4MXWH 4F7TA 3SPVA 5B3JF 1UB5B 4M7LL 2FX7H 1CICB 1UH2A 1TJIH 4X9IA 1OD9A 4LHUD 5IEHB 1OP9A 5A2KH 5C0AA 1KCRL 1FFOB 2BZDA 4CAGA 4X80H 3QI9A 3M45A 4JB9L 4LCWA 1CD0A 5EUOA 1Z2KA 1X5AA 4ZD3H 4P4RA 2R0WH 4JKMA 3RUGB 1B0GB 5MP6L 3TJHC 4LOUD 3BPLC 1QSED 4NC0B 4OD3H 3BFOA 5JOPE 1JGDB 2OL3H 2XWTA 5C0IB 1DBBL 5T3XH 2AEPH 3QCUH 3EO0A 1MPAH 4F15C 3SJVE 1SVCP 2V6HA 4NSKB 4XB8A 2IGFH 1G7QA 3VWKA 5FO9B 3CUPB 4NHUB 3TN0B 2YS4A 3LKNB 3QG6B 3HMXH 2LABA 1BD2A 4UI2A 2V7NB 2EXYD 2EZ0C 2H32A 5I9QB 2ZUWA 4HCRH 1MFAH 2RCSH 4KJPC 4L8BA 5J7CC 4PP1C 4DGIL 4OKDA 4DEPC 4XNUH 1N0XL 1W72B 1HILA 2XZZA 1S8DA 2CUIA 2GYSA 2YWYA 5LQBH 3D39E 4ZXBD 1FGVH 1S7TB 2E9BA 5LG1A 2OMBA 3BE1H 3VRIB 1DBJH 1MFEH 3OMZA 1GPOL 3BGFC 4C56E 5JHDB 4WO4C 2VLKB 3K2UL 1V7MH 4HXAH 5CP3A 1JF6A 4JHWH 2D0GA 3QYCA 3WSQL 1KTRL 4CL7A 3WJJC 4YHPA 4ZFOL 5HBBA 2EIDA 5KSVB 1YPZA 1NLDL 3ZDYE 3TESA 4KK6C 3IETB 1T1XB 4LCCA 4FXGA 5BQ7A 3U7YH 2R1YA 2XQBH 4K3DH 2P47B 3SQBA 1G7MA 1RUQH 3QUZD 4PJ5A 1VEOA 3CZFA 5HHVL 4GW4B 3IFPB 2D7TH 3C6LA 1E6OL 3BRGC 1A3LH 1K8IB 3BZEA 1EHNA 4M9PA 4TUJB 1M05B 1I1FB 3VGAB 3MV8A 3S6CA 1YEFH 3HE6D 2AK4D 4DGYL 3RUGE 5JDJA 3BGMA 1IC4L 4KPHH 5HXMA 1JPGB 3GIVB 1SBSH 3FO2A 2XNAA 1U3YA 4EDXA 4KK5C 3EDJA 5FCUL 4D2NA 3V6FB 5F9WC 4BZ2L 3R8BB 3GM0A 4NOFA 4WCYH 3VU2A 2X10A 3NA9H 5F89A 4GRWE 1IEAB 3E3QE 4QTHB 4NHUE 1Y18B 3MJ7A 2CH8A 2CGRH 3N9GL 4PJHA 1MCOL 2W07A 3NIGE 4I3SH 1DBAH 3RZCB 4PJ9A 5D6CB 3WIIH 1I1AD 1FVCA 5HHOB 3PWPD 3RL2B 3L7EB 5C07B 3L5HA 3PDDA 1OTUD 4NC2B 3KYAA 1BOYA 3BO8A 1QBLH 4IIQC 4WFED 2DQFB 4KHXL 4LAQL 3EZ8A 3LS5H 5GQBA 4PJ7F 4GQ9L 1SHMA 2A73B 2VZSA 1ED3A 3AC0A 1FZJB 1NL0H 3QWRD 4J4PA 5JHDE 3U9UB 2HJKB 1JGVH 2VLKE 3ULVH 3QT2A 1JRHH 4JFDD 2NY2D 3PNWB 4WI6A 1TCMA 5F3HA 4A6YL 3CXDL 1BQUA 3RWCA 1KCSH 3DUUA 5I1IL 4ELMB 1AE6L 1NCWH 3GMRB 1HE7A 4D0CA 5FOBB 4NKQB 4Y0GA 3ROOB 1II4E 4PPTA 4LSQL 3Q5OA 5EC2B 1A7QH 1WCQA 2YRLA 1BX2B 3G5VB 3QEGH 4PY8I 1IGMH 3B83A 4ZO6A 4PJEF 3KPQA 4P9MH 5EU3A 1GAFH 1IILE 2B5IB 3JTSB 5CGTA 3SDAD 4O5LL 4CNIB 4JO3L 3Q0HA 4PJ8A 4ZS6C 4BM7A 2FR4B 2KBGA 3D48R 3SE9L 3BW9A 3VXSE 5E99H 4OZHA 3NAAH 5DYOB 3MUHL 2WBWB 5FK9B 1CG9B 3RDTC 3IDUA 4LRIA 3OKKA 4I18C 5DO2C 4JPVH 4JFHD 3S36H 4NWUL 3VI4E 1EMTH 1UC6A 1A6WH 5FO8B 3I3BA 4KUCD 3MLYL 2MWCA 1JHTB 5ALBH 5IW6B 3MLXH 4U1LA 5E8DH 2C9AA 4KI5F 4M5ZH 3WN5C 4Z78B 3ILPB 3BISA 5GRUH 4XPHL 3D85D 4ZUTB 5E8EA 1JPST 5C07E 1T1YA 4JFQA 3D18A 3HUJA 4M48L 4JGJA 2DD8L 4IOFC 4KDWA 1YEDB 1FC2D 4Z7OE 2ARWA 4JDTL 1DN0B 1X6LA 4EVNB 4YBHA 4U1JA 4MAUH 1ZMYA 5E0QA 1SYVB 4PRAB 5DVKA 3RA7H 2VLLA 3ZHKA 3GUTA 4HX1A 3TPKA 5IM7A 1NMAL 2LAGB 4KDTA 5BZDB 5I0ZA 3MXWL 1AY1H 5JIHA 4X6DF 3FHAA 2VWEC 3MACL 3ARBB 4ELME 1CFNB 5BCAA 1VSCA 5IVXB 4ODXA 4TTGA 2CO7B 3MMEB 1G1YA 1P7QA 3FL7A 1A0QL 1RAMA 1RZGA 1DZBA 1S9VB 4PTUA 4PRPD 3F5WB 2QADD 1ZVSB 3CDGA 3UZVB 2I27N 3F7YA 1KULA 4MS8C 4HV8B 4PRNA 1Z3GH 4F33A 5D1ZA 4PTTB 4H88L 4P9HL 3MRFB 3QIBA 3OB0H 4QRQA 1YECL 1QLEH 4KJWC 2VOTA 3WFBH 5D2NC 4MQ7A 4XZUA 5GSVA 1MVFA 2EO1A 2PO6C 4G6FB 4JKPL 4WEBH 5TE6L 4ALAH 2ERJB 3OR7A 1FORL 4QRUB 1U8JB 1TJGL 3K81A 4DKEL 2AK1H 2DWEA 5F97E 1AHWA 3HCVB 3PP4H 1TZGH 3QUMA 1DFBL 1FRGL 5HD8C 2NQCA 2R0KL 3ZT5A 4F37K 1NC4D 4U2YA 2EYSB 1RZKH 3L95B 5JA9A 3OX8B 3UC0L 2DQUL 4K9EH 1R3HB 3W81A 1BPVA 3TO4B 1WWBX 1NCDL 4GRLA 4U6YA 3IXAA 3DXAB 4HWBH 4AIZB 1BBJA 4OGYL 1QR4A 1HYRC 5E5RB 4AMKL 1T2QL 2V2TA 1T5WB 1CDYA 2P46B 4MMXC 5D1QB 1B2WH 4QOKA 3CFEB 1F6AB 2H1PH 3QEQB 4NNYB 3VFGL 3SKOA 3RAJL 4LLAA 2JJTA 3GI9H 4ODSL 5KSBF 3AGVA 3VRJB 2IALB 3MROA 5CBEA 1ADQH 1ZWIB 4D0DA 2XN9D 4HKZA 1F3RB 1INDH 4G9FA 4JO1H 4TSAL 4F2MA 3D6GA 3CH1B 3ARYA 1KJ2H 5IVXE 1HOCB 5E9DD 3U0TA 4Q6IA 4GKOA 3CX2A 3H9SA 1JP5A 1QBAA 5DQ9A 4EQ3A 2Z93A 4PJXF 4KXZH 4NFCA 1P9MA 1PEZA 5IIEA 5D9SA 4WW2A 2A9NH 5F1KC 5F7HA 1F4WH 3T2PA 5D1XC 1JNHB 1WQVT 1YN7A 1AGEB 1RUAH 1KB9K 5I1EH 1E28B 1DANU 3CZJA 5FA3A 2NY3B 1ZKAA 2FATL 4XC3H 3L7FA 1ND0A 4OT1H 3U9PH 1BZQK 4HK3N 5HSFA 4MJ2A 4JY6A 4JQIL 1DQJA 3NCYS 5HGGS 4F8TA 3MLTB 1JGUL 4UDTB 1F8TL 3OJDA 3N85L 2BNUA 3C60A 4LHUG 1F2QA 3JTCA 3RVUC 3JZ7A 3LMJH 3QIWC 4LLUA 4QRSB 4Z7WA 3K46A 3RL1B 3A6CL 3M17A 5EOTA 5GZND 4OZ4A 1GC1H 1UWXH 3G6AB 3VG0L 4LHUA 1C8PA 3QUYD 1P4LB 4OCWH 5DRXB 5FYKE 3HNTL 4JREC 4PY8J 1LE9A 5EPMB 3DXAE 1UYWH 3FQRA 4XCNB 3MRHA 1OWWA 2CDGA 5DA0B 4YAQA 3B43A 1KEML 1BEYL 5MEOA 1QSEA 5FOJA 1QLRB 1KJMB 2P48B 3F7RA 3WCYA 4HH9A 3I85A 1JNNL 4I48B 4PJ8C 3T3MF 5GS0D 4L4TA 1FE8H 3LB6D 4YDJA 2ADGB 3IDGB 4EDWL 1KCVL 4ZTOH 1R5VA 2OCFD 4HIXH 2FCBA 3QEQE 1EHXA 2CXGA 5SX5K 1XR9A 4JKWA 3PGDB 3ZL4H 2XQYK 1H5BB 1LWRA 3HG1B 4X4ME 5J6HB 1BFOB 1XF5B 4OZIF 1PVHA 3IJYB 3K8KA 2HAZA 2JB6B 2CK0H 2W60A 2IADB 4H25B 4N0UA 2CUHA 4CJ0A 2Z91B 4M03A 4WU5A 3V2AR 1QFHA 1U91A 5T5NF 3G6JA 3WXWL 4P2CG 2XXCB 1F58H 4FXLA 1WC7B 4FXKB 4HAGA 5CCKL 1G6RA 3OPZL 3C5SA 4RMSA 1KFAH 3GJEA 4ZXBA 1T0NB 4DVBA 1FP5A 1T6WA 4TSCH 2DM4A 4PJAE 5I8EB 3NABH 1UWEL 1Q0YH 4GKZB 3LKOA 1U8IB 2V2XA 4AQ1B 4JRYB 5TFSL 3FZUD 1AD0B 1XFPA 3AU1A 1K85A 4HC1H 5I16A 3EO1A 3FQTB 5J4MA 1S3KL 2YPKA 1LD9A 1VADB 1K2DB 4F8QA 4KDTC 5TE7L 3NN8A 3QFJB 1OPGH 4I0PD 3RKPA 2Z4QB 4B5EA 1WAAF 3DNKA 4S0UC 4UB0H 4AEEA 3QUZA 1QFWM 3O41A 3GGWB 4D9LH 1S5IL 1KN4H 4LARL 5DR5L 3UTTE 1D5XB 1NDMB 2X4NB 1P53A 3D1MC 2AK4A 3HE6A 5AEAA 3FOLB 4PBWD 3DBXB 3X13B 3CK0H 2B4CL 3QIUC 4OFIA 3PDOA 1R5WB 2VL5B 4CKVX 3HE7D 3NCFB 2NY1B 5DJYA 5HGDB 3DRTA 5DLML 3FOMA 1N5YL 5CD5D 1GIGL 3BH8A 3X12A 2N7AA 3RBGA 2R0LH 5T3ZD 3GSNB 4APQB 2NY4B 5HYJD 3GHEL 4ZOBA 1MCIA 1MRDL 2P43B 3RP1A 2GY7B 2E7BA 1YNTB 1PW3A 2IPKB 1I1AA 1EEZA 4P3CH 4Y89A 5CKAA 3PWPA 1AHWC 4P4KB 2FX8H 1IBGH 1MHHB 1RVFH 4NN6C 1T4KB 3QDJB 4UDUB 1CL7H 2NMSA 2ZUVA 3D2UD 4ZPVB 4YDLC 3H9HA 1JNLH 3NFNA 3P73B 4IDJL 4PIRF 2F5BL 1NUGA 4OAWB 5KJRL 5DFVD 4HIIA 1AGFA 4LFHD 3EYFA 5F96H 2FJHB 3F62A 2LU7A 4GRLC 5DJ6B 4HK3J 3QWRA 2OSLB 3ARFC 2B1AH 4JFDA 1IAOA 3FQXB 12E8L 4G80B 1VACB 4LKXA 4LSPL 4LIQL 4JRYE 1OD7A 5K9OB 3BPLB 1MWAL 5JW3H 5SX4I 4QHLA 1EZVX 1F45A 2ZKHL 3OKYA 5AD0B 1N6VA 3J8F7 1RK0A 3B6SB 1KPUA 4DKAA 3CSBA