3HULA

Structure of putative homoserine kinase thrb from listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
277
Chain Sequence
SLRIRVPATTANLGPGFDSCGLALTLYLTLDIGAEADSWYIEHNIGGGIPHDETNVIIETALNLAPNLTPHHLVMTCDIPPARGLGSSSAAVVAGIELANTLAELNLSKEEKVRIAAEIEGHPDNVAPAVLGNWVVGAKLDGEDFYVRHLFPCALIAFIPKAELLPDTLPFKEAVQASSIANVMIAAILRNDMTLAGEMMERDLWSQLVPHLAQIRDVAKNQGAYAACLSGAGPTVLVFAPRNLANKLQTSLQTLEIDADVLLLDVEGSGAEVFREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative homoserine kinase thrB from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords Homoserine kinase
total genus 75
structure length 277
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.1.39: Homoserine kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3hulA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hulA01
4DV0E 2UUAI 1BKNA 5A2QQ 1MX0A 3J80C 1N32E 1XMQE 1J5EE 2HHHE 4JI2I 4DV5E 1Z5AA 4NXNI 4UT4A 3OTOI 1ZXNA 4JI6I 2CZ9A 4GKJI 2E1RA 1ZM3A 1IBKE 4WUBA 3WU3A 4LFCE 2E5LI 4JI1I 3T1HI 4DV7I 3ZZUA 4KHPI 1ELOA 1H7UA 2HFSA 3M6AA 1B62A 4NXMI 4DR2E 4DV4E 1H74A 4DU7A 1QZRA 2HK2A 3LPSA 3WU5A 2VQFI 4DV1I 2LJPA 4FWHA 1A6FA 2HKEA 1Z0GA 4FWGA 4X64E 2UUBE 1Z59A 2EFGA 1HNXE 1FJGI 1N33I 1PVGA 4AQYI 1RREA 4EMDA 2UUCI 1Z0BA 4MYUA 3ZM7A 4DV5I 5LMNE 3PYGA 3HULA 1WUUA 2UU9E 1Z0CA 4M1KA 2WW4A 3K17A 2ZM6I 4JI3I 2R3VA 2NPFA 4UTGA 1ZM4A 4DR1E 1XMOI 4LF7E 4DV3E 1NHJA 4LFBI 2J7KA 1DARA 4LF8I 4DR5I 3PYFA 4DV6E 2A2CA 1N34E 1XNQE 3J7AG 1N0VC 2ZITA 4JI2E 1D6TA 3LNUA 3ZZ0A 4PRXA 4JI8I 5IT9C 4YHHI 4FW9A 3WU4A 4NXME 2F4VI 4K0KI 4DUZI 3QT7A 4KQVA 4X62I 4Z7CA 1EI1A 4DV7E 1H73A 4JI6E 3J81C 1PIEA 4DR5E 1XNRE 1S4EA 4X66I 4B3SI 4HACB 4DR1I 4YY3I 1HNZI 1HNWE 4DUYI 1IBLE 4LF9I 1RR9A 4FN5A 4JI3E 2BM1A 4Z7YA 4B3MI 4HXZA 1HR0E 4LF4E 3D4JA 1KIJA 4JI5E 1N33E 4R1FA 1HNXI 2A2DA 1OJ4A 1Z0WA 4LF6E 3T1YI 4JYAE 1ZM9A 3JAMQ 4JI4E 1FJGE 1FWKA 2R42A 2UXBI 2HFUA 3B8HA 2V2QA 4GKKI 4B3RE 4DPXA 1S16A 1ZXMA 5BR8I 1XNQI 1KTVA 2HK3A 4DV6I 4RPFA 4LF8E 5LL6R 1XMOE 4JI1E 1KKHA 2VF3A 3WU6A 3ZZTA 1IBME 1N34I 4USMA 5L3JA 4PRVA 5IWAI 2AJ4A 5A2QC 3J80Q 1U2RA 1HR0I 1XMQI 4WUCA 3V5RA 1NHHA 2GS8A 1K47A 3QT6A 1Z5BA 3ZKBA 2BM0A 4JI7E 2UXDE 3PYEA 1ZM2A 4B3SE 1N32I 3H4LA 1H7SA 1NZ0A 2UXBE 4JI4I 2DEJA 4DV0I 3J7AM 4DPTA 4AQYE 4DUZE 4WUDA 3PYDA 1Z5CA 2VQFE 4ED4A 4LFAI 1FNMA 2HKJA 1MG7A 1N36E 3ZKDA 2Q2EB 3LTOA 5FLXQ 4DR4I 1FKAE 2ZBKB 4LF5E 4X65I 4JI0I 1IBMI 4LF9E 4DR7E 2E5LE 4JYAI 4KHPE 1FI4A 4GKKE 4X66E 2V8PA 2X7IA 4GKJE 2V2ZA 2HHHI 4JI0E 4MYTA 4X62E 4LFCI 3OTOE 4URLA 5LMUI 4OX9I 4LF6I 2UU9I 4JV5E 4JG4A 4B3ME 3QT8A 1Z0TA 4DV2I 4DR7I 3Q1QA 2UUCE 3J81Q 4DR4E 4LFAE 1HNWI 4DR6I 1XHKA 4ZVIA 1H72C 5IWAE 5LMNI 4DXLA 2UUAE 1NHIA 1B63A 4DU8A 2BV3A 3F0NA 1Z0EA 2F4VE 4K0KE 1I94E 4I3HA 3JAMC 4HY1A 5GMDA 3GONA 4JI8E 4JI7I 2UXDI 5BR8E 3QT5A 4DR3I 4DPWA 4DV2E 4LF4I 1HNZE 4FWDA 2UXCI 2XEXA 4JV5I 2DEIA 3CWVA 4OX9E 4PU9A 1EA6A 3B78A 4DR2I 2VQEI 1MU5A 4DUYE 1IBLI 3T1YE 5LMUE 4YY3E 4B3TI 2X36A 4B3TE 3B82A 1XNRI 4YHHE 4NXNE 4X64I 2UUBI 4USKA 2VQEE 1J5EI 2UXCE 2ZM6E 3V2UC 4HACA 1VISA 5GMEA 4XTJA 4DV3I 5FLXC 4X65E 4B3RI 2V34A 4DR3E 1N0UA 4DPYA 4DV4I 4LF5I 4HYMA 1N36I 5IT9Q 1KVKA 4LFBE 1I94I 1UEKA 1PKPA 3T1HE 2OI2A 4DPUA 1FWLA 3K1JA 1Z0VA 4P52A 2V2VA 4DR6E 4JI5I 1IBKI 4LF7I 4DV1E 4P7AA
chains in the Genus database with same CATH superfamily
4H4KA 3JAMY 3K8VA 5A2QU 5LMUF 2UUAI 3DD6A 3ZZRA 2Z2LA 1XBWA 3NKYA 4RUBA 4CNYA 5RUBA 2FJVA 2XWYA 3NWGA 3CIZA 1DLOA 3BGLA 4E98A 4GKKF 1OYRA 2CQIA 3TVZA 5KFTA 5KFOA 3SBMA 1EB0A 5HO4A 3MMCA 3TRGA 4HDHA 1MX0A 2EFQA 2W24A 4AD6A 3D6MB 4DL0C 4DI6A 2Q66A 4QIVA 1HWIA 2UUAE 4K2XA 1K1QA 3GIJA 3FFIA 1MN9A 1VQLS 2HHHE 5L1JA 3HKZD 3OTOI 2KM8C 1T9TA 3NOGA 2UUCJ 1E6YB 4LVNP 4O3RA 2MGZA 1AXQA 3W5XA 2CZ9A 4GKJI 2H1YA 2MMYA 1SCJB 2DGTA 2VFRA 3DCAA 1NK0A 4AIDA 4Q7AA 2DK2A 4K0KF 3R97A 4WUBA 3WU3A 4QYRA 4KV8A 5DQIA 3J7AN 3UD4P 4LFCI 2KJWA 2GVZB 5K8PA 5LSLA 2X1BA 4I2QB 4I4BA 3AOCA 3M8QB 4F8RA 2J8AA 3BGUA 4C11B 3RBDA 4JI1I 3NG8A 4RLEA 3FVYA 4RWXA 3D67A 4MFBA 5LOQA 3VALA 4KGXB 1LW0B 1HI0P 5HAOA 4KH0B 1W7WA 2AEMA 2CJYB 2DNOA 4G65A 3ZZUA 2QA1A 3R1HA 4KHPI 4BWMA 1UJ6A 4CLTA 3KNGA 4NA2A 1Q82T 1YBTA 4KT0C 4O3NA 5DDPC 5C0XD 2UVWA 3HHLC 3ZZZA 2Y1LB 1VI7A 1DAXA 1EETB 3BQ0A 3TJ8A 5GVQA 4QWBA 4HL9A 4NXMI 4Y0FA 3OFHA 4DV4E 2E5LJ 4MK7A 1PCAA 1S9GA 4OYAA 1RKJA 2MGZB 1QZRA 2AT1B 1X0FA 1IR2A 1N5SA 3C14B 1RT4B 3DI6B 5EGYA 5KFNA 3PO4A 2LJPA 3WU5A 4V1Ak 4B3OB 2QA4G 1WC6A 1NDKA 3FRYA 3AB2B 4UOGA 5HQMA 2C28A 4LF8F 4OYBA 3IM8A 4ZVEA 1A6FA 2VQEE 3M32A 3BO4A 1FKPB 3MPYA 1XMOF 3BREA 1S77D 2R2TA 2HKEA 3KUEA 2HQGA 3EGNA 2OSQA 2OD6A 3MEGA 3MMJA 5BYQA 1P8GA 3CCRS 2XMAA 2RU9A 1WKJA 3BYPA 1NB7A 1Z59A 4F67A 2FHJA 2FJEB 3MCNA 4J9NA 3G2XA 3SQGA 4ZMMA 4Y6IA 3SXLA 1HNXE 4YEAA 2RQMA 4N41A 3IG1B 1P1LA 2B9EA 3FMWA 3QAEA 4KFBB 4KHMA 4O4RA 4WK3A 3H20A 5B0BA 4PQUB 1PGZA 2RQ4A 2FY8A 1RWMB 4I0WA 1VQSA 1F9HA 2ZKUA 4NYPA 5DRKA 1RREA 3M6UA 3MPDA 3UDEA 4UZCA 5F9LA 4J91A 2DR5A 2XBPA 1OSDA 3TQ1A 3GMGA 2UUCI 1BQNA 1FDBA 2BKPA 4IUFA 1MW7A 4ZJOA 3CD7A 2JEJA 2QE5A 2UUCF 3OVBA 3DKDA 4P2FA 2EPIA 3CD6S 4DDFA 2DNPA 4KJIA 3PYGA 4PYDA 3IWXA 1WUUA 4WFBQ 4QW9A 1D1UA 2OPSA 3CDWA 2XGQA 4JV1A 2UU9E 4USWA 1Z0CA 3MCOA 3I6PA 1SUQA 2B0GA 4TNOA 2PEHA 3CC2S 2Y1IA 4JI1J 3OSPA 1O51A 2ZE2A 2IRUA 4DUYJ 1JJ4A 4BS2A 3HVAA 4KO0A 5B0GA 4ZLPA 4YOEA 1BQMB 2Q79A 3NEKA 3D66A 3A3PB 1KEKA 3AD7C 3M85D 3VCDA 2DXEA 3CJRA 3VAIA 2Y1JA 1N33J 1XMOI 1WHXA 2DNMA 2BABA 1NHJA 1UVLA 4OX9E 4LFBI 4NXMJ 1DARA 1REVB 1RT7A 4QW8A 4LF8I 2AX1A 1VFJA 3ZNUA 3K5LA 2DXDA 4F4AA 1IJFB 3DRPA 2XMTA 2HBRB 1SQGA 1Q5VA 2O3DA 3EDRB 3ILOA 3L9ZA 4FPRA 4WE1A 1K1SA 1ZTTA 1M5VC 1CSJA 1XNQE 3W66A 2L9DA 4A8KA 3DOKB 3PR4A 4JI3F 5K14B 3H42A 4JI3J 1TL4A 3CDIA 1PJ5A 2MQQA 2M3DA 4HDGA 2W2NP 3FUYA 1R0AA 5D0HA 3TAPA 2EW9A 2JL9A 1WI8A 4PQAA 4C3KA 4Q2MA 4DBQA 3NWRA 3K5NA 1S7IA 3MR2A 2RILA 3B54A 4PG7A 1QY7A 2HNYB 1OWXA 2P6TA 2E29A 2C39B 3LH2S 4IZKA 5C25B 3J7A1 3KK2B 2DNQA 3SCKE 1GNKA 5F8JA 2RVJA 3AHPA 3VGSA 4Y2CA 5LXYA 3LWMA 3LW5C 4DSKA 4JI8I 3AAWB 4ICLB 1WSRA 2H4YB 2V8VA 5EWFA 5K36E 5A8RB 2YWFA 3H40A 4GKKE 1B4SA 4FW9A 3WU4A 1SC1B 5KT6A 4OO1F 1WHYA 1F9FA 3GYXB 4FF2A 4GKJF 4TY9A 4OYIA 1EP4A 3QT7A 3CSKA 1KOHA 3DOKA 3HVTA 3IG1A 3CJQA 4X64F 2N7CA 1NJXA 2H9ZA 5HN0A 5E3PA 3W2VA 1EI1A 1OMSA 1HMVA 2FLOA 1D9AA 2FIUA 2IRYA 1VBKA 2XYPB 1XC9A 3K0JA 2BYCA 1U6FA 1U8SA 2DR8A 3H90A 2O1UA 3J81C 4DR5E 3SEOA 3G8TA 3G82A 4HEA9 4C0OC 2AF6A 3D1OA 1U48A 4X66I 4B3SJ 2PEBA 3R3TA 1IBLF 2FGOA 2J7WA 3PFEA 4YY3I 3BPDA 1MROB 4OI1A 1N6QB 2J0SD 4A4JA 4DR6F 1AW0A 4DUYI 1PC4A 1XMBA 4WZMA 4J9UE 3ISNC 2GZOA 4LF9I 1WG4A 5DG9A 2JZ5A 2ZBRA 7AT1B 4OX6A 3LGNA 3ZZYA 2AQ4A 1QSYA 4K4UA 3K1JA 3M8QA 2VBWA 3GIKA 1TU0B 4DHVA 3F73A 3NMAA 2BM1A 4YB6A 3TAQA 1RACB 3I0RA 4DV6F 3BM7A 1NBEB 1SV5B 1R8PA 4NPOA 1X5PA 4DV7F 1U7LA 1N32F 2QZ8A 3M1VB 2BJ8A 2Z30B 1TMJA 2JFKA 2V0NA 4LRDA 4OJ1A 4DJBA 2DPJA 2H51B 2E7XA 2Q6CA 2YWEA 1IQZA 1CJKB 2K7JA 3DM2B 3E3XA 4LSLB 4KR0B 4U9RA 1X5SA 5G0RA 3CCVS 1HBOB 2PC6A 3OBIA 4R25A 3GR0A 5K8NA 3IXQA 5B0CA 2WTFA 5HVFA 3CEDA 2E1PA 4YQWA 2HVHA 2WBMA 4QIWD 2YBVA 2YWKA 3TJ9A 4YP3A 4H54A 3MGJA 2KKHA 4OZ2A 3KG1A 2PFDA 5AE3A 5L39A 3Q23A 2Z5BA 2RMLA 4OYXA 4ZVUB 1RCOB 3TA2A 4LQ9A 1X4DA 1OY8A 1HBNA 4JI8J 2YX4A 1Y5YA 1ZAXA 4JI4E 1FJGE 1Y4ZB 2R7QA 1WF1A 2C3PA 1H2UX 4IH5A 2XLJA 1N34F 4YHHJ 5C42A 2DIVA 2GGPA 8ATCB 2ZJQQ 3QWUA 2IBKA 4KPYA 4FNHA 1DZ5A 1CBKA 2HFUA 2YH0A 3MFIA 1F6TA 3B8HA 2V2QA 3KG4A 5DM7Q 3T5LA 4DPXA 5C25A 3RRGA 1USUA 1SQFA 1JMTA 1HQEA 4XO0A 2G13A 4CO3A 1R8AA 2AGPA 2IIHA 2KXNB 4YB1P 4X62J 1TL3B 1SBRA 4F4ZA 2DITA 1U4BA 3MI7X 4M5KA 4ZVTB 3I0RB 2G4BA 1U8WA 1ZAWA 4FYYB 4KGVB 3MM6A 4CO1A 4I2PB 2BW2A 4ZS6A 2O1PA 5EX0A 1D9DA 1WEZA 5BR8I 2GAGC 2NYIA 2SXLA 1SJRA 1IM6A 1RTIB 4CYUA 3I55S 1B3TA 4MIWA 2IM3A 4Q8EA 1N4LA 5DNLA 2HG4A 3DLKB 4DWIA 1TV6A 2M88A 1RK8A 4OHZA 3GQCA 4X4UA 2A18A 3VR1A 4R8UB 5EWGA 5IT9Y 1CJVB 5LL6R 4K4ZA 1T05B 3DRYA 5C0XA 2QA2A 1YBAA 2XI3A 3DXSX 3GYGA 3HHKA 4P2MA 3HP6A 1KVJA 4OYZA 1Q1KA 5J2NB 3J80Q 4C11A 1L3KA 1IBME 2V9WA 2O1WA 1BWEA 2ZEJA 1J2VA 1XJWB 1YSJA 2AYEA 2B4OA 1VR6A 2GHVC 4NEZA 3JS9A 1TZ0A 1BQMA 4KV8B 4P7VA 3TAMB 4USMA 5AE1A 4RU9A 1N36F 4RBTA 4PRVA 5K36A 4A8FA 4OJ3A 4BA1A 4A8OA 3OTBA 2EFOA 5KFQA 4DR3F 3HK2A 2XO6A 1LWEA 2HBQB 4RWWA 3KFWX 2RHSB 3DLGB 4XPEA 2GS8A 4U8VA 3T5KA 3V81A 1TK0A 4M5LA 1PJ6A 3HJFA 1BY9A 1HWJA 1PAEX 4M5HA 4ZK7M 1JQGA 3ZKBA 1HPZB 1RU2A 4B9SA 1UP1A 2PIIA 3A4TA 3KXDA 2G2YA 3P3GA 5LSOA 1YX2A 2GQQA 2Z57B 3HFZB 2AJQA 1REGX 1UVIA 4LFAJ 1S1TA 4FYWB 4GVBB 4I69A 1FEEA 2Z8QA 1SJ4P 4RU2A 3LGHA 4X2BA 3KHLA 1N32I 3K8WA 4GC6A 1NZ0A 2JE6B 4IH7A 2DNYA 1JXVA 3BV8A 3QPIA 4Q8FA 2BANA 2ZM6E 4JI4I 5HATA 1Z0WA 2HIQA 4DUTA 2BEFA 3A8IA 4C9DA 3CC4S 2IY5B 5D3GB 4FW7A 1BQXA 3EVOA 3UWTA 2BJ1A 1WORA 1Y3JA 4IDKB 4CLWA 2VHGA 2HSEB 4EBEA 2HW3A 1UZDA 4DR2F 4WUDA 2G1DA 3GTYX 3DYAB 3KK1B 2E5JA 4DV0F 4QNKA 2YKMB 2VOPA 4OZ5A 3NMRA 2EXUA 4B9TA 1URNA 1H6KX 2KT3A 5I3PA 4KGKA 2CGEA 5ETTA 4QIGA 3SFUA 4DQPA 3ITHB 3ZZPA 1SVDA 1RT3B 1LNQA 2IDLA 2WB1D 2VICA 3GCXP 4X4VA 2UU9F 5J2QA 2V9KA 3MM5B 4K8RA 5F3ZA 4WWSA 1TMMA 4NI2A 2QLFB 4NRTA 4LR7A 5G4DA 5KAKA 2IA6A 4OMFG 1OPIA 5K20B 4DR4I 2ZBPA 1CJTB 1AROP 1RHUB 4OHYA 3PS1A 1FKAE 1F1BB 3CW2C 3I9ZA 3M8ZA 4RR5A 3HXMA 3CCQS 4LF5E 3NS6A 3IWLA 5DRRA 1KRPA 3G71S 1RTZA 4ED8A 1RHYA 3L09A 3P3DA 1T05A 4LRAA 3E8OA 1RBOB 2BR0A 3JTPA 2ALZA 4OKGA 3M2RB 2IM0A 1AB8A 4IQMA 4JUZA 1J5EI 1RHMB 4JYAI 4KHPE 3LALA 1R7IA 3K5MA 4B9VA 1U47A 2DISA 2FD2A 3KRNA 1YRXA 1NKEA 3KLVA 2DH7A 4X66E 1TUWA 2EBEA 2QL7B 5L46A 3TI0A 3KMQA 3EPGA 2AYGA 5J1EB 3KYLA 2KYZA 2KT5A 3KLGA 3N6NA 1EKSA 3BGFA 4A8WA 4X4SA 1TFYA 4BBYA 4ECSA 2B7BB 1IJEB 4GKJE 1KQKA 2WP8B 3PNIA 1HHQA 4LBHA 4JI0E 3T9NA 5GADU 3H8YA 5M2PA 2AV5A 4V19J 4URSA 4KGMA 2R7RA 3OTOE 5LMUI 3UCGA 4JP8A 4J9SA 3FCVA 5D4OA 1IBMJ 4ZVFA 2ASJA 1JLCA 3H2VE 4OLOA 4C48A 3LPYA 1QUVA 3JSBA 3QGGA 3UR3C 3R5DA 1CJTA 3SIPB 3OR2B 3QT8A 4JI4J 4HH0A 4NLPA 2BJDA 4NLQA 2ZC4A 3BH6B 3M9MB 3A3NB 2LXFA 5J2QB 3HZGA 1LFPA 4ZJLA 3G8SA 4PXBA 4B3TF 1N32J 3J81Q 4RJVA 2R2RA 1MLAA 3UFCX 1HD0A 2HS4A 2DGUA 2I0XA 2DT9A 4DR4E 1HNWI 2OP5A 3L7ZA 2LQ5A 1H3DA 3FNNA 2XS5A 4DR6I 3EVWA 3P5TL 1TTHB 2ROGA 4JI7J 4DXLA 2G2OA 4XIUA 1M5SA 1GTHA 4F3QA 5GAGU 3H4BA 2UXDJ 5FIIA 2JC1A 2WNRB 1B63A 1K0VA 4MT1A 1LKZA 1NHUA 3QGIA 4CQ1A 1R8CA 3TQEA 2BMBA 4YFUA 2KG1A 2LU2A 2C3MA 3M8WA 1AUDA 4LIWA 1VBYA 2DR7A 3F0NA 4LF5J 3H7HB 1IWAA 4OLPA 1Z0EA 1QSSA 4K0KE 2WSFC 2FJXA 3AFGA 3TUPA 1RWNB 4EYIB 2BDPA 4PUOA 2OEMA 2VOOA 3R5CA 5KT2A 4KGZB 4X65J 2Y0SD 1JLBB 2C2KB 2UV8G 2V4QA 2L9WA 4H4OB 2OSRA 1CJUB 4ANDA 4PWDB 3PZPA 3J81U 1VMBA 2KT2A 3AJ2A 1R43A 4JI6F 4DQRA 2YTCA 1ZETA 1KN6A 3FEXB 4DG1A 1XNRJ 5FD1A 2CKWA 4DPOA 4NX9A 1A9NB 1WC5A 2XYHB 1JNZB 2CDRB 2DEIA 3CWVA 3EZ5A 2HHHJ 3JTOA 1RAGB 2HAIA 3MMAA 4FKXA 1FVQA 1S1UA 2YNFB 1GTEA 4AIMA 2C37A 4OX8A 1CULB 2H5JB 3UCUP 4NCGA 2BJEA 3FBCA 3MEEB 4B08A 4F4XA 4NXMF 2HNZA 2HNDA 2G9OA 1SL0A 2IJRA 4YY3E 4TKTA 1NAQA 2HQDA 3DGVA 3DU6A 4I67A 2KXHA 5KFSA 1NK9A 1WSVA 5HBMB 4KHPF 3IC1A 1B70B 1KHVA 3P4UB 2FGCA 4I7FA 2ZWOA 3MCMA 2RUSA 1CJUA 5ETNA 2VKRA 3DMJB 5DG7A 3RBEA 5D4PA 4PWWA 1Y5IB 5F9NA 3PKMA 4USKA 1YLXA 2PDAA 4OI4A 2GGPB 1PG5B 2U1AA 3HHDA 3R5AA 1U02A 4B17A 4OV6A 1D9FA 4OZNA 1HNWJ 5ETQA 3BN4A 5T41A 3T1AA 4HACA 2PO1A 4NL5A 1UCNA 4JI6J 2CFXA 3H2UB 1HBNB 1QJHA 2RKIB 3BSCA 4UY8T 2F65A 2B9WA 2GQ0A 1KQFB 3ENWA 4O23A 1Y7PA 2FC9A 3OL7A 1I6JA 2D3UA 1I94F 1MNEA 3MM9B 4U7CA 3OW2R 3DYAA 3R6LB 2I5JB 2D74B 2BXJA 4HHHA 4J5OA 1S6PA 1VBZA 5CZVA 4DUZE 4DR3E 3RBXA 5KFAA 1JJHA 4DPYA 5E33A 2UP1A 4LF5I 5D15A 4LSNA 2MXYA 4HYMA 1HL6A 2DO0A 5IQQA 4X64J 2UUBJ 3F41A 2KTQA 1HFEL 3QMQA 2VDHA 4UZBA 2RS8A 3BQ1A 4B9UA 4N3OA 3HT3A 1IR0A 1IBMF 2J76E 4JI8E 3CJ2A 2XSJB 3UN5A 1I94I 1W26A 3JQJA 1UEKA 2CJXB 2XZTB 2VFUA 3O1LA 2H5IB 1HARA 1Q16B 1Y60A 1RLCL 2OI2A 2LQBA 2FLPA 3KJVA 1VQMS 1FWLA 2M4MA 4C4WA 2QT7A 3TEGA 1LWFA 1YJWS 4O44B 3W7BA 1TAUA 3C6TB 3MAAB 4IFYA 2W8LA 3W63A 2DTJA 1RABB 3ETMA 1SH3A 3MM7A 4N77A 1NHKL 4NE9C 4KBIA 3JYTB 4BHQA 4C7QA 1SJ3P 2HFNA 2WONA 2QJ3A 2CNLB 4NMLA 1Q5YA 2FY1A 2ZH1A 4K5RA 1X7VA 4NZ6A 4ZPBA 4DV1E 4NXNJ 4LPFA 2H54B 4WFZA 1VQ5S 1S1WA 1N5TA 1N5VA 4CZCA 4ZP8A 1G2EA 2IYIA 3J81Y 1SL1A 2X1FA 5KT4A 1DTQB 3KLGB 1PILA 1NPPA 3VGTA 3OL8A 2GQ2A 3T5HA 1HMVB 4IZJD 1RU1A 2I5JA 2JSXA 1QE1B 3QGHA 2HRYA 2IJNA 2DVIA 1SL2A 5A2QQ 4XDDA 2D3ZA 1JLGB 1RWXB 2P5VA 4N7TA 4Q2LA 1QM9A 3PRBA 4RBUA 2MQPA 1ZH5A 1M5KC 1J5EE 5A8WA 1UW4A 5HROA 1E6VB 1Q95G 1T03B 2LA4A 2YKPA 2L41A 4N56A 3CB4A 1KLMA 3Q83A 1R6MA 3LANA 2HBYB 4HYKA 3C16B 1GXTA 3K5PA 5KFMA 1MU2B 3UVJA 2RS2A 2HMIB 2E1RA 4DV5J 3LF0A 1SJQA 2LQ8A 1ZM3A 2MPUA 2VG6A 4H4KC 4A47A 2RF2B 2A6OA 1JJ2R 1SV5A 4LRBA 1RADB 2LFVA 5T14A 2IVYA 4Q0BA 4YHHF 5JEAF 2GMHA 1P1TA 4Z37A 4ECUA 2VZ9A 2NR0A 2DB1A 2E7WA 2VUGA 4CLZA 4MJKA 4DN0A 5IM0B 5AJ3J 2MKYA 2OLWA 3IGNA 4J9MA 2ZVIA 1O6XA 4OYOA 1UJ4A 2EKYA 2EK1A 3NZKA 5KG0A 1EARA 3KK1A 1HBOA 4G6VB 1S1VB 4RW8A 4P71A 2J9EA 3NAIA 1CC7A 2LYVA 4TVAB 4WE1B 4ZA1A 1NJZA 4K5SA 2RHQB 2VD3A 2MHNA 2R7SA 2KJVA 2M52A 2V94A 4ZVRB 1KQSR 1RTDA 2JEBA 4DR2E 1WHVA 2ACMA 1GFWB 5CYMA 5KG7A 2IJFA 3RR7A 1R89A 1H74A 5JVGQ 3TUJC 1NUEA 3LPSA 3H1CA 3PW2A 4EYHB 2W7AA 2CG8A 4AQYJ 3GU0A 2VQFI 4DV1I 4JI4F 2V68A 4ED5A 2VG6B 3W1YC 1FHTA 2QLJB 4KH1B 2CQGA 2U2FA 2MKHA 1ZZFA 1M1GA 4KYZA 4WXOA 5KOWA 3OL6A 4W92B 2OPRB 3UDLA 1MROA 2Y3YA 2N82B 3Q0AA 4J9LA 1N6QA 3T1HF 4TY8A 5T7LA 3R9LA 3TP2A 2WZ1A 1X4HA 4ITSA 5F41A 5C2GA 4WFAQ 3R8YA 2H5EA 3TANA 3MTJA 3PJWA 2RJZA 4OYWA 3CJTA 4M95A 4C8OA 1X8DA 1VRTA 2V4JB 3CCTA 2JLEA 3MWBA 1GMUA 5CAAA 1IVZA 1HR0I 3CDBA 4AXJA 1RAJA 2QGFB 4ZPVR 2CQPA 1LW2B 5KFRA 4DF4A 9ATCB 1PVGA 4QPXA 3H2LA 5U47A 1RTIA 4CYUB 3IGVA 4U6PA 3ADAC 1DTQA 2ZH3A 3W9IA 4ZOSA 1JKHA 4EU0A 4EFAC 1R3NA 1YZ6A 3C14A 4U3DA 1G7CB 2VPXB 2JVOA 5KG3A 3DDIA 3KLFA 2G1HA 1KFSA 4NLTA 2HGNA 4RW9B 3IRXB 4J7CA 2PMZD 3SV3A 4MYUA 4XAKA 2VH7A 2YX1A 4ECQA 2MLXA 4NWBA 1SPBP 3DFEA 1RTDB 3FBBA 3CWJA 2ZH7A 1RT2B 1WD6A 2CPDA 4CLLA 3LPEA 4TY8B 4CWBA 4KHRA 4DSEA 2LEBA 1KBRA 3C16A 2N3OA 2J6UA 5T7LB 2XS7A 1U0SA 2BR2B 2ZM6I 4QPTA 3GFXA 2J0WA 3EUNA 1ZPVA 3D3CJ 5CYQB 4ELTA 3N0VA 2MEWA 4ERDA 3PIOQ 4B9MA 1J5EF 4DR5F 2QL5B 2PO2A 2FUG9 2NPFA 2A6MA 3TWZA 3M8PB 5JVHQ 1ZM4A 3DLHA 4QYZJ 5B0AA 2YNGB 5L9XA 2CPYA 5F8MA 4DV3E 3AD8C 3S7RA 2IDEA 1HQEB 2FJAB 2IA0A 4LSNB 1PYSB 3LP0A 3VVTA 3ZC4A 1Q86T 1NH8A 2GO8A 1Y4UA 4LFCF 3CC7S 3DU5A 1N0VC 1S1VA 4RW8B 3UDVA 3IRXA 1DTTA 1UVKA 5A6WA 3NOCA 1PBAA 4OO1D 2VQFJ 3BS9A 3I0SA 3MR3A 1D6TA 4A8XA 2OJ3A 2XS2A 2MYFA 1JKHB 1O8BA 1JIHA 2H4WB 2LU1A 4LT6A 3VAHA 3GV7B 4B3SF 2GV1A 3KNAA 5FWKA 1RDRA 5HQLA 4BC9A 4DV5F 2OFGX 3RB0A 1CEZA 2GIQA 2HLUA 2GJIA 3MAAA 2VC0A 3BGOP 3FBEA 2HGMA 3ZZOA 4F0MA 4ECXA 4ECWA 5ADZA 1C0TB 3FEYB 2MKKA 2OPSB 4DV4F 3KUGA 4RW6B 4M94A 3AQOA 3GG0A 5FDLB 1M1KT 2Y8WA 3PIPQ 3PW0A 4KB7A 2UXDE 4WXWA 3BBFA 4OZ0A 2MQMA 5JMNA 4WU3A 1ZYQA 4WKRA 4M63A 3P45B 1VK3A 1HQ2A 3CDAA 5IT9C 4U3BA 1VOMA 1RT6A 1IN0A 2GFFA 1GMWD 1WI6A 2WVFA 3TX0A 1FDNA 5LT5A 1D8ZA 2FYXA 3PG9A 4AL7A 4NXME 4CDIA 4K0KI 1RTHA 3FQKA 2KVIA 4ELUA 2JDJA 2X1GA 2C3OA 1FK9A 4C8YA 1XK8A 5HLFA 2K8GA 3EZUA 1NZ8A 2KXFA 1X4EA 4LBIA 4ZLNA 5GMKa 1QE1A 2OEJA 4DV7E 1OQ6A 1SIWB 1H73A 3MHYA 1EAYC 4I6WA 3CDEA 4Y2MA 1RWPB 3HT0A 2J6SA 2JT2A 4L73A 2MJNA 1NPRA 4LF6E 4M5MA 1OO0B 4HACB 4WCEQ 2HMIA 4DR1I 2ZM6J 3UVJB 3TUIC 3OFFA 3C15B 1HNWE 3FSYA 4K4SA 1IBLE 4H4OA 5L1LA 2APOA 2ERRA 3L95X 1HNWF 3MXHP 4FN5A 4RKUC 2IPOB 1GX6A 4MFBB 2MY8A 4F26A 4OQJA 1C0UA 1UL3A 2POKA 4ZIWA 4ECYA 3ISZA 3Q8UA 4IG3A 1XMOJ 4C3MA 4LFBJ 3JXOA 2YKOA 4RUAA 3T1YJ 1UDOA 4LF4F 4XTTA 3GB0A 1XNQF 1NMEB 1TFWA 4X62F 4L3KA 2JOQA 4CLSA 5IWAJ 4QWCA 3OXFA 2V6AA 3TVKA 2R7VA 1HR0J 3DRRA 1KIJA 1NK5A 1H7XA 3HMJG 1N33E 3QZ8A 4EO6A 3O8WA 3NL0A 3L4BC 3LWLA 4PG8A 2KI2A 1OYDA 2GVDA 3BO2A 3VVUA 1FRKA 1JB0C 4K2JA 4CO0A 2HRTA 3NGRA 3GV8B 4PAAA 1X5OA 4J9OA 1RWKB 1GMWA 4X84A 2B56A 2EI5A 7FD1A 2JLGA 4ZLJA 3VAGA 3CJSA 4IO1A 2A2DA 5E2QA 3I31A 3TARA 5HSPA 3DHXA 4NI2B 1QAJA 4JYAE 3GP9A 2AP6A 2EKNA 4I6AA 4OIXA 2E7VA 4ZVSB 5LMNJ 3CDJA 2XNRA 4IRCA 3OD2A 4GMKA 1FJEB 2YNHA 3M8SA 2W4DA 2HHWA 2UXBI 3BR8A 1XEZA 3DXBA 3PXGa 3S1TA 5KG5A 3FSIA 3KLEB 2Z56B 5LXRA 1NJYA 1N33F 4UUXA 4B3RE 1UFKA 1Q4RA 4IOCQ 1S16A 2DNLA 1YQHA 2JVRA 3PX4A 2C42A 3PRVA 4RNMA 1FX2A 3VHQA 1TVRB 1Y5NB 1ZXMA 3M7NG 2DHXA 1EQ0A 4IG0B 2PMHA 2GVDB 2YH1A 1JWWA 3C8YA 2RQCA 3GR1A 5C0XF 3KK3A 2XMMA 5HP1B 2FQQB 3A1YG 3NNAA 3P8BB 1XNQI 2Y8YA 1KONA 4ZDNA 4RPFA 3L7OA 4C8KA 1W25A 4FXDA 3OV7A 3DC2A 1XMOE 2CQCA 1JLEA 2HLTA 1VRUA 2P6SA 3T41A 3KLIA 3W2WB 3MMBA 1DY3A 1TL1B 3J80Y 1S72S 4C8ZA 1FJ7A 1KKHA 3W9JA 2UUTA 2K7KA 3W5ZA 3KWMA 3V6DB 3MM7B 4DG1B 1FNXH 4MMOA 1RE1B 2XCAA 1KDNA 1JXLA 1V5IB 3H5YA 4AXIA 3S01A 2W8KA 1NJWA 1WTBA 2CQ2A 2OMLA 5J2PB 4GC7A 3PEHA 5KFEA 2QC3A 3HDSA 4P74A 2PMWA 5IWAI 3CD0A 1YGYA 2KRBA 5A2QC 1ROFA 1CULA 3L7ZB 5C2CA 4DV5E 1IKVB 4OZJA 1R0BG 5A8KB 1UTAA 4RZRA 1WTFA 2CJAA 3U1MA 2M2BA 1Y0HA 1RKIA 3V5RA 2LEAA 3M6VA 4M5DB 3D6HB 4P73A 1S10A 1K47A 1T9UA 5HMWA 1NB2A 4JV2A 2ZH2A 4DV3F 4WYLA 4YDDB 2W2MP 5B08A 2RRBA 5KFKA 2QLBB 2ZFHA 3W61A 4I7FB 3PYEA 3BSOA 4AL6A 2CPJA 2E5LF 1KLNA 4WJBA 1UFWA 3DLLQ 4PABA 3D2WA 4K4VA 2GMLA 5K36D 5B7WA 3M8YA 4W4MA 2IOQA 1TL1A 1UEVA 3CT9A 3B6BA 5CZXA 1YJNS 4OV1A 4NLGA 3AXKA 3QAUA 3H4LA 5DQHA 1W2BR 2UXBE 4JI2F 1P42A 3JSRA 4NOHA 1FWPA 3X1LB 3EZOA 2UXBJ 2GVZA 5ETMA 2VBZA 4Y28C 3C2PA 2V69A 2MQNA 4MKBA 4CLKA 2DNKA 2R8GA 4EZ6A 5KFUA 2VDIA 2EC0A 4FBTA 3I4HX 4CTAA 1FJGF 4AQYE 4HHJA 2H65B 3TAMA 4ZCIA 2NUHA 4DF8A 1WDDA 1GXUA 1S6OA 3PRDA 4NLYA 2BE2B 4HTJA 4MAKA 2MZTA 1EP4B 4CNZA 4J9QA 4NCAA 5EN1A 4OO1E 2BVZA 1FE0A 1RTHB 2ATCB 2N3LA 2GJ2A 1FTRA 2CJ9A 1XERA 2YPZA 3HLUA 4YUDA 4U95A 1XNQJ 3P3EA 4URLA 5A8RA 3DLGA 5K36C 2B9XA 3MD3A 4P72A 1FNMA 4HH1A 4QU7A 4Y2AA 3J7ZT 1WF2A 2JRSA 3RUBL 3M9OB 2RRAA 5BR8F 4Q45A 1W2IA 4EK2A 1Q81T 2WP8A 2NN6C 2P9EA 1N36E 4CT9A 2Q2EB 4HVZA 3OHBA 2QSWA 2QSFA 3MECB 1X9MA 5FLXQ 2ZM6F 1RBLA 4NLUA 1RAIB 2HZAA 3CCSS 4JB8B 2RDDA 1UWBB 2IAJA 2JE6A 3O44A 1NU4A 2W25A 3BJYA 3BZQA 4N8NA 2VFVA 5IT0A 3KLHA 5E5NA 1ZAVA 4LF6J 3P6YC 3BYRA 2KZMA 2GO4A 4DR7E 3MAHA 4AYBD 3NLCA 4YR3A 2H3EB 3WHIA 3H25A 4RNNA 1RYSA 3N6LA 4ZCLA 4RW7B 4QR1A 5LSRA 4BDPA 4X4QA 3SV4A 4Q44A 4LF4J 2GAHC 1RXOB 3HHEA 2WAQD 2X7IA 4I6YA 3Q8QB 3KHHA 4HKQA 5HI7A 3UQSA 5A76A 4B3RF 2P9CA 3HFVA 4USTA 4DL5A 1RUSA 2NZCA 2V2ZA 2OIHA 4DR4J 2ZJRQ 2CNOB 3HJCA 4MYTA 1IKVA 5A8KA 4N76A 2CPHA 3M6WA 2ZVSA 3D28A 2XI2A 4L75A 3B4TA 2UUAF 1B0VA 5IQ6A 2ZNZA 2NXJA 3CJ5A 3IM9A 5LL6d 4YMEA 3EPIA 2GHPA 4ECVA 3V4IA 1K8AT 1FXLA 2VPZB 1SKUB 4JYAJ 3IAM9 1KC8T 1DTTB 4AFFA 5IC6B 4DR7F 2FZCB 1Z4UA 3MR6A 1YJUA 4X4NA 4DV2I 2VESA 4DR7I 3Q1QA 4IFDF 2PA8D 1TELA 3CPWR 4ZJQA 2UUCE 3DLBA 1Q0NA 1VQKS 3N4WA 2BQUA 3LUYA 2ILZA 2IHR1 5AT1B 3N9UC 3CD5A 3P06A 2K3IA 2QN6B 3HZEA 2BQ3A 1C1CB 2GIFA 1VGYA 3GCWP 1RSCA 3QIPA 2H48B 3W62A 3KG0A 1H72C 1FCAA 1X60A 2N7YA 3H0PA 2DRAA 5LMNI 1LV5A 4ZLLA 4YB5A 2IM1A 4JBCA 4LF2A 5D77A 2PGCA 4ELVA 2BZ2A 5IM0A 1YITS 5FLXY 1CLFA 4OHXA 4ID5A 4B3RJ 2OEKA 2GHWA 4DU8A 4NCBA 5C24A 3PX6A 3HHLA 3JSMB 2DR9A 1CJVA 3OQ2A 2F4VE 2Z2MA 3M30B 1NXIA 3BPSP 1RT3A 2C2OB 3PR5B 2D41A 3C15A 4AQYF 2ASLA 2O1TA 1I94E 3Q8PB 4WFYA 5HMZA 3JAMC 4HY1A 2YWWA 4CH0S 4R5PA 4FPIA 4GVLA 2EG1A 1KFDA 3EE3A 4D3HA 4G3IA 1IBLJ 3CMES 2B6AB 2HEKA 3M6XA 1X31C 3GWCA 2IVMA 4OZ3A 1JLFB 1VHIA 3JQMA 4JI8F 5KFHA 3R1LA 1BGXT 5DG8A 1YJRA 3OTOF 5JJBA 2X3GA 1MMDA 5J2NA 4FW5A 4LF4I 4JI5J 2RF2A 1NHVA 1HNZE 1IM4A 2BA1G 4ANEA 2F4FA 4P7TA 4USIA 5HK4A 2AX0A 3SCJE 1TK5A 2BA9A 4JV5I 3W60A 3AA8A 4PU9A 3FCWA 1YWXA 2AIRB 3IO1A 3HD2A 1CJKA 3DM2A 1YG0A 2QFJA 1TKZA 2KL8A 3W64A 5LMUJ 5GAEI 2Z5CA 4DR2I 3AODA 2NCKL 2QL9B 3ENQA 3WX8A 5CCLA 4DR1F 2KFNA 3AOAA 1JLGA 3T1YE 3HKMA 3LP2A 3NCQA 2Q43A 2W4PA 4OL8A 4DR7J 4MIAA 2R7XA 1PC5A 3B82A 1XNRI 2UXCJ 1U2CA 2FJBB 3T6BA 3HHLB 1S1XA 1WF0A 3ENAA 3TVYA 5K36F 4YB7A 1HNIA 4ZHRA 4JI2J 3U1YA 3C6UB 5ITHA 1YTYA 3U1NA 1U24A 1URRA 4QJVA 3V2UC 2MDAA 1S12A 2R7OA 2ZBQA 3EX7B 1VQ7S 4DR6J 3HSGA 1WG5A 4Y2KA 2AU0A 5M2UA 1DFDA 2ZH9A 4DV3I 1F2HA 3TA1A 5ETVA 1PKUA 3CJKA 3UHMA 1HHSA 2KVQE 4AT1B 2NXCA 4KQZA 1B99A 5HL7Q 3MPUB 2QO3A 1YDLA 2DGSA 1FE4A 2V8GA 3SSRA 2CQBA 3GLJA 2LVWA 5EDWA 4PG5A 4FW3A 1PYOB 1FESA 2HAFA 4CO5A 3PKYA 1Y10A 4PG4A 2PO2B 2WBRA 4KPCA 3ETOA 1REVA 4P2SA 4DCJB 3EYZA 5H9EK 4DSIA 2HQIA 4DL4A 3RB4A 4LF7J 4ZPCA 3TW0A 3WIUA 3JB9k 4NLSA 2MQLA 3D7SB 1T9YA 5G0RB 5HROB 2HBZB 1G3OA 4ZCKA 2UUAJ 5KFCA 2PI4A 4LREA 1PKPA 3G87A 4M5GA 3VAMA 2NN6D 4TU7A 1JXEA 3I4PA 3QZ7A 4CIOA 1YHQS 1LEOA 4RNOA 4HI2A 2LDYA 3FMBA 4QIEA 4ILMA 2OAUA 2C2NA 2VC1A 5B09A 5KT7A 2DGVA 1UMJA 1NSQA 3A8JA 2PI5A 1IBKI 4JV5J 4IRKA 1FKOA 2MKSA 1D0EA 2OPQA 2O3ZA 3HJVA 4EO8A 5D78A 2BA0G 1QTMA 2UVVA 3EGWB 2YQ1A 1Y5LB 1FX4A 3D6TB 3MUMP 2BR2A 1S99A 4ICLA 2GNKA 1BWVA 4F2SA 3GPAA 1T11A 1JNRB 4J9VA 4DV0E 1LXJA 6AT1B 4WU2A 1S5ZA 2E9RX 1IKYA 1LW0A 2W1BA 1FDDA 5KG1A 3OR1A 1BKNA 2P2CB 1F5CA 5KG2A 3M9NB 3VAKA 1G1XA 1G4CA 2LP4A 2L08A 3J80C 2XCPA 1RWWB 1HWLA 2WRMA 1TL3A 1XMQE 2HNZB 4KC5A 5KFXA 4ETZA 1VQPS 3BN7A 1S79A 5HLFB 2WVEA 4ZPTR 1SJFA 1JLBA 2UXCF 3HPOA 1C1BA 2MSSA 2WOMA 2XSJA 3Q8YA 3K58A 3FKBA 3AOBA 2E5IA 1TP7A 4UT4A 4KHPJ 3QJJA 1ZXNA 3M2VB 4ZP6A 4WBFA 1EZZB 3RAQA 1KNZA 4JI6I 4TLRA 1EX8A 5EKWA 5CYMB 2W7OA 1T9VA 4BCAA 2B51A 4B3OA 1FKOB 2A3JA 2Y0BB 5E41A 2V67A 1O5JA 1TKXB 2KG0A 1FT8A 1VLYA 5B0FA 4CRJA 3IN5A 2AYBA 2OTLS 1S6QB 2F63A 2J6TA 2NSBA 3MZIA 4M5IA 4O3OA 3DLJA 3ELHA 5MLCV 4HTIA 4ZN1A 4FF4A 1I51B 1DLOB 1TKTA 3RAMA 3CIMA 3CJKB 1HR0F 3BF4A 5I3UA 2VG5A 1IBCB 4DV7I 2XMJA 1T3OA 2BRLA 2UV8A 1ELOA 2YNIA 5J1PA 5IWAF 4E0DA 4KFBA 1CS4B 3MFHA 1H7UA 2LXIA 4LSLA 1JLAB 1T95A 2JX2A 4IH6A 1K0TA 4IFDA 4NEYA 3UPFA 3FZBA 1RA7A 1SC3B 4LF9F 1QVGR 3DMJA 2FB0A 3PJ9A 4LCFA 3G9CA 3BQ2A 2IBOA 4ZVOB 4TU9A 2IC3A 1GEHA 2AKWB 2WCXA 3M2VA 4EUVA 3KOAA 2HK2A 4WFXA 3W8GA 5BJRA 5EL9A 4AE5A 4FF3A 2I2YA 3KJVB 2ZHOA 1IBKJ 2HHTA 1TQLA 2CQ3A 3D3BJ 4PXEA 3S6EA 2Z0GA 5KG6A 5F8LA 3QLHB 2W9CA 1U1RA 5IV3A 5DROA 4KKOA 1RT1B 2HVZA 1DRZA 1V5VA 3WC0A 4PEOA 4CLPA 4IR9A 3KKFA 1S0MA 4AUKA 1HLWA 1KTQA 3T6JA 3ZTSA 5KT3A 1UVJA 3D1HA 1VDHA 3OTEA 4FWGA 3HCXA 4X64E 2UUBE 4WP8A 2D3OR 1UEUA 4DX8H 1VBXA 2J5AA 3MOZA 4RW7A 2M9KA 5AE2A 3MPVA 1HQUA 5B0EA 3VTIA 1APSA 1RT5A 3RRKA 1FK9B 4RL1A 2DNHA 4K4WA 5D0EA 1AZSA 2LQJA 5DGAA 1U45A 1HI8A 2XWXA 5KFFA 4WFNQ 4NCGB 3UD3P 1FRHA 3Q22A 2OUGA 1RTJB 2P8IA 7FDRA 2HKJA 1TAQA 3FZ2A 1OYPA 2OPPA 1J5OA 4O44A 1XR7A 3PCOB 2XMWA 4DV5I 4PCQA 4JYAF 3PACA 1GAOA 3IAS9 4QWAA 3KK2A 1D09B 5LMNF 1SQEA 2F7VA 2QMXA 3I87A 3KDOA 1RHRB 3G96A 2YKNA 2R8KA 2BKNA 3J7Z5 1E6YA 2GO9A 4M1KA 4O4GB 3T9ZA 3K17A 4ZVHA 3K57A 1M90T 1QLNA 5THWA 2K1RA 3D5MA 3KJQB 3G6VA 2OPRA 3U7JA 4JI3I 3MEDA 2PO0A 4HI1A 1WOSA 2JEIA 4OHWA 3Q8RB 2GA7A 2RDIA 4L74A 3JQKA 3SSSA 4DSLA 1RT5B 3FRZA 4LOMA 2QX0A 4NYOA 3ENVA 2VJUA 2ZHBA 3RRHA 4LF7E 2GCFA 1IR1A 4URQU 1A7GE 2J7KA 4DR5I 1O0PA 5F0UA 4FW6A 2AJ2A 2CXEA 2W2QP 4F02A 2A2CA 1PJ7A 2VKZG 3J7AG 1U49A 5CABA 3CMAS 1TUGB 3N79A 4X4RA 3HF5A 2VQEF 4HT5A 2ZITA 5HP1A 3PHTA 2VG7A 4F3OA 2CRLA 4DFJA 1RAAB 3OTDA 2B4PA 1UVMA 2W4CA 4O4GA 1NDCA 2I1RA 6FDRA 2YKNB 3QFHA 2IC3B 2RNEA 4ED1A 4LCGA 1L3VA 3LNUA 3C3LA 2RB7A 3FCHA 2XTJP 3TOQA 5ETKA 4CTAB 3ZZ0A 3W2WA 2E1CA 4LF8J 5C0XE 3H5SA 4NASA 1KP6A 2YKAA 4JI7E 4D3GA 1BLUA 3K7RA 3P96A 2CVIA 1ZOTA 4EZ9A 1DQ8A 4AM3A 1V3RA 5L1KA 4C0HA 3GSIA 3R7NB 4V19X 2ZBCA 3BBBA 2HHQA 5HJXA 3OJSA 1WKKA 1DBDA 4CLFA 1HBMB 2RIJA 3D0IE 5ETRA 2GC8A 2G0CA 5MAOA 1L3TA 2UVUA 4GKKJ 1V9OA 2YKMA 2NZ4A 2F4VI 5GAHU 2M8HA 2UVRA 5F8NA 4JOUA 3G6XA 4X4OA 5F3TA 4KQVA 8RUCA 2OH2A 4DSJA 4Z7CA 1HW9A 3A8EA 2Q1LA 3MUTP 4WF9Q 3B4MA 4PUOB 4G1QA 2QIFA 4DX7A 4P9SA 4JI6E 3MECA 2NPIA 4ED7A 1U0HA 2ZWPA 3NP5A 2GQCA 4Q5VA 3QNWB 3P76A 2KZZA 1FFGB 4JI2I 1S4EA 4B3SI 2NUUG 3BEGB 2CQDA 2B4UA 5GAGI 2HS0A 4C98A 4KTQA 1RJJA 2PNMA 1A0OB 4LSZB 1YRUA 3CCZA 4LIRA 3CO0P 1HNZI 1X4CA 2KH9A 3NBPA 1QD1A 2QYCA 4K0KJ 1RR9A 3IBCB 1Y4SA 1SKRA 2Y9HA 3QQCD 4JI3E 4MU1A 2ROPA 3R27A 1NCLA 1VQOS 3PY8A 1Q8LA 3FGVA 4WK1A 3NGTA 5LJ3Y 2XZDB 1KWMA 4I56A 4Z7YA 2GO3A 4B3MI 2VPWB 2AJFE 4BC7A 2CADA 1VHFA 2RSQA 2XMKA 5E7OB 5I4MA 4DR5J 4ED6A 3R5BA 3T5JA 2QFIA 4Q43A 1U26A 3TX8A 2I6WA 3UR0A 4X66J 1JJCB 3QIDA 1CS4A 1SIZA 4F0HA 3R2DJ 2YNIB 3DLKA 1V3SA 4WYWA 4OX9F 3G8QA 2JEAA 3F44A 3PW4A 1S1TB 4GVBA 3OLAA 1Z2ZA 4FBUA 4LF9J 1HNXI 2NLWA 4PRFA 2AGQA 2AJ0A 1JK9B 1WC1A 2XYGB 1OY9A 4IG0A 4J37A 5JXSA 5GAEU 2HQCA 4I64A 1ULRA 2HVEA 3OR2A 2EFPA 4ID8A 4NBQA 4NLDA 4O3PA 1GXLA 1UAWA 2CPEA 2KN4A 3CE8A 1F5BA 5ETPA 2FJDB 2DGWA 3EJMA 1NDLA 3V6DA 4K4TA 4IZJB 5C5JA 3T1YI 1ZM9A 5D3GA 4TYAA 3BH7B 2KHCA 4L76A 2K2PA 2D9PA 4K4XA 4B9LA 5HVGA 3GJQB 1LXNA 3JAMQ 2HQFA 1FD2A 4DFMA 1LWCA 1FWKA 4WTOB 3QWPA 4JI0F 5LJ5Y 4M8LA 3PVXA 5DJBA 4ER8A 4ECRA 3M1VA 4FKYA 4DV0J 1M1HA 5C0XC 2HYIB 3MTKA 3SCLE 1LK5A 1RCXB 5K36B 1VK8A 1HW8A 2B43A 2C38B 1S97A 1XTZA 2EFNA 5HVHA 3KHGA 4ENOA 2ADCA 4RUHA 2ZNYA 3MDFA 2XB2D 4EBCA 5D6GA 2BQRA 2AE8A 3POTA 2NXEA 3MM5A 2MQ8A 3JSYA 3O5TB 2DH9A 1KTVA 2MTLA 4YR0A 5HANA 1B7FA 4W90B 4DV6I 2OPPB 4DR1J 1Z2LA 3N28A 3Q2SC 3OXGA 1ZTWA 1J5OB 1TL7A 4DQSA 3OHAA 2VB6A 2OHDA 1Q53A 1LK7A 5DO2A 3TJAA 1VRQC 2EBGA 4LR9A 4P6QA 4R0JA 4EWTA 4QNJA 2G0JA 2J9DE 2VBYA 4CO2A 4JI1E 2GJFA 1RP5A 3AXMA 3I96A 2NXNA 4O3QA 4FS1A 3MD1A 3V6KA 4B3MJ 4J3DA 2LMIA 2MZRA 3AB4B 4FP9A 1FTCA 4JI0J 3G6YA 2RD5C 2ZHAA 2CIMA 4OJGA 2XMUA 3H5UA 3VZIA 2AJ4A 1TKZB 2FVQA 5CCMA 4C8LA 5H9FJ 5DLFA 1U2RA 2FHOB 2XSFA 3NS7B 1BMQB 3P5BP 2Z2ZA 4IQXA 1HNVB 2G0IA 4ZVGA 5C42B 1S1UB 1FRLA 4F50A 5EX3A 2AGOA 3MMAB 3UO0A 3AJ1A 2WK4A 5KFBA 5I3UB 2HWIA 3LP1B 3QT6A 3CJ0A 5F0WA 4DUZF 2GX8A 1T7PA 3LQVA 2V5HG 3ILLA 1Z5BA 1S48A 4LRCA 2JJ4D 5DETA 3L3CA 1DJ0A 5DQGA 4ZPAA 3LAMA 3QJPA 4E2FB 2EFVA 1ZM2A 3PJXA 1WC0A 4LFCJ 1N88A 1KOOA 1MWYA 2YY3A 2HFVA 2ZOMA 3BO3A 5A2QY 4DL6A 2YPYA 1R0AB 1YJTA 2JH3A 3UNGC 3CMQA 5HJYA 1LWXA 3I0SB 1VS3A 4ZVPB 3E01B 4OI2A 2YKQA 3QO9B 2HHSA 1RI7A 2D1CA 2IMOA 4X4TA 1KLMB 4G1PA 1R0CB 2L3MA 4DCPB 4F2RA 3DOMA 2DEJA 3Q86A 2O5DA 4IZKB 1F5AA 3C66A 1Q78A 5DZ7A 1C0TA 4OYMA 4IFVB 5FDLA 4M5DA 5A6PA 4RW6A 2QLWA 3PYDA 4MKAA 4USUA 2ZOGA 5D4LA 5KT5A 3G6ES 3QRPA 4QR0A 1GH8A 2VQFE 1SB6A 1NEEA 1UZHA 1HIYA 3ZTOA 1HYSB 2F40A 3E51A 3D9BA 4ILRA 1N5YA 1AT1B 2XULA 3GYNA 3OVAA 1UDNA 4N47A 4DV2F 3WBZA 4MU4A 1HNVA 2DHAA 3HSZA 4HT7A 3M30A 2CZVC 2W2PP 2N4CA 4QR2A 1XXEA 4DLGA 1MG7A 2F5GA 4Y34A 2AEJA 2BJ3A 1RLDA 2F9DA 1T0TV 4NZ7A 1OIAA 3T19A 3LTOA 3UN2A 5C7PA 5KFDA 3KMSA 2O01C 2J0XA 1QAXA 4W98A 4FS2A 2YQ3A 2PSZA 2VONA 5L1IA 1QSLA 2FLLA 4EI2A 2BANB 3C6TA 3DRSB 1TV6B 3DGPB 4IFYB 1LWFB 1U09A 5IV4A 2XM3A 4QIFA 2XQCA 3UE2A 3NGSA 5CH7B 4DS4A 1R8HA 2O66A 2DKOB 2RUGA 3QLHA 4XK8C 9RUBA 1R8BA 3TA0A 1X5TA 4ZITA 2HHXA 3CCWA 3W65A 3EVMA 3W8PA 2R9LA 1S0OA 1JX4A 3CJ4A 4J9PA 2FVRA 1SUQB 4OO1A 2E5LE 2WSEC 2D3O1 1YKWA 3THTA 1FI4A 2CPZA 3CTRA 3T1YF 2V8PA 1S49A 1F60B 3V4MA 2M7SA 3NY0A 1R6LA 5JEAB 2WSCC 2CJBA 5JEAD 1PSDA 1XIQA 4O3SA 1S7HA 2JLFA 3JTNA 5H1SV 1D8YA 1FRMA 2A0FB 3N5BA 1HNXF 2CG4A 2ZD1A 2V50A 2NS1B 2XMVA 4BA2A 2Z2YB 2VQEJ 1RA6A 1C1BB 1WEYA 2WOMB 3I5CA 5H9FK 4LF6I 4OX9I 2FHMA 4ETXA 2QA4S 3IRWP 4JV5E 3GILA 1I5OB 2IAJB 1RBAA 2PO4A 1QTNB 2X51A 3DGPA 3TR5A 4ES2A 4R5PB 3OUYB 1HHTP 4B3TJ 3PO5A 1S59A 4FVCA 1FA0A 2EWHA 4ZHRB 1TKXA 1PYTA 4WKYA 3AH6A 4LQ3A 3DN9A 4C8MA 4OFZA 4IFDE 2MZJA 2J7UA 4IO9Q 1S76D 4UOCA 2DXFA 2AJ1A 4DX5A 4Y65A 2HNYA 4QWDA 4LFAE 1RB0A 1TR0A 1UW9A 4K59A 1P9YA 2BA1D 2ZZMA 1HWKA 4DMZA 4J90A 4KO0B 3RZAA 2FLNA 1NK8A 2OPQB 4CI0B 4ZVIA 4A8QA 5ETOA 3J80U 5IWAE 1LQ9A 1XR5A 2EEYA 1HA1A 2HFOA 1BUXA 2YWHA 5CYQA 2ADBA 2C22A 1TKDA 4UUWA 4GO5X 2AYMA 5BXIA 4MK8A 1AYEA 1M5OC 2R8JA 1WEXA 3O3LA 4DL7A 2LXUA 3GFHA 2BV3A 5D0GA 3X3UA 4RNFA 2COLA 5J1EA 2ZH8A 2FVSA 1LFWA 2VFTA 3PW7A 2W7PA 4X65F 1L5UA 3BKTA 2Z5CB 3KTQA 3W2VB 1TL7B 3BBCA 1JLAA 4FXVA 1KVIA 4I3HA 4F3MA 4H4MA 1IKXB 1U1OA 1HNIB 3EGZA 3GONA 2CQ0A 4FW4A 4ISAA 2NXUA 2WONB 1ZPWX 2WVBA 4FDFA 2CZ4A 2JEFA 5IC4B 2HHPA 1CQNA 3VWSA 1UWBA 4F04B 4KRWA 3TNVA 4F4YA 1NSKL 3VGUA 4ZCMA 4PYAA 1WDTA 4U96A 4B9NA 2HZCA 3QT5A 2DH8A 3DRSA 4FYVB 2DGOA 3KDNA 4DPWA 1XMQF 5FJ4A 4DV2E 3HHLD 1XNRF 4QWEA 4FWDA 1RQ0A 4F0KA 1M0SA 4HHUA 2RKIA 1IKWA 3PDNA 2W9AA 2FVPA 3MF5A 1HWUA 4USVA 1Y00A 2ABYA 4C0BA 2Z5EA 3MEGB 1J5EJ 2ZH4A 3D0HE 3M7VA 2XNQA 1Z5CA 5A8WB 1N54B 2VG5B 1SH0A 2XGPA 4XPCA 4DUYE 3ISND 4NLXA 1YI2S 1KSPA 2MJUA 3WC2A 4PQUA 3AD9C 2Y1RI 1FEHA 2R8HA 1CG2A 1T8EA 4B3TE 4QU6A 4ED3A 1EJ7L 1RISA 1CPZA 4YHHE 2DGQA 2FHJD 1NM2A 3AT1B 2YVSA 3GFYA 3ICLA 1IXKA 5I42B 2UUBF 2NSCA 4NXNE 3U1KA 3C46A 3GZ7A 4X64I 1KD1T 2BJ7A 1QDUB 2CPXA 4IR1A 2UUBI 2OMOA 2DRDA 3THPA 2DY1A 1WWHA 2C2DA 1VQ4S 3NS5A 3GMEA 2DR6A 3MM8B 1RYRA 4OZEA 3DLEB 1VISA 1OY6A 4ES1A 3A3OB 5GMEA 4XTJA 1UVNA 1E3PA 3UCZP 5SUHA 4X65E 2F1FA 2HHVA 1RWUA 3CNQP 4B3RI 4JI7I 2LDIA 3MM6B 2HWTA 4UF4A 2RAQA 2V34A 2VPYB 2YNGA 1T02A 1B0TA 1YJ9S 3Q2TC 2OTJS 1TL5A 1N0UA 4ANCA 2Z58B 1TK8A 4DV4I 2R7UA 3SQGB 2C2RA 4NA3A 1N36I 4DN9A 1UJ5A 4CM2A 5K8MA 1EETA 5K14A 3V6JA 5IT9Q 1FVSA 1KVKA 1S9FA 1ITPA 3IMQJ 2XC9A 1NDPA 4U67Q 1NZAA 3UNYA 5DS7A 4IFDC 2ASYA 1UA1A 2RDJA 3C6UA 1ZA1B 3DRPB 4ZIVA 2C2ZB 3MAQA 3IA0A 1X4AA 2B3TB 4DPUA 1FKAF 2C39A 3Q8VA 4OI6A 2W2OP 2DNGA 5F8HA 5JEAA 1WHWA 3ZNJ1 2V2VA 2BOPA 4DR6E 5DM6Q 4F4WA 2B8PA 3AA9A 4JI5I 3FJ2A 1SXLA 3WZ0A 2PT0A 4YR2A 1ACMB 1VCTA 1IQTA 3RTVA 3KLHB 2BACA 2XY7A 4B3MF 4LF7I 1LWCB 2PO1B 2MQOA 4B02A 1SC6A 1RGVA 4DR2J 4WIQA 2FPHX 3ET6B 2JEGA 4JI1F 1KS2A 4GKJJ 2DCLA 4DX6A 3J81j 3SI8A 2N4DA 2NQPA 3M7ND 1QAIA 4PR6A 4WZQA 4DZ6A 4G1QB 1XN9A 4OO1C 1FJGJ 1Q7LB 1HNZF 3RR8A 2RH3A 2KYXA 1B64A 1N32E 4OI3A 4MKVA 2Z4PA 3K85A 4ECTA 2OKQA 2DNRA 2DY9A 1U1MA 3RU0A 1UPPA 1RHJB 3IR5B 1EIYB 3MEEA 5IFMA 3V4IB 5D0RA 1JLEB 1VRUB 4NLOA 4J9RA 2QEXS 4LF5F 3DI6A 4KAIA 1Z5AA 4NXNI 2P9GA 2EG2A 3DOLA 3ONQA 4PXDA 2LA6A 5A0YB 2PE8A 1RHQB 4KKOB 2ASDA 1UDSA 2CUYA 4MU3A 2F4VF 1U6BA 2CWKA 4WP9A 1IBKE 1WELA 1FDAA 5J2PA 4LFCE 3TO8A 2E5LI 3QYYA 2WVDA 4TYBA 5J2MB 3UW1A 5J1NA 2IM2A 6FD1A 2DPIA 1ICEB 1P27B 4M5JA 1N36J 3GFZA 2IERA 3T1HI 3CULA 3LGMA 2DNNA 1L3SA 1X4FA 2VIHA 2GIRA 3N6MA 3W3SA 1LWEB 2OO4A 2VL1A 2BE7D 2OD4A 3M4XA 3RG6A 1BC6A 5E3RA 3MCSA 1T9WA 5EWEA 4YDXA 2HFSA 3M6AA 2CNNB 1BXNA 1B62A 2WVCA 2VBXA 2DCUB 2KHDA 2ZC3A 4N5SA 3SDEB 3HO1A 4L72B 5C24B 3GV5B 1A6LA 1FFWB 4DU7A 4I68A 1GT8A 3GCMA 2VASA 5DGBA 3JAMU 1L3UA 4P7AA 3R5GA 4RO0A 4N8OA 5H9EJ 4KE5A 4QQBA 2E9ZA 2MSTA 3NGKA 2CDQA 4PWDA 2DD8S 2JNJA 3HM9A 1Q7YT 1CVJA 2VQFF 4ZKAA 1YRTA 2ZE2B 4A8MP 2J9CA 4YN3B 4OX7A 3EXCX 5J2MA 1Z0GA 2QMUB 2OELA 4JI5F 2R8IA 4YS2A 2EC2A 2D9OA 3Q24A 2ZH6A 3ILJA 2EFGA 3BKUA 1KQGB 1FJGI 5ETSA 3DNCA 1N33I 2B7CB 2E1MC 3M8PA 2V4RA 2HURA 3QGPA 5CYJA 2B9YA 2VA3A 4AQYI 3OR1B 1JLCB 1K44A 2QV6A 4DV1J 2O67A 4FYXB 4XDCA 4F4KA 3OFEA 4IOBA 4URGA 1USVA 4DUZJ 1MWQA 4EMDA 4OI0A 2LQ9A 1VC0A 1Z0BA 1X4GA 2HIYA 1SKWA 2YWGA 3C19A 3L7UA 3N01A 5AXNA 4UY85 4FF1A 1VLOA 2CJQA 4HLBA 2RU3A 1Q8IA 3CGIA 1NJIT 3ZM7A 5LMNE 5BYSA 4F25A 2DYAA 3OXLA 1UA0A 3VQSA 5I42A 1Z1ZA 3HULA 5IOLA 4Y2IA 1YHCA 1WKLA 1C2PA 3PW5A 1YIJS 2KM8B 2CPFA 2MZQA 2B8QA 2AZ3A 2WW4A 1SI9A 4RBVA 3EICA 4C3LA 1EHWA 1T3NA 1VC5A 1FKPA 4U7UK 2GW8A 3R7SB 5KFVA 4A8YA 3T1HJ 1WG1A 2R3VA 3EGVA 2BE9B 4DV7J 2PD1A 4A8SA 4CCHA 4IS9A 2V8HA 1HK7A 2NYHA 3J7YI 4DCOB 4UTGA 2ATLA 5AXMA 2FDNA 3DRRB 4DR1E 2ILYA 3M2UB 3MMCB 4MIBA 3CJ3A 4PWUA 3K2YA 3VZHA 1Y3KA 4A48A 3UDCA 3G4SS 5F8GA 1G6BA 3M8RA 4S0MA 1YBUA 3PYFA 3DRXA 3CCMS 4DV6E 4DV1F 1JLQA 4LR8A 1FFSB 1N34E 4RW9A 1WACA 3KLFB 4NYZA 3PEJA 1WC3A 4CP5A 2YQ0A 1DQ9A 4FVMA 4CLYA 5JUMA 1YVFA 2X1AA 2M0GB 4LRFA 3R5JB 1NH7A 1RTJA 4RUCA 2O1VA 3E01A 4ECZA 4JI2E 2E44A 3AJDA 2K06A 3FC9A 4ILLA 4LBPA 2EK6A 2AHOB 1R6VA 1PO6A 4UW2A 5DZ6A 1H38A 1VQNS 1RT4A 3QRQA 2PA3A 8AT1B 1WJ9A 3N5FA 4GO7X 3VAJA 1HD1A 1TUVA 4I2QA 4IDKA 3SFGA 2KFZA 5KFWA 1IKWB 5C0XB 1Y11A 1S9EA 3NXZA 1Y6ZA 5AXKA 2PNZB 3IS9A 1IUJA 2ROEA 4NRUA 1V6HA 1NLKL 4PRXA 1OYEA 3PHEA 2YNFA 1PBUA 4ZPWR 3SSQA 4JI7F 4IG3B 2UXDF 4QYZK 4GQUA 4YY3J 1C0UB 1NKBA 4YHHI 1VJWA 2VODA 2KO1A 3M85G 1N5YB 4CLUA 1GQEA 1FRJA 4C6AA 4ZN3A 2IFXA 2E1AA 4CT8A 1VQ9S 2F9JA 4DUZI 3ZTQA 1F3VA 4I2PA 2MY7A 2HS3A 2MLZA 1AZSB 1X9SA 4PZVA 4RX6A 5KFJA 4X62I 3KJNB 5CD4H 4DQIA 5LM7E 3FBFA 4NA1A 2FZKB 5AXLA 5BR8J 4UOFA 3H4DA 3CJ8A 1PIEA 1S0VA 1RAFB 1AA1B 3IP0A 1AUSL 3MMBB 3GIMA 4R8UA 4QCLA 1IWGA 3CCJS 1XNRE 1N56A 1MU2A 3MM8A 3ITHA 2CG9A 2R4FA 2ZOFA 4C8NA 3M32B 5GADI 3DOLB 2C2EA 2ZZNA 1GX5A 2MZ1A 5DDRC 4ED0A 1RWOB 3F56A 4UQGA 3M2RA 4TU8A 2DBBA 2F8HA 3O2IA 1MMNA 2HFZA 4OZ1A 4K4YA 3PX0A 2IRXA 2F4VJ 2BX6A 1TKTB 1ZS6A 4R0EA 5IT4A 2K1RB 2Z5BB 2ZUAA 3PRYA 3EDQB 2IOPA 5K8OA 1TVRA 2M5YA 3I5AA 3LA0A 5KFIA 1N34J 1M5PC 4LFBF 3ZFVA 2X3DA 3DHWC 5KFPA 4U7UD 4HXZA 1HR0E 3OLBA 3OL9A 3BGRA 1U1QA 1SKSA 2HGLA 1Q8KA 1WOOA 3EM1A 3KLEA 3V81B 3D4JA 4LF4E 3TZZA 2XHCA 3HSDA 3M05A 3MR5A 2IESA 1WOPA 3GSDA 3WDOA 3VAFA 1HNZJ 4JI5E 2YX7A 4P10A 3PS3A 2LKZA 3R7BB 4ES3A 1P9QC 2AEFA 4R1FA 5KFZA 3US5A 4NMXA 4AL5A 3KK3B 1NK6A 2ZDPA 2DJWA 3VF0B 5ELWA 3JYTA 4TQRA 3HVWA 4RNHA 2LECA 2QLXA 5JEAE 2KDOA 1OJ4A 1S4FA 1EKRA 3B4DA 5B0DA 4ZP9A 1X4BA 3BSNA 4MQYA 2WW8A 3HD1A 3IR7B 2F3JA 2RQKA 2Q3PA 3A12A 3KLIB 3MR7A 2PO0B 1N5QA 1S1WB 2WHOA 4USHA 3ET6A 2OFHX 5E0OA 3BSAA 1DHMA 2R42A 5DLGA 4CH1A 1RAEB 2JFDA 1X9WA 1RT1A 2DGXA 2CQ1A 4PPDA 3NCRA 4GKKI 3BGRB 2C2MB 5CD4A 3L7PA 3NAHA 1HYSA 1S6PB 1LW2A 1F9EB 5CA5A 4QZVB 3OT9A 3CCES 3ZTRA 5EUHA 3R2CJ 2JEBB 3OJUA 1H2TZ 2OGUA 2WB4A 2BKOA 1XQIA 4QOTA 2J9DA 4LF7F 4WP3A 4USJC 4LMZA 3KHRA 2NREA 2RE1A 1OS5A 1IKXA 3UN3A 5SZTA 2HK3A 3HVRA 2ZD1B 4O0IA 4IZJA 3RB3A 3D0GE 2MZSA 1MWZA 1RWVB 3OPKA 4GRSA 2MKIA 4LFAF 4LF8E 1V3ZA 3EWGA 3G82B 2CPIA 2IVFB 1E6VA 1RT2A 1T03A 2GMJA 1OQ3A 1Q79A 4K7QA 5EHHA 4JV0A 2UXBF 2VF3A 3WU6A 1C4CA 3ZZTA 3LO3A 3P3CA 3GJSB 1N34I 1JLFA 2DHHA 1S6QA 4J9KA 2BA0D 3AY0A 4IFVA 3NNHA 2QMWA 3FK4A 3RYLA 3MUVP 4JV5F 1OYSA 5L3JA 2XY5A 3D6FB 2XY6A 1F3FA 3I32A 4DV6J 3TUZC 1S57A 3EMTA 4HR2A 4C97A 5IZHA 1XMQI 4WPAA 2NN6A 3W9HA 2PNLA 1NHHA 4WUCA 1ZA2B 3BKFA 4IOAQ 3MEKA 3LP0B 1HNXJ 1UFLA 2MLYA 3HX9A 1D3WA 3RGIA 2XO7A 3CCUS 2AD9A 1RT7B 4U8YA 5KG4A 3CVKA 1YJVA 5HBMA 4DR4F 4IFDB 2BM0A 4Y3CA 2R7TA 1YJ7A 2FZGB 3QFWA 4I1TA 4O0NA 2HQ3A 1MMLA 4K50A 5D8HB 3PS2A 3LP2B 4IRDA 5CQGA 1KR4A 1BE4A 3QATA 3GLLA 2JWNA 3ZXWA 2HWHA 3UD5A 2LCWA 3FSXA 1SC4B 3H5XA 4ZPDA 4B3SE 2F8EX 4UQTA 3K5OA 4KIAA 2UU9J 4LF9E 3KUHA 2C3UA 3O6QA 2VG7B 3RW6A 2XLKA 1H7SA 3ZO7A 4WTYA 3CUNA 1N48A 4RW4A 1XMQJ 4H4MB 2DO4A 5IXUA 3RJMB 1YK9A 3OVSA 4P75A 2BUNA 3IS9B 1VRTB 2V4JA 4X4PA 4DV0I 1S9EB 2PNZA 3CCLS 2LLZA 4IYQA 1KHWA 4DPTA 5DRQA 3J7AM 4DUYF 1RAOA 4NLRA 1RAHB 3TYTA 1H7WA 2DNZA 3IFEA 4FYDA 2NN6F 4YY3F 4MTPA 3Q6NA 3KJFB 2ZDOA 5IT9U 3BR9A 3NCPA 3HVTB 4ED4A 2M8DB 4G1IA 4X66F 2E9TA 3QJLA 2C38A 2FC8A 1FF2A 4OO1B 5M2RA 2J0QD 3U1LA 3OSNA 4F36A 3DDNA 2ZKTA 2YXLA 4BA2B 2KU7A 5JEAC 1FERA 1N52B 2EVZA 3ZTPA 3PM9A 3K59A 3THVA 2MB0B 2HHUA 1VIXA 4FWHA 1FRXA 1S9GB 2CWXA 1H2VZ 2HPUA 2VV5A 2FHKA 3QSIA 4L3NA 4L6V3 4LJMA 3SQOP 4P2XA 4QBUA 3S8SA 1BHNA 5CXTA 3ZKDA 5KFYA 1U1LA 1BD6A 1WC4A 2VU5A 2BW7A 3IR6B 4C2MA 3GIRA 3D54A 3FEZA 2CAJA 4LF1A 1E3HA 2HZVA 1H98A 1FXRA 3AQPA 2W9BB 3TZYA 2C1EB 4OYPA 2HRUA 1VYAA 2ZBKB 2V2KA 2ZZTA 3FDSA 3OUYA 4JI0I 2MHEA 1XR6A 4X65I 1IBMI 2ACYA 2RT3A 2XZWA 3ULHA 4OZLA 3MURP 3Q6MA 2CA9A 2E66A 4TXSA 2R7WA 3RW7A 1WNEA 2BE2A 3IWNC 1F2GA 4DS5A 2ZUGA 3OFGA 4DR3J 3IBWA 4WIIA 1HQUB 3U27A 3EXYA 1J27A 3TZWA 5HMYA 3BDEA 3NRBA 3NGDA 1IKYB 3POTB 2L9NA 3SZ2A 1U1KA 2IMWP 4LCHA 1NRKA 3M2UA 3PTWA 2HHHI 1FO1A 2R2SA 1ZZNA 2XG8A 1S0NA 4X62E 3A13A 4ID5B 2FVCA 5K5MA 1BQNB 2KB2A 3LOUA 5E3AA 1NNDA 2AW0A 4FNIA 3VQTA 5F8IA 2D7SA 2I9SA 2UU9I 2AWZA 3GIIA 1C4AA 2JEAB 1OSCA 3H59A 1YH8A 1VQYA 4JG4A 4B3ME 2DHSA 3HSJA 3QBCA 4MK9A 4DFPA 2BBEA 1T94A 4F7VA 2D69A 2ZBIA 3LAKA 5HQ8A 1IBKF 1Z0TA 3RAXA 2JHEA 3A8KA 3OTCA 4LVOP 4OJHA 4OHVA 5D4NA 1NSAA 3P49B 3CO9A 5DDQC 3D1QA 4LF6F 1I1GA 1R6YA 2RRNA 2B4VA 3DOMB 2QG9B 4TLQA 3SCIE 5AJ3F 3U02A 5ETLA 5L38A 2I8EA 1X0PA 3FQLA 2PN6A 3D68A 1OPZA 1PAUB 1NPKA 3HFKA 3Q89A 4BLGA 3V6HA 3H98A 1NK7A 1XHKA 3WIVA 1NHIA 1GMVA 3QSYB 1R31A 2C37B 4DOZA 5IS2A 3QRRA 4NLVA 2CQ4A 4FZVA 4Z2XA 3GJTB 2B5JB 4DV2J 1Y9OA 3SDEA 2JC0A 3HI9A 2W01A 2ZH5A 3UI3A 1H0HB 4LFAI 2NN6E 4DQQA 3MOJB 1U0HB 2C3YA 1K9MT 1F0XA 2QTWA 1SH2A 4ZVQB 2AZ1A 1K73T 1MSWD 5CHCB 1FJCA 2BOAA 2HNDB 5GMDA 3K89A 1HI1A 4KSEB 1HBUB 2L48A 4BWJA 1S1XB 3CF5Q 1HKAA 3NBPB 1VQ8S 2I38A 4MKYA 2ZJPQ 5BR8E 4LUBA 3BB5A 2XLIA 3QIPB 2W9BA 1C1CA 4DR3I 1RHKB 2BJ9A 4UOHA 3TEHB 1QUPA 4A46A 4NXNF 1AFIA 4IFDD 2UXCI 3R6GB 2CQHA 4Q0BB 2XEXA 3HHNB 2DHGA 3LP1A 5DDOC 3SYZA 1VJQA 3GJRB 3MPWA 1SJ1A 2B5JA 3I9V9 1R27B 4IKAA 1EA6A 4CM0A 4MU0A 3WQPA 1UDQA 1U2FA 4NLWA 2Q6BA 3SMZA 2NN6B 3B78A 3GE9A 4PPZA 4OX9J 1P6TA 1VIOA 5DRPA 4BA1B 2KRRA 1MU5A 2VQEI 1U1NA 1Q8BA 4DV3J 3JSMA 4PXCA 4M5NA 4CO4A 5L9NA 1HBMA 1FD8A 1N8RT 1IBLI 5LMUE 1UPMB 1NK4A 5HMXA 4B3TI 2KFYA 1DQAA 2X36A 1GK8A 1HPZA 1U6ZA 2B6AA 1B7YB 1UWAA 5FLXU 3WX4A 2A1BA 4DSFA 3T3FA 3J7YU 5A0YA 2CYYA 2YNHB 5L8RC 5GAHI 4RW4B 5E3CA 3HKWA 3OTOJ 2UXCE 2XHWA 3VGVA 1FRIA 1UKUA 2MKCA 3QO9A 2A10A 4NZ0A 1I94J 3I56S 4ZP7A 3DDKA 2V8DA 3CDUA 5KTQA 1U1PA 2LEPA 2J8SA 2ALYB 4PG6A 5FLXC 2AMCB 2UZAA 3I5BA 3MEDB 2E5GA 4DZDA 2R2UA 2HHHF 1DURA 4MH8A 4EEYA 2DRBA 2UXDI 1VQ6S 4TQSA 1QAYA 2FTRA 3IBFB 3ILIA 4EGLA 2WNRA 2BRKA 1EQMA 4PKDB 4ALZA 3TZXA 4DL2A 1VC6A 2VA2A 2K3KA 3Q8SB 1QVFR 5E3QA 3PV8A 2CVEA 1CC8A 2VFSA 1FXDA 1T9XA 4ED2A 2VJVA 2PFFB 1UETA 5I3QA 1RZMA 5BYRA 1NSPA 3I82A 4KY3A 4LFBE 5DNXA 2IYGA 3W5YA 1NO8A 3RB6A 3GG1A 1JLQB 3BDPA 4MDTA 2F8MA 2HVDA 2W9CB 1U25A 2CNKB 2DIUA 3FFIB 2F1DA 3PFOA 4TN2A 4Y00A 3T1HE 3VV2B 5K9FA 5KOXA 2E5HA 5KFGA 3G86A 1CQMA 2UUWA 4DFKA 1Z0VA 1MN7A 2J65A 1I3OB 2QRRA 4P52A 3CXCR 3NGUA 1AFJA 1B0PA 3E2EA 4DV4J 3MM9A 2QYGA 4DLEA 1M5HA 1S6UA 4DEZA 2M70A 2V63A 2G2ZA 1HBUA 4EBDA 2HVIA 3DLEA 1NKCA 1RT6B 3RBZA 1FNOA 4CH7A 2FJWA 1LOUA 4ATNA 2MKJA 4FXWA 2CJKA 1YZ7A 3NNCA 4E8UA 1ZBTA 1XWLA 5KFLA 4DL3A
chains in the Genus database with same CATH topology
4DV0E 2UUAI 1BKNA 4IZJD 5A2QQ 1MX0A 3J80C 1N32E 3K85A 1XMQE 1J5EE 2HHHE 4JI2I 4DV5E 1Z5AA 4NXNI 4UT4A 3OTOI 1ZXNA 4JI6I 2CZ9A 4GKJI 2E1RA 1ZM3A 1IBKE 4WUBA 3WU3A 4LFCE 2E5LI 4JI1I 3T1HI 4DV7I 3ZZUA 4KHPI 1ELOA 1H7UA 2HFSA 3M6AA 1B62A 4NXMI 4DR2E 4DV4E 1H74A 4DU7A 1QZRA 2HK2A 3LPSA 3WU5A 2VQFI 4DV1I 2LJPA 4FWHA 1A6FA 2HKEA 1Z0GA 4FWGA 4X64E 2UUBE 1Z59A 2EFGA 1HNXE 1FJGI 1N33I 1PVGA 4AQYI 1RREA 1USVA 4EMDA 2UUCI 1Z0BA 4MYUA 3ZM7A 4DV5I 5LMNE 3PYGA 3HULA 1WUUA 2UU9E 1Z0CA 4M1KA 2WW4A 3K17A 2ZM6I 4JI3I 2R3VA 2NPFA 1HK7A 4UTGA 1ZM4A 4DR1E 1XMOI 4LF7E 4DV3E 1NHJA 4LFBI 2J7KA 1DARA 4LF8I 4DR5I 3PYFA 4DV6E 2A2CA 1Y4UA 1N34E 1XNQE 3J7AG 1N0VC 2O1VA 2ZITA 4JI2E 1D6TA 5FWKA 3LNUA 3ZZ0A 1Y6ZA 4IZKA 4PRXA 4JI8I 5IT9C 4YHHI 4FW9A 3WU4A 4NXME 2F4VI 4K0KI 4DUZI 3QT7A 4KQVA 4X62I 4Z7CA 1EI1A 4DV7E 1H73A 4JI6E 2O1UA 3J81C 1PIEA 4DR5E 1XNRE 1S4EA 4X66I 4B3SI 4HACB 2CG9A 4DR1I 2PNMA 4YY3I 1HNZI 1HNWE 4DUYI 1IBLE 1Y4SA 4LF9I 1RR9A 4FN5A 4JI3E 2Z5BB 3PRYA 2IOPA 2BM1A 4Z7YA 4B3MI 4HXZA 1HR0E 4LF4E 3D4JA 1KIJA 4JI5E 1N33E 4R1FA 1HNXI 2A2DA 1OJ4A 1Z0WA 2Z5BA 4IZJB 3T1YI 4LF6E 4JYAE 1ZM9A 3JAMQ 4JI4E 1FJGE 1FWKA 2R42A 2UXBI 2HFUA 3B8HA 2V2QA 4GKKI 4B3RE 4DPXA 1USUA 1S16A 1ZXMA 5BR8I 1XNQI 1KTVA 2HK3A 4DV6I 4RPFA 4LF8E 5LL6R 1XMOE 4JI1E 1KKHA 2VF3A 3WU6A 3ZZTA 1IBME 1N34I 4USMA 5L3JA 4PRVA 5IWAI 2AJ4A 5A2QC 3J80Q 1U2RA 1HR0I 1XMQI 2PNLA 4WUCA 3V5RA 1NHHA 2GS8A 1K47A 3QT6A 1Z5BA 3ZKBA 2BM0A 4JI7E 2UXDE 3PYEA 1ZM2A 2IOQA 4B3SE 1N32I 3H4LA 1H7SA 1NZ0A 2UXBE 4JI4I 2DEJA 4DV0I 4IZKB 3J7AM 4DPTA 4AQYE 4DUZE 4WUDA 3PYDA 1Z5CA 3Q6NA 2VQFE 4ED4A 4LFAI 2CGEA 1FNMA 2HKJA 1MG7A 1N36E 3ZKDA 2Q2EB 3LTOA 5FLXQ 4DR4I 1FKAE 2O1WA 2ZBKB 4LF5E 4X65I 4JI0I 1IBMI 4LF9E 4DR7E 2E5LE 4JYAI 3Q6MA 4KHPE 1FI4A 4GKKE 4X66E 2V8PA 2X7IA 4GKJE 2V2ZA 2HHHI 4JI0E 3HJCA 4MYTA 4X62E 4LFCI 3OTOE 4URLA 5LMUI 4OX9I 4LF6I 2UU9I 4JV5E 4JG4A 4B3ME 3QT8A 1Z0TA 4DV2I 4DR7I 3Q1QA 2UUCE 3J81Q 4IZJA 4DR4E 3P06A 4LFAE 1HNWI 4DR6I 1XHKA 4ZVIA 1H72C 5IWAE 5LMNI 4DXLA 2UUAE 1NHIA 1B63A 4DU8A 2BV3A 3F0NA 1Z0EA 2F4VE 4K0KE 2Z5CB 1I94E 2O1TA 4I3HA 3JAMC 4HY1A 5GMDA 3GONA 4JI8E 4JI7I 2UXDI 5BR8E 3QT5A 4DR3I 4DPWA 4DV2E 4LF4I 1HNZE 4FWDA 2UXCI 2XEXA 4JV5I 2DEIA 3CWVA 2Z5EA 4OX9E 4PU9A 1EA6A 3B78A 4DR2I 2VQEI 2Z5CA 1MU5A 4DUYE 1IBLI 3T1YE 5LMUE 4YY3E 4B3TI 2X36A 4B3TE 3B82A 1XNRI 4YHHE 4NXNE 4X64I 2UUBI 4USKA 2VQEE 1J5EI 2UXCE 2ZM6E 3V2UC 4HACA 1VISA 5GMEA 4XTJA 4DV3I 5FLXC 2GQ0A 4X65E 4B3RI 2V34A 4DR3E 1N0UA 4DPYA 4DV4I 4LF5I 4HYMA 1N36I 5IT9Q 4N3OA 1KVKA 4LFBE 1I94I 1UEKA 3T1HE 1PKPA 2OI2A 4DPUA 1FWLA 3K1JA 1Z0VA 4P52A 2V2VA 4DR6E 4JI5I 1IBKI 4LF7I 4DV1E 4P7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 E;  2UUA I;  1BKN A;  5A2Q Q;  1MX0 A;  3J80 C;  1N32 E;  1XMQ E;  1J5E E;  2HHH E;  4JI2 I;  4DV5 E;  1Z5A A;  4NXN I;  4UT4 A;  3OTO I;  1ZXN A;  4JI6 I;  2CZ9 A;  4GKJ I;  2E1R A;  1ZM3 A;  1IBK E;  4WUB A;  3WU3 A;  4LFC E;  2E5L I;  4JI1 I;  3T1H I;  4DV7 I;  3ZZU A;  4KHP I;  1ELO A;  1H7U A;  2HFS A;  3M6A A;  1B62 A;  4NXM I;  4DR2 E;  4DV4 E;  1H74 A;  4DU7 A;  1QZR A;  2HK2 A;  3LPS A;  3WU5 A;  2VQF I;  4DV1 I;  2LJP A;  4FWH A;  1A6F A;  2HKE A;  1Z0G A;  4FWG A;  4X64 E;  2UUB E;  1Z59 A;  2EFG A;  1HNX E;  1FJG I;  1N33 I;  1PVG A;  4AQY I;  1RRE A;  4EMD A;  2UUC I;  1Z0B A;  4MYU A;  3ZM7 A;  4DV5 I;  5LMN E;  3PYG A;  3HUL A;  1WUU A;  2UU9 E;  1Z0C A;  4M1K A;  2WW4 A;  3K17 A;  2ZM6 I;  4JI3 I;  2R3V A;  2NPF A;  4UTG A;  1ZM4 A;  4DR1 E;  1XMO I;  4LF7 E;  4DV3 E;  1NHJ A;  4LFB I;  2J7K A;  1DAR A;  4LF8 I;  4DR5 I;  3PYF A;  4DV6 E;  2A2C A;  1N34 E;  1XNQ E;  3J7A G;  1N0V C;  2ZIT A;  4JI2 E;  1D6T A;  3LNU A;  3ZZ0 A;  4PRX A;  4JI8 I;  5IT9 C;  4YHH I;  4FW9 A;  3WU4 A;  4NXM E;  2F4V I;  4K0K I;  4DUZ I;  3QT7 A;  4KQV A;  4X62 I;  4Z7C A;  1EI1 A;  4DV7 E;  1H73 A;  4JI6 E;  3J81 C;  1PIE A;  4DR5 E;  1XNR E;  1S4E A;  4X66 I;  4B3S I;  4HAC B;  4DR1 I;  4YY3 I;  1HNZ I;  1HNW E;  4DUY I;  1IBL E;  4LF9 I;  1RR9 A;  4FN5 A;  4JI3 E;  2BM1 A;  4Z7Y A;  4B3M I;  4HXZ A;  1HR0 E;  4LF4 E;  3D4J A;  1KIJ A;  4JI5 E;  1N33 E;  4R1F A;  1HNX I;  2A2D A;  1OJ4 A;  1Z0W A;  4LF6 E;  3T1Y I;  4JYA E;  1ZM9 A;  3JAM Q;  4JI4 E;  1FJG E;  1FWK A;  2R42 A;  2UXB I;  2HFU A;  3B8H A;  2V2Q A;  4GKK I;  4B3R E;  4DPX A;  1S16 A;  1ZXM A;  5BR8 I;  1XNQ I;  1KTV A;  2HK3 A;  4DV6 I;  4RPF A;  4LF8 E;  5LL6 R;  1XMO E;  4JI1 E;  1KKH A;  2VF3 A;  3WU6 A;  3ZZT A;  1IBM E;  1N34 I;  4USM A;  5L3J A;  4PRV A;  5IWA I;  2AJ4 A;  5A2Q C;  3J80 Q;  1U2R A;  1HR0 I;  1XMQ I;  4WUC A;  3V5R A;  1NHH A;  2GS8 A;  1K47 A;  3QT6 A;  1Z5B A;  3ZKB A;  2BM0 A;  4JI7 E;  2UXD E;  3PYE A;  1ZM2 A;  4B3S E;  1N32 I;  3H4L A;  1H7S A;  1NZ0 A;  2UXB E;  4JI4 I;  2DEJ A;  4DV0 I;  3J7A M;  4DPT A;  4AQY E;  4DUZ E;  4WUD A;  3PYD A;  1Z5C A;  2VQF E;  4ED4 A;  4LFA I;  1FNM A;  2HKJ A;  1MG7 A;  1N36 E;  3ZKD A;  2Q2E B;  3LTO A;  5FLX Q;  4DR4 I;  1FKA E;  2ZBK B;  4LF5 E;  4X65 I;  4JI0 I;  1IBM I;  4LF9 E;  4DR7 E;  2E5L E;  4JYA I;  4KHP E;  1FI4 A;  4GKK E;  4X66 E;  2V8P A;  2X7I A;  4GKJ E;  2V2Z A;  2HHH I;  4JI0 E;  4MYT A;  4X62 E;  4LFC I;  3OTO E;  4URL A;  5LMU I;  4OX9 I;  4LF6 I;  2UU9 I;  4JV5 E;  4JG4 A;  4B3M E;  3QT8 A;  1Z0T A;  4DV2 I;  4DR7 I;  3Q1Q A;  2UUC E;  3J81 Q;  4DR4 E;  4LFA E;  1HNW I;  4DR6 I;  1XHK A;  4ZVI A;  1H72 C;  5IWA E;  5LMN I;  4DXL A;  2UUA E;  1NHI A;  1B63 A;  4DU8 A;  2BV3 A;  3F0N A;  1Z0E A;  2F4V E;  4K0K E;  1I94 E;  4I3H A;  3JAM C;  4HY1 A;  5GMD A;  3GON A;  4JI8 E;  4JI7 I;  2UXD I;  5BR8 E;  3QT5 A;  4DR3 I;  4DPW A;  4DV2 E;  4LF4 I;  1HNZ E;  4FWD A;  2UXC I;  2XEX A;  4JV5 I;  2DEI A;  3CWV A;  4OX9 E;  4PU9 A;  1EA6 A;  3B78 A;  4DR2 I;  2VQE I;  1MU5 A;  4DUY E;  1IBL I;  3T1Y E;  5LMU E;  4YY3 E;  4B3T I;  2X36 A;  4B3T E;  3B82 A;  1XNR I;  4YHH E;  4NXN E;  4X64 I;  2UUB I;  4USK A;  2VQE E;  1J5E I;  2UXC E;  2ZM6 E;  3V2U C;  4HAC A;  1VIS A;  5GME A;  4XTJ A;  4DV3 I;  5FLX C;  4X65 E;  4B3R I;  2V34 A;  4DR3 E;  1N0U A;  4DPY A;  4DV4 I;  4LF5 I;  4HYM A;  1N36 I;  5IT9 Q;  1KVK A;  4LFB E;  1I94 I;  1UEK A;  1PKP A;  3T1H E;  2OI2 A;  4DPU A;  1FWL A;  3K1J A;  1Z0V A;  4P52 A;  2V2V A;  4DR6 E;  4JI5 I;  1IBK I;  4LF7 I;  4DV1 E;  4P7A A; 
#chains in the Genus database with same CATH topology
 4H4K A;  3JAM Y;  3K8V A;  5A2Q U;  5LMU F;  2UUA I;  3DD6 A;  3ZZR A;  2Z2L A;  1XBW A;  3NKY A;  4RUB A;  4CNY A;  5RUB A;  2FJV A;  2XWY A;  3NWG A;  3CIZ A;  1DLO A;  3BGL A;  4E98 A;  4GKK F;  1OYR A;  2CQI A;  3TVZ A;  5KFT A;  5KFO A;  3SBM A;  1EB0 A;  5HO4 A;  3MMC A;  3TRG A;  4HDH A;  1MX0 A;  2EFQ A;  2W24 A;  4AD6 A;  3D6M B;  4DL0 C;  4DI6 A;  2Q66 A;  4QIV A;  1HWI A;  2UUA E;  4K2X A;  1K1Q A;  3GIJ A;  3FFI A;  1MN9 A;  1VQL S;  2HHH E;  5L1J A;  3HKZ D;  3OTO I;  2KM8 C;  1T9T A;  3NOG A;  2UUC J;  1E6Y B;  4LVN P;  4O3R A;  2MGZ A;  1AXQ A;  3W5X A;  2CZ9 A;  4GKJ I;  2H1Y A;  2MMY A;  1SCJ B;  2DGT A;  2VFR A;  3DCA A;  1NK0 A;  4AID A;  4Q7A A;  2DK2 A;  4K0K F;  3R97 A;  4WUB A;  3WU3 A;  4QYR A;  4KV8 A;  5DQI A;  3J7A N;  3UD4 P;  4LFC I;  2KJW A;  2GVZ B;  5K8P A;  5LSL A;  2X1B A;  4I2Q B;  4I4B A;  3AOC A;  3M8Q B;  4F8R A;  2J8A A;  3BGU A;  4C11 B;  3RBD A;  4JI1 I;  3NG8 A;  4RLE A;  3FVY A;  4RWX A;  3D67 A;  4MFB A;  5LOQ A;  3VAL A;  4KGX B;  1LW0 B;  1HI0 P;  5HAO A;  4KH0 B;  1W7W A;  2AEM A;  2CJY B;  2DNO A;  4G65 A;  3ZZU A;  2QA1 A;  3R1H A;  4KHP I;  4BWM A;  1UJ6 A;  4CLT A;  3KNG A;  4NA2 A;  1Q82 T;  1YBT A;  4KT0 C;  4O3N A;  5DDP C;  5C0X D;  2UVW A;  3HHL C;  3ZZZ A;  2Y1L B;  1VI7 A;  1DAX A;  1EET B;  3BQ0 A;  3TJ8 A;  5GVQ A;  4QWB A;  4HL9 A;  4NXM I;  4Y0F A;  3OFH A;  4DV4 E;  2E5L J;  4MK7 A;  1PCA A;  1S9G A;  4OYA A;  1RKJ A;  2MGZ B;  1QZR A;  2AT1 B;  1X0F A;  1IR2 A;  1N5S A;  3C14 B;  1RT4 B;  3DI6 B;  5EGY A;  5KFN A;  3PO4 A;  2LJP A;  3WU5 A;  4V1A k;  4B3O B;  2QA4 G;  1WC6 A;  1NDK A;  3FRY A;  3AB2 B;  4UOG A;  5HQM A;  2C28 A;  4LF8 F;  4OYB A;  3IM8 A;  4ZVE A;  1A6F A;  2VQE E;  3M32 A;  3BO4 A;  1FKP B;  3MPY A;  1XMO F;  3BRE A;  1S77 D;  2R2T A;  2HKE A;  3KUE A;  2HQG A;  3EGN A;  2OSQ A;  2OD6 A;  3MEG A;  3MMJ A;  5BYQ A;  1P8G A;  3CCR S;  2XMA A;  2RU9 A;  1WKJ A;  3BYP A;  1NB7 A;  1Z59 A;  4F67 A;  2FHJ A;  2FJE B;  3MCN A;  4J9N A;  3G2X A;  3SQG A;  4ZMM A;  4Y6I A;  3SXL A;  1HNX E;  4YEA A;  2RQM A;  4N41 A;  3IG1 B;  1P1L A;  2B9E A;  3FMW A;  3QAE A;  4KFB B;  4KHM A;  4O4R A;  4WK3 A;  3H20 A;  5B0B A;  4PQU B;  1PGZ A;  2RQ4 A;  2FY8 A;  1RWM B;  4I0W A;  1VQS A;  1F9H A;  2ZKU A;  4NYP A;  5DRK A;  1RRE A;  3M6U A;  3MPD A;  3UDE A;  4UZC A;  5F9L A;  4J91 A;  2DR5 A;  2XBP A;  1OSD A;  3TQ1 A;  3GMG A;  2UUC I;  1BQN A;  1FDB A;  2BKP A;  4IUF A;  1MW7 A;  4ZJO A;  3CD7 A;  2JEJ A;  2QE5 A;  2UUC F;  3OVB A;  3DKD A;  4P2F A;  2EPI A;  3CD6 S;  4DDF A;  2DNP A;  4KJI A;  3PYG A;  4PYD A;  3IWX A;  1WUU A;  4WFB Q;  4QW9 A;  1D1U A;  2OPS A;  3CDW A;  2XGQ A;  4JV1 A;  2UU9 E;  4USW A;  1Z0C A;  3MCO A;  3I6P A;  1SUQ A;  2B0G A;  4TNO A;  2PEH A;  3CC2 S;  2Y1I A;  4JI1 J;  3OSP A;  1O51 A;  2ZE2 A;  2IRU A;  4DUY J;  1JJ4 A;  4BS2 A;  3HVA A;  4KO0 A;  5B0G A;  4ZLP A;  4YOE A;  1BQM B;  2Q79 A;  3NEK A;  3D66 A;  3A3P B;  1KEK A;  3AD7 C;  3M85 D;  3VCD A;  2DXE A;  3CJR A;  3VAI A;  2Y1J A;  1N33 J;  1XMO I;  1WHX A;  2DNM A;  2BAB A;  1NHJ A;  1UVL A;  4OX9 E;  4LFB I;  4NXM J;  1DAR A;  1REV B;  1RT7 A;  4QW8 A;  4LF8 I;  2AX1 A;  1VFJ A;  3ZNU A;  3K5L A;  2DXD A;  4F4A A;  1IJF B;  3DRP A;  2XMT A;  2HBR B;  1SQG A;  1Q5V A;  2O3D A;  3EDR B;  3ILO A;  3L9Z A;  4FPR A;  4WE1 A;  1K1S A;  1ZTT A;  1M5V C;  1CSJ A;  1XNQ E;  3W66 A;  2L9D A;  4A8K A;  3DOK B;  3PR4 A;  4JI3 F;  5K14 B;  3H42 A;  4JI3 J;  1TL4 A;  3CDI A;  1PJ5 A;  2MQQ A;  2M3D A;  4HDG A;  2W2N P;  3FUY A;  1R0A A;  5D0H A;  3TAP A;  2EW9 A;  2JL9 A;  1WI8 A;  4PQA A;  4C3K A;  4Q2M A;  4DBQ A;  3NWR A;  3K5N A;  1S7I A;  3MR2 A;  2RIL A;  3B54 A;  4PG7 A;  1QY7 A;  2HNY B;  1OWX A;  2P6T A;  2E29 A;  2C39 B;  3LH2 S;  4IZK A;  5C25 B;  3J7A 1;  3KK2 B;  2DNQ A;  3SCK E;  1GNK A;  5F8J A;  2RVJ A;  3AHP A;  3VGS A;  4Y2C A;  5LXY A;  3LWM A;  3LW5 C;  4DSK A;  4JI8 I;  3AAW B;  4ICL B;  1WSR A;  2H4Y B;  2V8V A;  5EWF A;  5K36 E;  5A8R B;  2YWF A;  3H40 A;  4GKK E;  1B4S A;  4FW9 A;  3WU4 A;  1SC1 B;  5KT6 A;  4OO1 F;  1WHY A;  1F9F A;  3GYX B;  4FF2 A;  4GKJ F;  4TY9 A;  4OYI A;  1EP4 A;  3QT7 A;  3CSK A;  1KOH A;  3DOK A;  3HVT A;  3IG1 A;  3CJQ A;  4X64 F;  2N7C A;  1NJX A;  2H9Z A;  5HN0 A;  5E3P A;  3W2V A;  1EI1 A;  1OMS A;  1HMV A;  2FLO A;  1D9A A;  2FIU A;  2IRY A;  1VBK A;  2XYP B;  1XC9 A;  3K0J A;  2BYC A;  1U6F A;  1U8S A;  2DR8 A;  3H90 A;  2O1U A;  3J81 C;  4DR5 E;  3SEO A;  3G8T A;  3G82 A;  4HEA 9;  4C0O C;  2AF6 A;  3D1O A;  1U48 A;  4X66 I;  4B3S J;  2PEB A;  3R3T A;  1IBL F;  2FGO A;  2J7W A;  3PFE A;  4YY3 I;  3BPD A;  1MRO B;  4OI1 A;  1N6Q B;  2J0S D;  4A4J A;  4DR6 F;  1AW0 A;  4DUY I;  1PC4 A;  1XMB A;  4WZM A;  4J9U E;  3ISN C;  2GZO A;  4LF9 I;  1WG4 A;  5DG9 A;  2JZ5 A;  2ZBR A;  7AT1 B;  4OX6 A;  3LGN A;  3ZZY A;  2AQ4 A;  1QSY A;  4K4U A;  3K1J A;  3M8Q A;  2VBW A;  3GIK A;  1TU0 B;  4DHV A;  3F73 A;  3NMA A;  2BM1 A;  4YB6 A;  3TAQ A;  1RAC B;  3I0R A;  4DV6 F;  3BM7 A;  1NBE B;  1SV5 B;  1R8P A;  4NPO A;  1X5P A;  4DV7 F;  1U7L A;  1N32 F;  2QZ8 A;  3M1V B;  2BJ8 A;  2Z30 B;  1TMJ A;  2JFK A;  2V0N A;  4LRD A;  4OJ1 A;  4DJB A;  2DPJ A;  2H51 B;  2E7X A;  2Q6C A;  2YWE A;  1IQZ A;  1CJK B;  2K7J A;  3DM2 B;  3E3X A;  4LSL B;  4KR0 B;  4U9R A;  1X5S A;  5G0R A;  3CCV S;  1HBO B;  2PC6 A;  3OBI A;  4R25 A;  3GR0 A;  5K8N A;  3IXQ A;  5B0C A;  2WTF A;  5HVF A;  3CED A;  2E1P A;  4YQW A;  2HVH A;  2WBM A;  4QIW D;  2YBV A;  2YWK A;  3TJ9 A;  4YP3 A;  4H54 A;  3MGJ A;  2KKH A;  4OZ2 A;  3KG1 A;  2PFD A;  5AE3 A;  5L39 A;  3Q23 A;  2Z5B A;  2RML A;  4OYX A;  4ZVU B;  1RCO B;  3TA2 A;  4LQ9 A;  1X4D A;  1OY8 A;  1HBN A;  4JI8 J;  2YX4 A;  1Y5Y A;  1ZAX A;  4JI4 E;  1FJG E;  1Y4Z B;  2R7Q A;  1WF1 A;  2C3P A;  1H2U X;  4IH5 A;  2XLJ A;  1N34 F;  4YHH J;  5C42 A;  2DIV A;  2GGP A;  8ATC B;  2ZJQ Q;  3QWU A;  2IBK A;  4KPY A;  4FNH A;  1DZ5 A;  1CBK A;  2HFU A;  2YH0 A;  3MFI A;  1F6T A;  3B8H A;  2V2Q A;  3KG4 A;  5DM7 Q;  3T5L A;  4DPX A;  5C25 A;  3RRG A;  1USU A;  1SQF A;  1JMT A;  1HQE A;  4XO0 A;  2G13 A;  4CO3 A;  1R8A A;  2AGP A;  2IIH A;  2KXN B;  4YB1 P;  4X62 J;  1TL3 B;  1SBR A;  4F4Z A;  2DIT A;  1U4B A;  3MI7 X;  4M5K A;  4ZVT B;  3I0R B;  2G4B A;  1U8W A;  1ZAW A;  4FYY B;  4KGV B;  3MM6 A;  4CO1 A;  4I2P B;  2BW2 A;  4ZS6 A;  2O1P A;  5EX0 A;  1D9D A;  1WEZ A;  5BR8 I;  2GAG C;  2NYI A;  2SXL A;  1SJR A;  1IM6 A;  1RTI B;  4CYU A;  3I55 S;  1B3T A;  4MIW A;  2IM3 A;  4Q8E A;  1N4L A;  5DNL A;  2HG4 A;  3DLK B;  4DWI A;  1TV6 A;  2M88 A;  1RK8 A;  4OHZ A;  3GQC A;  4X4U A;  2A18 A;  3VR1 A;  4R8U B;  5EWG A;  5IT9 Y;  1CJV B;  5LL6 R;  4K4Z A;  1T05 B;  3DRY A;  5C0X A;  2QA2 A;  1YBA A;  2XI3 A;  3DXS X;  3GYG A;  3HHK A;  4P2M A;  3HP6 A;  1KVJ A;  4OYZ A;  1Q1K A;  5J2N B;  3J80 Q;  4C11 A;  1L3K A;  1IBM E;  2V9W A;  2O1W A;  1BWE A;  2ZEJ A;  1J2V A;  1XJW B;  1YSJ A;  2AYE A;  2B4O A;  1VR6 A;  2GHV C;  4NEZ A;  3JS9 A;  1TZ0 A;  1BQM A;  4KV8 B;  4P7V A;  3TAM B;  4USM A;  5AE1 A;  4RU9 A;  1N36 F;  4RBT A;  4PRV A;  5K36 A;  4A8F A;  4OJ3 A;  4BA1 A;  4A8O A;  3OTB A;  2EFO A;  5KFQ A;  4DR3 F;  3HK2 A;  2XO6 A;  1LWE A;  2HBQ B;  4RWW A;  3KFW X;  2RHS B;  3DLG B;  4XPE A;  2GS8 A;  4U8V A;  3T5K A;  3V81 A;  1TK0 A;  4M5L A;  1PJ6 A;  3HJF A;  1BY9 A;  1HWJ A;  1PAE X;  4M5H A;  4ZK7 M;  1JQG A;  3ZKB A;  1HPZ B;  1RU2 A;  4B9S A;  1UP1 A;  2PII A;  3A4T A;  3KXD A;  2G2Y A;  3P3G A;  5LSO A;  1YX2 A;  2GQQ A;  2Z57 B;  3HFZ B;  2AJQ A;  1REG X;  1UVI A;  4LFA J;  1S1T A;  4FYW B;  4GVB B;  4I69 A;  1FEE A;  2Z8Q A;  1SJ4 P;  4RU2 A;  3LGH A;  4X2B A;  3KHL A;  1N32 I;  3K8W A;  4GC6 A;  1NZ0 A;  2JE6 B;  4IH7 A;  2DNY A;  1JXV A;  3BV8 A;  3QPI A;  4Q8F A;  2BAN A;  2ZM6 E;  4JI4 I;  5HAT A;  1Z0W A;  2HIQ A;  4DUT A;  2BEF A;  3A8I A;  4C9D A;  3CC4 S;  2IY5 B;  5D3G B;  4FW7 A;  1BQX A;  3EVO A;  3UWT A;  2BJ1 A;  1WOR A;  1Y3J A;  4IDK B;  4CLW A;  2VHG A;  2HSE B;  4EBE A;  2HW3 A;  1UZD A;  4DR2 F;  4WUD A;  2G1D A;  3GTY X;  3DYA B;  3KK1 B;  2E5J A;  4DV0 F;  4QNK A;  2YKM B;  2VOP A;  4OZ5 A;  3NMR A;  2EXU A;  4B9T A;  1URN A;  1H6K X;  2KT3 A;  5I3P A;  4KGK A;  2CGE A;  5ETT A;  4QIG A;  3SFU A;  4DQP A;  3ITH B;  3ZZP A;  1SVD A;  1RT3 B;  1LNQ A;  2IDL A;  2WB1 D;  2VIC A;  3GCX P;  4X4V A;  2UU9 F;  5J2Q A;  2V9K A;  3MM5 B;  4K8R A;  5F3Z A;  4WWS A;  1TMM A;  4NI2 A;  2QLF B;  4NRT A;  4LR7 A;  5G4D A;  5KAK A;  2IA6 A;  4OMF G;  1OPI A;  5K20 B;  4DR4 I;  2ZBP A;  1CJT B;  1ARO P;  1RHU B;  4OHY A;  3PS1 A;  1FKA E;  1F1B B;  3CW2 C;  3I9Z A;  3M8Z A;  4RR5 A;  3HXM A;  3CCQ S;  4LF5 E;  3NS6 A;  3IWL A;  5DRR A;  1KRP A;  3G71 S;  1RTZ A;  4ED8 A;  1RHY A;  3L09 A;  3P3D A;  1T05 A;  4LRA A;  3E8O A;  1RBO B;  2BR0 A;  3JTP A;  2ALZ A;  4OKG A;  3M2R B;  2IM0 A;  1AB8 A;  4IQM A;  4JUZ A;  1J5E I;  1RHM B;  4JYA I;  4KHP E;  3LAL A;  1R7I A;  3K5M A;  4B9V A;  1U47 A;  2DIS A;  2FD2 A;  3KRN A;  1YRX A;  1NKE A;  3KLV A;  2DH7 A;  4X66 E;  1TUW A;  2EBE A;  2QL7 B;  5L46 A;  3TI0 A;  3KMQ A;  3EPG A;  2AYG A;  5J1E B;  3KYL A;  2KYZ A;  2KT5 A;  3KLG A;  3N6N A;  1EKS A;  3BGF A;  4A8W A;  4X4S A;  1TFY A;  4BBY A;  4ECS A;  2B7B B;  1IJE B;  4GKJ E;  1KQK A;  2WP8 B;  3PNI A;  1HHQ A;  4LBH A;  4JI0 E;  3T9N A;  5GAD U;  3H8Y A;  5M2P A;  2AV5 A;  4V19 J;  4URS A;  4KGM A;  2R7R A;  3OTO E;  5LMU I;  3UCG A;  4JP8 A;  4J9S A;  3FCV A;  5D4O A;  1IBM J;  4ZVF A;  2ASJ A;  1JLC A;  3H2V E;  4OLO A;  4C48 A;  3LPY A;  1QUV A;  3JSB A;  3QGG A;  3UR3 C;  3R5D A;  1CJT A;  3SIP B;  3OR2 B;  3QT8 A;  4JI4 J;  4HH0 A;  4NLP A;  2BJD A;  4NLQ A;  2ZC4 A;  3BH6 B;  3M9M B;