3HULA

Structure of putative homoserine kinase thrb from listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
277
Chain Sequence
SLRIRVPATTANLGPGFDSCGLALTLYLTLDIGAEADSWYIEHNIGGGIPHDETNVIIETALNLAPNLTPHHLVMTCDIPPARGLGSSSAAVVAGIELANTLAELNLSKEEKVRIAAEIEGHPDNVAPAVLGNWVVGAKLDGEDFYVRHLFPCALIAFIPKAELLPDTLPFKEAVQASSIANVMIAAILRNDMTLAGEMMERDLWSQLVPHLAQIRDVAKNQGAYAACLSGAGPTVLVFAPRNLANKLQTSLQTLEIDADVLLLDVEGSGAEVFREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative homoserine kinase thrB from Listeria monocytogenes
rcsb
molecule keywords Homoserine kinase
molecule tags Transferase
source organism Listeria monocytogenes
total genus 75
structure length 277
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.1.39: Homoserine kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3hulA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hulA01
4JI4I 4GKJE 1Z59A 4B3MI 2GS8A 2J7KA 3T1HE 2AJ4A 4YHHI 1Z5BA 5IT9C 4HYMA 4MYTA 4JI0E 1PIEA 2WW4A 5L3JA 1PKPA 4DR7I 4DV1E 4JYAE 4NXME 3CWVA 4UT4A 2VF3A 4JI7I 4DV6I 2LJPA 2UU9E 1IBLI 2UXBI 2UUBI 5BR8I 3ZKBA 4LF4E 1A6FA 1MU5A 1XMQI 2ZITA 4DR3I 3T1YE 4XTJA 4DUYE 2HFSA 4JI4E 1HNWE 3GONA 3J7AM 5IWAI 1Z5AA 4B3ME 3B82A 1N0VC 1WUUA 1FKAE 2V2VA 1KTVA 2HHHI 4YHHE 1Z0EA 4DR2I 1H72C 4LF9I 2R3VA 4I3HA 4DU7A 4DR7E 2ZM6I 3J81Q 4B3RI 4LF5E 4HY1A 4JI7E 4DV6E 4X64I 4LF6I 2UXBE 1I94I 2UUBE 5BR8E 4AQYI 3PYEA 5LMNI 4DR3E 3PYGA 5IWAE 4P7AA 4K0KI 1FWKA 2XEXA 1HR0I 5FLXQ 4JI1I 2UXDI 4FWDA 2HHHE 4DR2E 4OX9I 4DV7I 1N32E 4LF9E 4NXMI 4DUZE 3K17A 4NXNE 2ZM6E 1H74A 3JAMC 1RR9A 4LF8I 2BM0A 4P52A 3F0NA 1KIJA 2E5LI 4B3RE 2NPFA 4LF7E 1N36I 3M6AA 4X64E 2EFGA 4LF6E 1I94E 3T1YI 1ZM3A 1VISA 4AQYE 4JI6E 1HNWI 5LMNE 1Z5CA 3ZZ0A 4ZVIA 1ZM2A 1ELOA 1RREA 4X65I 4K0KE 3J7AG 4MYUA 1FJGI 4HACB 2DEJA 1HR0E 4KQVA 5LMUE 4JI1E 2UXDE 2UXCI 4R1FA 1BKNA 3V2UC 4OX9E 4DV7E 4FN5A 4LF5I 3V5RA 1H7UA 4PRVA 4PU9A 3OTOI 1B62A 3D4JA 1XNRI 1S16A 4LF8E 4JI2I 4DPYA 1IBMI 2E5LE 1NHJA 1MG7A 1N36E 2X36A 4HXZA 4LFBI 3LTOA 1H7SA 3J80Q 4DPWA 4LFAI 1U2RA 3K1JA 4LFCI 4X65E 4WUCA 3ZM7A 1N34I 1J5EE 1FJGE 4DR4I 1UEKA 4B3TI 2UUAE 3QT7A 4UTGA 2VQFE 1EA6A 1N32I 2UXCE 4YY3I 4DUZI 4FWGA 2UUCI 4NXNI 1D6TA 4DXLA 2HK2A 1Z0TA 3OTOE 4LF7I 1XNRE 4JI2E 1IBME 1FI4A 4JI6I 4DR1E 2VQEI 4DV4I 4GKKE 1N0UA 5LL6R 2V2ZA 4X66I 5GMDA 4LFBE 1OJ4A 4LFAE 4DPXA 5LMUI 4LFCE 1N34E 4DR4E 4DV0E 2CZ9A 5A2QQ 3J81C 1KKHA 4B3TE 2X7IA 4WUBA 5GMEA 4DPUA 4YY3E 1Z0VA 4DV3E 2V8PA 2F4VI 3ZZUA 2UUCE 4Z7YA 4DV5E 4Z7CA 1EI1A 1ZXNA 1FNMA 4JI3I 1KVKA 3B8HA 2VQEE 4DV4E 1N33E 3WU6A 2HFUA 5IT9Q 4WUDA 4KHPI 1Z0WA 1FWLA 2E1RA 1IBKI 4RPFA 4X66E 5FLXC 2R42A 3WU4A 1J5EI 3Q1QA 3QT6A 2Q2EB 4DV2I 2UUAI 2VQFI 3PYFA 3HULA 1PVGA 4M1KA 4X62I 2BM1A 2V2QA 2F4VE 4PRXA 1QZRA 4JI8I 4DR6I 1XMOE 1ZXMA 4DR1I 4B3SI 4GKKI 2HKJA 4JI3E 2HKEA 1XNQI 1HNXI 4KHPE 1IBKE 4JV5I 1ZM4A 2HK3A 4DV0I 4JG4A 1HNZI 4DV2E 1S4EA 4JI5I 4DV3I 1MX0A 3B78A 4X62E 4DR5I 4DV5I 3LNUA 2OI2A 4ED4A 4EMDA 4DPTA 4JI8E 4DR6E 3WU3A 3PYDA 1N33I 3J80C 1Z0BA 4B3SE 1XNQE 1HNXE 3ZKDA 1NZ0A 2A2CA 4JV5E 3QT5A 4USKA 3H4LA 1DARA 4FWHA 1IBLE 1NHIA 3JAMQ 1HNZE 4HACA 4GKJI 3LPSA 4FW9A 4DU8A 1XMQE 1Z0GA 1Z0CA 4JI5E 2DEIA 3WU5A 2A2DA 3T1HI 4DR5E 1ZM9A 1B63A 4URLA 1XMOI 4JI0I 2V34A 3ZZTA 2ZBKB 4USMA 4DV1I 4JYAI 1XHKA 1H73A 1NHHA 2BV3A 2UU9I 5A2QC 4LF4I 1K47A 3QT8A 4DUYI
chains in the Genus database with same CATH superfamily
2HYIB 3KG4A 4LSLB 2QEXS 4ETXA 2LA4A 4A8KA 1WDTA 3DC2A 2ASDA 1PAEX 2A18A 2RDDA 2YWKA 5IT9C 1FE4A 4QWDA 2F8HA 5F8LA 1RAHB 3GG0A 4ZS6A 1VRUA 2C2RA 4EFAC 1SQFA 2LJPA 1JLFA 2VPZB 2QT7A 1AA1B 1T05A 1K44A 1SQGA 1NSQA 4HKQA 3RG6A 3W2WA 1DRZA 1UPMB 5KFXA 3IM8A 2KYZA 1XNQJ 4RW7B 1FKAE 2JH3A 3K58A 1JJ4A 3TAMB 5KT7A 4LF2A 4NLQA 2A10A 2RSQA 1VLYA 2DNHA 3QQCD 2MJUA 4QWAA 3POTB 3PW0A 4NCAA 3FSXA 2IVYA 1HHSA 4L74A 4X64I 5GAEU 4J9OA 2Y3YA 4L76A 1VQ7S 2B4PA 2NR0A 2J9DE 4GVBA 1S9EB 2MHEA 3K0JA 3NG8A 1XWLA 1TMMA 4RBUA 1FERA 2DNPA 1ZH5A 3BO4A 3HHLA 3A8KA 4B3OB 2LDYA 2ZM6E 1H74A 1PO6A 4WBFA 2XB2D 2OEKA 1YITS 1S9GB 2EW9A 3EZUA 4J9QA 3MF5A 2NPFA 2VDIA 4LF6E 4NA2A 5LMNE 1ZM2A 4DLGA 3DM2B 4ES2A 3GMEA 5DGBA 3SSRA 3QLHB 3GR0A 1T9YA 2F3JA 5CABA 2QL7B 4IFDB 3IM9A 3DRSA 3N5BA 3LUYA 3Q83A 4RUCA 4P74A 1FF2A 1NHJA 1KOHA 4F02A 5K36A 3R8YA 2FHJD 3R5JB 5KFBA 2VHGA 4IH6A 2PNMA 4IFDD 1RT2B 4KR0B 2BUNA 3MWBA 1PJ7A 2G9OA 1FJGE 4PCQA 1RA7A 4OL8A 3ZZZA 2XY6A 1JLCA 4K50A 2UUBJ 4RJVA 5C0XE 2BJ8A 2V5HG 1HBMA 4D3HA 1YJ7A 2H5IB 4NRTA 2DNOA 4PWUA 1XJWB 4YR2A 5HL7Q 3CJRA 2AEJA 5DZ7A 3ZTQA 2F8EX 4W98A 2GHWA 4X4QA 3JTPA 3MEDB 1VQKS 1QSLA 2HLTA 4EBEA 5HO4A 3MM6A 2HHHJ 1Y00A 1OJ4A 1VQOS 4ZJOA 2EC0A 1EB0A 4ELTA 3W5ZA 4LFAE 2QN6B 1FJEB 1XQIA 2XI2A 2H9ZA 2PO4A 3NOCA 4UQGA 4OI0A 1U45A 1OYRA 1OO0B 1YBTA 2RKIA 2RF2A 4I2QA 4F4XA 2EG2A 3SZ2A 2HQGA 4MK8A 2IYIA 1RT7B 4AT1B 3IFEA 1YDLA 3Q8UA 3GPAA 3G8TA 2E1RA 3F73A 2O1TA 4DV7J 1IKVB 3CCJS 3QT6A 5CQGA 4DL4A 1YSJA 3SSQA 3PFOA 2C38B 2LU2A 3PRVA 2ILYA 3R5CA 1NJIT 2I6WA 1RBOB 4ALZA 3DI6A 2KT3A 2CG9A 3MCNA 1K9MT 3BGRA 3W7BA 3BBFA 4Y2MA 4OLOA 2FHOB 4B3SI 4DUTA 2C37B 1VQ8S 5HVHA 3BSCA 4M5HA 2PA3A 3CO0P 3G86A 2DKOB 4OHXA 2CDRB 1N5QA 1WSVA 3BPDA 4FPRA 1TVRB 4DEZA 1DURA 3NAHA 4P2MA 4OJ1A 3M2UA 1TL3B 1S6QB 2VG7B 5DRRA 3IS9B 5HI7A 3N6LA 3FGVA 2B9EA 1CVJA 1T9WA 3S7RA 2BKPA 3TAPA 4ZVFA 4YY3J 1NZ0A 1HWKA 2G2OA 2M52A 4FW5A 4ZVGA 2UUWA 3EYZA 4HACA 1WDDA 2HHSA 3NEKA 2DEIA 2WB1D 2H1YA 4DSFA 2LCWA 3DLBA 5CD4A 1U25A 5LOQA 1NEEA 1N48A 2VV5A 3M9OB 2DD8S 2VFVA 4U7UK 2ZBKB 1KD1T 4GVLA 2Z0GA 1CJKB 4KQZA 4QYZK 3BBBA 4C8NA 1NHHA 4MQYA 4C0OC 1H7WA 1HNWF 1V9OA 2H4YB 3MAHA 4NLDA 2E9RX 3FEXB 2CJBA 3CDBA 3TUIC 2ZE2B 3CCSS 4DUYI 1Q8BA 2ZBPA 2QIFA 3H59A 4FXWA 5GAHI 3MEGB 2DNQA 4X4TA 4RR5A 3T1HE 5KG1A 2XCAA 1B7YB 5CD4H 1PKPA 4CTAA 1E6VA 3CJ8A 4ED0A 4C3MA 2JC0A 4B9NA 4UT4A 1YHQS 3PVXA 2YWEA 2OTLS 3CNQP 3CW2C 1A6FA 5KFGA 2KJWA 4YDDB 1MU5A 4B9VA 1SC1B 2J8AA 3GONA 1FRKA 2CNKB 2R7VA 2BANB 2UV8G 3P3GA 4FNHA 2RRAA 4LF7F 4ZITA 2FVSA 1H72C 4U6PA 1T03B 2MZTA 2OPRB 1VQ4S 4Y00A 4FW7A 2K1RB 4OHZA 2JOQA 3OW2R 4M5NA 1R0CB 4M5LA 1LWCB 2RAQA 3UVJB 3MECA 4P7AA 5DO2A 4OZJA 4OHWA 2GJIA 3KK1A 2BA1G 3I5AA 1FK9A 5ETSA 3J81Y 4ZP6A 3R2DJ 3ILJA 3G2XA 4AL7A 5AXLA 1RWUA 5JEAA 3HFKA 1BY9A 2B3TB 1VGYA 3UCGA 3VZHA 4CLFA 3SV3A 4C8LA 2VG6A 4JI0J 3ZZ0A 1OSDA 3A12A 3NBPB 4OYBA 3A13A 2XY7A 2VASA 1UVNA 3JYTB 5IC6B 3JSMA 2CQCA 3CSKA 1YJVA 4DR1F 2RS8A 1ZETA 1CS4B 1X60A 4OYZA 2BJ1A 4K7QA 4RW4B 1LV5A 2CGEA 2K3KA 3TX8A 2IJRA 3GILA 3G6XA 3WC0A 2EC2A 3ZM7A 3J7YI 3D1HA 2PFDA 3MD1A 1HWIA 2AX0A 4J91A 4DR3J 2JEIA 3KG1A 4BDPA 3P5BP 3Q89A 3Q8YA 3QO9B 1MU2A 4Q45A 2C3MA 5SZTA 3V6DA 1NJXA 3V4IB 3OHAA 3D67A 3JSBA 3KMQA 4OZ3A 5DRKA 2W9BB 3FFIA 2OMLA 2XYHB 4DPXA 3OVBA 2ADCA 4J3DA 2V63A 3NGDA 5HLFA 2JVRA 3RGIA 1C0UA 2VG5A 3GCMA 2HQCA 3ZC4A 4TYBA 3JSRA 2RQMA 3BEGB 4DL7A 3D66A 3V81B 4WK3A 1QLNA 5J1EB 3ONQA 4Y6IA 3TUPA 4WKYA 1SL0A 1MROB 5L1LA 5C2CA 4DFMA 4LREA 3QRPA 2BMBA 3TJAA 2GA7A 4NLUA 1SJFA 3VZIA 3Q1QA 4ZPVR 5A2QY 2Q2EB 2PFFB 3FCHA 1B0VA 4TU8A 1NKCA 1PVGA 1NCLA 2B8PA 1UWBA 3H2UB 1RADB 6AT1B 3THVA 1UFLA 2G2YA 3HSGA 3AODA 3GP9A 1Q78A 1H2TZ 4ZKAA 4JP8A 1DLOA 3UCZP 2V8VA 2UZAA 3R6LB 3FMBA 1FNOA 4DOZA 3OTEA 2RVJA 1S1XA 3CVKA 4F50A 2IY5B 2FD2A 1TL7A 2M8DB 4KGZB 3HSZA 2ZH3A 4QIGA 3F44A 4E8UA 3C19A 4J9LA 3SDEA 1RT6B 1YWXA 2AF6A 1REVB 4DR4J 3L7ZA 4QWCA 2WTFA 2NXNA 4B3TJ 3IA0A 1DJ0A 3K57A 4B02A 4CNZA 4MFBB 2A2CA 3QT5A 4EWTA 2HWHA 2PGCA 4OX8A 3I82A 4FW9A 4NLSA 2W9AA 2R7RA 3DRRB 4DU8A 1VC0A 2O3ZA 2MQQA 3WBZA 1T9UA 1WOPA 2LDIA 3M4XA 1KSPA 4PRFA 5KG7A 3X1LB 2LEPA 2QLWA 4JYAI 4FVMA 4KO0A 2GC8A 1WTBA 2UVVA 3FK4A 1W26A 5DDRC 2UU9I 4JOUA 3D7SB 2W2OP 4V19X 2RNEA 4ECTA 3FNNA 2JJ4D 4FS2A 1R8CA 3DLHA 4LR8A 2OMOA 3Q23A 3RZAA 3EVOA 4IZKB 1EKSA 1AZSA 4FYXB 1VQSA 2MKKA 5CH7B 4HH0A 5BR8I 5DDOC 2R7XA 1R8AA 2ZITA 1NB2A 1BLUA 1HNWE 3GFZA 4LPFA 1VJQA 4QIVA 4I2PB 4P2SA 2AJ2A 1WG4A 4JV5J 4NLOA 3P3CA 4C6AA 2C3OA 4LF9I 4G1QB 2RUSA 3IMQJ 1H38A 1NHVA 5DRQA 4YEAA 1OY8A 1UJ5A 1DQAA 2CUYA 3OJUA 3UNYA 4FF1A 1SC4B 4QR0A 1X5TA 4DR5J 1FXRA 3RJMB 1GNKA 5LMUF 2FLNA 5KAKA 5A8KB 2HRUA 1LWFA 2ASYA 1HL6A 1U0HA 5IM0A 2D3UA 4K0KI 4DV7F 3LP0A 2GO3A 2NREA 4JI1I 1U26A 2BX6A 3UNGC 5IT4A 3IRXB 2DNGA 5HP1A 3B6BA 3R5BA 1VFJA 4CLWA 1RR9A 4PUOB 4YR3A 4P52A 1RLDA 4LF7E 3WC2A 5FDLB 1H98A 1Q5VA 3P8BB 2DCLA 5GAEI 1HNWI 2GQ0A 1UW4A 3ILOA 4C0HA 2VONA 3VGUA 4O23A 3DHWC 5D15A 3OFFA 1F60B 1Z2ZA 2X3DA 5GADU 2CIMA 1N88A 3PX4A 4KFBA 1MW7A 5H9EK 2CQGA 2Z57B 3IG1A 2MKHA 3MZIA 4YY3F 4DR7J 4LFCI 3BGUA 1NLKL 1Y5IB 4P2FA 1R6VA 2R4FA 2XCPA 1EX8A 2O3DA 2KFNA 1URRA 5HJYA 3H90A 4LF7I 3KLGA 2NCKL 3TVYA 1FI4A 1CJTA 4DR1E 2M88A 3DOLB 3HKWA 3J80Y 4X66I 2FIUA 3DOMB 3CTRA 3NMAA 4QR2A 3SCKE 4ID5B 2IAJB 3CDEA 4RU9A 2CQDA 5FLXU 1IKYB 1I94J 1MWYA 1WEXA 5M2UA 3OT9A 1PAUB 3HZGA 2FYXA 2MKJA 5KFUA 3M8QB 3A8JA 4Q43A 3M6XA 2LXIA 1D3WA 3B8HA 4QBUA 1U1LA 2K7KA 2BQUA 3NS7B 3I0RA 4WIIA 3AQPA 4A8SA 1C1CA 5CZVA 3VWSA 3GFYA 4GQUA 4CYUA 4LF8J 2NZCA 3PRDA 1FVQA 3ZTRA 4R0EA 4EK2A 4J5OA 1TP7A 1YRUA 3NWGA 5KFVA 2QA4S 4FYWB 4C11A 4I68A 3D9BA 4Z37A 4DR1I 5HQMA 2C2OB 4WU2A 3GCWP 4BA2B 1GFWB 3CCWA 1I51B 4RBTA 2R7WA 4ED1A 4ZVPB 2UVUA 5A8WB 3N01A 1WHWA 5BXIA 3OTOJ 1Y3KA 2C2NA 3KMSA 4BWJA 3H1CA 1OYPA 5J2PB 4FPIA 4NRUA 5J2NB 4B17A 2J0SD 1A6LA 3HJFA 3CJSA 2I8EA 3KLFB 2LQ5A 1KLNA 2FPHX 2PNZA 1Z0BA 3R3TA 2D41A 1FKOB 4FXDA 1HNVA 1XNQE 4IG3B 3IBCB 5KFRA 3AB4B 4LRBA 1YG0A 2YY3A 2XM3A 4M5GA 4F4ZA 2C2MB 3AD8C 1Y10A 4HEA9 1Z0GA 1Z0CA 5GAGU 2H51B 4JI0F 4XDCA 1Y9OA 1QE1A 2V34A 4NLVA 4DV1I 3A4TA 2B4VA 2XG8A 2Y0BB 3T1YF 2AIRB 1HWJA 3GSDA 3HT0A 5FJ4A 1CC7A 2F5GA 2FLPA 3CCVS 4USVA 3PW7A 3UCUP 3CJKA 2J9CA 2ACYA 2FJEB 4H4MB 3R5AA 1S99A 1DTTA 4B3MI 5D4PA 4HI2A 1EQ0A 2D9PA 1NK8A 4BHQA 5DG8A 2HNYB 3LP2A 1EZZB 2YX1A 4OZ0A 3PFEA 5J1NA 4R5PB 1C1BA 3Q8SB 3CJTA 4DFPA 2HIQA 1R0AA 2R2UA 3I96A 2HFNA 2DGOA 5T41A 1F9FA 2MKYA 1HLWA 3PM9A 1URNA 4CDIA 3NRBA 4A8QA 2WOMA 5CCLA 3U27A 3C6UB 3J7A1 1X4DA 3I4HX 4KPYA 4ZDNA 2H5EA 1P1LA 4USUA 3B82A 2MKIA 4NXNF 2VBZA 4IOCQ 3DDIA 3KKFA 2C2ZB 1KTVA 2V2VA 3CD6S 2CJQA 4DR2I 4BBYA 5ETVA 2EVZA 1FCAA 1HNZJ 1R31A 2R3VA 4O3SA 3PRYA 4NLYA 3EUNA 4JI5J 3VAJA 4K8RA 2LXFA 1RYSA 4V1Ak 3H25A 2UUBE 3PY8A 4IOBA 1RCOB 2GAHC 1Y0HA 4ICLB 3Q8PB 1UCNA 4USWA 1UVIA 2N82B 3ZTSA 1NK0A 4R0JA 1Q8KA 2XZTB 4H4OB 4NX9A 3ZTOA 3T9ZA 3BJYA 2HHHE 4IFYA 2HW3A 3GFHA 4X4RA 2ZHAA 2A6OA 2E44A 2B9XA 3BR9A 4PPDA 3IR5B 1VQNS 4TY8B 2POKA 2W2PP 3KLHA 5BYRA 4WP8A 1CPZA 4LSNB 2J8SA 1IKXB 2KG1A 2R7OA 2HGMA 1VYAA 3J7AG 4P7VA 5LMUE 1VQMS 2UXCI 4ELVA 2C3PA 3C16A 1F2GA 1YTYA 4QNKA 4GKKF 1OWXA 4DV7E 4IFDF 3TO8A 4FN5A 2C3YA 3TZZA 3D1QA 3EDQB 2XTJP 3HHLB 3I0SA 1RT4A 4I69A 4DR4F 2X3GA 3FEYB 4B3TF 5LXYA 1IM4A 4NYZA 1JLAA 5L9NA 1C2PA 2EG1A 1WOOA 4ZCKA 3MMCA 2MZJA 3NGUA 3BBCA 5CYQB 4ZVSB 1SKRA 4IQXA 2DXDA 4LBHA 4DS4A 1QD1A 3H42A 2KM8B 1WC4A 4DF4A 1S1WA 2G2ZA 5IWAJ 2OAUA 2YWHA 3DGPA 4MTPA 2EK1A 3DRSB 4J9VA 1TFWA 2AJ0A 5LL6R 2FHMA 1S7HA 1HQEB 4IQMA 2B7CB 1LW0B 3MEEB 2DNMA 4LSLA 4OO1B 5LMUI 1AROP 1TV6B 1ZZNA 1VMBA 2XYGB 3D3BJ 2DIVA 1XR6A 4YQWA 3K5PA 2IVFB 4YY3E 2V67A 3EGWB 1JQGA 3OPKA 2MZ1A 1RWNB 1CJVB 2MXYA 4OO1D 1IM6A 1IXKA 3RW6A 3CT9A 3MR5A 1M0SA 3HO1A 3CDWA 4AXJA 4C4WA 2XNQA 2HFUA 4LIWA 1Z0WA 4LRCA 5JJBA 5FLXC 2VD3A 3I6PA 1UKUA 2RU3A 2MZSA 4RW7A 1HI8A 2KVQE 3RBDA 3TAMA 1YZ7A 1IN0A 2HBQB 1MWZA 1RWMB 3HHKA 1JLGB 1HQUB 4PWDB 2E7XA 3AOCA 1HBUB 4PRXA 3POTA 3R97A 1XN9A 2OD4A 3HD2A 1NB7A 4YN3B 2FZGB 3DGVA 4N8NA 2UXBF 1S6PB 1KLMB 2EK6A 4Z2XA 1VLOA 5L8RC 3QSYB 2HNZB 3FCWA 3UWTA 4KYZA 3FDSA 4P71A 4I67A 2FZCB 2W9CB 2YH1A 5HATA 2C42A 2V0NA 3VF0B 3PNIA 4LFBJ 4PR6A 3I9V9 4ED4A 3N5FA 1S9GA 5EHHA 3R1LA 1M1HA 2ZVIA 2YKNB 1X4CA 1KQSR 1N34J 3U1MA 1RJJA 3TNVA 2GIFA 3BGRB 2V9KA 3FQKA 1C0TB 3MEKA 4DUZJ 1DY3A 1U8WA 4OYXA 3QATA 1VR6A 3CC2S 2QA1A 2VBWA 1HA1A 2MTLA 1T0TV 3H5UA 3JAMQ 4OI3A 3NAIA 2A3JA 3BO2A 4K2JA 4A8WA 2CG8A 2FGCA 3QLHA 2UXDF 1P27B 1RWXB 3M8ZA 1N33J 2FHJA 4QCLA 4IFDA 5HANA 2HRYA 1GX6A 5F8JA 4U67Q 4MAKA 2YNGB 1X9WA 5H1SV 2YBVA 2F4VJ 1RT2A 2K8GA 1W25A 1D0EA 3I4PA 2XWXA 3B4MA 2B9WA 2HGNA 2F4FA 1NK7A 4CH7A 2GAGC 4DR7F 2KXNB 5ETRA 2PNLA 1UJ6A 2FVCA 4PPZA 1GK8A 4CLUA 4P10A 4C9DA 5E3RA 1TKZB 4JI0E 2B7BB 3MEDA 1WEZA 2UP1A 1S1UB 2ZC3A 3VGSA 3LP1A 4OYMA 3BB5A 3D0IE 2MY7A 5KFNA 5FWKA 3B54A 4TY9A 4Y65A 3MURP 3W5YA 2OPSB 3RAMA 4OZNA 2VUGA 3T1YE 3QAUA 3ET6B 1Q8LA 1TAUA 2IHR1 3MCSA 2GVZA 3LGMA 3DOKB 3TUZC 5AJ3J 2JEBB 3CCZA 3ENAA 1I94F 2W4CA 1FD2A 5KFSA 3IGVA 3J81Q 2VB6A 4DV3J 3OXGA 4NI2B 3ZNUA 2WB4A 2E1PA 1IKVA 2L9WA 4PYDA 2C38A 3ILLA 4DR3E 4ILMA 2RHQB 2AW0A 3GMGA 2JE6B 4USHA 3UDVA 4UW2A 5U47A 3TARA 3QGIA 3CDUA 3GYGA 3L4BC 4LF8F 3FCVA 3CPWR 3VAGA 5D4NA 3LWLA 4CO1A 1WSRA 4NXNE 2SXLA 4U9RA 2BM0A 4ZPAA 1YJTA 3UD3P 2EFGA 1OMSA 3CULA 3T1YI 1HWUA 5I3QA 2XMKA 1O8BA 4YP3A 4RBVA 1G4CA 2X1FA 1TL3A 1S6QA 2HZAA 4A46A 3IS9A 3PCOB 3OTOF 3OFGA 5KFZA 4R1FA 4MKBA 4KIAA 4CLYA 3SQGB 4O4GB 2NXEA 3OL9A 4PU9A 2B4OA 4ELUA 2XI3A 4OX7A 4YMEA 2Z5CB 1SC6A 3GTYX 3M8RA 1LWXA 1RAOA 2F9JA 2YXLA 4YHHJ 4UQTA 2XHCA 3GCXP 1O6XA 3HHEA 5KT3A 4YUDA 4TLRA 3WQPA 3OVSA 2C22A 2AGPA 2OH2A 4NXNI 4C3LA 1CJKA 4OI6A 2ZHOA 3PIOQ 1X4GA 3LGNA 5GADI 3TR5A 4EUVA 4GKKE 4IFDE 2FZKB 4JBCA 2ZE2A 4Y34A 3UW1A 2OPQB 3OL7A 5BYSA 2OPPA 2HGLA 4M5MA 2DXEA 5DS7A 3MEGA 2RHSB 4C8YA 2LQJA 3JTOA 3R9LA 1S0MA 1HPZB 4DR4E 5A2QQ 2FHKA 4B3TE 4P7TA 5GMEA 3R7BB 2ATLA 2CG4A 3KLEB 2VBXA 1ZXNA 4NLTA 4JV1A 4KBIA 2QSWA 2G0JA 3WU6A 2LEAA 3KDNA 4F0HA 2RQKA 2A0FB 1JX4A 1TR0A 5DROA 2BE2B 3V6DB 4FBUA 4DLEA 2OUGA 1K73T 1GMVA 2BANA 2QX0A 3D54A 1TK0A 4QWBA 2DNRA 4DCPB 2V2QA 1T03A 2OPRA 5A8RB 5DETA 5L9XA 4UZBA 3O44A 2BA0D 5DQHA 2VG5B 4H4KC 4ANCA 4GKKI 2K1RA 1ZBTA 3V6KA 1HNZF 2B43A 2VQFJ 4Q8FA 4OZLA 3W2VB 1A7GE 4JI5F 2K3IA 3D5MA 2ZFHA 1LWCA 4DSIA 2KTQA 1PG5B 1B3TA 2CA9A 2V50A 4I4BA 4HHHA 8RUCA 3PO5A 2WONB 4JB8B 1IBMJ 3WIUA 1RTJB 4FYVB 3NNHA 1B0PA 2KXHA 4UZCA 4RX6A 2FC8A 3H5SA 3QRQA 1RGVA 1NPPA 1UJ4A 1QAIA 2C2DA 5KFEA 4HYKA 5K5MA 4M63A 4CH0S 2RT3A 1NMEB 3LO3A 1KVIA 4JV5E 3NBPA 4NYOA 1TU0B 3JYTA 3GQCA 4QJVA 4XAKA 5THWA 4IDKB 2VQEJ 3WU5A 3KK3B 4B9MA 4JUZA 4DR5E 1G2EA 4DQRA 1CS4A 1TK5A 3CB4A 3OTBA 4IUFA 2GMLA 3W9JA 1N36F 4RW4A 2YWGA 1L3SA 4AM3A 5C25B 2JEFA 1BD6A 5A0YA 3W63A 1SI9A 2XHWA 2V4RA 4PXEA 3FZBA 3UI3A 4JI3J 5GAGI 3PW4A 2NPIA 3ZZYA 1O0PA 4QU6A 1WELA 3QO9A 3L95X 4DV2J 2NN6D 3EGZA 2LVWA 2GO9A 3V4IA 2F9DA 5E3PA 4ZLNA 4JI7I 4DV6I 5IWAF 2UXBI 2W9BA 3QFWA 2JNJA 1V6HA 4UOFA 4KC5A 4A47A 4DR6J 3MAAB 1Z5AA 2CNNB 3CCQS 1TELA 1IKWB 4BA1B 5J1EA 1RAIB 1L3VA 2D3O1 1MROA 4RL1A 4DR7E 2Y8WA 1QAYA 4B3RI 2CYYA 4GC7A 1M5SA 4RWWA 4F0MA 4LOMA 1KONA 1GMWA 5FD1A 1KEKA 1KR4A 4ZPDA 4MU3A 1NDCA 4ZIVA 3RR7A 1OYEA 2NUHA 1HR0I 3DDKA 2RJZA 2DNYA 2MGZB 2UXDI 2V8HA 1S49A 4RUAA 4QIEA 3NGSA 2B56A 3NNCA 2YQ3A 4Y2AA 3DHXA 3OHBA 2V9WA 2CKWA 4MKAA 5DRPA 2RQ4A 1U8SA 1I94E 1RKIA 4CNYA 1U1PA 4KSEB 3CC4S 2DH8A 3C14B 4MYUA 5J2MB 2GNKA 1OS5A 1NPRA 1KQFB 1U0HB 2ZOGA 1RT6A 2HVEA 3JQJA 3E8OA 1REVA 3VAFA 4MK7A 4X4OA 4BS2A 2O66A 2JFKA 2VL1A 1QTNB 4LFBF 1XNRI 4LF8E 3P45B 4JI2I 2DRAA 4K5SA 1MN9A 1UW9A 2LYVA 1IUJA 4NZ6A 4MFBA 1WORA 2MDAA 2W4PA 1N34F 3VAMA 2XMWA 3LW5C 2DY1A 1JKHB 1A0OB 3DRRA 3O3LA 3J80Q 3ISNC 4G1IA 2DGUA 3K1JA 2ZWOA 4WUCA 1GX5A 1EA6A 4USIA 3TQ1A 3K5NA 3UN2A 4OLPA 1N33F 1PJ5A 1JJHA 1FFSB 3HD1A 3OTOE 3DMJB 1QDUB 4ECUA 1Y60A 2D9OA 2IYGA 1IVZA 4ZVQB 5B08A 3H20A 3ICLA 2BZ2A 4I6YA 1SIZA 4PYAA 5GMKa 4B9LA 2F4VF 3HP6A 1RWVB 5AXNA 5K8PA 3P76A 2ZBIA 4ZLJA 4LIRA 3VAIA 4ZJLA 3Q8RB 1EP4B 3M7NG 3ZZUA 1RE1B 4Y28C 4IZKA 2PDAA 1EI1A 2I5JB 3OQ2A 2UVWA 3A3OB 1SH2A 2GQQA 5C0XB 1WG5A 3FMWA 2Y1RI 3IWNC 2VC1A 1MMLA 4OX9J 1NRKA 5IV4A 3DNCA 2ZUGA 4A8OA 4I2PA 4EI2A 4F04B 2VJUA 3UFCX 3KNAA 5C0XD 4X62I 2GIQA 3HVRA 1RISA 3M7VA 3KDOA 3SIPB 1SH3A 1NH7A 4G1QA 5KFPA 2DPIA 1CBKA 2GHPA 3OLAA 3DLKA 3OUYA 5C2GA 5AJ3F 1H2UX 4B9SA 2KH9A 4RW9B 5A8KA 2KFYA 1PYOB 2XLJA 1YJUA 1QUPA 4JG4A 1S4EA 4DPOA 2HBRB 5KT5A 3IRXA 1C1CB 4FKYA 1VIOA 4L73A 1FVSA 1Q16B 2CNLB 1R43A 3H0PA 4PUOA 5KG3A 3ENVA 3OBIA 1MLAA 3K5LA 5FDLA 3VCDA 1L5UA 4DDFA 2MZRA 1Q79A 3ZKDA 2JZ5A 2UUCJ 1QY7A 1TL4A 1M5HA 5LT5A 1HNZE 5I3UB 4O0IA 1AXQA 2ROPA 4JI5E 3QJJA 2P9EA 3BKUA 4DV4J 3KHLA 2KL8A 2ZC4A 1VJWA 1SBRA 4E98A 1ZM9A 2QV6A 3H40A 2IBOA 1EIYB 3CIMA 4USMA 1XHKA 1S10A 1VC5A 1GAOA 4IG0B 5K20B 1JXVA 5DQIA 3QT8A 1FJGF 4JI4I 2AZ3A 4YHHF 4NA1A 2CPHA 1RCXB 1WHXA 2GS8A 1Y5LB 2M3DA 5D3GB 1IBKJ 1YVFA 2AJ4A 1GXLA 3LH2S 2KDOA 1ZTTA 1NHKL 1QVGR 4NBQA 3DOLA 2GW8A 2YQ1A 2ZD1B 5BJRA 4HTIA 4GRSA 2DGWA 4P75A 1Y4ZB 3ILIA 3M2RB 4HH1A 4LFAF 4QIFA 3DOMA 4OZEA 1G1XA 4CO2A 3NMRA 3GLLA 4LBIA 4XTJA 4ID5A 2IAJA 1F1BB 1KQKA 1J27A 2AV5A 2KXFA 4KGMA 1IKYA 1TKDA 3H7HB 3GFXA 2Y1LB 5RUBA 5E33A 2IIHA 2A6MA 4F67A 3E51A 3M8QA 2NXCA 1CJUB 3DLJA 1XR5A 4DU7A 2IMWP 3TA0A 4NWBA 3HJCA 2FY8A 4TNOA 1C1BB 4I7FB 3M8PB 3UN3A 3CCTA 3ENWA 4AQYI 5EN1A 3PYEA 3D6FB 1RAGB 1XTZA 5IWAE 2XEXA 2AGOA 3UO0A 4RW6A 2WOMB 1Z4UA 2VPXB 2ZZTA 4BA2A 1NZ8A 4GKJJ 2VA3A 4LQ9A 2WSEC 2E5LI 1Y5NB 1U7LA 5HMXA 1N36I 5A8WA 3V6JA 1VISA 4ECYA 3FQLA 2VQFF 5E7OB 2ROEA 1P1TA 2HVDA 5J2PA 2YNHB 3BN7A 4X65I 2NXJA 2IBKA 4IO1A 1S7IA 2JT2A 4PEOA 5KOXA 5J2NA 3UE2A 3A3PB 1U48A 2CQ2A 4MK9A 2VICA 1E3HA 4LF4J 1BKNA 1IBMF 1LW2B 2YH0A 3KLFA 3NCRA 2NSBA 2HAIA 1FKOA 3PJ9A 4IG3A 1YIJS 4O3PA 4IFYB 4ZVRB 2DNZA 2QLBB 2N4DA 4ER8A 3TAQA 1EQMA 1Q5YA 2OEJA 4CT8A 4DPWA 4KHMA 4OHYA 3FBFA 4PQUB 4OV1A 4DV5F 1VS3A 1UEKA 2RRBA 3PRBA 1UDSA 4UOCA 2GX8A 4FW4A 1Q4RA 4QW9A 1YKWA 2VQEF 2VA2A 4AUKA 1G3OA 2P6TA 3HHDA 1FNXH 3C16B 1WEYA 4YS2A 3I56S 1KS2A 3R2CJ 1D8YA 2X1GA 4H4MA 1U6BA 2IJFA 3UDLA 3LPEA 3HHNB 1UEUA 3IAS9 3HKZD 4LFBE 1UDQA 2F1FA 2DB1A 4Y2CA 1N34E 4NLPA 5K36F 4IR1A 3MPWA 1I5OB 3EDRB 3RTVA 4X64J 2HNYA 2VKZG 1D1UA 4QOTA 4M5DB 2N4CA 4JI6J 4JI3F 2W1BA 4CZCA 4AE5A 4YB6A 3P49B 5K14B 1PKUA 4Z7CA 3MI7X 3CJ0A 1VOMA 5LJ5Y 4DV2F 1N33E 4ED5A 3LA0A 1FE0A 4KHPI 3TA1A 3DGPB 1CG2A 4WFBQ 3C6UA 2HWTA 2K2PA 3FRYA 7AT1B 1I1GA 2MYFA 3DRYA 3HULA 4DR6F 4OX6A 1RBAA 2WVDA 4IRDA 1BUXA 2HRTA 3TJ8A 2F4VE 1AFJA 3HHLC 3PHEA 2R2TA 4WFYA 3R7NB 4JI8I 4G1PA 4IYQA 4C98A 5E2QA 5IT9Y 2KRBA 2ZJRQ 2G4BA 2HKJA 1HNXI 3D0GE 1KWMA 4MU0A 3QGHA 3KJNB 4ICLA 2HK3A 3OXLA 1Y11A 1SJ1A 1DHMA 1GTEA 4H4OA 5HK4A 3CGIA 2KM8C 1N6QA 3QIPB 3BSNA 3LNUA 4OJHA 5EX3A 3KUGA 1PSDA 3PO4A 2ZVSA 4CWBA 4TY8A 2BQ3A 3PYDA 1N33I 1P9QC 1EAYC 4URGA 5KFCA 1ZAVA 2MSSA 2HQIA 3RB4A 5E41A 3GSIA 4LSNA 5AXMA 5K36C 1IKXA 1RSCA 4OFZA 1VC6A 4WXOA 2XS7A 2RS2A 3AB2B 4J9UE 3TUJC 5DG9A 3RR8A 5CYMB 4NXMF 3RRKA 2ALYB 1F3FA 1B63A 4FNIA 2M4MA 3MXHP 4Q0BB 3P3EA 1T9TA 4CLSA 5SUHA 1BWVA 1VHIA 3N6MA 4ZN3A 4PG8A 1HFEL 2E7WA 3WIVA 3AJ1A 4KH1B 1C4AA 4Y3CA 3IP0A 5CYQA 3LPYA 3QJPA 4F3QA 2RUGA 2W4DA 2J7KA 1AW0A 2FJVA 5B7WA 4HYMA 5L3JA 5E3QA 2CJKA 2D3ZA 4J9PA 1WF2A 1D9AA 1HQEA 1LW0A 3MEEA 3ZKBA 2ZNZA 4OO1A 1ULRA 1TV6A 4PQAA 1YZ6A 4B3SJ 2AGQA 1VQ6S 2XMAA 4LMZA 3P5TL 2B6AB 1H3DA 1ZPWX 2O5DA 1CJVA 4CLTA 3H4BA 2IM1A 4EBDA 4YHHE 6FDRA 3B4TA 4BLGA 3OFHA 3CJ2A 1U49A 1NU4A 2ZM6I 3LF0A 4K2XA 1LKZA 4ISAA 1BXNA 4HLBA 3QYYA 3OLBA 1Y4SA 4LF6I 4DX7A 1HKAA 5HMZA 1PGZA 1FDNA 1SJQA 7FD1A 3GIJA 3LP1B 4GO7X 2LQ8A 5LMNI 2COLA 3OR2B 4AD6A 2BJ9A 3IBWA 4PWDA 1HQUA 1JLGA 1T9XA 1TAQA 4EBCA 2CQHA 3TWZA 1HBUA 4XK8C 1JWWA 3M6WA 5LL6d 3ITHA 2WHOA 3D6MB 3M30B 4K4SA 4UF4A 2N7YA 1U2FA 3GB0A 2JEGA 2GVZB 1S6PA 1KLMA 2NLWA 2HNZA 1PBUA 2QYCA 1RHYA 3VR1A 3OVAA 2CVIA 3KOAA 2AEFA 4CLZA 5A76A 1P6TA 3GZ7A 4MU1A 2W9CA 5JVGQ 3K85A 1B99A 1VBXA 4N76A 1FJGI 4KH0B 2DEJA 1F5AA 4WKRA 2E5HA 2YKNA 2BA1D 4DUYJ 4WYLA 3NXZA 3AA9A 5FIIA 1V3RA 3OL6A 5L1IA 1C0TA 3HMJG 5IC4B 4DPYA 4HTJA 2ERRA 4K5RA 5IFMA 2Y0SD 2W7PA 3ZO7A 5JEAF 4HXZA 2JX2A 2JC1A 4LSZB 4LFAI 1UVKA 2B9YA 2YQ0A 2Z30B 1JJ2R 4UTGA 2VQFE 4U95A 2CQ0A 2WRMA 3MM8B 3PS1A 2WP8B 1D6TA 3M05A 4DV4F 2BW7A 2MQ8A 1TZ0A 2CPXA 2YNGA 1Q7LB 4ZVOB 1Z0TA 2IRUA 1N4LA 3GIIA 2ZH8A 2PE8A 1IBME 1N5TA 2UUTA 3W9IA 3N6NA 2CPYA 2K06A 1N32J 1JLBB 1X4HA 3FKBA 2M7SA 3G6YA 2KT2A 1QAXA 1LQ9A 2AWZA 4ZVEA 3QZ8A 2CZ9A 4L75A 4CLLA 1RWPB 2GO8A 1RHKB 1TKZA 3AY0A 1S1UA 2E5IA 4DV5E 1IBKF 1K8AT 2PSZA 2BJDA 5C5JA 1XXEA 2VQEE 2OPSA 3HZEA 4DQIA 3E3XA 3MUTP 3H8YA 3ET6A 2FVRA 5KT2A 2R42A 4A48A 3JAMY 2L3MA 4FP9A 1J5OA 2WSCC 1FXDA 1RTIB 1RHQB 2G13A 5EKWA 2VQFI 3SSSA 3PYFA 5H9FJ 2Z4PA 1CULB 3DOKA 4N56A 2OPPB 2IA0A 3M85G 2JEBA 1RP5A 3Q2SC 1TUWA 2HNDB 5K36E 2BJEA 4PG6A 3DLLQ 5K8OA 4MKYA 4NI2A 1N56A 5JEAC 1RZMA 4JI3E 3RBXA 1BQXA 4ES1A 2HLUA 4M5JA 4WK1A 2JE6A 4DV2E 2V4JB 5ETNA 2PEBA 4ZA1A 3CCES 3PEHA 3TZWA 3B78A 3EE3A 1L3KA 1U6FA 4DV5I 2HSEB 2LKZA 2PMZD 4DR6E 2ZH1A 4AYBD 3KJQB 3EVWA 2LU1A 2VPWB 4GKJF 2CQ3A 3HJVA 1FXLA 2WAQD 2F40A 4FXVA 4J9SA 1FHTA 2ZH5A 3K2YA 3H5YA 2HQDA 2QA4G 1VQPS 1GQEA 2OD6A 3I87A 2DH7A 3T1HI 4U3DA 3SQGA 3PDNA 3CDAA 4N7TA 4O4GA 2UVRA 3KJFB 2ADBA 1RHMB 4LF4F 2Z5CA 1H73A 2EEYA 1HBNB 5I42B 1GTHA 2EFOA 1KBRA 4I6WA 2OKQA 4B08A 4ECVA 2C3UA 2XGQA 3D6TB 2O1VA 1F9EB 4S0MA 1HK7A 2CPDA 1KFDA 3DCAA 2PMWA 1S1VB 4NLXA 2AYMA 1BQNB 3G82B 4L3NA 3DFEA 3DXSX 3PKMA 1TKTB 2MY8A 2JEJA 5LSLA 4ILRA 5ETQA 4KGVB 1OIAA 4P9SA 3LOUA 2MHNA 3ELHA 4NXME 2W2NP 1N5VA 2OPQA 3CWJA 2WK4A 4ERDA 4LVNP 4RNOA 1ROFA 4EO6A 3EJMA 5K9FA 2C2EA 1HPZA 4O3NA 2H5JB 3MFHA 5F8HA 5A0YB 2YNIB 3KLEA 1NAQA 4YFUA 5EWGA 5LSOA 2PC6A 4X64F 4K4XA 3ZZOA 4JI6F 1UDNA 2EI5A 2DR7A 3TRGA 2CPIA 3FSYA 5LJ3Y 1NO8A 2BE2A 3M8WA 4LQ3A 3RRGA 2AYEA 1S9FA 3GLJA 2V2KA 3PTWA 5A8RA 3G8SA 3CDIA 2CWKA 1ICEB 4OZ1A 2WW8A 4PKDB 3E2EA 1LNQA 1RWWB 4NXMI 3T5LA 4QIWD 4QQBA 5IQ6A 3O6QA 5F0WA 1KIJA 3W2VA 4U8YA 3M6AA 3CE8A 3RUBL 2J6SA 3C3LA 2WONA 4ZCLA 1FTRA 5CHCB 4U7UD 4JYAJ 1RTJA 1RREA 2OLWA 1JB0C 1UL3A 3M32B 4JV0A 2KB2A 3T1AA 4ZOSA 1KP6A 5D0RA 5F3TA 2P9GA 2UU9J 2R8HA 4N5SA 2C28A 5GVQA 2HFOA 4OX9E 3DYAB 1XNQF 2DGSA 3OR1B 4AFFA 1FX2A 2MKSA 1YQHA 3K5MA 3EPIA 3GWCA 1VRQC 2MQMA 3HSDA 5F41A 4A8XA 4IDKA 4DMZA 2DGXA 3I5BA 4DHVA 3KK3A 2HHWA 3NWRA 2AD9A 2L9DA 5F8IA 5BR8J 2EXUA 5L46A 1QSSA 3FVYA 2MPUA 3WX4A 4OZ2A 1LWEB 2OJ3A 2VH7A 1ZOTA 2XZDB 5C25A 2QMXA 2RDJA 4OKGA 1NM2A 2EFQA 4LF9J 2PO2B 1OPZA 3HVAA 1D09B 3VTIA 1OSCA 3FJ2A 3BDEA 1KKHA 5JEAE 3BO3A 4DI6A 4DSLA 2KKHA 2UUCE 2RB7A 4CH1A 4WF9Q 4Z7YA 4ECSA 3OSNA 2XO6A 1XC9A 1BWEA 2PIIA 1NBEB 4K0KJ 5KG4A 1HD1A 2CVEA 4DFJA 3PJXA 2Q43A 4IFVB 2J7WA 4JI1J 4DV4E 2U1AA 1RU1A 1FWLA 1QVFR 3FSIA 3MM9A 2RQCA 1CLFA 5B0FA 3MAAA 2FQQB 1IKWA 3PR4A 3R5GA 1REGX 1U1RA 4BA1A 2Q66A 4NE9C 4B3SF 3C15A 4WZQA 1K0TA 1QZRA 3TVZA 1ACMB 4WFAQ 2R8JA 3VALA 3ZTPA 2UUBF 2QRRA 2UUAJ 2FJBB 2Y8YA 2ZOFA 1IBKE 4YB5A 1RABB 2KN4A 1ZM4A 3Q0AA 4O3QA 3EGVA 2W25A 2XNRA 2Z5EA 2MGZA 2CNOB 3BGLA 2HHHF 1MX0A 4F3OA 4K4TA 5M2PA 5DM6Q 1SKUB 1WHYA 3T41A 4A8MP 3L7OA 2EPIA 4MIWA 5J2QB 1FFWB 3MMJA 4DX6A 4J7CA 3UR3C 4DPTA 3I31A 4LFCJ 4HVZA 1ZA1B 2FB0A 4F36A 1SB6A 1KHVA 2GMJA 4FF4A 4F26A 3DLKB 3OUYB 3VQSA 2R7TA 3BH7B 3C14A 4KPCA 2DGVA 3D28A 4ANDA 2BOAA 5J2MA 3LPSA 2NYHA 4OQJA 3LAKA 3HXMA 1KQGB 2GQ2A 1WACA 4X66J 4USJC 2MKCA 4ZN1A 3W3SA 2J9DA 4WE1B 3KG0A 3BQ2A 1R8PA 1FJ7A 3TX0A 4DUYF 1RTHB 5KFWA 5J1PA 1JKHA 2Z56B 2DR9A 2IVMA 4TYAA 1RTDB 4GKJE 1JIHA 3N9UC 5KT6A 2ZH2A 5LM7E 1OQ6A 3HFVA 1SUQB 2XS5A 2PA8D 3CMAS 1Y4UA 3N79A 3MAQA 1LFWA 2HAFA 1S76D 3KK2B 5LXRA 5KFHA 3DMJA 3CF5Q 1VBZA 1I6JA 5KFQA 1NK4A 4C48A 2Z5BA 1IWAA 1RT5B 2FTRA 4ED3A 3RW7A 1O51A 1DQ9A 3PXGa 5KFFA 4LF4E 2J6UA 4DR1J 1J2VA 4ZIWA 4DX8H 4DL6A 4RO0A 4KGKA 4N41A 4GO5X 1N32F 3RYLA 2LFVA 1EP4A 3BKTA 1N0VC 4CO3A 1X4AA 1TKXB 3ETMA 2P2CB 5D6GA 1L3UA 2YKMB 4XIUA 3UHMA 4HHJA 4EZ6A 3BZQA 2I5JA 1U6ZA 2CXEA 1X9MA 1HMVB 3EVMA 5E3CA 4ZHRB 2BVZA 1XMQJ 2D69A 5C0XA 2NQPA 1P42A 1PC4A 1YHCA 2AE8A 4V19J 5ELWA 5B0CA 2DVIA 3JAMU 3VV2B 2H65B 3C2PA 2F8MA 3FBBA 4DF8A 1FWKA 1TFYA 1S72S 2ZBQA 3C8YA 4RW8B 2CJAA 3M6VA 4OYPA 3DLEA 4HHUA 4KV8B 3JSYA 3KYLA 4U96A 5KG6A 4RW9A 3ZNJ1 1R89A 4X64E 3FEZA 1TUGB 1SKWA 4JI6E 2H54B 3BF4A 1IJFB 2VC0A 3ISZA 1N52B 4DV1J 1WOSA 2CJYB 2Z8QA 4FF3A 2J0QD 3LAMA 4OZ5A 2HZCA 4ECZA 1DFDA 2P9CA 2IM2A 4QPTA 2YNFB 1UZDA 3DU6A 3I32A 2FDNA 4CM0A 2WVFA 1JNRB 3IR7B 4RW6B 2QJ3A 2C1EB 2V6AA 3MM7A 4LRFA 4B3MJ 2HVHA 1S16A 4UOGA 1S77D 2WCXA 1JLEB 5I3UA 4NASA 1Y7PA 1N54B 2XBPA 5A6WA 1HNIB 3QMQA 3DRPB 4YB1P 3W61A 2JVOA 3IWXA 4F4YA 3HDSA 5CXTA 3VGTA 5LSRA 4DXLA 4Q7AA 1JMTA 2OSRA 4XPEA 1F3VA 1RYRA 4IG0A 3J81U 3M9MB 3W65A 4EO8A 1S1TB 2AMCB 1U09A 3NGTA 2BR0A 3ZXWA 4NLRA 3A8EA 4JI6I 3DN9A 3J7ZT 2WVBA 2L41A 4ILLA 3I5CA 4DR2J 2PO1B 3T6BA 3AH6A 4DCOB 3ENQA 5B0AA 4F0KA 4TLQA 2IMOA 5D3GA 2XMUA 3C66A 2NSCA 1UA1A 1Y3JA 3S01A 3GIKA 3OSPA 2DO0A 2E1CA 2ZD1A 2ZZNA 3TZYA 5DNXA 1FNMA 3UDEA 3IXQA 1C4CA 1KVKA 2BYCA 3M2RA 5IT9Q 3BR8A 1RAAB 3OTDA 1RAEB 2QL5B 1DAXA 1UMJA 3WU4A 8AT1B 3S8SA 4RWXA 5F8GA 2BBEA 4YB7A 2W8KA 3MM5B 1H7XA 3G4SS 4O44A 1CJUA 4M95A 4QYZJ 1W2IA 1R8BA 1RK8A 2AJFE 4CLKA 1MN7A 4I7FA 3M8PA 3R27A 1XNQI 4DN9A 5AE2A 2UXCJ 5B0DA 4DR3F 4KE5A 1YJWS 2N3LA 2FVPA 2MZQA 4OI2A 1YGYA 1UETA 3GV8B 5JUMA 5JXSA 2BEFA 1HI1A 1UVJA 2RMLA 2X1BA 1FESA 2DT9A 3R6GB 1BC6A 1EKRA 1M5OC 2EFNA 4ZPWR 1EJ7L 2DXFA 4ZP9A 4B3SE 4TQSA 3PG9A 3EM1A 1HI0P 1XMBA 2GFFA 5F8MA 1AUSL 3AT1B 2R7QA 1XK8A 4IZJB 2YNHA 1RU2A 1SPBP 3OD2A 1UFWA 2FLOA 4DQQA 6FD1A 2ZJPQ 4MKVA 5A2QU 4Q5VA 1Y5YA 4JYAF 4ZP8A 1LW2A 4A4JA 4LR7A 1YH8A 4IZJD 1LEOA 1FTCA 2UU9F 1AYEA 4LCFA 3S6EA 5LMUJ 1N6QB 2IDLA 2N3OA 1VQ5S 2JEAB 4M5KA 2QC3A 4CO4A 4LRAA 2IFXA 1RA6A 4PQUA 1K1SA 2D1CA 4DQPA 2G0CA 2HMIB 3K5OA 5B09A 3BN4A 5F9LA 3L9ZA 1HHTP 2HHUA 2O01C 4WFZA 1Z5BA 2QSFA 5BR8F 3VGVA 4J9KA 3M2VB 4GC6A 2IM0A 4ES3A 3BV8A 4YOEA 5D0HA 1HARA 1ZAWA 1WC0A 1N5SA 4WWSA 3KXDA 2UUBI 2R9LA 4DL5A 1G7CB 4DUYE 2FJXA 4OYWA 2HFSA 2DIUA 2RRNA 2ACMA 1NHUA 1D9FA 4LF9F 2MLXA 2JSXA 4M5DA 3OTCA 1OQ3A 2YWFA 3BS9A 4OV6A 5K14A 3UDCA 2HHHI 3CC7S 1Z0EA 1IBLJ 5DJBA 1RKJA 3L7PA 1S59A 1CQMA 1KRPA 3MCOA 4RUBA 4K0KF 3IRWP 1X5OA 1CSJA 3KNGA 4JI1F 1RB0A 4HR2A 4NL5A 4LCGA 2ZHBA 1F2HA 3HVTB 4J90A 2BQRA 3KUEA 5CCMA 3ETOA 3W5XA 1S79A 4QW8A 1Y6ZA 4DV7I 1SVDA 1N32E 4M8LA 3JAMC 3UN5A 2BE9B 2HQFA 1XBWA 3NKYA 4K4WA 2UUAF 1FRJA 2DRBA 1RQ0A 5FLXY 2GGPB 3RB0A 2XMVA 3QIPA 3VHQA 2MJNA 1WG1A 5I3PA 4P2XA 4IFDC 1U2CA 4TXSA 1WF1A 2BE7D 4F4AA 3PV8A 2WSFC 4PRVA 2VZ9A 5L38A 3ITHB 2VOPA 4JV5F 5L1KA 4LFCF 4CO0A 1RWKB 2VFTA 2R7UA 2DR5A 1FWPA 1H7SA 2R8KA 2HZVA 3MOJB 2GCFA 4DR5F 5CYMA 1D8ZA 3ZZRA 2WBMA 5T7LB 1N32I 4YY3I 4Q0BA 5E5NA 2PO0A 4BWMA 4LBPA 3QWUA 3K8WA 4PG5A 4X66F 4IR9A 2QZ8A 2NUUG 1WI6A 1RAFB 1X7VA 2KZMA 5HQLA 1N0UA 4IRCA 2V2ZA 3KTQA 3VVTA 3GG1A 3Q8QB 2F1DA 3J81C 4U7CA 2E5GA 2HS4A 1VK3A 1PBAA 1X0PA 1EETB 3T5KA 3UPFA 1BQMB 1PYTA 4C0BA 4DN0A 2HS3A 1W7WA 2YPYA 3C6TB 4WUDA 2DR6A 1UFKA 2O1WA 4RPFA 3Q22A 1ZZFA 2KO1A 4UOHA 2B6AA 1SV5B 1Q1KA 4M1KA 3SYZA 1RHJB 3T1YJ 1R6YA 4CI0B 3TEHB 4DQSA 5B0EA 2HHQA 1B0TA 1U1KA 5C42B 1UEVA 1TUVA 4G6VB 1LXJA 4ENOA 3NY0A 4WP3A 4XPCA 3G6VA 3MPVA 2V8DA 4NPOA 2CQBA 1XMQF 1JK9B 2JLFA 4F3MA 2XULA 4MDTA 1L3TA 3OR2A 1WHVA 2UV8A 2MQOA 2Z2YB 4YR0A 1YK9A 3EZ5A 3J80U 5A6PA 1VRTB 2J0XA 3IGNA 3CJQA 3TW0A 3EXCX 2HFVA 3CD0A 5MAOA 2FUG9 1LK7A 3P06A 1BMQB 2K7JA 2WNRB 1SCJB 3M30A 4L72B 4OJ3A 2GQCA 4FS1A 1J5OB 2J76E 4NLWA 4WTOB 1H6KX 2QTWA 4ED6A 1XR7A 1R8HA 3CO9A 1SQEA 2CQIA 4HT7A 3GE9A 4NXNJ 1Z1ZA 1R27B 4USKA 2X1AA 3B4DA 1SIWB 4KKOB 4G65A 3JQKA 3M8YA 2XYPB 4C7QA 3QZ7A 3T19A 4DV1F 1S6UA 4Q8EA 3W8PA 1E6YB 3AXKA 3C46A 1GH8A 1RT1B 4ITSA 4FW3A 4JI0I 2Q3PA 2LQ9A 3AAWB 2CPZA 2GMHA 1N8RT 4ZLLA 4B3MF 5A2QC 1Q53A 3GJQB 2I9SA 3BYRA 1XMOJ 1RT3B 1WC3A 3CMES 3QWPA 2ILZA 1ZPVA 3J7AN 3DRXA 2YVSA 1NSPA 9ATCB 3MM8A 2WP8A 2OELA 3R1HA 1GMWD 1DTQB 3MTKA 3QJLA 4K4VA 4Q2MA 4IKAA 3TANA 2RILA 1Q0NA 4JYAE 3TOQA 4DSKA 4C97A 4QNJA 5JMNA 2DCUB 4F2RA 2VF3A 2UU9E 1JLBA 1UDOA 2ZNYA 3Q2TC 4DR3I 4GKKJ 3LALA 2N7CA 4DR2F 5HROB 5IV3A 4WZMA 4W4MA 3SQOP 3HKMA 3O5TB 5G0RB 4DBQA 4R25A 3BM7A 2GO4A 5IXUA 3M9NB 2IC3B 2LEBA 1SJRA 5H9EJ 4ZVTB 3OL8A 5ETOA 1B64A 3JS9A 1TL1B 4UUWA 4WP9A 3QBCA 2D7SA 4RU2A 5BR8E 4LF1A 1RTIA 1ZA2B 4RNMA 1X5PA 1CULA 1FRMA 5CZXA 2RE1A 5CAAA 4WU3A 1SKSA 2F63A 4NCBA 5DG7A 2HNDA 2GVDB 4M5IA 3CMQA 1IJEB 4LF9E 5M2RA 3K17A 1OYDA 3PW5A 2R2SA 4NCGB 2IPOB 1U1OA 1F6TA 2QE5A 4AIDA 1YJRA 3M1VB 4CIOA 2BRLA 8ATCB 4X4VA 1WTFA 3W60A 2V4JA 2UXCF 3IAM9 2EFPA 1PC5A 4K0KE 5I4MA 4F4KA 2PD1A 2IRYA 4KQVA 4MIBA 3MPYA 3G96A 2FJWA 4JI1E 2J5AA 1MWQA 4IO9Q 1SJ3P 1LOUA 3K59A 2E5JA 2VU5A 2YKPA 2VFSA 3FUYA 2DNKA 1HYSB 1XIQA 5CA5A 3CCMS 4FYDA 1U4BA 3RAQA 2VFUA 4JV2A 4PABA 3GV7B 2DITA 1JLQB 3I9ZA 3A1YG 2CQPA 3FRZA 2ZDOA 5JVHQ 4DR4I 2BXJA 4JI7J 2MSTA 4B3TI 3KHRA 4DV6J 2UUAE 2UXBJ 1S57A 3CEDA 3MCMA 1IR2A 4E0DA 3MMAB 3MGJA 3AJ2A 2CPJA 2YTCA 3RB6A 1VK8A 3EICA 3ZFVA 4ECXA 1HBNA 3ISND 5I42A 3JB9k 1B70B 3NS5A 1D9DA 4EYHB 4KGXB 2M9KA 4L6V3 4WXWA 5GMDA 3SCIE 1QM9A 1IR1A 1S1VA 1BQNA 3G82A 2H3EB 2RD5C 4LFCE 4ETZA 1FEEA 2BABA 4B3RJ 4N47A 5F9NA 2ATCB 1YJNS 1Z0VA 1TKTA 1V3ZA 2Y9HA 3W62A 2HHPA 4BC9A 1N5YB 3T5JA 1HR0J 3E01B 2UXDJ 2XO7A 1NJZA 1PILA 4X66E 1Q81T 2OTJS 2UUAI 3HI9A 3FC9A 2YNIA 2KT5A 2NN6B 3PS3A 2IOPA 3BGOP 4CRJA 2W2MP 3DDNA 3M7ND 1NK5A 1J5EJ 5B0BA 3KLIB 1IBLF 3IO1A 2DHHA 5DNLA 4JV5I 5KFKA 4NZ0A 1MNEA 3TZXA 2YWWA 1Q86T 1XNRJ 4JI2J 1S0OA 4U8VA 1R6MA 2AP6A 3MM9B 2HEKA 5MLCV 1O5JA 4DR5I 2PI4A 1VI7A 3TQEA 3PKYA 3TI0A 3WU3A 5DDQC 3C15B 3J80C 4DV0J 1S6OA 1S5ZA 2AU0A 1R6LA 3GJRB 2AJQA 2QLJB 4WYWA 5AE1A 2E9TA 3M6UA 3M32A 1R0BG 5D0GA 1NK6A 3KJVB 2VPYB 3MUVP 2J7UA 2I1RA 1FRXA 1XMQE 2DHAA 4FF2A 1WD6A 2M2BA 4LUBA 5HAOA 2DNNA 2KVIA 4LVOP 2ZH4A 3F41A 3DYAA 1EHWA 3HF5A 3LANA 2NYIA 1V5IB 3WHIA 3OR1A 1HHQA 2BV3A 3NOGA 4ECQA 3H4DA 4OI1A 2VFRA 1NJWA 3HVWA 2YKOA 3OV7A 3DLGB 3GYNA 4FKXA 2OFGX 3GV5B 2O1PA 1IWGA 5EWFA 3T3FA 4TU7A 5DQGA 2ZDPA 1HBOB 1LWEA 4OJGA 1YBUA 3NCQA 1IQZA 2EKYA 5HBMB 4CO5A 4I0WA 4DV1E 4MMOA 4DR7I 2VESA 2W7AA 3T6JA 2ZBCA 4NOHA 4X62J 2Z58B 4X4SA 2PO2A 1NXIA 4URQU 4XTTA 1XMQI 2C39B 4R8UB 4ID8A 4B3ME 4DZDA 4DUZF 4DG1B 2CADA 1FKPB 3H2VE 3L3CA 1WUUA 4NMLA 2HVZA 2VDHA 1RHRB 4DX5A 1GT8A 3SXLA 3N28A 3NNAA 2BACA 4IFVA 4O4RA 4RZRA 4DL2A 1USVA 3A3NB 1I94I 3QGGA 3IBFB 2Z5BB 4UUXA 5HMYA 2G1DA 3K7RA 2B0GA 2BJ7A 2OP5A 1MSWD 1RDRA 1QAJA 1TMJA 2QFJA 4DR2E 1T11A 3M8SA 2MQPA 4ZK7M 1YLXA 5IQQA 4LF8I 4M94A 2XC9A 2QG9B 4K4UA 2QFIA 1NDKA 2HBZB 3NCPA 4ZVIA 1VDHA 1ELOA 1HW8A 2NXUA 2KI2A 2R8GA 2DYAA 2W2QP 2CJXB 1UVLA 3MR7A 5J2QA 4KAIA 1PYSB 1S0NA 3QFHA 1T9VA 3GIMA 1T02A 3V2UC 4FDFA 4JI4J 2YX7A 3NLCA 5AXKA 3U1NA 3OTOI 4KT0C 2EBEA 3D4JA 3SMZA 2XSJB 1HW9A 3TEGA 3DLEB 3KFWX 5C24B 2QLXA 2X36A 3MMBB 2F7VA 2KHCA 5EL9A 4LCHA 4DV3F 3H98A 2B5JB 4CM2A 4LF5J 2L48A 1SXLA 5AT1B 2PN6A 4KJIA 5D4OA 4UY85 2UXCE 4WE1A 1WC6A 1FDDA 1T3OA 1NDPA 1RTHA 3CD7A 2YX4A 1X0FA 1UPPA 3JXOA 2ZH7A 4I56A 1VRUB 4QZVB 2EWHA 3BSAA 1RTDA 3MM7B 5DDPC 1JLFB 4OYIA 5KG2A 1T05B 2IOQA 2BRKA 3HLUA 2ZWPA 1SUQA 3W2WB 3P96A 1Q82T 2AQ4A 2QYGA 2OIHA 5IS2A 1XMOF 1USUA 3T5HA 3THPA 2J9EA 2KHDA 4AQYJ 3KK2A 3GJTB 4C8OA 5D77A 4BCAA 2PMHA 3HFZB 3EWGA 3H2LA 4ZJQA 2XQCA 1RT5A 2VJVA 5KT4A 2HFZA 3TYTA 1K0VA 3ADAC 1WKLA 3DD6A 4QWEA 1R7IA 4DZ6A 1F5BA 2G0IA 1BGXT 2E5LJ 1TKXA 1N36J 2YKMA 4GVBB 3PJWA 2BA9A 2BM1A 3HX9A 1HMVA 2ZZMA 4ZHRA 3N0VA 1CQNA 4X65J 2HIYA 3RBEA 1VBKA 3RRHA 2HG4A 4ECWA 4CQ1A 4RNHA 1ITPA 5EUHA 5ITHA 2BR2A 4MIAA 4PG4A 3MR6A 3KHHA 2VIHA 3HHLD 3EPGA 1U0SA 1HNZI 3D2WA 1RI7A 4WPAA 2QA2A 4JI5I 3MTJA 4KB7A 5ETKA 4RW8A 4TQRA 1VCTA 2RU9A 2O1UA 4Q2LA 4KV8A 1KFSA 4NA3A 4O44B 4DL0C 3CJ4A 4HDGA 3QGPA 3DKDA 1VQ9S 2DH9A 4IH7A 2I38A 3H4LA 2IDEA 5K36B 1IBLE 4ZVHA 3D1OA 5D78A 2YNFA 2DGTA 1JXEA 3AOBA 3H5XA 2I2YA 3RU0A 4DS5A 4A8FA 1JLCB 5E0OA 5D0EA 5K36D 4RLEA 2FJAB 1HBMB 1FRHA 2D3OR 1NJYA 1SL2A 1VQYA 2IM3A 4HDHA 1JLEA 3MOZA 1WC1A 1DZ5A 1Q95G 1HNIA 3DRPA 1K47A 4F8RA 3MM6B 3Q24A 1SC3B 4X84A 2DBBA 4UY8T 3LWMA 2XMJA 5HN0A 4CP5A 3HK2A 1Z2LA 2B4UA 4KHPJ 1S48A 1M1GA 1YJ9S 2ZUAA 1KNZA 4JI7F 4LR9A 4DV6F 1RLCL 1S1TA 2RKIB 2RF2B 3W66A 5L1JA 1KVJA 3KRNA 4I2QB 2V4QA 1QUVA 3QPIA 3L09A 1A9NB 1V3SA 3CWVA 1NNDA 2E9ZA 1IBLI 3SCJE 2PO1A 3BYPA 1S9EA 2J65A 2L9NA 4F2SA 3N4WA 4JI8J 1T8EA 1UAWA 5IWAI 3KLVA 1R3NA 1T3NA 4ZPCA 2OSQA 3VVUA 1HNXJ 4B3OA 2M8HA 2QL9B 3IWLA 4B3RF 1VIXA 3DI6B 2W7OA 2EBGA 4OYAA 1RWOB 3PS2A 1SH0A 5KFOA 1OPIA 2OGUA 4WJBA 4HY1A 3HM9A 4DL3A 1U1NA 3NS6A 2ALZA 3DM2A 1OYSA 1HR0F 3MPDA 4EU0A 3K8VA 3MR2A 3CIZA 2HHTA 3MM5A 3PYGA 2XWYA 5AE3A 1VBYA 1CC8A 4DSJA 3G87A 4OO1F 5FLXQ 3ZZPA 3M2UB 2IESA 2FJDB 1P8GA 1T94A 3UR0A 4H54A 4Q44A 4DUZE 4NEYA 1ZTWA 2LXUA 2LMIA 2GIRA 4ZLPA 3GIRA 5CYJA 3SI8A 1MMNA 1J5EF 3UD5A 2XSFA 1UA0A 4QPXA 3PW2A 4CLPA 2MQNA 3NGKA 1M5KC 1TTHB 5DLFA 1WKKA 5G4DA 4WCEQ 1NKEA 4OI4A 3Q6NA 4HACB 2XLIA 4MT1A 2AEMA 1U1QA 1XNRF 1NZAA 2E1MC 4JI2F 1PCAA 3PACA 2ZH9A 3AHPA 3MFIA 1K1QA 1AUDA 4U3BA 4WIQA 3O1LA 1MG7A 4BC7A 3RBZA 2ASJA 4IZJA 3W1YC 2GZOA 4DV0F 1E3PA 4PZVA 4LFBI 3LTOA 1WI8A 1JJCB 5HSPA 2HQ3A 1N34I 2Z2MA 3HSJA 4I6AA 4DUZI 4FWGA 3WZ0A 3T9NA 5ETLA 1RT7A 1NPKA 2I0XA 4NLGA 2JEAA 3G8QA 3HCXA 2DGQA 4CTAB 1KC8T 1E6VB 5DGAA 1RTZA 2CRLA 4WFNQ 2OHDA 2E29A 3MDFA 2LLZA 3OJSA 1FA0A 2DPJA 4KTQA 1F5CA 2V69A 1U24A 4OO1C 2H4WB 2HMIA 3W9HA 2L08A 2P6SA 3BPSP 2ZM6J 4O3RA 2C2KB 1IQTA 4W90B 2X7IA 4LF6J 2Z2LA 4DV3E 3EGNA 2F4VI 4C8MA 3GYXB 2C37A 3L7UA 3EMTA 2LA6A 5LMNJ 3M2VA 4PXCA 2XGPA 2CZVC 1RUSA 2PO0B 4ATNA 4J9RA 4N3OA 1M90T 3ULHA 2XMMA 1TVRA 4IRKA 1RACB 1FX4A 4X62F 3SBMA 1APSA 2XZWA 2VG7A 4X4UA 3AFGA 3SCLE 1T95A 5DLGA 3G6ES 2ZKTA 3MECB 4IH5A 4B9UA 2NS1B 3KK1B 2XS2A 1FK9B 4AL5A 4L3KA 2Q79A 1XMOE 1NK9A 2EFVA 4RNNA 1FJGJ 4C3KA 2Q1LA 3HT3A 2DK2A 2QGFB 3TJ9A 5JEAB 4E2FB 3CJ5A 4C8KA 2AX1A 2GV1A 2JLEA 2VG6B 2WVEA 3HVTA 4K4ZA 2CWXA 2AHOB 4DV3I 3U7JA 5JEAD 4ED8A 3OXFA 2P5VA 3X3UA 3JSMB 2LECA 2DY9A 2MB0B 4EZ9A 1LK5A 4LFAJ 3CCUS 3M85D 1JNZB 3BGFA 1FEHA 3BDPA 5EDWA 2IERA 3EZOA 3QNWB 4PWWA 1NHIA 1B4SA 2GGPA 3CXCR 2OO4A 2R2RA 4ZVUB 4DJBA 4G3IA 1WJ9A 2EKNA 3AJDA 2A2DA 4OX9F 2MEWA 3O2IA 3Q86A 4PAAA 1XMOI 1I3OB 2APOA 3F56A 4AIMA 2BKOA 3ZZTA 1SL1A 4PXDA 1FO1A 2V8GA 1RXOB 4JI4F 3BQ1A 1MU2B 3RB3A 2QLFB 2ROGA 5EWEA 3VAKA 2CQ1A 3MD3A 3Q6MA 4FW6A 2ZOMA 1LFPA 1YBAA 5T7LA 3FFIB 2VOOA 4ZCMA 5D4LA 2KZZA 5HLFB 4LF5F 4YHHI 1C0UB 3OFEA 4MYTA 2V94A 4J9MA 1PIEA 4GMKA 1JXLA 4J37A 2OEMA 2CDQA 3QSIA 3WX8A 2CJ9A 2B51A 3UVJA 4WFXA 3D0HE 2M5YA 4Y2IA 3GR1A 3J7AM 3V4MA 3KHGA 2JHEA 3LQVA 4N77A 1UVMA 2LP4A 2UUCF 2RH3A 1EETA 1UWBB 4HI1A 2YKQA 1BQMA 1G6BA 2Q6BA 2FY1A 4AQYF 1X4BA 1WF0A 3NZKA 1TQLA 1S12A 5KTQA 4FBTA 3C6TA 4TKTA 1IR0A 1SJ4P 4USTA 4JI7E 4DV6E 4DV5J 3DU5A 2UXBE 2ZJQQ 4ZP7A 1DLOB 3SEOA 3U1YA 3TP2A 1MMDA 1SV5A 4FYYB 1WC5A 5C7PA 3MUMP 2CZ4A 1TK8A 2P8IA 5ETTA 3SFUA 1S1XB 5KFJA 2ZEJA 1TL7B 2CFXA 2E5LF 2FVQA 5C42A 3D68A 2W01A 3PIPQ 4TVAB 4H4KA 1X31C 2QMUB 2JRSA 3SDEB 3F0NA 4B3RE 3T1HJ 4OIXA 3L7ZB 4X65F 5L39A 2HVIA 1VRTA 1OY6A 2RIJA 4I64A 1V5VA 2IRXA 5K8NA 2BKNA 5BYQA 2WNRA 1UP1A 4X2BA 2FLLA 2DHGA 4HL9A 1UZHA 2AJ1A 1HR0E 2UXDE 3IN5A 1ZS6A 4OO1E 3V5RA 4MJKA 1IBMI 4KO0B 3G9CA 2KG0A 1FD8A 3EXYA 4KKOA 4NZ7A 2DR8A 3U02A 1U2RA 1J5EE 5EX0A 1E6YA 2HBYB 3V81A 1X4EA 4NEZA 2AYBA 4NYPA 1RT1A 1QTMA 1AFIA 4A8YA 4ED2A 2BW2A 4QR1A 1RHUB 5HVGA 3P3DA 4ZPTR 1XNRE 1FRIA 4JI2E 5KFDA 2VQEI 3GJSB 1AZSB 2NZ4A 1RT3A 2PT0A 3BSOA 4IOAQ 2E66A 5F0UA 2A1BA 2WZ1A 1X5SA 4LT6A 3QIDA 3P6YC 4DV0E 1GMUA 2CAJA 3AOAA 4NMXA 1DTQA 2CQ4A 4WUBA 2BA0G 4W92B 3UD4P 2DTJA 1ZAXA 3KUHA 3RAXA 4KHPF 1S97A 2CPEA 4QYRA 4JI3I 3CCRS 4TU9A 3AXMA 2ZBRA 1QJHA 5KOWA 2HS0A 2QO3A 1HD0A 4NXMJ 1J5EI 1X4FA 3D3CJ 3PR5B 3DXBA 4DV2I 5HROA 1IBCB 1LWFB 5IM0B 3FBCA 3QAEA 4JI8F 5G0RA 5HQ8A 2M0GB 4C8ZA 2NN6F 1GEHA 5ETPA 3LP0B 2IC3A 1HNXF 4DR6I 2ASLA 1ZXMA 5HP1B 1TL1A 2HWIA 2WVCA 3BH6B 2HURA 1NSKL 2FC9A 3PZPA 2W8LA 4DV0I 5IT0A 3PEJA 2IJNA 4Y0FA 2GVDA 4Y2KA 1H2VZ 2W24A 3BQ0A 4X62E 4KRWA 5KFAA 4AL6A 2OI2A 2GJFA 1ZYQA 3G71S 4EMDA 4NCGA 1NKBA 2VODA 1YX2A 5HJXA 9RUBA 3M1VA 4I1TA 1GXTA 2E1AA 1DBDA 1UTAA 2HPUA 2JL9A 4FZVA 1NH8A 4KFBB 2DJWA 4DCJB 2Y1IA 1DARA 3J81j 2QMWA 5GAHU 1NDLA 2O67A 3TVKA 3IG1B 4ECRA 5D8HB 2JLGA 3MHYA 3MR3A 3Q8VA 4P73A 5H9FK 4O0NA 4URLA 1HIYA 2JFDA 3UQSA 1X9SA 4DSEA 4PXBA 7FDRA 2GJ2A 1HYSA 3KLGB 2B8QA 3JQMA 2DHSA 5IT9U 3FBEA 1CJTB 5E3AA 3QRRA 1JLQA 3NP5A 2DO4A 1FKAF 3US5A 1HQ2A 2ZH6A 2NN6C 1FRLA 3AQOA 1Z59A 2Y1JA 1CEZA 1BE4A 3MMAA 1TL5A 4MH8A 2XY5A 2LQBA 2F65A 2YKAA 1YRTA 2J0WA 2WW4A 1QSYA 3VQTA 2OFHX 2HHXA 4OMFG 5KFLA 1LXNA 5KFTA 4RUHA 1RAJA 4JI4E 2HHVA 3I0RB 2AT1B 4C2MA 4CYUB 2YPZA 2ZM6F 4XDDA 1N5YA 1YRXA 2KU7A 1DQ8A 4LF6F 5B0GA 5DZ6A 4DWIA 4I3HA 4OYOA 2MLZA 3E01A 1WWHA 4C11B 5LMNF 1AB8A 4LF5E 2DISA 4ANEA 3FZ2A 2D74B 1B7FA 3TA2A 2NN6A 4CT9A 3D6HB 3NGRA 3BKFA 3CDJA 3R5DA 3BREA 3SFGA 4FWDA 1KTQA 4OX9I 2GHVC 2JWNA 3KLIA 4KHRA 1PJ6A 4X4NA 2J6TA 2PNZB 2PEHA 4EYIB 1ZM3A 4AQYE 1HNVB 3CCLS 5IOLA 1F0XA 3VAHA 1UWAA 2U2FA 2V68A 1Z5CA 5C0XF 4XO0A 3GU0A 1Q7YT 3J7YU 1U47A 1Q8IA 3LGHA 5F8NA 1GXUA 4ZPBA 1VHFA 2KJVA 4HT5A 1W2BR 1KN6A 4EGLA 2AZ1A 2Q6CA 1HNWJ 4LF5I 1H7UA 1B62A 1VQLS 3NL0A 3CD5A 3WDOA 1QE1B 1M5PC 2E5LE 1NSAA 1N36E 4ZMMA 3I55S 1KDNA 2DRDA 4P6QA 3KJVA 4F4WA 5KFMA 1XEZA 2CPFA 3V6HA 3CJKB 5IZHA 4B9TA 4X65E 2BOPA 4LJMA 3PX0A 1DTTB 2KYXA 3QT7A 3O8WA 2R8IA 3THTA 2DNLA 4FVCA 5HVFA 4DFKA 4IS9A 1XERA 2UUCI 3AA8A 4P72A 1HWLA 1FDAA 1P9YA 2HK2A 3CJ3A 3W64A 1YI2S 3LP2B 2Z2ZA 4F25A 1RBLA 4DV4I 1R0AB 3DLGA 3MPUB 2MLYA 2R7SA 1KOOA 4LF7J 1HBOA 3U1KA 3P4UB 1U1MA 4DPUA 2V8PA 5HBMA 5K8MA 4PG7A 4URSA 1FFGB 4O3OA 1H0HB 2ZKUA 4D3GA 5C0XC 2RDIA 2FGOA 1IBKI 2C39A 3JTNA 4R8UA 2G1HA 1T7PA 3W8GA 4DG1A 1FKPA 1F9HA 4X4PA 3J7Z5 3HPOA 2JDJA 2MMYA 4ED7A 1S0VA 5F3ZA 1KHWA 3IR6B 3PX6A 4CCHA 4TN2A 3AD7C 3KWMA 1NUEA 1M1KT 2WBRA 5KFIA 2HKEA 3IC1A 4MU4A 1WKJA 5DM7Q 4J9NA 4KHPE 3SV4A 1M5VC 3KLHB 4LRDA 4K59A 5ETMA 1X8DA 2ABYA 5EGYA 3R7SB 4AXIA 1WNEA 2VKRA 4OHVA 1BHNA 2BJ3A 2KRRA 2PI5A 1AT1B 4N8OA 4EEYA 3AD9C 1FT8A 4RNFA 2X51A 2IA6A 1EARA 2DHXA 4JI8E 3K89A 2MQLA 5KG5A 2NN6E 5T14A 2AKWB 5KFYA 2XLKA 2H48B 5KG0A 1HNXE 4K4YA 3I0SB 1RT4B 1OY9A 2VBYA 4WTYA 5ADZA 3EX7B 4FWHA 3T1HF 4QU7A 5HMWA 4GKJI 2BDPA 1JLAB 2BR2B 3MMCB 4R5PA 1FJCA 3U1LA 4ZCIA 2E7VA 1FDBA 3S1TA 2XSJA 5C24A 2AYGA 4RKUC 4F7VA 1S1WB 3MMBA 3PHTA 4YDXA 3CUNA 4KY3A 2M70A 2XMTA 4LF4I 2B5JA 3A8IA 1S4FA 1U02A 2KFZA
chains in the Genus database with same CATH topology
4JI4I 4GKJE 2O1VA 1HK7A 1Z59A 4B3MI 2GS8A 2J7KA 2PNLA 3T1HE 1Y4UA 2AJ4A 4YHHI 1Z5BA 5IT9C 4HYMA 4MYTA 4JI0E 1PIEA 2WW4A 5L3JA 1PKPA 4DR7I 4DV1E 4JYAE 2Z5BA 4IZKB 4NXME 3CWVA 4UT4A 2VF3A 4JI7I 4DV6I 2LJPA 5FWKA 2UU9E 1IBLI 2UXBI 2UUBI 5BR8I 3ZKBA 4LF4E 1A6FA 1MU5A 1XMQI 2ZITA 4DR3I 3T1YE 4XTJA 4DUYE 2HFSA 4JI4E 1HNWE 3GONA 3J7AM 5IWAI 1Z5AA 4B3ME 3B82A 1N0VC 1WUUA 1FKAE 2V2VA 1KTVA 2HHHI 4YHHE 1Z0EA 4DR2I 1H72C 4LF9I 2R3VA 3PRYA 4I3HA 4DU7A 4DR7E 2ZM6I 3J81Q 3HJCA 4B3RI 4LF5E 4HY1A 4JI7E 1USVA 4DV6E 1Y4SA 4X64I 4LF6I 2UXBE 1I94I 2UUBE 5BR8E 4AQYI 3PYEA 2Z5BB 5LMNI 4DR3E 3PYGA 5IWAE 4P7AA 4K0KI 1FWKA 2XEXA 1HR0I 5FLXQ 4JI1I 2UXDI 4FWDA 2HHHE 4DR2E 1Y6ZA 4OX9I 4DV7I 1N32E 4LF9E 4NXMI 4DUZE 3K17A 4NXNE 2ZM6E 1H74A 3JAMC 1RR9A 4LF8I 2BM0A 4P52A 3F0NA 1KIJA 2E5LI 4B3RE 2NPFA 4LF7E 1N36I 3M6AA 4X64E 2EFGA 4LF6E 1I94E 3T1YI 1ZM3A 1VISA 4AQYE 4JI6E 1HNWI 2GQ0A 5LMNE 1Z5CA 3ZZ0A 4ZVIA 1ZM2A 1ELOA 1RREA 4X65I 3K85A 4K0KE 3J7AG 4MYUA 1FJGI 3Q6NA 4HACB 2DEJA 1HR0E 4KQVA 5LMUE 4JI1E 2UXDE 2UXCI 4R1FA 1BKNA 3V2UC 4OX9E 4DV7E 4FN5A 4LF5I 3V5RA 1H7UA 4PRVA 4PU9A 3OTOI 1B62A 3D4JA 1XNRI 1S16A 4LF8E 4JI2I 4DPYA 2Z5CB 1IBMI 2E5LE 1NHJA 1MG7A 1N36E 4IZJA 2X36A 2CGEA 4HXZA 2PNMA 4LFBI 3LTOA 1H7SA 3J80Q 4DPWA 4LFAI 1U2RA 3K1JA 4LFCI 4X65E 4WUCA 3ZM7A 1N34I 1J5EE 1FJGE 4DR4I 1UEKA 4B3TI 2UUAE 3QT7A 4UTGA 2VQFE 1EA6A 1N32I 2UXCE 4YY3I 4DUZI 4FWGA 2UUCI 4NXNI 1D6TA 4DXLA 2HK2A 1Z0TA 3OTOE 4LF7I 1XNRE 4JI2E 1IBME 1FI4A 4JI6I 4DR1E 2VQEI 4DV4I 4GKKE 1N0UA 5LL6R 2V2ZA 4X66I 5GMDA 4LFBE 1OJ4A 2IOQA 4LFAE 4DPXA 5LMUI 4LFCE 1N34E 4DR4E 4DV0E 2CZ9A 5A2QQ 3J81C 1KKHA 4B3TE 1USUA 2X7IA 4WUBA 5GMEA 4DPUA 4YY3E 1Z0VA 4DV3E 2V8PA 2F4VI 3ZZUA 2UUCE 4Z7YA 4IZKA 4Z7CA 4DV5E 1EI1A 1ZXNA 1FNMA 4N3OA 4JI3I 1KVKA 3B8HA 2VQEE 4DV4E 1N33E 3WU6A 2HFUA 5IT9Q 4WUDA 4KHPI 2O1TA 1Z0WA 1FWLA 2E1RA 1IBKI 2O1WA 4RPFA 4X66E 5FLXC 2R42A 3WU4A 1J5EI 3Q1QA 3QT6A 2Q2EB 4DV2I 2UUAI 2VQFI 3PYFA 3HULA 1PVGA 4M1KA 2IOPA 4X62I 2BM1A 2V2QA 2F4VE 4PRXA 2CG9A 1QZRA 4JI8I 4DR6I 1XMOE 1ZXMA 4DR1I 4B3SI 4GKKI 2HKJA 4JI3E 2HKEA 1XNQI 1HNXI 4KHPE 1IBKE 4JV5I 1ZM4A 2HK3A 4DV0I 4JG4A 1HNZI 2Z5EA 4DV2E 1S4EA 4JI5I 4DV3I 1MX0A 3P06A 3B78A 4X62E 2O1UA 4DR5I 4DV5I 3LNUA 2OI2A 4ED4A 4EMDA 4DPTA 4JI8E 4DR6E 3WU3A 3PYDA 1N33I 3J80C 1Z0BA 4B3SE 1XNQE 1HNXE 3ZKDA 1NZ0A 2A2CA 4JV5E 3QT5A 4USKA 3H4LA 1DARA 4FWHA 4IZJB 1IBLE 1NHIA 3JAMQ 1HNZE 4HACA 4GKJI 3LPSA 4FW9A 4DU8A 1XMQE 1Z0GA 1Z0CA 4JI5E 2DEIA 3WU5A 2A2DA 3T1HI 4DR5E 1ZM9A 1B63A 4URLA 1XMOI 4IZJD 4JI0I 2V34A 3ZZTA 2ZBKB 4USMA 4DV1I 2Z5CA 4JYAI 1XHKA 1H73A 1NHHA 2BV3A 2UU9I 5A2QC 4LF4I 3Q6MA 1K47A 3QT8A 4DUYI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 I;  4GKJ E;  1Z59 A;  4B3M I;  2GS8 A;  2J7K A;  3T1H E;  2AJ4 A;  4YHH I;  1Z5B A;  5IT9 C;  4HYM A;  4MYT A;  4JI0 E;  1PIE A;  2WW4 A;  5L3J A;  1PKP A;  4DR7 I;  4DV1 E;  4JYA E;  4NXM E;  3CWV A;  4UT4 A;  2VF3 A;  4JI7 I;  4DV6 I;  2LJP A;  2UU9 E;  1IBL I;  2UXB I;  2UUB I;  5BR8 I;  3ZKB A;  4LF4 E;  1A6F A;  1MU5 A;  1XMQ I;  2ZIT A;  4DR3 I;  3T1Y E;  4XTJ A;  4DUY E;  2HFS A;  4JI4 E;  1HNW E;  3GON A;  3J7A M;  5IWA I;  1Z5A A;  4B3M E;  3B82 A;  1N0V C;  1WUU A;  1FKA E;  2V2V A;  1KTV A;  2HHH I;  4YHH E;  1Z0E A;  4DR2 I;  1H72 C;  4LF9 I;  2R3V A;  4I3H A;  4DU7 A;  4DR7 E;  2ZM6 I;  3J81 Q;  4B3R I;  4LF5 E;  4HY1 A;  4JI7 E;  4DV6 E;  4X64 I;  4LF6 I;  2UXB E;  1I94 I;  2UUB E;  5BR8 E;  4AQY I;  3PYE A;  5LMN I;  4DR3 E;  3PYG A;  5IWA E;  4P7A A;  4K0K I;  1FWK A;  2XEX A;  1HR0 I;  5FLX Q;  4JI1 I;  2UXD I;  4FWD A;  2HHH E;  4DR2 E;  4OX9 I;  4DV7 I;  1N32 E;  4LF9 E;  4NXM I;  4DUZ E;  3K17 A;  4NXN E;  2ZM6 E;  1H74 A;  3JAM C;  1RR9 A;  4LF8 I;  2BM0 A;  4P52 A;  3F0N A;  1KIJ A;  2E5L I;  4B3R E;  2NPF A;  4LF7 E;  1N36 I;  3M6A A;  4X64 E;  2EFG A;  4LF6 E;  1I94 E;  3T1Y I;  1ZM3 A;  1VIS A;  4AQY E;  4JI6 E;  1HNW I;  5LMN E;  1Z5C A;  3ZZ0 A;  4ZVI A;  1ZM2 A;  1ELO A;  1RRE A;  4X65 I;  4K0K E;  3J7A G;  4MYU A;  1FJG I;  4HAC B;  2DEJ A;  1HR0 E;  4KQV A;  5LMU E;  4JI1 E;  2UXD E;  2UXC I;  4R1F A;  1BKN A;  3V2U C;  4OX9 E;  4DV7 E;  4FN5 A;  4LF5 I;  3V5R A;  1H7U A;  4PRV A;  4PU9 A;  3OTO I;  1B62 A;  3D4J A;  1XNR I;  1S16 A;  4LF8 E;  4JI2 I;  4DPY A;  1IBM I;  2E5L E;  1NHJ A;  1MG7 A;  1N36 E;  2X36 A;  4HXZ A;  4LFB I;  3LTO A;  1H7S A;  3J80 Q;  4DPW A;  4LFA I;  1U2R A;  3K1J A;  4LFC I;  4X65 E;  4WUC A;  3ZM7 A;  1N34 I;  1J5E E;  1FJG E;  4DR4 I;  1UEK A;  4B3T I;  2UUA E;  3QT7 A;  4UTG A;  2VQF E;  1EA6 A;  1N32 I;  2UXC E;  4YY3 I;  4DUZ I;  4FWG A;  2UUC I;  4NXN I;  1D6T A;  4DXL A;  2HK2 A;  1Z0T A;  3OTO E;  4LF7 I;  1XNR E;  4JI2 E;  1IBM E;  1FI4 A;  4JI6 I;  4DR1 E;  2VQE I;  4DV4 I;  4GKK E;  1N0U A;  5LL6 R;  2V2Z A;  4X66 I;  5GMD A;  4LFB E;  1OJ4 A;  4LFA E;  4DPX A;  5LMU I;  4LFC E;  1N34 E;  4DR4 E;  4DV0 E;  2CZ9 A;  5A2Q Q;  3J81 C;  1KKH A;  4B3T E;  2X7I A;  4WUB A;  5GME A;  4DPU A;  4YY3 E;  1Z0V A;  4DV3 E;  2V8P A;  2F4V I;  3ZZU A;  2UUC E;  4Z7Y A;  4DV5 E;  4Z7C A;  1EI1 A;  1ZXN A;  1FNM A;  4JI3 I;  1KVK A;  3B8H A;  2VQE E;  4DV4 E;  1N33 E;  3WU6 A;  2HFU A;  5IT9 Q;  4WUD A;  4KHP I;  1Z0W A;  1FWL A;  2E1R A;  1IBK I;  4RPF A;  4X66 E;  5FLX C;  2R42 A;  3WU4 A;  1J5E I;  3Q1Q A;  3QT6 A;  2Q2E B;  4DV2 I;  2UUA I;  2VQF I;  3PYF A;  3HUL A;  1PVG A;  4M1K A;  4X62 I;  2BM1 A;  2V2Q A;  2F4V E;  4PRX A;  1QZR A;  4JI8 I;  4DR6 I;  1XMO E;  1ZXM A;  4DR1 I;  4B3S I;  4GKK I;  2HKJ A;  4JI3 E;  2HKE A;  1XNQ I;  1HNX I;  4KHP E;  1IBK E;  4JV5 I;  1ZM4 A;  2HK3 A;  4DV0 I;  4JG4 A;  1HNZ I;  4DV2 E;  1S4E A;  4JI5 I;  4DV3 I;  1MX0 A;  3B78 A;  4X62 E;  4DR5 I;  4DV5 I;  3LNU A;  2OI2 A;  4ED4 A;  4EMD A;  4DPT A;  4JI8 E;  4DR6 E;  3WU3 A;  3PYD A;  1N33 I;  3J80 C;  1Z0B A;  4B3S E;  1XNQ E;  1HNX E;  3ZKD A;  1NZ0 A;  2A2C A;  4JV5 E;  3QT5 A;  4USK A;  3H4L A;  1DAR A;  4FWH A;  1IBL E;  1NHI A;  3JAM Q;  1HNZ E;  4HAC A;  4GKJ I;  3LPS A;  4FW9 A;  4DU8 A;  1XMQ E;  1Z0G A;  1Z0C A;  4JI5 E;  2DEI A;  3WU5 A;  2A2D A;  3T1H I;  4DR5 E;  1ZM9 A;  1B63 A;  4URL A;  1XMO I;  4JI0 I;  2V34 A;  3ZZT A;  2ZBK B;  4USM A;  4DV1 I;  4JYA I;  1XHK A;  1H73 A;  1NHH A;  2BV3 A;  2UU9 I;  5A2Q C;  4LF4 I;  1K47 A;  3QT8 A;  4DUY I; 
#chains in the Genus database with same CATH topology
 2HYI B;  3KG4 A;  4LSL B;  2QEX S;  4ETX A;  2LA4 A;  4A8K A;  1WDT A;  3DC2 A;  2ASD A;  1PAE X;  2A18 A;  2RDD A;  2YWK A;  5IT9 C;  1FE4 A;  4QWD A;  2F8H A;  5F8L A;  1RAH B;  3GG0 A;  4ZS6 A;  1VRU A;  2C2R A;  4EFA C;  1SQF A;  2LJP A;  1JLF A;  2VPZ B;  2QT7 A;  1AA1 B;  1T05 A;  1K44 A;  1SQG A;  1NSQ A;  4HKQ A;  3RG6 A;  3W2W A;  1DRZ A;  1UPM B;  5KFX A;  3IM8 A;  2KYZ A;  1XNQ J;  4RW7 B;  1FKA E;  2JH3 A;  3K58 A;  1JJ4 A;  3TAM B;  5KT7 A;  4LF2 A;  4NLQ A;  2A10 A;  2RSQ A;  1VLY A;  2DNH A;  3QQC D;  2MJU A;  4QWA A;  3POT B;  3PW0 A;  4NCA A;  3FSX A;  2IVY A;  1HHS A;  4L74 A;  4X64 I;  5GAE U;  4J9O A;  2Y3Y A;  4L76 A;  1VQ7 S;  2B4P A;  2NR0 A;  2J9D E;  4GVB A;  1S9E B;  2MHE A;  3K0J A;  3NG8 A;  1XWL A;  1TMM A;  4RBU A;  1FER A;  2DNP A;  1ZH5 A;  3BO4 A;  3HHL A;  3A8K A;  4B3O B;  2LDY A;  2ZM6 E;  1H74 A;  1PO6 A;  4WBF A;  2XB2 D;  2OEK A;  1YIT S;  1S9G B;  2EW9 A;  3EZU A;  4J9Q A;  3MF5 A;  2NPF A;  2VDI A;  4LF6 E;  4NA2 A;  5LMN E;  1ZM2 A;  4DLG A;  3DM2 B;  4ES2 A;  3GME A;  5DGB A;  3SSR A;  3QLH B;  3GR0 A;  1T9Y A;  2F3J A;  5CAB A;  2QL7 B;  4IFD B;  3IM9 A;  3DRS A;  3N5B A;  3LUY A;  3Q83 A;  4RUC A;  4P74 A;  1FF2 A;  1NHJ A;  1KOH A;  4F02 A;  5K36 A;  3R8Y A;  2FHJ D;  3R5J B;  5KFB A;  2VHG A;  4IH6 A;  2PNM A;  4IFD D;  1RT2 B;  4KR0 B;  2BUN A;  3MWB A;  1PJ7 A;  2G9O A;  1FJG E;  4PCQ A;  1RA7 A;  4OL8 A;  3ZZZ A;  2XY6 A;  1JLC A;  4K50 A;  2UUB J;  4RJV A;  5C0X E;  2BJ8 A;  2V5H G;  1HBM A;  4D3H A;  1YJ7 A;  2H5I B;  4NRT A;  2DNO A;  4PWU A;  1XJW B;  4YR2 A;  5HL7 Q;  3CJR A;  2AEJ A;  5DZ7 A;  3ZTQ A;  2F8E X;  4W98 A;  2GHW A;  4X4Q A;  3JTP A;  3MED B;  1VQK S;  1QSL A;  2HLT A;  4EBE A;  5HO4 A;  3MM6 A;  2HHH J;  1Y00 A;  1OJ4 A;  1VQO S;  4ZJO A;  2EC0 A;  1EB0 A;  4ELT A;  3W5Z A;  4LFA E;  2QN6 B;  1FJE B;  1XQI A;  2XI2 A;  2H9Z A;  2PO4 A;  3NOC A;  4UQG A;  4OI0 A;  1U45 A;  1OYR A;  1OO0 B;  1YBT A;  2RKI A;  2RF2 A;  4I2Q A;  4F4X A;  2EG2 A;  3SZ2 A;  2HQG A;  4MK8 A;  2IYI A;  1RT7 B;  4AT1 B;  3IFE A;  1YDL A;  3Q8U A;  3GPA A;  3G8T A;  2E1R A;  3F73 A;  2O1T A;  4DV7 J;  1IKV B;  3CCJ S;  3QT6 A;  5CQG A;  4DL4 A;  1YSJ A;  3SSQ A;  3PFO A;  2C38 B;  2LU2 A;  3PRV A;  2ILY A;  3R5C A;  1NJI T;  2I6W A;  1RBO B;  4ALZ A;  3DI6 A;  2KT3 A;  2CG9 A;  3MCN A;  1K9M T;  3BGR A;  3W7B A;  3BBF A;  4Y2M A;  4OLO A;  2FHO B;  4B3S I;  4DUT A;  2C37 B;  1VQ8 S;  5HVH A;  3BSC A;  4M5H A;  2PA3 A;  3CO0 P;  3G86 A;  2DKO B;  4OHX A;  2CDR B;  1N5Q A;  1WSV A;  3BPD A;  4FPR A;  1TVR B;  4DEZ A;  1DUR A;  3NAH A;  4P2M A;  4OJ1 A;  3M2U A;  1TL3 B;  1S6Q B;  2VG7 B;  5DRR A;  3IS9 B;  5HI7 A;  3N6L A;  3FGV A;  2B9E A;  1CVJ A;  1T9W A;  3S7R A;  2BKP A;  3TAP A;  4ZVF A;  4YY3 J;  1NZ0 A;  1HWK A;  2G2O A;  2M52 A;  4FW5 A;  4ZVG A;  2UUW A;  3EYZ A;  4HAC A;  1WDD A;  2HHS A;  3NEK A;  2DEI A;  2WB1 D;  2H1Y A;  4DSF A;  2LCW A;  3DLB A;  5CD4 A;  1U25 A;  5LOQ A;  1NEE A;  1N48 A;  2VV5 A;  3M9O B;  2DD8 S;  2VFV A;  4U7U K;  2ZBK B;  1KD1 T;  4GVL A;  2Z0G A;  1CJK B;  4KQZ A;  4QYZ K;  3BBB A;  4C8N A;  1NHH A;  4MQY A;  4C0O C;  1H7W A;  1HNW F;  1V9O A;  2H4Y B;  3MAH A;  4NLD A;  2E9R X;  3FEX B;  2CJB A;  3CDB A;  3TUI C;  2ZE2 B;  3CCS S;  4DUY I;  1Q8B A;  2ZBP A;  2QIF A;  3H59 A;  4FXW A;  5GAH I;  3MEG B;  2DNQ A;  4X4T A;  4RR5 A;  3T1H E;  5KG1 A;  2XCA A;  1B7Y B;  5CD4 H;  1PKP A;  4CTA A;  1E6V A;  3CJ8 A;  4ED0 A;  4C3M A;  2JC0 A;  4B9N A;  4UT4 A;  1YHQ S;  3PVX A;  2YWE A;  2OTL S;  3CNQ P;  3CW2 C;  1A6F A;  5KFG A;  2KJW A;  4YDD B;  1MU5 A;  4B9V A;  1SC1 B;  2J8A A;  3GON A;  1FRK A;  2CNK B;  2R7V A;  2BAN B;  2UV8 G;  3P3G A;  4FNH A;  2RRA A;  4LF7 F;  4ZIT A;  2FVS A;  1H72 C;  4U6P A;  1T03 B;  2MZT A;  2OPR B;  1VQ4 S;  4Y00 A;  4FW7 A;  2K1R B;  4OHZ A;  2JOQ A;  3OW2 R;  4M5N A;  1R0C B;  4M5L A;  1LWC B;  2RAQ A;  3UVJ B;  3MEC A;  4P7A A;  5DO2 A;  4OZJ A;  4OHW A;  2GJI A;  3KK1 A;  2BA1 G;  3I5A A;  1FK9 A;  5ETS A;  3J81 Y;  4ZP6 A;  3R2D J;  3ILJ A;  3G2X A;  4AL7 A;  5AXL A;  1RWU A;  5JEA A;  3HFK A;  1BY9 A;  2B3T B;  1VGY A;  3UCG A;  3VZH A;  4CLF A;  3SV3 A;  4C8L A;  2VG6 A;  4JI0 J;  3ZZ0 A;  1OSD A;  3A12 A;  3NBP B;  4OYB A;  3A13 A;  2XY7 A;  2VAS A;  1UVN A;  3JYT B;  5IC6 B;  3JSM A;  2CQC A;  3CSK A;  1YJV A;  4DR1 F;  2RS8 A;  1ZET A;  1CS4 B;  1X60 A;  4OYZ A;  2BJ1 A;  4K7Q A;  4RW4 B;  1LV5 A;  2CGE A;  2K3K A;  3TX8 A;  2IJR A;  3GIL A;  3G6X A;  3WC0 A;  2EC2 A;  3ZM7 A;  3J7Y I;  3D1H A;  2PFD A;  3MD1 A;  1HWI A;  2AX0 A;  4J91 A;  4DR3 J;  2JEI A;  3KG1 A;  4BDP A;  3P5B P;  3Q89 A;  3Q8Y A;  3QO9 B;  1MU2 A;  4Q45 A;  2C3M A;  5SZT A;  3V6D A;  1NJX A;  3V4I B;  3OHA A;  3D67 A;  3JSB A;  3KMQ A;  4OZ3 A;  5DRK A;  2W9B B;  3FFI A;  2OML A;  2XYH B;  4DPX A;  3OVB A;  2ADC A;  4J3D A;  2V63 A;  3NGD A;  5HLF A;  2JVR A;  3RGI A;  1C0U A;  2VG5 A;  3GCM A;  2HQC A;  3ZC4 A;  4TYB A;  3JSR A;  2RQM A;  3BEG B;  4DL7 A;  3D66 A;  3V81 B;  4WK3 A;  1QLN A;  5J1E B;  3ONQ A;  4Y6I A;  3TUP A;  4WKY A;  1SL0 A;  1MRO B;  5L1L A;  5C2C A;  4DFM A;  4LRE A;  3QRP A;  2BMB A;  3TJA A;  2GA7 A;  4NLU A;  1SJF A;  3VZI A;  3Q1Q A;  4ZPV R;  5A2Q Y;  2Q2E B;  2PFF B;  3FCH A;  1B0V A;  4TU8 A;  1NKC A;  1PVG A;  1NCL A;  2B8P A;  1UWB A;  3H2U B;  1RAD B;  6AT1 B;  3THV A;  1UFL A;  2G2Y A;  3HSG A;  3AOD A;  3GP9 A;  1Q78 A;  1H2T Z;  4ZKA A;  4JP8 A;  1DLO A;  3UCZ P;  2V8V A;  2UZA A;  3R6L B;  3FMB A;  1FNO A;  4DOZ A;  3OTE A;  2RVJ A;  1S1X A;  3CVK A;  4F50 A;  2IY5 B;  2FD2 A;  1TL7 A;  2M8D B;  4KGZ B;  3HSZ A;  2ZH3 A;  4QIG A;  3F44 A;  4E8U A;  3C19 A;  4J9L A;  3SDE A;  1RT6 B;  1YWX A;  2AF6 A;  1REV B;  4DR4 J;  3L7Z A;  4QWC A;  2WTF A;  2NXN A;  4B3T J;  3IA0 A;  1DJ0 A;  3K57 A;  4B02 A;  4CNZ A;  4MFB B;  2A2C A;  3QT5 A;  4EWT A;  2HWH A;  2PGC A;  4OX8 A;  3I82 A;  4FW9 A;  4NLS A;  2W9A A;  2R7R A;  3DRR B;  4DU8 A;  1VC0 A;  2O3Z A;  2MQQ A;  3WBZ A;  1T9U A;  1WOP A;  2LDI A;  3M4X A;  1KSP A;  4PRF A;  5KG7 A;  3X1L B;  2LEP A;  2QLW A;  4JYA I;  4FVM A;  4KO0 A;  2GC8 A;  1WTB A;  2UVV A;  3FK4 A;  1W26 A;  5DDR C;  2UU9 I;  4JOU A;  3D7S B;  2W2O P;  4V19 X;  2RNE A;  4ECT A;  3FNN A;  2JJ4 D;  4FS2 A;  1R8C A;  3DLH A;  4LR8 A;  2OMO A;  3Q23 A;  3RZA A;  3EVO A;  4IZK B;  1EKS A;  1AZS A;  4FYX B;  1VQS A;  2MKK A;  5CH7 B;  4HH0 A;  5BR8 I;  5DDO C;  2R7X A;  1R8A A;  2ZIT A;  1NB2 A;  1BLU A;  1HNW E;  3GFZ A;  4LPF A;  1VJQ A;  4QIV A;  4I2P B;  4P2S A;  2AJ2 A;  1WG4 A;  4JV5 J;  4NLO A;  3P3C A;  4C6A A;  2C3O A;  4LF9 I;  4G1Q B;  2RUS A;  3IMQ J;  1H38 A;  1NHV A;  5DRQ A;  4YEA A;  1OY8 A;  1UJ5 A;  1DQA A;  2CUY A;  3OJU A;  3UNY A;  4FF1 A;  1SC4 B;  4QR0 A;  1X5T A;  4DR5 J;  1FXR A;  3RJM B;  1GNK A;  5LMU F;  2FLN A;  5KAK A;  5A8K B;  2HRU A;  1LWF A;  2ASY A;  1HL6 A;  1U0H A;  5IM0 A;  2D3U A;  4K0K I;  4DV7 F;  3LP0 A;  2GO3 A;  2NRE A;  4JI1 I;  1U26 A;  2BX6 A;  3UNG C;  5IT4 A;  3IRX B;  2DNG A;  5HP1 A;  3B6B A;  3R5B A;  1VFJ A;  4CLW A;  1RR9 A;  4PUO B;  4YR3 A;  4P52 A;  1RLD A;  4LF7 E;  3WC2 A;  5FDL B;  1H98 A;  1Q5V A;  3P8B B;  2DCL A;  5GAE I;  1HNW I;  2GQ0 A;  1UW4 A;  3ILO A;  4C0H A;  2VON A;  3VGU A;  4O23 A;  3DHW C;  5D15 A;  3OFF A;  1F60 B;  1Z2Z A;  2X3D A;  5GAD U;  2CIM A;  1N88 A;  3PX4 A;  4KFB A;  1MW7 A;  5H9E K;  2CQG A;  2Z57 B;  3IG1 A;  2MKH A;  3MZI A;  4YY3 F;  4DR7 J;  4LFC I;  3BGU A;  1NLK L;  1Y5I B;  4P2F A;  1R6V A;  2R4F A;  2XCP A;  1EX8 A;  2O3D A;  2KFN A;  1URR A;  5HJY A;  3H90 A;  4LF7 I;  3KLG A;  2NCK L;  3TVY A;  1FI4 A;  1CJT A;  4DR1 E;  2M88 A;  3DOL B;  3HKW A;  3J80 Y;  4X66 I;  2FIU A;  3DOM B;  3CTR A;  3NMA A;  4QR2 A;  3SCK E;  4ID5 B;  2IAJ B;  3CDE A;  4RU9 A;  2CQD A;  5FLX U;  1IKY B;  1I94 J;  1MWY A;  1WEX A;  5M2U A;  3OT9 A;  1PAU B;  3HZG A;  2FYX A;  2MKJ A;  5KFU A;  3M8Q B;  3A8J A;  4Q43 A;  3M6X A;  2LXI A;  1D3W A;  3B8H A;  4QBU A;  1U1L A;  2K7K A;  2BQU A;  3NS7 B;  3I0R A;  4WII A;  3AQP A;  4A8S A;  1C1C A;  5CZV A;  3VWS A;  3GFY A;  4GQU A;  4CYU A;  4LF8 J;  2NZC A;  3PRD A;  1FVQ A;  3ZTR A;  4R0E A;  4EK2 A;  4J5O A;  1TP7 A;  1YRU A;  3NWG A;  5KFV A;  2QA4 S;  4FYW B;  4C11 A;  4I68 A;  3D9B A;  4Z37 A;  4DR1 I;  5HQM A;  2C2O B;  4WU2 A;  3GCW P;  4BA2 B;  1GFW B;  3CCW A;  1I51 B;  4RBT A;  2R7W A;  4ED1 A;  4ZVP B;  2UVU A;  5A8W B;  3N01 A;  1WHW A;  5BXI A;  3OTO J;  1Y3K A;  2C2N A;  3KMS A;  4BWJ A;  3H1C A;  1OYP A;  5J2P B;  4FPI A;  4NRU A;  5J2N B;  4B17 A;  2J0S D;  1A6L A;  3HJF A;  3CJS A;  2I8E A;  3KLF B;  2LQ5 A;  1KLN A;  2FPH X;  2PNZ A;  1Z0B A;  3R3T A;  2D41 A;  1FKO B;  4FXD A;  1HNV A;  1XNQ E;  4IG3 B;  3IBC B;  5KFR A;  3AB4 B;  4LRB A;  1YG0 A;  2YY3 A;  2XM3 A;  4M5G A;  4F4Z A;  2C2M B;  3AD8 C;  1Y10 A;  4HEA 9;  1Z0G A;  1Z0C A;  5GAG U;  2H51 B;  4JI0 F;  4XDC A;  1Y9O A;  1QE1 A;  2V34 A;  4NLV A;  4DV1 I;  3A4T A;  2B4V A;  2XG8 A;  2Y0B B;  3T1Y F;  2AIR B;  1HWJ A;  3GSD A;  3HT0 A;  5FJ4 A;  1CC7 A;  2F5G A;  2FLP A;  3CCV S;  4USV A;  3PW7 A;  3UCU P;  3CJK A;  2J9C A;  2ACY A;  2FJE B;  4H4M B;  3R5A A;  1S99 A;  1DTT A;  4B3M I;  5D4P A;  4HI2 A;  1EQ0 A;  2D9P A;  1NK8 A;  4BHQ A;  5DG8 A;  2HNY B;  3LP2 A;  1EZZ B;  2YX1 A;  4OZ0 A;  3PFE A;  5J1N A;  4R5P B;  1C1B A;  3Q8S B;  3CJT A;  4DFP A;  2HIQ A;  1R0A A;  2R2U A;  3I96 A;  2HFN A;  2DGO A;  5T41 A;  1F9F A;  2MKY A;  1HLW A;  3PM9 A;  1URN A;  4CDI A;  3NRB A;  4A8Q A;  2WOM A;  5CCL A;  3U27 A;  3C6U B;  3J7A 1;  1X4D A;  3I4H X;  4KPY A;  4ZDN A;  2H5E A;  1P1L A;  4USU A;  3B82 A;  2MKI A;  4NXN