3HULA

Structure of putative homoserine kinase thrb from listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
277
Chain Sequence
b'SLRIRVPATTANLGPGFDSCGLALTLYLTLDIGAEADSWYIEHNIGGGIPHDETNVIIETALNLAPNLTPHHLVMTCDIPPARGLGSSSAAVVAGIELANTLAELNLSKEEKVRIAAEIEGHPDNVAPAVLGNWVVGAKLDGEDFYVRHLFPCALIAFIPKAELLPDTLPFKEAVQASSIANVMIAAILRNDMTLAGEMMERDLWSQLVPHLAQIRDVAKNQGAYAACLSGAGPTVLVFAPRNLANKLQTSLQTLEIDADVLLLDVEGSGAEVFREG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine kinase
publication title Structure of putative homoserine kinase thrB from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 75
structure length 277
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.1.39: Homoserine kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3hulA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hulA01
2V2ZA 3T1YE 1RR9A 2WW4A 3J80C 1Z0VA 4DPTA 2DEJA 1EA6A 1NZ0A 2ZM6I 4DV0I 2V2VA 3V5RA 4JI2I 4NXME 4PRXA 1Z0BA 4URLA 2DEIA 2UUBI 4JI7E 1S16A 2BM1A 2R3VA 4Z7YA 4DUYE 3H4LA 4X66I 1HNWI 4JI6I 1N32I 1XNRI 4LF9I 2E5LE 4JI3I 1DARA 2Q2EB 3T1HI 4LF4I 4KHPI 1NHHA 1I94E 5BR8E 2HK2A 4DV7E 4FWGA 5A2QC 3CWVA 5A2QQ 3ZZTA 1XMQE 4FN5A 4OX9I 2OI2A 5FLXC 3PYFA 1N0UA 2VQEI 4NXMI 1Z0TA 4JI7I 4DUYI 1XMOE 4DPWA 1B63A 4UT4A 4B3RE 4LFAE 4P52A 3OTOI 4LFBI 1A6FA 1IBME 4USMA 2UUAE 1J5EI 5LL6R 4DR3E 1VISA 4YHHE 5BR8I 1IBLE 4DV7I 1Z0EA 3JAMC 3JAMQ 1IBKE 2GS8A 4HXZA 1N33E 4ED4A 4AQYI 4JV5E 4X62I 1XNQE 3J81C 1FWLA 4B3SI 3J81Q 4FWDA 2UU9E 4X64E 2AJ4A 4GKKE 4DV1I 4B3ME 4NXNE 2UXCI 4DR5I 2EFGA 4JI4I 2VQFE 2HHHE 3D4JA 4DR2E 4FWHA 5IWAE 4R1FA 1XMOI 1BKNA 3WU3A 1HR0E 2HFUA 1PVGA 4LFCE 1UEKA 4JI8E 4ZVIA 1N34I 1FNMA 4B3TE 4MYTA 1IBMI 4DR4I 4DUZE 5GMDA 3QT7A 4PRVA 1EI1A 1KVKA 3B82A 1NHJA 4DV3E 4JI5E 3B8HA 1N33I 1MX0A 4LF8E 4DR7I 2E1RA 1XNQI 2BV3A 1H74A 4X64I 2HKEA 3QT5A 1RREA 1Z0GA 2HKJA 4GKKI 2A2CA 1HNXE 4JYAI 4DV4E 4JI1E 1ZXNA 2V8PA 4B3MI 1FJGI 4NXNI 3Q1QA 4YY3I 4LF6E 5GMEA 2XEXA 5IWAI 3QT6A 1ELOA 2UXBE 1NHIA 1PIEA 5LMNE 4DR6E 3HULA 1U2RA 3B78A 3PYEA 3T1YI 4P7AA 4B3TI 4DUZI 1HNZE 2BM0A 5IT9C 3LTOA 4DV5E 3LNUA 5IT9Q 4LF5E 3K1JA 3LPSA 1K47A 4DU8A 2F4VE 2CZ9A 2J7KA 1FWKA 3WU5A 4JI1I 1H72C 4DV6E 4MYUA 1H73A 2E5LI 3PYGA 1N36E 1I94I 4LF7E 4DR6I 4M1KA 2LJPA 4JI0E 1XMQI 2UUCE 1HNZI 1XHKA 1KKHA 4LF5I 3ZZ0A 2HK3A 4HACB 4DV0E 2ZM6E 4GKJE 4JI2E 2R42A 5L3JA 4DV2E 1Z0WA 4K0KE 4B3RI 1ZM2A 3F0NA 3V2UC 1Z5BA 4WUCA 4LFAI 5LMUE 2NPFA 2HFSA 4X66E 4JI6E 2UUAI 1WUUA 2V2QA 4DR3I 1XNRE 4YHHI 1IBLI 4JG4A 4LF9E 2ZITA 4JI3E 1MG7A 1IBKI 4LF4E 4DPYA 4JI0I 4KHPE 1B62A 4JV5I 2V34A 1H7UA 1ZM9A 4DR1E 2UU9I 4DXLA 3ZM7A 1QZRA 2A2DA 3WU4A 3J80Q 3ZZUA 4OX9E 4HY1A 4GKJI 1ZM4A 2VQEE 2VQFI 2HHHI 4DU7A 1Z59A 4DR2I 4DV2I 1FKAE 4K0KI 1HR0I 4LFCI 2UXDE 4JI8I 1Z5AA 2X7IA 4HYMA 5LMUI 4UTGA 2VF3A 4DPUA 4Z7CA 1OJ4A 3OTOE 1ZM3A 4LFBE 1J5EE 1FI4A 4DV3I 4JI5I 3K17A 4LF8I 3PYDA 3ZKDA 4EMDA 4DR1I 2X36A 4XTJA 4AQYE 1HNXI 1ZXMA 4DV4I 4X62E 5FLXQ 4KQVA 4B3SE 3J7AG 4LF6I 1KIJA 3WU6A 4PU9A 4DV1E 1PKPA 2UXBI 2UXCE 4DR5E 4JI4E 5LMNI 2UXDI 4X65E 1Z5CA 1Z0CA 4DV5I 4DR7E 1N34E 3J7AM 4DR4E 1KTVA 1D6TA 3QT8A 2F4VI 2ZBKB 3GONA 1MU5A 3ZKBA 4WUDA 4WUBA 2UUBE 4DV6I 4DPXA 1N0VC 1HNWE 4JYAE 1FJGE 4USKA 1N36I 4RPFA 3M6AA 4YY3E 1N32E 4LF7I 4X65I 1H7SA 3T1HE 4I3HA 1S4EA 2UUCI 4HACA 4FW9A
chains in the Genus database with same CATH superfamily
2V2ZA 4L72B 1UTAA 3QWPA 3J80C 2FJXA 3KLHA 3M32A 3BH6B 1UW4A 3D5MA 3RBEA 4JI2I 5B0EA 1KLMA 1TVRB 2MY8A 3GCWP 2X51A 3DLKA 1JKHB 3PW4A 2WB4A 3Q8VA 3E8OA 2ZM6J 4RW6A 2M2BA 3BGRA 3TP2A 5FLXY 1VBXA 2GIRA 3GIKA 6AT1B 1I6JA 1DTTA 3VF0B 2HW3A 2XBPA 2AYBA 3I9ZA 5HI7A 1DARA 1RAJA 4F2SA 1I94E 2DRAA 4UQGA 2HBYB 5KFCA 3GIJA 3PS2A 2MQMA 2VBXA 2W4DA 4OX9I 2M3DA 2CIMA 3G9CA 4NXMI 4QIEA 1CC8A 1S1UB 4N76A 2EVZA 4ECXA 2VQFF 3EM1A 3EPGA 3NAHA 5ETMA 2V68A 1RT7A 1U0SA 1NJZA 2NN6C 3AB2B 2H3EB 2ZH8A 2LECA 3TX8A 2LKZA 3N5BA 4RZRA 2OAUA 2HHSA 1EQ0A 1XR7A 1YX2A 2FPHX 3SYZA 2AJ4A 3MTJA 1SXLA 2WNRA 2IVFB 3TNVA 1DQ9A 2W7PA 1F9FA 1S49A 3QSIA 4ILRA 4F8RA 2MYFA 5JEAB 2HFUA 2YKQA 1JNZB 3CF5Q 3KJVB 4KE5A 1MSWD 2VOOA 3QRRA 1HBOB 4DFJA 2WRMA 3HT0A 5HBMB 2RKIB 3Q83A 2J0QD 2XCAA 1S6QB 2PSZA 2FUG9 2MY7A 2ZH4A 5K9FA 1R6LA 4WU3A 1FD2A 1I51B 4YY3I 2MJNA 3A4TA 5KT4A 3QT6A 1FRHA 4OMFG 1T3OA 2POKA 1Z2LA 4JYAJ 3N5FA 3B6BA 1S7IA 3MGJA 1RQ0A 3DRPB 2DNNA 5D78A 5KT2A 2Y3YA 4E2FB 3HVTA 2BACA 4ZPVR 3J7A1 3KLIA 2DO4A 3T5HA 4DU8A 2HNDA 2Z5BB 2Q43A 3BB5A 5H9EJ 5IT9U 1RWPB 5F3TA 1C4CA 4AL5A 1H72C 5ADZA 5JJBA 4ELUA 3T9NA 3GJQB 2FC8A 2UUTA 3IR5B 1TKZB 3A3NB 1D9DA 1VK8A 2M8HA 4CCHA 2OPPB 4OLPA 4DV4J 1U1RA 3EWGA 4QYRA 1Y3KA 4GO7X 1RTDB 2XSJB 2N4DA 1HHTP 4HLBA 4B08A 3KFWX 5CABA 2B5JB 2IJNA 4DV0E 2E7XA 4EBEA 2Q79A 4AE5A 1P1TA 1U1MA 2CG9A 3M32B 3FCVA 3D28A 5I4MA 2DISA 4MKBA 4B3RI 3FSIA 1SL0A 1WC4A 3DLKB 4ID5A 1J2VA 4OO1C 4RW6B 1XNRE 3G8QA 1HFEL 3BGRB 4LFBF 3PXGa 1NJWA 1DTTB 5B0FA 4CLTA 4IFDC 4DSLA 1T9XA 5B0AA 4WIIA 1S5ZA 1S57A 1R3NA 1V9OA 2QLWA 2QLXA 3MR3A 4O0NA 4JP8A 1RXOB 1XMOF 3HP6A 4K50A 5K36C 1VQYA 2HHHJ 3U02A 4DV2J 1RT7B 2QEXS 2MLYA 1ZM3A 3Q8RB 4K0KJ 2LU2A 3EVMA 2G0IA 1FKOA 2GVZA 2JLFA 1AROP 1SB6A 5I42B 1U1PA 2JL9A 3G6VA 4OKGA 4OV6A 3BPSP 5FLXQ 3EICA 3MAQA 4DV1E 1X0PA 2XWYA 3A3PB 2DNHA 1Q7LB 2WNRB 2UVUA 2HBZB 3GTYX 4OJ1A 2YQ0A 4HL9A 4LRBA 2WBRA 4LREA 4KV8A 3BZQA 2E9RX 2UXDJ 2I2YA 1L3TA 2XMAA 3H20A 3TJ8A 3H40A 2VL1A 4UZBA 4FXWA 1HW8A 1U2FA 2JEAA 1RTHA 3PJXA 4WFAQ 1RBOB 4LF7I 5ELWA 1X5TA 1WC1A 4DR6F 1IKXA 5IV4A 1R8AA 3MCOA 1S0OA 3WX4A 3QZ7A 3DDIA 3EDQB 1YJVA 1RP5A 4U9RA 5DO2A 1NZ0A 5EKWA 2WVFA 2BA9A 2HVDA 2CVEA 2RB7A 3RB0A 5D4OA 3CDJA 3HVTB 1Z0BA 3KLIB 3U1YA 4IH6A 1PJ6A 2HNDB 4ZCIA 4FS1A 3OSPA 1S0MA 2W7OA 2E5LE 4OHXA 5HANA 3RRGA 4DR3F 5GVQA 4N5SA 1XEZA 3TI0A 2WAQD 3C6TB 1T9UA 3RAMA 2ACYA 3ZZTA 4JV5F 2DNLA 5FJ4A 3NKYA 2YNIA 3LF0A 1JLQA 3KDNA 2DNRA 4YB5A 5G0RA 2OKQA 4C7QA 4QWEA 4AXJA 2XO7A 3VQTA 3W5XA 3NBPA 5GAGU 1M1KT 3GJTB 4C8MA 1R0CB 2Z8QA 1FNOA 4DSJA 4ZVOB 1R0BG 3OTOI 1NRKA 3HFZB 4JBCA 4USMA 3I5CA 3M7NG 4DUYJ 4ID5B 4LRCA 4PPZA 3WIVA 2HNZA 3CJ0A 5B0CA 4DWIA 1TL3A 2R7SA 4JI5F 4HXZA 1N33E 3CO9A 2GIFA 1X4FA 4ZVHA 4RNFA 3MD1A 3FEZA 4DV7J 4HYKA 4DR5I 3DN9A 2CFXA 3WBZA 1D3WA 4AQYJ 3JSRA 2IYGA 5JEAF 3VVTA 3KG1A 1QUPA 3POTA 5HMYA 1NK6A 2B6AA 4C8OA 1FXDA 4B3TE 3UD5A 1IQZA 5CD4H 3CCRS 2ZHOA 3EPIA 2DHSA 4PRVA 1U7LA 4B3RJ 3QPIA 2E9TA 1FWPA 4GO5X 2F4VF 1FKOB 3JB9k 5A6WA 2B43A 2HIQA 3CD0A 2HQIA 3NEKA 4P6QA 2CNKB 1SJQA 5KFFA 2J8SA 2C2DA 1PIEA 1U2RA 4LBPA 4HDHA 2G1DA 3ISNC 3R2DJ 4X65F 4W4MA 2ACMA 1U6ZA 2UUCF 3SXLA 2CJBA 4I56A 4FW6A 1EQMA 1OYEA 2EKYA 2J6TA 3GIRA 4KV8B 4ED6A 2OEMA 2H4WB 3A1YG 3KUEA 2XGQA 2ATLA 3TUPA 2IY5B 2UUBF 4KIAA 2W01A 4ED2A 4DX7A 4X66F 1O6XA 4DN0A 5KT6A 4ELTA 2JEAB 5EWFA 1RTHB 1HIYA 3T1HF 1R8CA 4JI0E 3S7RA 1W7WA 2CWXA 2XMWA 4CO5A 4O3OA 3CXCR 4J3DA 3UR3C 1WC6A 2R42A 1PILA 3LAKA 2ZH1A 1JLFA 1USUA 1NKEA 5E0OA 4ZS6A 3M9OB 5CD4A 5C2GA 4JI6E 5C42A 2NQPA 1M5OC 4RUBA 3R8YA 3MPVA 4M5JA 4HT5A 5D0GA 3BO2A 1Z1ZA 3PFEA 3EJMA 4HT7A 3A8IA 4N7TA 2VBZA 1YQHA 2YNIB 4B9SA 3SIPB 1JLQB 3V6JA 1BY9A 3DCAA 3HPOA 2QV6A 5G0RB 2ZDPA 2ZNYA 4GKJJ 1FJEB 3NBPB 6FD1A 1N34F 2I1RA 4LPFA 4FF3A 4MJKA 1HR0J 2IOPA 2AX0A 4LF8I 3M7VA 4ZP6A 1MU2A 1Q5YA 1Q79A 2JFKA 4C8YA 4KR0B 3W9JA 2DR8A 2HNZB 2NS1B 1A0OB 1PAEX 4X62E 1TL3B 4ZP7A 5BJRA 4GKKF 4UOGA 2KB2A 2B51A 1KIJA 4P7VA 4B3MF 2KXFA 1SCJB 4DR1J 2BR0A 1QUVA 4ATNA 3I9V9 2G2YA 2EPIA 1IM6A 3POTB 2ERRA 4KGMA 2WSFC 5K8MA 2ALYB 4XPEA 2JEGA 2KFZA 4I7FA 4ED3A 4X4PA 4IKAA 1EIYB 2FB0A 3ADAC 1UKUA 4LCFA 3MM7B 2U1AA 1R0AA 3FMBA 1ZBTA 2CDRB 1L3VA 4V19X 4ZVQB 3MOZA 2DIVA 4TNOA 1N6QA 3BQ1A 1VQNS 5MLCV 4KT0C 4TU9A 3NS7B 4USKA 1VBKA 3M6AA 3TOQA 4PG4A 4WWSA 2V4JA 1N32E 4FW4A 4YB7A 2YWFA 1U6FA 2BA1D 2OIHA 4ZN1A 2V69A 5B08A 3KHRA 1EA6A 1HQEA 4I2QA 3OSNA 4DL5A 3LAMA 3HCXA 3JSYA 3D0GE 5KT3A 4KPYA 2IA0A 3V6DA 3HMJG 1HLWA 2GQQA 2NN6D 2E5IA 4HR2A 5KT7A 2CADA 4LFAF 3UVJA 2XS7A 1VHFA 1PKUA 1YBTA 2OPSA 3ILJA 1Y10A 3W5YA 4FWGA 1C0UB 3CWVA 2BOPA 3J7YU 1S1TA 3HHLC 2YKMA 4G3IA 4KHPJ 2B4VA 4TYBA 3K57A 3HSJA 2IMWP 4NLSA 2P9EA 4NL5A 2MKIA 2YQ3A 1EHWA 1YDLA 4J37A 1VC0A 1JLFB 3T5LA 1RWWB 5EHHA 4TLRA 2ZH2A 3W7BA 3OFHA 3JAMC 5C42B 4F7VA 4DV3F 2ASDA 2ZBPA 1HK7A 4Q44A 3HT3A 3K0JA 3HFKA 5DLGA 1TMJA 2NN6A 4CT8A 4NXNE 4NLGA 2VQFE 4P2MA 3T1AA 2CJKA 4KHMA 3Q6NA 3J81U 4M5HA 2JEIA 2UXCJ 3Q2SC 2CNOB 3QT7A 5HQLA 4OX7A 5ETRA 1L3SA 1N33I 4IZJD 1FFSB 1W2IA 1YJ7A 3MCMA 1MU2B 2HKJA 4H4MA 2KYXA 3VGSA 2PEBA 1ELOA 5A76A 4A48A 4M95A 2VDIA 1UVLA 5DLFA 4B3TI 3GLJA 1MW7A 4QYZJ 3RW7A 2OLWA 2OPQA 5IWAJ 4KGVB 4WTOB 4NWBA 5DROA 4JB8B 4HTIA 2UV8A 2FLLA 2IJFA 2AJ2A 1URRA 3T1YJ 3JAMY 3ICLA 4LF1A 2CQ2A 1HNIB 4I7FB 3ZC4A 4LBIA 3HSZA 2ZHAA 1FWKA 1X9MA 1R0AB 1IBCB 2IJRA 4LF8J 1OO0B 3JS9A 2Y1IA 3W2VB 1UJ6A 4LF9F 3IWXA 1MNEA 4IFDD 1WG5A 4JI1J 2V4JB 4IZJA 1RAEB 4O3RA 3H5SA 1R8HA 2V0NA 4G1IA 4YOEA 2NSCA 2PNZA 3RU0A 4RKUC 1HQEB 4I2QB 2B4UA 4RUCA 4P2XA 3KHLA 1TKTB 1RT6B 1GMVA 1JMTA 4OZ2A 2DXFA 3RW6A 3V6DB 2V2QA 4DJBA 3UWTA 3AA8A 3OTCA 3UVJB 4JI0I 4G1PA 4GRSA 3A8KA 5J2NB 4DZDA 2OPSB 3PJWA 4HKQA 2NZCA 3MMJA 4C98A 1Y4ZB 1IBLJ 3NGSA 4OZ5A 3GR1A 4HY1A 5GAHI 1S1TB 4NYOA 4USWA 3HDSA 4OO1A 1QSSA 4C4WA 3WDOA 4DR2I 2YKMB 5HL7Q 5AJ3F 4A4JA 4A8MP 1SL1A 4KBIA 1OYPA 4IFDA 4OFZA 4RW7A 3LA0A 1BQMA 4LFBE 1XQIA 2RF2A 3AY0A 1KOHA 4ENOA 1JJ2R 3MCSA 1WHXA 3PTWA 3K8VA 1XNQF 3MMBA 2GHVC 4CNZA 5K36A 2B56A 4KQVA 1URNA 4B3SE 2KO1A 3H5YA 5GMKa 1IWGA 2NN6B 2RS2A 2W8LA 1B70B 4F50A 4H54A 2JDJA 4O4GA 4CO2A 1SKWA 3FUYA 2O66A 1S4FA 1FX2A 2QA1A 4ED5A 2ZC3A 2GQ2A 3EDRB 4O0IA 5D15A 4DV5J 1O5JA 2LXIA 4RNOA 2HLUA 3QRPA 1RHRB 1DQAA 2VZ9A 2F5GA 1FRJA 1RT5A 2C2RA 1FVQA 4H4MB 1YZ7A 3I5BA 3HJFA 5HJYA 3TO8A 2EK1A 4BC9A 2ZUGA 3TA1A 3VAJA 2CNNB 3QFHA 3PS3A 5KFNA 3T41A 2HSEB 2V8HA 1WKJA 5LSRA 1JJHA 5E5NA 3KDOA 3MM6A 3N79A 2B4PA 1PGZA 1O8BA 2V8VA 2XYHB 3LWLA 1N32I 3IG1A 2DR7A 3CJ4A 4CP5A 4LF4I 1NHHA 2R7TA 2C2ZB 1Y5LB 2CQBA 2B9WA 1T05A 2XNQA 2FVRA 5DRPA 2CQGA 3GFZA 4NLWA 1N0UA 4IZJB 2GJIA 1VBZA 4BCAA 1CJTA 3EE3A 1FTRA 5A2QU 5F8NA 2GHWA 3HKZD 2PNZB 1M1GA 1FD8A 3ZFVA 1IJFB 4ECQA 3O5TB 3L7OA 2EKNA 1LK5A 3NLCA 2VOPA 3PX0A 4DR3E 3JAMQ 3OR2A 5CQGA 1LWFA 1G2EA 3RB3A 2XZWA 3R5CA 4JV5E 4L6V3 1FESA 1FE4A 3K58A 4QU7A 2UU9E 1R6YA 2RHQB 2QSFA 4DV4F 2FC9A 5KFRA 3M8RA 1FKAF 3ISND 3WU3A 2IM1A 4OO1B 2DNOA 4LFCE 1VQ7S 3K8WA 4MH8A 2FHMA 1D0EA 5H9EK 4F02A 4LVOP 3BF4A 3HSGA 4DR4I 4DUZE 5GMDA 4OYIA 2VASA 3FDSA 4IFDB 3M6UA 4Q7AA 4RW7B 1BQMB 1YH8A 3GIIA 4JI5E 3B8HA 1RHQB 4DQRA 2RF2B 2E5HA 2DCUB 2LQBA 1FX4A 4F4WA 1NHVA 5F9LA 4LRFA 4K4XA 2V8PA 4NXNI 3Q1QA 2GMJA 1IR2A 5EX3A 2ZE2A 3MMBB 5K36B 1N36F 2XSFA 1QAYA 4X64J 2C2KB 3UE2A 3ZTSA 2ROPA 1YJ9S 3C8YA 1AUSL 3SFGA 3J7Z5 3DDKA 2CJ9A 3HJVA 4MU4A 1GH8A 2FJEB 4K8RA 4FYYB 1UPPA 4O4GB 4RU2A 4PG7A 1FXRA 4OHVA 5L9NA 2GMHA 2O67A 1EZZB 3PR5B 4JI2F 2F4VE 2AF6A 1YITS 1HI1A 3ILIA 5K14A 4DX6A 2CQHA 2E5GA 4WK3A 2KG1A 1B3TA 5JXSA 2Z4PA 3PW0A 4C9DA 3Q8PB 4ISAA 2KRBA 3AHPA 1RT5B 3OLAA 2LJPA 2APOA 1IQTA 2UUCE 3ISZA 4ED8A 2BJ3A 3BREA 3PO4A 2FVCA 1Y4SA 4OX9F 2ZWOA 1FFGB 3N01A 1WELA 4NXMF 4KYZA 4USTA 1HNZJ 2OP5A 3V4MA 4LF5J 2VFSA 1QE1A 4ALZA 3NGUA 4YFUA 2NPFA 3MM6B 4X66E 2NXUA 2CPXA 4P72A 5GADI 4MKVA 3AA9A 1IBKI 3IG1B 2W7AA 4AD6A 2CA9A 2PT0A 4OI0A 1TK8A 3L7UA 1TELA 4A8SA 5J1NA 2Z0GA 4L74A 2ZKUA 2NSBA 2L3MA 1QY7A 4KAIA 2CQ1A 1K1QA 1CJTB 2JSXA 2EBGA 2YY3A 3IXQA 2JEFA 2F65A 4N3OA 3HD1A 1QVGR 1EKRA 5AE3A 3C66A 3KK3A 2IERA 1HW9A 5HMXA 1YJUA 1RADB 2XLJA 1NK9A 3OVAA 3QAUA 4MK9A 2R4FA 1NXIA 3RRKA 1ZZNA 3OR2B 1LWFB 4IYQA 3TZYA 2GVDB 2QA4G 3J7AG 2I8EA 4C97A 1RISA 3CJRA 2QX0A 4YY3F 3P3EA 1OWXA 2UV8G 3TA2A 2AEMA 2NN6F 3NOGA 2CZ4A 3MF5A 1Y5IB 2CAJA 3RAXA 2HS0A 2VG6A 2MJUA 2YWKA 1N34E 3TRGA 3MECA 2ZH5A 5KFJA 3QT8A 4F26A 1B4SA 2RNEA 3GONA 3DU5A 3LPEA 4E98A 2IDEA 3ZO7A 3CMQA 1K44A 5M2RA 1DAXA 1P42A 2J0XA 4OYXA 1YLXA 3OVSA 4Q8FA 2CVIA 2BQ3A 2VG5A 1SC1B 2ZE2B 3HHLD 3ZZOA 3TUZC 2WZ1A 2P9GA 1RAHB 4OYMA 2VV5A 1U1QA 3L3CA 2HVHA 4L3KA 2BW7A 3NL0A 4ZP8A 5AT1B 2E1PA 3E2EA 2MKHA 3D6FB 2KHCA 2CYYA 3L9ZA 4CLZA 5F8JA 3OW2R 1T9WA 2VC1A 1PBUA 5K14B 4XDDA 3G6XA 2V5HG 8RUCA 1TL4A 3FC9A 3ZZZA 4PQUB 3LP2A 3UCZP 1TL7A 1DZ5A 5F8LA 4F4XA 3CT9A 1FRMA 2F4FA 3GE9A 3RB4A 4I67A 2VJUA 2VQEI 4K4ZA 3M8WA 5IOLA 3KRNA 3M2UA 4U3DA 5DRKA 2DNYA 5C0XE 2RH3A 4UY8T 5DZ7A 1CEZA 4DOZA 2HQGA 2RU3A 1DHMA 3HHLA 4LFAE 1JLBB 2FTRA 1Y3JA 1IBME 3MPUB 1FJCA 4JI7J 2ZZMA 1BC6A 2R7UA 3NNCA 1RTZA 1XWLA 2MPUA 1X4AA 3UN3A 4I1TA 2V4QA 1IR1A 4H4KA 1YK9A 4QQBA 3W8PA 4F3MA 3CCWA 4R5PA 1U1LA 1NSPA 4ZJQA 3HFVA 2BRKA 2J7UA 2IOQA 2VPYB 4EYIB 3CE8A 2ZVSA 4R1FA 1JIHA 3FRZA 1BKNA 1VOMA 1Q81T 1U8WA 1IJEB 4WKYA 4PXCA 2KL8A 4YDXA 1QAIA 4DFKA 1WF0A 4IFDF 2HQDA 4J9UE 4IUFA 4PPDA 4DV3E 4OZ0A 4KJIA 3KK3B 4M5MA 2E5JA 2G0CA 4UOHA 3PFOA 1RWKB 5KFOA 1AFIA 4RUHA 4DEZA 4A47A 4J9SA 2MKJA 3KMSA 4PZVA 1FJGI 3TJAA 3PEHA 5HSPA 2XEXA 3I4PA 5K36F 1T11A 3W1YC 2HQ3A 2GO4A 2UXBE 2QC3A 5C24A 4LF7F 3I32A 1KC8T 2U2FA 4DUZI 4FZVA 2KT5A 2A1BA 4NI2A 2MZTA 5A8KA 4ZLLA 2ROGA 2CQPA 2N3LA 5A8WA 3MM5A 3L7ZA 4DL2A 4FYVB 2CZ9A 4NMLA 4U7UD 4DX5A 1DQ8A 1SC4B 1UA1A 5LOQA 3K89A 4ANDA 3Q8UA 2K7JA 3P6YC 2IA6A 1WF2A 1T9VA 4IQMA 1PCAA 2WONA 2AHOB 1XMQI 3OL8A 3NGRA 3ZZ0A 1I94J 1L3UA 3CSKA 2ASLA 3M4XA 4WF9Q 3MAHA 4IR9A 2DY9A 3EXCX 4NLUA 1NM2A 2X1FA 1Z5BA 1O0PA 1NK7A 5LMUE 5GAGI 2HFSA 2F8MA 4P7TA 1WUUA 5KFBA 4YHHI 3OTOF 4LF9E 1OY9A 4X4SA 2ZITA 3PHTA 3QQCD 2R8KA 3QJPA 3CDEA 2Y0BB 3Q2TC 1M5HA 3H5XA 4EZ6A 4KGKA 3LP2B 2MQOA 3SDEA 1VQOS 1TL7B 3SV4A 2MKCA 5FWKA 2W2OP 2BZ2A 2E44A 3NMAA 1H0HB 5JUMA 4DR5F 4Y3CA 3W61A 4JI8I 2QMUB 3M2UB 2J7WA 5CAAA 3UDEA 5L39A 2RUGA 4B9MA 5A6PA 2BW2A 3TVYA 1FDNA 3HHLB 4O3NA 3DDNA 2OO4A 3GG0A 4EMDA 3NY0A 3QGHA 4FW5A 1Q0NA 5JVHQ 4DQSA 3LW5C 2B7BB 1APSA 1FHTA 3VHQA 2WCXA 4R5PB 1K9MT 4LSZB 1M5VC 2KM8C 2ABYA 4X4UA 5BYRA 2VQEJ 5E3CA 2QZ8A 2DR9A 2AMCB 2DY1A 2ZOGA 4CZCA 2M8DB 3D3CJ 2L9NA 3AD9C 1WDTA 4URSA 4M5DA 4CO1A 2E1MC 1N0VC 1KQKA 4MK8A 4NCAA 3SBMA 5CCMA 3EYZA 5C24B 3HXMA 4K59A 2VICA 4LJMA 4NI2B 3CCUS 5A8KB 4J9LA 3CNQP 5A8WB 5ITHA 3L7ZB 2IFXA 1X4HA 5LL6d 4QIVA 1H2VZ 4MIWA 1LXJA 5CCLA 3DFEA 2Q2EB 2IPOB 5C0XC 4BLGA 1HNWJ 1N56A 4PKDB 1UETA 1LW0B 1XNRJ 1WKKA 3NCRA 2CPHA 3IRWP 1AZSA 1YRUA 2WONB 4LQ3A 2RUSA 1KFDA 2VESA 4CLWA 3FBCA 5DJBA 3OUYA 2DGTA 2HMIA 5HVFA 2CXEA 4EUVA 4M5NA 2VDHA 5F8IA 4DL6A 2MHNA 3FK4A 3HHNB 4CLUA 3B4MA 3GILA 2CPIA 2HZAA 5GAEI 1X60A 3BBFA 3CCJS 4LRAA 2Z2ZA 5KG6A 2GS8A 4CLKA 1H3DA 4NE9C 2G9OA 4C8NA 4DFPA 5BR8J 4QYZK 2Z2LA 2F63A 3C14B 3SDEB 1SH0A 3JQMA 2QLFB 1XMQJ 3D4JA 1RYRA 1AUDA 5KFHA 3FEXB 4ZVIA 4DV1J 5F41A 1FNMA 2VB6A 2YPYA 1IBMI 1CQMA 4Y2AA 4ZCLA 4ZIWA 1KEKA 4GMKA 1U48A 3I6PA 2CG4A 2R7QA 2HYIB 5AXMA 2JC0A 1MMDA 2BV3A 1LW2A 4OYBA 4YHHJ 1VQ9S 4DV4E 3BR8A 2XMUA 3R6LB 4QNKA 2DNGA 2WW8A 2GNKA 1TFYA 5KFMA 4IRDA 4ANCA 2PEHA 2YKAA 3QYYA 3K5MA 1S59A 2MKYA 1U6BA 1SC6A 2C2OB 3EUNA 4CIOA 2CJYB 3DMJB 5KFTA 3CDUA 1KQSR 2IM2A 1EJ7L 1K47A 4M8LA 1C1CA 2KU7A 3BR9A 1VQLS 2K1RA 4B9LA 5U47A 3M6WA 3T5KA 3N9UC 2RJZA 2PFFB 3EMTA 3GR0A 2AJQA 4MYUA 2GO8A 2UUWA 1H73A 1Y4UA 3CDWA 3PYGA 4M5DB 1N36E 3MTKA 5KFSA 2BJ9A 4ZVEA 3CCMS 4N47A 1NSQA 5E41A 4TY8A 4QCLA 3TANA 4F67A 1CULA 4NLYA 3MEEA 4LSLA 1XHKA 1FCAA 2E5LJ 1U8SA 3CCSS 1UVNA 2MLZA 3J7YI 3MR5A 5F0UA 3I5AA 2XY7A 4YB1P 4F4YA 1F3VA 2J0WA 4JI2E 4K4VA 4DV2E 3CCES 3I82A 5KFYA 1YKWA 4K0KE 2W2QP 2D9OA 3GIMA 3C16A 3G2XA 4K4WA 2UUAI 1TKDA 2AGPA 5D0EA 3UPFA 3FQLA 3KYLA 1ROFA 4NZ0A 2WSCC 4OZLA 4EWTA 1W26A 2GCFA 3DGPA 4NLDA 1JX4A 1KHWA 4DXLA 4DCPB 3WU4A 1NJYA 4OX9E 2O1VA 1BWEA 2HURA 1AZSB 2C39A 2DT9A 1I5OB 3KUHA 2UXDE 1ZETA 3AAWB 3L7PA 3OUYB 4C0BA 5DZ6A 5LMUI 2HMIB 3FJ2A 4JV0A 2LXFA 2QL5B 4PWUA 2YX1A 1HWJA 3NZKA 4CTAB 1FE0A 3BO3A 4OX6A 2QL9B 3BGUA 2GA7A 3PS1A 1N33F 2Q6CA 1NPRA 1HNXI 2RQMA 2CKWA 4G1QB 2W2MP 4OLOA 5IFMA 3U1MA 4FP9A 2AP6A 1TKXA 1WG1A 5LMNI 1KLNA 2E7VA 3MMCA 4CM0A 1Z0CA 1SIWB 4PCQA 4MK7A 1P27B 1XK8A 1P8GA 1E6VA 1RK8A 4B3TF 2GZOA 3WZ0A 1C2PA 4HHHA 4P73A 4NX9A 4OZEA 4RO0A 2R8GA 4BWJA 4ICLA 4O3QA 3OV7A 3CCLS 2QE5A 2ZBRA 4ZCMA 4DV6I 3PCOB 2VKRA 5F8MA 2RQ4A 4X4VA 1LW2B 3CJ5A 5B7WA 4YY3E 3CWJA 1ICEB 4DF4A 2W2NP 4FVCA 4U6PA 1IR0A 3R5AA 5KTQA 3EGWB 4K4YA 3RB6A 2V9KA 1NSAA 5F9NA 1BD6A 2IVMA 4PR6A 2ZM6I 4I68A 2Q1LA 5D77A 3G6ES 5B09A 1RJJA 4J9KA 5IXUA 4DR7J 1F3FA 1QJHA 2Z5CA 2O3DA 4IO9Q 4XAKA 3TZWA 4DX8H 3BDPA 1WNEA 3VAMA 3H4LA 1C1CB 3J80U 4DUYE 2K1RB 4YQWA 3FBEA 3S6EA 4ZVSB 2CPEA 3I31A 2VPZB 5KOWA 4DV7E 4RNNA 2X3DA 4JI6J 4JI0F 2DNKA 4FYDA 4TY8B 1S9FA 4ES3A 3QJLA 4A8XA 1CULB 3AT1B 4LSLB 3MUTP 3CCVS 2DH7A 2HGLA 1M5PC 3ENVA 3VAKA 2GJ2A 4V1Ak 2LEPA 3LQVA 1X9SA 4DR2F 2YKPA 3PACA 1RU1A 2LA6A 4B3RE 1IUJA 2DO0A 1VQMS 5E3RA 2OD4A 3KMQA 3O6QA 3TEGA 1VJQA 1LWEA 3THPA 3J81j 4USHA 1P9YA 4N41A 3G8TA 4PAAA 4DMZA 1BLUA 4Y28C 4WJBA 2R7WA 3SCLE 5LM7E 4I6WA 4YS2A 4DS5A 4FWDA 2CZVC 3DHWC 4WE1A 1OPZA 1WORA 3IGNA 1R31A 3Q86A 3OBIA 4X62J 2HS3A 4KC5A 2C39B 1GFWB 1UEKA 2BA0G 3H25A 2VFUA 4Y2MA 1NHUA 3S01A 1N88A 1YRXA 1VRUA 3H7HB 1VLYA 3GMEA 4RNHA 2GC8A 2IM0A 1MX0A 1GAOA 2JZ5A 3IP0A 3BBCA 2JNJA 2K7KA 2MDAA 4FYXB 4WKRA 4JYAI 1ZYQA 4OJGA 3LP1A 4Y2IA 1HBUA 1RHKB 1JLEA 4FKYA 4P71A 3CVKA 1CQNA 1UDOA 4RBUA 4UF4A 3MFHA 2R9LA 3MMCB 4CT9A 2WVEA 3UDLA 1Q8IA 1ACMB 2AZ1A 3M85G 2DGWA 1VMBA 2HRTA 1E6VB 3KXDA 2XZDB 4YDDB 4QZVB 3MFIA 1DLOA 2J7KA 3HZEA 4ZVGA 3VV2B 1ZH5A 2R8JA 4ICLB 2C37A 4FW3A 4F2RA 1TUWA 1AXQA 3G86A 4ETZA 2E29A 4PUOA 1N32F 2HWHA 4NCGB 4LF7E 1TZ0A 1LKZA 3DM2B 2IDLA 2LP4A 3PIPQ 3H2VE 4LF4F 3R5JB 1Q86T 1SH3A 1TU0B 1UDNA 1MLAA 3MEGA 5LMNJ 2JLEA 1BHNA 4GKJE 2DXDA 3RGIA 1CJUA 3AJ2A 2B9EA 1Q8BA 2A0FB 1ZM2A 3RBDA 3H4BA 4WUCA 4DF8A 1T3NA 3V6HA 3HHDA 3NP5A 2NXEA 2Z5CB 3KJQB 3H2LA 1U4BA 4A8KA 3MMAA 3QNWB 3CJQA 2MKKA 4DV6J 2WVCA 2DCLA 4DR1E 1NHKL 2NYHA 2WVBA 4DI6A 3UW1A 3A3OB 2KYZA 3HZGA 3T9ZA 2HHHI 4DV2I 4WFBQ 3KLGA 4K0KI 2PO4A 1NK5A 2VQFJ 3KOAA 3GYGA 3OTOE 2HVZA 3CGIA 4DR4F 2RIJA 4QNJA 5F3ZA 1SQGA 4MQYA 3BM7A 5HMWA 2HZCA 4OV1A 1QM9A 1S6UA 2YWHA 1RACB 4EK2A 3IAM9 2OMOA 4NXNF 4W90B 4DR5E 2UXDI 3RG6A 4WE1B 3GJSB 3P5BP 3BS9A 4FS2A 1D8YA 3VVUA 9RUBA 4USUA 4AL7A 2LDIA 3K59A 3PRYA 2GO9A 4ZCKA 2AX1A 4I64A 3W2WA 3A8JA 2VONA 4ZJOA 4ZJLA 1D6TA 4PXBA 4MKYA 1B99A 1KDNA 1VRUB 4WUDA 1E3HA 3PW5A 3UDCA 2CQ0A 4WBFA 3J80Y 1FRKA 5A8RA 4OHYA 3GV7B 2DXEA 3DC2A 4PXEA 4C6AA 1Q8LA 5C0XD 2BMBA 2D74B 3UCGA 3LP1B 1F6TA 1HBUB 4AM3A 1WI6A 2PO1A 3D66A 1JLEB 3AXKA 2M52A 2L41A 4CLFA 1RR9A 4CWBA 2WK4A 4ECWA 3MAAA 4PWDA 1HA1A 2XYGB 1UCNA 3VAIA 4KB7A 1HWIA 4PRXA 1WD6A 3UR0A 3H1CA 2H5JB 5KFZA 4MIBA 3DHXA 5KG7A 1YBAA 3SCIE 4BC7A 1DLOB 5ETVA 3VTIA 3IS9A 4X4TA 2C37B 4CH7A 3O8WA 3WQPA 1KBRA 4LMZA 1Y00A 2RDDA 4RWWA 2HG4A 4C2MA 1IBKF 4PUOB 1H98A 4ZVFA 4FN5A 1FEHA 3D1OA 3GV8B 1S1VA 1VHIA 1LFWA 4USIA 4EFAC 1XC9A 2VPWB 3MEGB 3CDBA 1TUGB 3MR6A 2XC9A 5C0XA 3UI3A 4Q5VA 2DYAA 3PV8A 5D4NA 4DUYI 2HFZA 3AQPA 4F0KA 3CCZA 1CJUB 4WXWA 4B02A 5M2PA 2G0JA 2XTJP 1IKVA 5KG5A 3PO5A 1PYTA 1J5EI 1M5SA 4DV7I 2PNMA 5DM7Q 2QTWA 3W63A 3O2IA 2HNYB 3PKYA 3LGMA 5LXRA 3R5GA 4AQYI 1C0TA 1AW0A 3MMAB 2BX6A 4GQUA 4DFMA 1VIXA 1RAAB 2K3IA 2R2TA 3KLHB 4HVZA 5IWAE 1HBMA 2N3OA 1NZ8A 1KLMB 1FTCA 4E0DA 5ETKA 3R7NB 3KLGB 1ZA1B 1DBDA 1KHVA 3MPDA 1FK9A 4M5IA 5DGBA 2N7CA 1XMOJ 1HARA 2DGOA 4LF8E 1NUEA 1HD0A 1UAWA 4B17A 2GAGC 1N5SA 2RDIA 2KT3A 4TQSA 4JI1E 3JYTA 3BPDA 4B3SF 4WFYA 4RL1A 1NLKL 1H6KX 3QO9A 3GWCA 2LCWA 2OH2A 4C8LA 3OTEA 3FFIA 1X4BA 5J2PA 2FHOB 4IFYA 4RU9A 2HQCA 4NPOA 2FZKB 1XMBA 1UL3A 3W2WB 1YJTA 2XYPB 1F0XA 3GSIA 2ADBA 1NB7A 2KM8B 2ASJA 5A8RB 4K4UA 3LGHA 2W9BA 1S7HA 2B8QA 4ZN3A 4UUWA 1QLNA 2JHEA 4UOFA 2PO1B 2VFVA 4DR6J 4OYOA 3DLJA 1BQXA 3SQGA 1OSDA 3M9MB 4QU6A 2KJWA 1IKYA 4PWDB 2DKOB 3F0NA 3HF5A 5T7LA 3OVBA 2WTFA 3PVXA 7FDRA 4AIMA 1R89A 3TEHB 3GYNA 4CI0B 4HTJA 1D09B 3D9BA 2J76E 2R8IA 4A8WA 3P8BB 3FMWA 3IS9B 3D6TB 2VPXB 4DR3J 3IM9A 3J80Q 1Q8KA 3PDNA 4GKJI 2GX8A 1YHQS 2ZNZA 3O44A 4JV5J 1HQ2A 5ETNA 1S1VB 3KLEA 1HR0I 5DG7A 1YHCA 2HAIA 3HJCA 2VFTA 4MU3A 4PEOA 2WOMA 4NLQA 4UTGA 5C0XB 2FJBB 1Z4UA 2D9PA 3UCUP 4PQAA 2RRNA 1IKVB 3IBCB 2D3OR 1UVJA 2B4OA 2DK2A 4DR1I 2EG2A 4LVNP 1CSJA 2JX2A 3IRXA 3TQ1A 2WBMA 1F2GA 2UU9F 1TP7A 4JI5J 1KQGB 1C0TB 2C2EA 1FJGF 4NEYA 3JTOA 2P2CB 4A8OA 4WP3A 1Z5CA 4PWWA 4LFCF 2W9CA 1A6LA 2FHKA 4U96A 1HBMB 4RBVA 3KK1A 3OLBA 4DUZF 4LF2A 1X9WA 1S1XA 4CLSA 4FPIA 4XTTA 1UFKA 1FK9B 4LRDA 4I69A 1OYSA 2OEJA 4HDGA 5F0WA 2NREA 1T9TA 4ZPAA 5EWGA 1J5EJ 4ZPWR 2JVOA 1CJVA 2RMLA 3BGFA 2F4VJ 3OTBA 3ZTOA 3V6KA 1B0PA 1UZHA 3JYTB 3OL7A 1NPKA 1KS2A 1EAYC 4F3OA 3QO9B 1HNVA 3GU0A 4DPTA 5CYJA 4X65J 4GC6A 5KOXA 2H48B 4NA1A 3D68A 3LANA 2XMTA 3P3DA 3OTDA 3MXHP 2UUCJ 3TJ9A 1VRQC 4IFYB 2JOQA 5CZVA 4X84A 4C3LA 1M1HA 2GVZB 2AD9A 2Y1JA 3KNAA 5D8HB 4Q2MA 2UUBJ 4KHPI 2MQ8A 1PC5A 2HK2A 2VA3A 4J5OA 4X66J 3GYXB 3ILOA 4AUKA 5KT5A 2W9BB 3CC7S 1U24A 3HI9A 4I4BA 2JVRA 3DNCA 5IS2A 3PYFA 7AT1B 3T1HJ 1U1NA 2EW9A 2ZOFA 2NYIA 5JMNA 5AXLA 3UD3P 3W5ZA 2MEWA 1RA7A 3AD8C 1IXKA 2NPIA 3SQGB 1NKBA 4JI8F 2Y1RI 1IKYB 1H7XA 3ENQA 5T7LB 3P06A 3PRBA 1FKPA 2HVEA 2NLWA 3BEGB 3DOMA 4ED4A 5I3PA 4TU8A 2O1UA 1Q78A 1VBYA 4X64E 1IKXB 2MKSA 1UZDA 1RBLA 2UXCI 3JAMU 2G13A 4DR2E 2O5DA 4QPXA 3AOCA 2L9DA 5E3AA 3BGOP 1REVA 3NWRA 2BQRA 4RW9A 2WOMB 2H54B 2Y9HA 3GQCA 3AJ1A 3N6NA 1JNRB 1HHQA 4G65A 1NHJA 1TUVA 5H9FK 1N34J 3I87A 4ZHRA 1MWYA 3QT5A 2LXUA 1B7FA 2A2CA 1VIOA 2PI5A 1XN9A 3ZTRA 1WSVA 2V8DA 4ZPBA 3IRXB 4K7QA 2QGFB 5IWAI 1WTBA 4LR9A 2DHXA 3KUGA 5HK4A 3HHEA 4GKKJ 2KVIA 2EXUA 3T1YI 1LEOA 4B3MJ 1RKJA 4URQU 1HNZE 2HGNA 1UWBA 5DRRA 4LF5E 2W9CB 1WC3A 3QBCA 3KK1B 4DL3A 2K2PA 4A8YA 3ET6A 3H42A 3BQ0A 5L9XA 1TL1A 5EL9A 4JI1I 2BEFA 1UPMB 2UZAA 5D0RA 5HP1A 1CJVB 2DITA 3N4WA 1CS4A 2HEKA 3C3LA 3VGTA 1SH2A 3R9LA 4DG1A 3X3UA 1HWKA 5GAHU 1QVFR 1ZAVA 3BJYA 4OL8A 1N5QA 2B6AB 1R8PA 3TQEA 1HNVB 2FQQB 1R43A 4U8VA 5E3QA 1O51A 2DPJA 2E7WA 2JT2A 3ZNJ1 4XIUA 1BXNA 4DQIA 2WHOA 3D1QA 3M8PA 2BR2A 1IBLI 4JG4A 4YP3A 1B64A 1HI8A 4ZOSA 4LF4E 3QWUA 5JVGQ 4B3OA 4F0HA 1NU4A 4K5RA 3T19A 2DHHA 2K06A 2EWHA 1S0VA 1DFDA 4DU7A 5ETOA 1OY6A 1LK7A 1G1XA 5L1IA 2PO0A 3K2YA 4MKAA 5C0XF 4C3KA 3CEDA 4QJVA 1YI2S 2Z2YB 3WC0A 2X1AA 5IQ6A 1NZAA 1SC3B 1ZZFA 1IBMF 2LEBA 1JKHA 4FBTA 1G3OA 1FKPB 4K2JA 1RWMB 4Z2XA 3DOMB 2FIUA 2DBBA 3OPKA 4DV3J 4Y2CA 1VS3A 4CYUA 2H51B 2QO3A 3ZTQA 3ZZYA 4C3MA 3IWNC 2KXHA 2NXCA 2BKPA 5L38A 3CIMA 2G2ZA 5DQHA 2H4YB 4DV5I 1BUXA 4DR4E 1REVB 3CD5A 3PZPA 2M7SA 4RW9B 3LOUA 3M2RA 2Y8YA 3OHBA 3C15A 1NDPA 3T5JA 3ZKBA 1LQ9A 4FF2A 2O1PA 3KHGA 4ZHRB 3E3XA 3RR7A 2XNRA 1Q53A 2FDNA 3E51A 2HGMA 4O3SA 2IRYA 1NEEA 2UXBF 1ZOTA 1VC6A 3D3BJ 1GX6A 2ILZA 2F9DA 2HZVA 1VQPS 4ED1A 4C0OC 1MROA 3TX0A 2C38A 4LSNA 4WP9A 1W2BR 5KG1A 1UWBB 2AYEA 2YWWA 4WFXA 2BXJA 3GPAA 1X5OA 1S77D 4IH5A 4JI7E 2C22A 1S16A 3ET6B 3FKBA 3HVRA 1KTQA 1RU2A 2RHSB 5EX0A 1TL1B 1T7PA 3BSOA 2UUAF 2HWIA 1Q1KA 3AJDA 5HP1B 1YSJA 4ILMA 2I6WA 1GMUA 2FJVA 3W64A 2P8IA 2O3ZA 4LF9J 3A13A 5FLXC 3T6BA 2DPIA 4DG1B 4R0EA 3H5UA 3JQKA 1FERA 1HMVA 4HHUA 3AXMA 2ZDOA 2BJ7A 2C2NA 3TAPA 1V5IB 4KGXB 2LFVA 2YNHA 4YEAA 4YMEA 1L3KA 4EBCA 2OHDA 1T94A 1TK5A 3BO4A 1B63A 5LJ5Y 3V4IA 5LMUF 4X4QA 5T14A 1N6QB 4O3PA 2IHR1 4CQ1A 1ZTWA 3H8YA 1IBKE 2KKHA 2V6AA 2BR2B 2YNFA 3W66A 3DRSA 2XULA 4UY85 2YX4A 3TA0A 1HNXF 4YR2A 5D0HA 4FXVA 4KQZA 4QPTA 2GJFA 2XG8A 3THVA 2XHCA 5LMNF 4J9QA 2B5JA 2QT7A 2PE8A 5AJ3J 2F8EX 3IR7B 2PO0B 1RHMB 3JTNA 4C0HA 1KSPA 1LXNA 2HWTA 4DSIA 5J1EA 2HFVA 3K5PA 4ZKAA 5THWA 4OI3A 1OPIA 2FLNA 2WP8A 2FD2A 4X64I 2HKEA 2YKOA 5A0YA 1U45A 3D7SB 2KG0A 2L08A 4DV6F 4IOCQ 3NNHA 1E3PA 2X1GA 5KFLA 2CNLB 1UEVA 1XNQJ 3CO0P 4CNYA 4CYUB 2PI4A 1RE1B 2E1CA 2OFGX 2AV5A 3UHMA 3ZTPA 1BQNA 3K1JA 3CJKA 1KN6A 5KFWA 2ZM6F 2XB2D 2X3GA 2HHPA 2OSQA 4HI1A 1DURA 2ZJRQ 5HATA 3QMQA 2DR5A 3M2RB 2VJVA 3C15B 5GADU 4QW8A 5HAOA 4OZJA 1U09A 3F44A 3MI7X 5I42A 1G7CB 3UQSA 1WDDA 2V67A 1FF2A 2ZOMA 2W25A 3QAEA 1PYSB 1HNZI 2ZZTA 1KKHA 4LF5I 2JE6A 1NDLA 4F04B 2ZJQQ 1JWWA 5HLFA 1MROB 2C38B 1FDBA 4LSNB 4DHVA 2IIHA 2VHGA 4B9UA 3X1LB 5KFKA 2RAQA 2I0XA 1RAFB 4DQQA 3DKDA 1NH7A 2J9CA 5ETPA 5CA5A 2LLZA 5B0BA 3Q89A 4MAKA 3GB0A 3TAQA 2PO2A 1NK4A 2HFOA 2PNLA 3F73A 1U1OA 3KLVA 4YR0A 2D1CA 1YJNS 1TV6A 3H90A 2VQEE 2VU5A 2OPQB 4LIWA 4DSKA 3M8SA 4FVMA 1XXEA 2HRUA 3NG8A 2E9ZA 1HMVB 5HVGA 4NLVA 4Z7CA 3NRBA 2YNHB 4J90A 3TZXA 2IAJA 1TAQA 3V4IB 3KJFB 1HQUA 3PYDA 1P1LA 4ZMMA 2DNPA 2VBWA 3NWGA 1F60B 1XIQA 1SQEA 2SXLA 2AKWB 1FDDA 2YNFB 4LF6I 3G82A 2O1WA 3DRSB 4JYAF 3WU6A 3C6TA 2XY5A 1RLDA 2PA8D 1JB0C 5F8GA 1M90T 3DOKA 2C1EB 1EB0A 2GO3A 2DB1A 4JOUA 3A8EA 2ZBQA 3JXOA 9ATCB 4ANEA 4GVLA 3GCMA 3BBBA 1SI9A 3WHIA 1SBRA 4KTQA 3AD7C 5J1EB 2DH9A 1KR4A 3K5OA 4PXDA 2P5VA 5LSOA 1HNWE 4IG0A 2WP8B 1FJGE 1VLOA 4TXSA 4X4OA 3M30A 5ETQA 5A0YB 4ECZA 3EGZA 3R5BA 4CO3A 2VG7A 2PIIA 4FW9A 3OJSA 1N36J 5L1LA 1N52B 2EFQA 3QSYB 3M9NB 5K20B 1BQNB 4CLYA 3CJKB 3KHHA 4URLA 4CLPA 1CJKA 2BM1A 2M0GB 4JI2J 1RWVB 1SV5A 2RE1A 2QMWA 2OSRA 2IRXA 3CD6S 1YRTA 3EGNA 4JI3I 1S10A 2FY8A 5BR8E 5DRQA 5CH7B 4EEYA 1WOPA 1U47A 3OXFA 1XMQE 3MPYA 1X8DA 2CQIA 1CVJA 4IDKA 5FIIA 2L9WA 2JE6B 3FBBA 1Z0TA 4JI7I 2HHHF 4CDIA 3TVKA 1NBEB 4DV2F 4OX9J 4A8FA 1R7IA 5HLFB 4K0KF 4TQRA 5FD1A 2MHEA 4NXMJ 2CDQA 1WJ9A 2Z30B 2HHWA 1C1BA 4IZKA 4YHHE 4B9VA 1WHVA 2LQ5A 1BGXT 2YNGA 1V3SA 1UW9A 5J2MA 1EARA 1F9EB 2PO2B 2HLTA 5KFUA 2BA1G 1JLAA 1VC5A 2QRRA 3P45B 2YPZA 4ELVA 4JI4I 2FY1A 3CJ3A 1SUQA 1TV6B 3MCNA 3OL6A 2UXDF 3OL9A 1YTYA 4JI8E 2GV1A 4RNMA 2AGQA 3BKFA 2ZH9A 1WKLA 4KO0A 1U02A 1ZAXA 2KT2A 3HX9A 2IAJB 1F2HA 4J7CA 1HQUB 1T05B 3OR1A 4CO4A 3GSDA 4O44A 1OY8A 4OI4A 3RAQA 4KKOA 3G82B 3HVWA 2W4CA 3JSBA 4Z37A 5BXIA 4P7AA 2CPYA 5LJ3Y 2JLGA 3QFWA 5E7OB 2J65A 4YY3J 2QA2A 2BM0A 5IT9C 3AB4B 3EXYA 5CYQA 3DOKB 2R7XA 1SJ4P 1J27A 4J9MA 3MDFA 2MGZA 5KFGA 3VCDA 4ECSA 3EVWA 3K85A 2XS2A 2HRYA 3VAFA 1N5VA 2Q3PA 3I96A 1I94I 1U0HA 3A12A 3D6HB 2V50A 4IG0B 1UDSA 1FVSA 3H0PA 1ITPA 2BOAA 3M30B 1P9QC 2EC2A 4LF6J 2ZBIA 1X5SA 2VG7B 3AH6A 2AJ1A 4NASA 4DN9A 2OEKA 3IM8A 2V63A 2CQ4A 4L75A 4I6AA 2J8AA 2QSWA 4RW4A 1GT8A 4ZPCA 3V2UC 4DUYF 1WF1A 1CJKB 2OFHX 3MM7A 1RCOB 5EGYA 2C3OA 3W60A 1SV5B 3DLGA 1J5EF 4DPYA 4DV7F 3UO0A 1HI0P 4HH0A 5LXYA 5IT9Y 4AQYF 3BN4A 1SKRA 1LFPA 2AW0A 3P5TL 1SKSA 2XMJA 1TR0A 5C2CA 2D69A 4NEZA 1BMQB 4IDKB 4DCJB 5LSLA 4I2PA 2X7IA 4M5KA 2VF3A 3KWMA 2XQCA 4B3RF 5G4DA 5D3GA 1V3RA 1LOUA 1MN7A 3IR6B 2VH7A 1HYSA 2LQ8A 2PMHA 3TWZA 2A3JA 5B0GA 1DRZA 1WACA 1T8EA 2CUYA 2XO6A 1C1BB 2QFIA 4IZKB 1JLGA 4UUXA 2VIHA 1OYRA 3KG0A 4C11A 1Q95G 4JI3J 2YNGB 3CCTA 2MZSA 5J2MB 1ZAWA 1PAUB 4DCOB 4ZIVA 1C0UA 2KZZA 2LQJA 2F1DA 1JLAB 2RRAA 1SUQB 2YTCA 4DR7E 4ZVPB 1QE1B 3OFEA 3R7BB 3SMZA 1DJ0A 3C6UA 2MSTA 1KTVA 4DSEA 4AIDA 4QWAA 3CIZA 4ZLNA 3SCKE 1S97A 2NUUG 4NLRA 1JJ4A 1MU5A 2MSSA 4KO0B 4WUBA 3GMGA 1S72S 4P9SA 2HHQA 2NR0A 5BYQA 3OR1B 1GNKA 2PC6A 3GJRB 2VUGA 2IBOA 1N48A 4O44B 2QG9B 3DXBA 4ZP9A 4KKOB 5KG3A 1A7GE 2CPDA 4IRKA 4JI4J 4IRCA 4LF7J 1Z0VA 3GCXP 2PGCA 4DV0I 3RJMB 2V2VA 3WIUA 2XI3A 3C19A 4ZLJA 3AOBA 1F9HA 5ETLA 5CYQB 1FDAA 1UEUA 4B9NA 2R3VA 2MGZB 1HNWI 3RBZA 2XCPA 5GAEU 2Z56B 1XNRI 3I0RA 1KRPA 5HN0A 3QGPA 3BGLA 2GQCA 1S76D 1MMNA 3M8YA 1RHUB 3U1KA 2Z5EA 1U0HB 1WSRA 5D6GA 1RWXB 3PKMA 3MOJB 1VYAA 2VG6B 1XERA 1TMMA 2ILYA 3QGGA 3W62A 1K8AT 4GKJF 3MECB 1GMWD 1RT1A 1YVFA 8AT1B 2XMKA 4QR0A 1QAXA 4WK1A 1FRIA 4NRUA 3DGVA 3AODA 1HR0F 2Q66A 4DPWA 4P75A 4UT4A 3THTA 3R6GB 1NAQA 1FRXA 4RW4B 3LWMA 1VCTA 2UUAE 3IA0A 1X7VA 1HNIA 3S8SA 3PG9A 2V4RA 5BR8I 3EVOA 3QRQA 2M70A 2KTQA 3SSQA 4USVA 2VG5B 3OTOJ 3DLGB 3BSNA 2ZJPQ 2CPZA 4DR1F 5D4PA 2HHUA 3HKMA 3W2VA 4DV1I 5IQQA 2ROEA 3IMQJ 2JH3A 2EFGA 1PBAA 5C25A 2LU1A 3OHAA 3DI6A 2KVQE 2OGUA 4OIXA 1PVGA 1YG0A 5HROA 1NKCA 2W4PA 3OJUA 4OJ3A 2Z2MA 1YBUA 2FLPA 2OPRA 4DR5J 4I2PB 4HI2A 2O01C 1IM4A 5D3GB 2ATCB 4FKXA 1FFWB 1TKTA 1RT6A 1HYSB 4WU2A 1J5OA 3BDEA 3K5LA 1GMWA 1WHYA 1B0VA 1RREA 3G71S 1HNXE 1RYSA 1ZXNA 1JLGB 2B0GA 3R3TA 1SJ3P 4WFZA 1KONA 4C11B 1SQFA 5HQ8A 2B7CB 3UDVA 5J2NA 1B0TA 3GP9A 5LMNE 3IC1A 5HJXA 4RBTA 1S48A 3LTOA 4UW2A 5IT9Q 3O1LA 3ILLA 1OIAA 3CJ8A 4FDFA 1NJXA 4KY3A 5EDWA 5IC6B 1CG2A 4O4RA 2XY6A 1SJFA 3C6UB 3R5DA 3Q8SB 3I56S 4H4KC 3G87A 1Y5YA 1ZTTA 4DV6E 3DXSX 2E5LI 1RWOB 3CDIA 2Z57B 3FCWA 1SJRA 3LH2S 3VGVA 4KHPF 3FZ2A 2PN6A 4ZITA 2ASYA 1RA6A 1S9GA 2LEAA 2EK6A 5DM6Q 4ECRA 2N7YA 4N8NA 1VI7A 4NA2A 2ZM6E 1B7YB 1R8BA 2MLXA 3M1VA 3ITHA 4IR1A 1KVJA 1AA1B 1Z0WA 2H1YA 1VQ6S 3MURP 2J5AA 5H1SV 5AXKA 4R8UA 1XR6A 4CM2A 3US5A 3QJJA 3NS5A 3ZZPA 1UWAA 1VGYA 2AZ3A 3BH7B 4LBHA 4R25A 1MG7A 3K7RA 3I0RB 4ITSA 4FYWB 2BABA 2HIYA 1ZM9A 4G6VB 2ZH7A 2F9JA 4CLLA 3GFXA 3Q24A 3ZZUA 2G4BA 2MQLA 1WC5A 3Q8YA 1ZA2B 2NXNA 3VQSA 4H4OA 1G6BA 2GGPA 2UXCF 1RT3A 4ZPTR 5K8OA 3MM5B 5B0DA 3DLEA 4HYMA 4DV0J 1VRTA 1RT1B 5HO4A 5DNLA 4Q45A 1OSCA 1T9YA 3EX7B 4P2SA 4OQJA 4N77A 2KH9A 3WX8A 2R8HA 7FD1A 2PA3A 4M5LA 5DDOC 1H38A 2B9YA 1EX8A 1FI4A 1X4DA 3ZKDA 1GTHA 3L09A 4QWCA 1V3ZA 1WHWA 4W98A 4KHRA 1AYEA 4U3BA 1TTHB 2E66A 2X36A 1UFWA 3OXGA 4XTJA 2AJFE 2J9DE 3H4DA 3P3CA 4EI2A 4OO1D 3U1NA 1FXLA 2K3KA 4QR2A 4PU9A 1PKPA 2BE7D 1QAJA 2HVIA 3RTVA 4Q2LA 5IWAF 4WIQA 2CJQA 4P2FA 5C25B 1YJRA 3DI6B 3T1YF 5ETSA 5HROB 2P9CA 2YKNA 5SZTA 4OYPA 1EETA 2OPRB 3HHKA 5EUHA 2D3O1 1HD1A 2ZBKB 1U1KA 4LF8F 2EI5A 4KPCA 1JQGA 5K36D 3RBXA 3RYLA 1J5OB 1RTJA 4JYAE 4JI1F 4LCHA 2FVSA 3HO1A 2JEBA 1AT1B 2HHXA 5K8PA 4M5GA 1WOOA 1S4EA 1GXTA 1RT4A 4HACA 4DR7I 1GXLA 3CB4A 3BN7A 2H5IB 2HFNA 4EO6A 3V5RA 2QJ3A 2N4CA 4PG6A 2MZ1A 4EO8A 4NYZA 1JJCB 4HHJA 3U7JA 4K4SA 4EBDA 2BRLA 4IFVA 4JI6I 2MQNA 2ZFHA 5I3UA 2FGCA 1H7WA 4ZK7M 1FT8A 4QR1A 3CPWR 1IBLF 1T0TV 3DOLA 3H59A 3NCQA 3KNGA 3QLHA 1HHSA 5DGAA 1I3OB 1S9GB 3IAS9 4ECVA 4Y34A 2DR6A 2AWZA 2VC0A 4OI2A 4NBQA 5KG0A 2FVPA 3KK2A 2N82B 3M1VB 3ITHB 3VGUA 1XMOE 1OMSA 4ER8A 3BQ2A 3CCQS 3ZNUA 2C42A 3IBFB 4RJVA 4R8UB 5LT5A 4BWMA 4FPRA 5EN1A 3CC2S 5LL6R 1RT2A 1VISA 2EFVA 3M8QA 3VR1A 1Z0EA 3H2UB 3NGTA 4AYBD 1LV5A 2G2OA 4EU0A 3PR4A 1D9AA 4X62I 3J81C 1FWLA 2QYGA 1S6OA 4K5SA 3UFCX 4P10A 2HHHE 1K0TA 3VALA 2CPJA 4H4OB 2GGPB 1SPBP 1RT3B 1Y0HA 3FSXA 4DSFA 3UN5A 3W9IA 3DLEB 4DV5F 1VRTB 2XM3A 2Z58B 4MTPA 2BE2A 3BKUA 4CH0S 1OQ6A 1R6VA 5DETA 2BANA 4TYAA 3MEKA 4FW7A 3R2CJ 1VQKS 1CC7A 3UD4P 1HL6A 2DHAA 3BYRA 2YXLA 1N33J 3LP0A 2QFJA 3GLLA 2R7RA 4DS4A 2BYCA 4DR6E 4QIGA 3W65A 4IOAQ 3MEDA 2R7OA 2AQ4A 2RU9A 2XZTB 3RZAA 3LNUA 1GEHA 3TR5A 3PIOQ 1D1UA 2KHDA 3TUIC 2AEFA 4B3TJ 2YKNB 4QWDA 1EETB 3RUBL 1RUSA 3J81Y 3DLBA 4LR8A 5T41A 1UP1A 2DGUA 4N8OA 3P49B 3MWBA 2VKZG 1RTJB 2LQ9A 1VK3A 3GFHA 3CMAS 1Y6ZA 2JEBB 1CLFA 3TUJC 3F56A 2GVDA 1XR5A 2NXJA 4NA3A 3MR7A 2XWXA 4Y00A 1RT4B 4HACB 2B8PA 1JXVA 2CRLA 4EYHB 1RHYA 3M05A 2DRBA 2CWKA 4X2BA 4NRTA 2HHVA 4WYLA 4TY9A 1RI7A 1YJWS 4YR3A 1X0FA 8ATCB 4QWBA 2DNQA 4C48A 4IFVB 5K8NA 4AFFA 1MMLA 4MU0A 3W8GA 4HEA9 1MN9A 5I3UB 2KFNA 1L5UA 2V34A 3BSCA 2CPFA 4Y65A 2ALZA 4AT1B 1BE4A 3LPYA 2RILA 4Q8EA 3DOLB 4LIRA 4KSEB 3D0HE 4JI0J 5L1JA 2VQFI 3CD7A 3QLHB 5JEAE 3OXLA 1R27B 2YQ1A 3VZHA 4FF4A 4ETXA 1JK9B 3C46A 2JC1A 3KK2B 2R2RA 1T02A 2PFDA 4LQ9A 2ZD1A 4DR2J 2XI2A 3I4HX 2AU0A 1FEEA 1N54B 3J7AN 2EG1A 1J5EE 3DLHA 3DRRA 2YVSA 2KJVA 4QIWD 2DVIA 1RT2B 2D3UA 3M8QB 1NSKL 4AQYE 4YUDA 2GAHC 1ZXMA 2OTJS 3W9HA 4X64F 3MEEB 4W92B 4PG5A 4PQUA 1X4CA 5AE1A 2NZ4A 3DYAA 1SJ1A 4X65E 3NAIA 1FO1A 1RB0A 5ETTA 4JUZA 3SCJE 1N4LA 2RQCA 5DQIA 3C16B 2CQDA 2YX7A 4J9RA 2PMWA 1RWNB 3GZ7A 3QZ8A 4PRFA 5DDPC 2BE2B 1JLBA 2F1FA 3OT9A 2UUBE 4BA1A 1UJ5A 4R0JA 1PG5B 4DPXA 4ED0A 2RS8A 2I38A 4OHWA 1KVIA 3VAGA 3DGPB 3DD6A 2BANB 2GHPA 1M0SA 5DNXA 2AT1B 4J9VA 3TZZA 4WYWA 2GIQA 3IFEA 3T1HE 2ZVIA 4X4RA 2FJWA 1VR6A 2KN4A 1OQ3A 3LP0B 1A9NB 3N28A 1AB8A 2WW4A 4E8UA 1HNZF 3MEDB 3P76A 1RWUA 2AYGA 3M6XA 4N56A 4LF5F 1FJ7A 4MFBA 1FRLA 2RDJA 2MTLA 2DEIA 3R97A 4NCBA 1TK0A 1SIZA 4IOBA 3SFUA 4FBUA 2A18A 4U8YA 4KH1B 4WTYA 1DTQA 1NH8A 1S6PA 4OZ3A 3NGDA 4NOHA 1TKXB 1UJ4A 2ZKTA 3G8SA 5A2QC 3VZIA 3OD2A 1N32J 4K2XA 3SEOA 3V81A 4LF4J 2I5JA 2DGSA 2WB1D 3H98A 1D9FA 1GX5A 5BYSA 3QIPA 5E33A 2PDAA 4BS2A 3BV8A 2M9KA 2IRUA 4LFBI 3FNNA 1A6FA 2JFDA 3FCHA 2V8GA 2IBKA 1RABB 3KJNB 1SKUB 1NO8A 1Y5NB 2YBVA 1N5TA 1Q4RA 4DDFA 2LDYA 4OYWA 3AFGA 2EBEA 4B3SI 3J81Q 4GKKE 4B3ME 4LF6F 4NZ7A 2IESA 4MU1A 4GC7A 1XMOI 2ZUAA 2KFYA 1HR0E 3HK2A 3Q22A 1T95A 5DDRC 2J6SA 5L46A 1BWVA 2A6OA 1U2CA 4XO0A 2ZD1B 1KVKA 2BDPA 2PMZD 4RX6A 1JXLA 3NMRA 1CBKA 1HPZA 5A2QY 2W2PP 5KAKA 4DR4J 3DRRB 4TKTA 3KKFA 3JQJA 1Z0GA 2E1AA 1K0VA 1V6HA 2GMLA 2J0SD 4XDCA 2CG8A 4MT1A 2D3ZA 1K73T 4ZLPA 1RBAA 2YWGA 1NHIA 3NXZA 4ERDA 1MWQA 1T03A 2W8KA 2AE8A 4FNIA 3DYAB 4NXNJ 4URGA 1N8RT 2FVQA 2FZGB 3HVAA 3KG4A 1VQSA 1YZ6A 4U95A 3CJSA 1LWEB 3D67A 4KGZB 3B54A 2ZWPA 2JJ4D 3NNAA 4J9OA 4OI1A 1HBNA 2C3MA 1E6YA 4B9TA 1LNQA 1F5AA 3PX4A 1RTIA 4BA1B 3TVZA 4USJC 4DR6I 4M1KA 1SVDA 3JSMA 2AIRB 4JI3F 1CPZA 3AQOA 1RHJB 2K8GA 2YH0A 1NMEB 3N0VA 2QMXA 1NK8A 1PJ7A 1REGX 1QD1A 4I6YA 4I0WA 4RW8A 1ZS6A 3NOCA 3R7SB 3FVYA 2GFFA 4OO1F 3PJ9A 4MFBB 5IT4A 1SL2A 4JI7F 5FDLA 2LVWA 2BJ8A 2OMLA 4M63A 1VQ5S 5JEAC 4XPCA 5K5MA 4DR3I 1FA0A 2EEYA 1Y11A 4KHPE 1QSLA 3ETMA 1DTQB 1B62A 3EZOA 4JV5I 5F8HA 2Y0SD 2A6MA 2QLJB 4L76A 4BHQA 3ENAA 1S6PB 2DNZA 2MQQA 2UU9I 2Q6BA 4M94A 1QZRA 2WVDA 4U7CA 1IBKJ 4IG3A 3G6YA 1ZM4A 1RAOA 3V81B 4L73A 2I5JB 5KFAA 3T3FA 4JI4F 4LFCI 2QYCA 1Z5AA 3M6VA 3TAMA 3CMES 2EFOA 3QIPB 1U26A 2AJ0A 4EGLA 1NNDA 3L4BC 4JI5I 2UP1A 2DGXA 2RT3A 1LWCA 4CRJA 2V9WA 2C3YA 2H9ZA 4NYPA 3L95X 4LUBA 4DQPA 3QATA 2VFRA 4MMOA 3FRYA 3IGVA 2UXCE 1LW0A 4Y6IA 1KFSA 2WSEC 2C2MB 5CYMA 1Q5VA 4OYAA 3HLUA 1R6MA 2FHJD 5DG9A 2F4VI 4F3QA 4F4ZA 1X5PA 3Q8QB 3D0IE 3FBFA 4LFBJ 3UN2A 1HPZB 2R7VA 4WZMA 2P6SA 3PRDA 2RSQA 3MM9A 3EZUA 4X65I 2FYXA 3NCPA 1I94F 4B3SJ 3UNGC 1U25A 2UUCI 3NS6A 4NLTA 3T1YE 2IVYA 3C14A 4BBYA 1T03B 3CUNA 5HVHA 2W1BA 2BA0D 4TVAB 2AEJA 2UVRA 2NUHA 3IO1A 2UUBI 2M88A 2QA4S 5EWEA 4Z7YA 4X66I 1JLCA 3CW2C 1GTEA 5DG8A 4QW9A 6FDRA 1HBNB 1E6YB 3T1HI 2FHJA 2XS5A 1RTIB 1TL5A 2BVZA 5A2QQ 3R27A 2QN6B 3UNYA 3ULHA 2M5YA 3ETOA 3JSMB 5I3QA 1H2UX 2OI2A 1S1WA 2BJ1A 4QBUA 1GK8A 1NDKA 4OI6A 2RD5C 2BKOA 2IMOA 1XTZA 4UZCA 4RW8B 3TYTA 5MAOA 5KG2A 2L48A 2XGPA 4RLEA 3DMJA 3RR8A 3M85D 1RSCA 2ZEJA 2KZMA 3CJTA 3EZ5A 1PSDA 4ZPDA 2QL7B 4KH0B 1Q7YT 4FXDA 1AFJA 4NLOA 5FDLB 1OYDA 3GV5B 2LYVA 4QOTA 1IBLE 2FJDB 4LR7A 3MUVP 1VQ8S 5KFXA 3KLFA 2Y1LB 1P6TA 2GQ0A 3OFGA 1XNQE 3PEJA 2EFNA 5DQGA 2BKNA 1FNXH 2MZRA 2AGOA 1ZPWX 4FF1A 1WWHA 2VQEF 1Q82T 2BE9B 1WG4A 3MAAB 4IG3B 5SUHA 3Q23A 1N34I 2BJEA 2X1BA 5D4LA 1I1GA 4Y0FA 3TAMB 1KD1T 3CC4S 4XK8C 1EI1A 3B82A 4JV1A 3J7ZT 4DLEA 4GKKI 2A10A 2J9EA 4B3MI 1LWCB 3D1HA 4F0MA 3MM8A 3ONQA 2H5EA 3FGVA 2UU9J 2MQPA 3HULA 3B78A 2XMVA 4YN3B 1FJGJ 5IM0A 2ZBCA 2KXNB 5J2QA 4DL4A 1UVKA 2NCKL 3FEYB 2OJ3A 4DV5E 4LOMA 2MXYA 1N5YA 2LMIA 3PW2A 1QTNB 2XLKA 4LFCJ 5CYMB 4P74A 1S99A 3O3LA 4DZ6A 4DV0F 2R2UA 4IS9A 2DH8A 4DUZJ 4A46A 4ED7A 3WU5A 2Y8WA 2VODA 4CTAA 3ENWA 3D6MB 4GVBA 1HNWF 1IKWA 1GXUA 3DLLQ 1HWUA 1WTFA 4J9NA 1JXEA 1XNRF 3LALA 2RRBA 1WC0A 4UOCA 3MM9B 3M2VA 3HD2A 4G1QA 2V94A 4TN2A 2DIUA 4KFBA 4L3NA 3FQKA 3QIDA 1Y7PA 3PRVA 3PNIA 4AL6A 3D54A 5L3JA 2J6UA 3SSSA 4WFNQ 1VDHA 4MIAA 1IWAA 4RUAA 3B4TA 4ZVRB 5C7PA 4ZDNA 4LFAI 3ZXWA 1X4EA 1GQEA 1S9EA 3I55S 2KRRA 3LGNA 4OJHA 3SZ2A 1QTMA 1JLCB 2DNMA 1QDUB 3GFYA 3P96A 1W25A 5BR8F 1WOSA 1WEXA 2BUNA 2F7VA 3IBWA 3W3SA 3ELHA 4OYZA 1XMQF 5KFEA 5CXTA 4ES2A 2B9XA 3FFIB 4DUTA 1FKAE 4DV1F 1S1WB 2MMYA 5J2PB 4Q43A 2EC0A 2BJDA 2HPUA 2XLIA 4MDTA 4D3HA 4DPUA 2ADCA 4ECTA 4ECYA 1OJ4A 3HSDA 4Q0BA 1NJIT 1WI8A 3G4SS 5RUBA 4JI8J 4DV3I 4YHHF 5IZHA 3DRYA 3NGKA 1WEZA 2J9DA 1EP4A 2F8HA 2OUGA 4EZ9A 3PHEA 3KLFB 1KOOA 2UXBI 5H9FJ 4DL0C 5L8RC 2HHTA 5CZXA 2PD1A 4ES1A 4TLQA 3J7AM 4U67Q 4FNHA 2LA4A 2EFPA 5KFQA 3BKTA 2RQKA 4JV2A 5E3PA 3IWLA 2UVWA 4OZ1A 2HQFA 1NDCA 3I0SA 5IT0A 3RRHA 2B3TB 4CO0A 1UA0A 4RPFA 1UVIA 2E5LF 3FZBA 2BQUA 3R1HA 2XMMA 3OFFA 1H7SA 2MZQA 2UVVA 4I3HA 1K1SA 4CH1A 2DGVA 3MM8B 3CTRA 3KLEB 4OHZA 5AE2A 1HWLA 3N6LA 4OZNA 3U27A 3Q0AA 2RVJA 4IO1A 2DEJA 3M8ZA 5IM0B 1VJWA 5J2QB 2C3UA 4NXME 1N5YB 2CQ3A 5HMZA 4WCEQ 1KWMA 1TAUA 1NK0A 1YGYA 4OX8A 2OELA 2FLOA 3K5NA 4C8KA 1Y60A 4PG8A 4LF9I 2M4MA 2FGOA 3E01A 3R1LA 1RGVA 1MWZA 1Q16B 1NB2A 4GVBB 2OD6A 1IKWB 3PM9A 1XJWB 4Y2KA 2JEJA 2IC3A 5IC4B 3AOAA 4UQTA 3M2VB 4D3GA 4KFBB 3SI8A 3ZZRA 5L1KA 1S1XB 2KI2A 2ZHBA 4PYDA 3P3GA 2CJXB 5FLXU 1F5BA 5IV3A 1YIJS 4YB6A 2AYMA 4TU7A 4P52A 2V2KA 3MD3A 3EGVA 5KFPA 4DLGA 2R2SA 4IH7A 3SQOP 2OTLS 1S9EB 5E2QA 4O23A 4WZQA 1RZMA 4BA2A 4RWXA 3N6MA 1S0NA 4NCGA 3DM2A 4F4AA 3FSYA 1X4GA 2NN6E 4ECUA 3VWSA 4FWHA 4AXIA 2W9AA 1EKSA 2XHWA 3P4UB 1RAIB 3HKWA 5HQMA 1RKIA 1F5CA 1M5KC 4MYTA 3MPWA 3VAHA 4PYAA 4Q0BB 4C8ZA 4LFAJ 1X31C 2E1RA 1XNQI 1IBMJ 4DL7A 1RCXB 1H74A 4BDPA 2QIFA 3TARA 1LWXA 4HH1A 2JWNA 1EP4B 1PYOB 3Q6MA 3MUMP 5GMEA 4LF6E 4J9PA 2DRDA 3LUYA 3S1TA 4ZVUB 3PYEA 2YH1A 2YWEA 4DR7F 1TVRA 1UMJA 1XBWA 1ZPVA 4K4TA 3B4DA 3LPSA 2CJAA 1NPPA 1G4CA 2O1TA 1RDRA 4DBQA 4V19J 1OS5A 2DHGA 1KNZA 4NMXA 2DTJA 3LO3A 2F40A 2G1HA 3F41A 4LCGA 1RLCL 4F25A 4PABA 2FZCB 2F3JA 2P6TA 2C28A 3MZIA 5JEAD 5KFVA 2IYIA 4X4NA 5AXNA 1KQFB 1PJ5A 4JI6F 4J91A 3I0SB 1YWXA 2MZJA 5J1PA 2C3PA 4ZVTB 3PW7A 1TFWA 1IVZA 2H65B 1S1UA 2UXBJ 1QSYA 2I9SA 2HK3A 4NZ6A 1Y9OA 4WPAA 1U49A 3U1LA 2VD3A 5KG4A 3BSAA 1USVA 3PX6A 2HBRB 2ZC4A 4IQXA 3TW0A 5DDQC 2ZH6A 1UDQA 1DY3A 3M7ND 1S79A 5KFDA 1KP6A 3G96A 1TQLA 4ID8A 3DRXA 1C4AA 1PO6A 4JI3E 3WC2A 5CHCB 2ZH3A 1ULRA 1HKAA 2GW8A 3E01B 1H7UA 2D7SA 3CULA 3QGIA 2UUAJ 5C5JA 3PY8A 2VA2A 1IN0A 3ZM7A 2A2DA 2IC3B 4X62F 5M2UA 4U7UK 4NLPA 5JEAA 1D8ZA 1VFJA 1Z59A 4S0MA 3KJVA 4OO1E 2DGQA 1S12A 1UVMA 1HBOA 3DU6A 2QLBB 2D41A 5HBMA 2RKIA 3KTQA 4IFDE 4KRWA 1S6QA 2HS4A 1WEYA 2CGEA 2W24A 2MB0B 2VBYA 3K17A 5LMUJ 1RAGB 2DD8S 1F1BB 3MHYA 1CS4B 4LT6A 5KFIA 4F36A 2ZZNA 4DV4I 3T6JA 4DPOA 3GG1A 3SSRA 4A8QA 1H2TZ 4WP8A 4BA2B 5K36E 3SV3A 4NLXA 3BYPA 4JI4E 4F4KA 3MR2A 2HBQB 3DRPA 4ZA1A 1HNXJ 1V5VA 3IN5A 2HAFA 4ILLA 3CJ2A 4RR5A 3HM9A 2KDOA 2Z5BA 5DS7A 3OQ2A 4QIFA 2JRSA 2FJAB 3D2WA 2CQCA 1VQ4S 1NCLA 3M8PB 1PC4A 1Z2ZA 1TKZA 4B3OB 3JTPA 1UFLA 2OPPA 1N36I 2HNYA 4WXOA 1RTDA 2IM3A 2XSJA 2BBEA 3CDAA 3C2PA 2COLA 2DJWA
chains in the Genus database with same CATH topology
2V2ZA 3T1YE 1RR9A 2WW4A 3J80C 1Z0VA 4DPTA 2DEJA 1EA6A 1NZ0A 2ZM6I 4DV0I 2V2VA 3V5RA 4JI2I 4NXME 4PRXA 1Z0BA 4URLA 2DEIA 2UUBI 4JI7E 2Z5CA 1S16A 2BM1A 2R3VA 4Z7YA 4DUYE 3H4LA 4X66I 1HNWI 4JI6I 1N32I 1XNRI 4LF9I 2E5LE 4JI3I 1DARA 2Q2EB 3T1HI 4LF4I 4KHPI 1NHHA 1I94E 5BR8E 2HK2A 4DV7E 4FWGA 5A2QC 3CWVA 5A2QQ 2Z5EA 3ZZTA 1XMQE 4FN5A 4OX9I 2OI2A 5FLXC 3PYFA 1N0UA 2VQEI 4NXMI 4IZJB 1Z0TA 4JI7I 4DUYI 1XMOE 4DPWA 1B63A 4UT4A 4B3RE 4LFAE 4P52A 3OTOI 4LFBI 1A6FA 1IBME 4USMA 3P06A 2UUAE 1J5EI 5LL6R 4DR3E 1VISA 4IZKA 4YHHE 5BR8I 1IBLE 4DV7I 1Z0EA 2PNMA 3JAMC 3JAMQ 1IBKE 2GS8A 4HXZA 1N33E 4ED4A 4AQYI 2GQ0A 4JV5E 4X62I 1XNQE 1HK7A 3J81C 1FWLA 2O1UA 4B3SI 3J81Q 4FWDA 2UU9E 4X64E 2AJ4A 4GKKE 4DV1I 2IOQA 4B3ME 4NXNE 2UXCI 4DR5I 2EFGA 4JI4I 2VQFE 2HHHE 3D4JA 4DR2E 4FWHA 5IWAE 4R1FA 1XMOI 1BKNA 3WU3A 1HR0E 2HFUA 1PVGA 4LFCE 3Q6NA 1UEKA 4JI8E 4ZVIA 1N34I 1FNMA 4B3TE 4MYTA 1IBMI 4DR4I 4DUZE 5GMDA 3QT7A 4PRVA 1EI1A 1KVKA 3B82A 1NHJA 4DV3E 4JI5E 3B8HA 1N33I 4IZJD 1MX0A 4LF8E 4DR7I 2E1RA 1XNQI 2BV3A 1H74A 4X64I 2HKEA 3QT5A 1RREA 1Z0GA 2HKJA 4GKKI 2A2CA 1HNXE 4JYAI 4DV4E 4JI1E 1ZXNA 2V8PA 4B3MI 1FJGI 4NXNI 3Q1QA 4YY3I 3Q6MA 4LF6E 5GMEA 2XEXA 5IWAI 3QT6A 1ELOA 2UXBE 1NHIA 1PIEA 5LMNE 4DR6E 3HULA 1U2RA 3B78A 3PYEA 3T1YI 4P7AA 4B3TI 4DUZI 1HNZE 2BM0A 5IT9C 3LTOA 4DV5E 3LNUA 5IT9Q 4LF5E 3K1JA 3LPSA 1K47A 4DU8A 2O1TA 2Z5BB 2F4VE 2CZ9A 2J7KA 1FWKA 3K85A 4JI1I 3WU5A 1H72C 4DV6E 4MYUA 1H73A 2E5LI 1Y4UA 3PYGA 1N36E 1I94I 4LF7E 4DR6I 4M1KA 1Y6ZA 2LJPA 4JI0E 1XMQI 2UUCE 1HNZI 1XHKA 4IZJA 1KKHA 4LF5I 3ZZ0A 2HK3A 4HACB 1Y4SA 4DV0E 2ZM6E 4GKJE 4JI2E 2R42A 1USVA 2CG9A 5L3JA 4DV2E 1Z0WA 1USUA 4K0KE 4B3RI 1ZM2A 3F0NA 3V2UC 1Z5BA 4WUCA 4LFAI 5LMUE 2NPFA 2HFSA 4X66E 4JI6E 2Z5CB 2UUAI 1WUUA 2V2QA 4DR3I 1XNRE 4YHHI 1IBLI 4JG4A 4LF9E 2ZITA 4JI3E 1MG7A 1IBKI 4LF4E 4DPYA 4JI0I 4KHPE 1B62A 4JV5I 2V34A 1H7UA 1ZM9A 2PNLA 4DR1E 2UU9I 4DXLA 3ZM7A 1QZRA 2A2DA 3WU4A 3J80Q 3ZZUA 4OX9E 4HY1A 2O1VA 5FWKA 4GKJI 1ZM4A 2VQEE 2VQFI 2HHHI 4DU7A 1Z59A 4DR2I 4DV2I 1FKAE 4K0KI 1HR0I 4LFCI 2UXDE 3HJCA 4JI8I 1Z5AA 2X7IA 4HYMA 5LMUI 4UTGA 2VF3A 4DPUA 4N3OA 4Z7CA 1OJ4A 3OTOE 1ZM3A 4LFBE 2CGEA 2IOPA 1J5EE 1FI4A 4DV3I 4JI5I 3K17A 4LF8I 3PYDA 3ZKDA 4EMDA 4DR1I 4IZKB 2X36A 4XTJA 4AQYE 1HNXI 1ZXMA 4DV4I 4X62E 5FLXQ 4KQVA 4B3SE 3J7AG 4LF6I 2O1WA 1KIJA 3WU6A 4PU9A 4DV1E 1PKPA 2UXBI 2UXCE 4DR5E 4JI4E 5LMNI 2UXDI 4X65E 1Z5CA 1Z0CA 4DV5I 4DR7E 1N34E 3PRYA 3J7AM 2Z5BA 4DR4E 1KTVA 1D6TA 3QT8A 2F4VI 2ZBKB 3GONA 1MU5A 3ZKBA 4WUDA 4WUBA 2UUBE 4DV6I 4DPXA 1N0VC 1HNWE 4JYAE 1FJGE 4USKA 1N36I 4RPFA 3M6AA 4YY3E 1N32E 4LF7I 4X65I 1H7SA 3T1HE 4I3HA 1S4EA 2UUCI 4HACA 4FW9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V2Z A;  3T1Y E;  1RR9 A;  2WW4 A;  3J80 C;  1Z0V A;  4DPT A;  2DEJ A;  1EA6 A;  1NZ0 A;  2ZM6 I;  4DV0 I;  2V2V A;  3V5R A;  4JI2 I;  4NXM E;  4PRX A;  1Z0B A;  4URL A;  2DEI A;  2UUB I;  4JI7 E;  1S16 A;  2BM1 A;  2R3V A;  4Z7Y A;  4DUY E;  3H4L A;  4X66 I;  1HNW I;  4JI6 I;  1N32 I;  1XNR I;  4LF9 I;  2E5L E;  4JI3 I;  1DAR A;  2Q2E B;  3T1H I;  4LF4 I;  4KHP I;  1NHH A;  1I94 E;  5BR8 E;  2HK2 A;  4DV7 E;  4FWG A;  5A2Q C;  3CWV A;  5A2Q Q;  3ZZT A;  1XMQ E;  4FN5 A;  4OX9 I;  2OI2 A;  5FLX C;  3PYF A;  1N0U A;  2VQE I;  4NXM I;  1Z0T A;  4JI7 I;  4DUY I;  1XMO E;  4DPW A;  1B63 A;  4UT4 A;  4B3R E;  4LFA E;  4P52 A;  3OTO I;  4LFB I;  1A6F A;  1IBM E;  4USM A;  2UUA E;  1J5E I;  5LL6 R;  4DR3 E;  1VIS A;  4YHH E;  5BR8 I;  1IBL E;  4DV7 I;  1Z0E A;  3JAM C;  3JAM Q;  1IBK E;  2GS8 A;  4HXZ A;  1N33 E;  4ED4 A;  4AQY I;  4JV5 E;  4X62 I;  1XNQ E;  3J81 C;  1FWL A;  4B3S I;  3J81 Q;  4FWD A;  2UU9 E;  4X64 E;  2AJ4 A;  4GKK E;  4DV1 I;  4B3M E;  4NXN E;  2UXC I;  4DR5 I;  2EFG A;  4JI4 I;  2VQF E;  2HHH E;  3D4J A;  4DR2 E;  4FWH A;  5IWA E;  4R1F A;  1XMO I;  1BKN A;  3WU3 A;  1HR0 E;  2HFU A;  1PVG A;  4LFC E;  1UEK A;  4JI8 E;  4ZVI A;  1N34 I;  1FNM A;  4B3T E;  4MYT A;  1IBM I;  4DR4 I;  4DUZ E;  5GMD A;  3QT7 A;  4PRV A;  1EI1 A;  1KVK A;  3B82 A;  1NHJ A;  4DV3 E;  4JI5 E;  3B8H A;  1N33 I;  1MX0 A;  4LF8 E;  4DR7 I;  2E1R A;  1XNQ I;  2BV3 A;  1H74 A;  4X64 I;  2HKE A;  3QT5 A;  1RRE A;  1Z0G A;  2HKJ A;  4GKK I;  2A2C A;  1HNX E;  4JYA I;  4DV4 E;  4JI1 E;  1ZXN A;  2V8P A;  4B3M I;  1FJG I;  4NXN I;  3Q1Q A;  4YY3 I;  4LF6 E;  5GME A;  2XEX A;  5IWA I;  3QT6 A;  1ELO A;  2UXB E;  1NHI A;  1PIE A;  5LMN E;  4DR6 E;  3HUL A;  1U2R A;  3B78 A;  3PYE A;  3T1Y I;  4P7A A;  4B3T I;  4DUZ I;  1HNZ E;  2BM0 A;  5IT9 C;  3LTO A;  4DV5 E;  3LNU A;  5IT9 Q;  4LF5 E;  3K1J A;  3LPS A;  1K47 A;  4DU8 A;  2F4V E;  2CZ9 A;  2J7K A;  1FWK A;  3WU5 A;  4JI1 I;  1H72 C;  4DV6 E;  4MYU A;  1H73 A;  2E5L I;  3PYG A;  1N36 E;  1I94 I;  4LF7 E;  4DR6 I;  4M1K A;  2LJP A;  4JI0 E;  1XMQ I;  2UUC E;  1HNZ I;  1XHK A;  1KKH A;  4LF5 I;  3ZZ0 A;  2HK3 A;  4HAC B;  4DV0 E;  2ZM6 E;  4GKJ E;  4JI2 E;  2R42 A;  5L3J A;  4DV2 E;  1Z0W A;  4K0K E;  4B3R I;  1ZM2 A;  3F0N A;  3V2U C;  1Z5B A;  4WUC A;  4LFA I;  5LMU E;  2NPF A;  2HFS A;  4X66 E;  4JI6 E;  2UUA I;  1WUU A;  2V2Q A;  4DR3 I;  1XNR E;  4YHH I;  1IBL I;  4JG4 A;  4LF9 E;  2ZIT A;  4JI3 E;  1MG7 A;  1IBK I;  4LF4 E;  4DPY A;  4JI0 I;  4KHP E;  1B62 A;  4JV5 I;  2V34 A;  1H7U A;  1ZM9 A;  4DR1 E;  2UU9 I;  4DXL A;  3ZM7 A;  1QZR A;  2A2D A;  3WU4 A;  3J80 Q;  3ZZU A;  4OX9 E;  4HY1 A;  4GKJ I;  1ZM4 A;  2VQE E;  2VQF I;  2HHH I;  4DU7 A;  1Z59 A;  4DR2 I;  4DV2 I;  1FKA E;  4K0K I;  1HR0 I;  4LFC I;  2UXD E;  4JI8 I;  1Z5A A;  2X7I A;  4HYM A;  5LMU I;  4UTG A;  2VF3 A;  4DPU A;  4Z7C A;  1OJ4 A;  3OTO E;  1ZM3 A;  4LFB E;  1J5E E;  1FI4 A;  4DV3 I;  4JI5 I;  3K17 A;  4LF8 I;  3PYD A;  3ZKD A;  4EMD A;  4DR1 I;  2X36 A;  4XTJ A;  4AQY E;  1HNX I;  1ZXM A;  4DV4 I;  4X62 E;  5FLX Q;  4KQV A;  4B3S E;  3J7A G;  4LF6 I;  1KIJ A;  3WU6 A;  4PU9 A;  4DV1 E;  1PKP A;  2UXB I;  2UXC E;  4DR5 E;  4JI4 E;  5LMN I;  2UXD I;  4X65 E;  1Z5C A;  1Z0C A;  4DV5 I;  4DR7 E;  1N34 E;  3J7A M;  4DR4 E;  1KTV A;  1D6T A;  3QT8 A;  2F4V I;  2ZBK B;  3GON A;  1MU5 A;  3ZKB A;  4WUD A;  4WUB A;  2UUB E;  4DV6 I;  4DPX A;  1N0V C;  1HNW E;  4JYA E;  1FJG E;  4USK A;  1N36 I;  4RPF A;  3M6A A;  4YY3 E;  1N32 E;  4LF7 I;  4X65 I;  1H7S A;  3T1H E;  4I3H A;  1S4E A;  2UUC I;  4HAC A;  4FW9 A; 
#chains in the Genus database with same CATH topology
 2V2Z A;  4L72 B;  1UTA A;  3QWP A;  3J80 C;  2FJX A;  3KLH A;  3M32 A;  3BH6 B;  1UW4 A;  3D5M A;  3RBE A;  4JI2 I;  5B0E A;  1KLM A;  1TVR B;  2MY8 A;  3GCW P;  2X51 A;  3DLK A;  1JKH B;  3PW4 A;  2WB4 A;  3Q8V A;  3E8O A;  2ZM6 J;  4RW6 A;  2M2B A;  3BGR A;  3TP2 A;  5FLX Y;  1VBX A;  2GIR A;  3GIK A;  6AT1 B;  1I6J A;  1DTT A;  3VF0 B;  2HW3 A;  2XBP A;  2AYB A;  3I9Z A;  5HI7 A;  1DAR A;  1RAJ A;  4F2S A;  1I94 E;  2DRA A;  4UQG A;  2HBY B;  5KFC A;  3GIJ A;  3PS2 A;  2MQM A;  2VBX A;  2W4D A;  4OX9 I;  2M3D A;  2CIM A;  3G9C A;  4NXM I;  4QIE A;  1CC8 A;  1S1U B;  4N76 A;  2EVZ A;  4ECX A;  2VQF F;  3EM1 A;  3EPG A;  3NAH A;  5ETM A;  2V68 A;  1RT7 A;  1U0S A;  1NJZ A;  2NN6 C;  3AB2 B;  2H3E B;  2ZH8 A;  2LEC A;  3TX8 A;  2LKZ A;  3N5B A;  4RZR A;  2OAU A;  2HHS A;  1EQ0 A;  1XR7 A;  1YX2 A;  2FPH X;  3SYZ A;  2AJ4 A;  3MTJ A;  1SXL A;  2WNR A;  2IVF B;  3TNV A;  1DQ9 A;  2W7P A;  1F9F A;  1S49 A;  3QSI A;  4ILR A;  4F8R A;  2MYF A;  5JEA B;  2HFU A;  2YKQ A;  1JNZ B;  3CF5 Q;  3KJV B;  4KE5 A;  1MSW D;  2VOO A;  3QRR A;  1HBO B;  4DFJ A;  2WRM A;  3HT0 A;  5HBM B;  2RKI B;  3Q83 A;  2J0Q D;  2XCA A;  1S6Q B;  2PSZ A;  2FUG 9;  2MY7 A;  2ZH4 A;  5K9F A;  1R6L A;  4WU3 A;  1FD2 A;  1I51 B;  4YY3 I;  2MJN A;  3A4T A;  5KT4 A;  3QT6 A;  1FRH A;  4OMF G;  1T3O A;  2POK A;  1Z2L A;  4JYA J;  3N5F A;  3B6B A;  1S7I A;  3MGJ A;  1RQ0 A;  3DRP B;  2DNN A;  5D78 A;  5KT2 A;  2Y3Y A;  4E2F B;  3HVT A;  2BAC A;  4ZPV R;  3J7A 1;  3KLI A;  2DO4 A;  3T5H A;  4DU8 A;  2HND A;  2Z5B B;  2Q43 A;  3BB5 A;  5H9E J;  5IT9 U;  1RWP B;  5F3T A;  1C4C A;  4AL5 A;  1H72 C;  5ADZ A;  5JJB A;  4ELU A;  3T9N A;  3GJQ B;  2FC8 A;  2UUT A;  3IR5 B;  1TKZ B;  3A3N B;  1D9D A;  1VK8 A;  2M8H A;  4CCH A;  2OPP B;  4OLP A;  4DV4 J;  1U1R A;  3EWG A;  4QYR A;  1Y3K A;  4GO7 X;  1RTD B;  2XSJ B;  2N4D A;  1HHT P;  4HLB A;  4B08 A;  3KFW X;  5CAB A;  2B5J B;  2IJN A;  4DV0 E;  2E7X A;  4EBE A;  2Q79 A;  4AE5 A;  1P1T A;  1U1M A;  2CG9 A;  3M32 B;  3FCV A;  3D28 A;  5I4M A;  2DIS A;  4MKB A;  4B3R I;  3FSI A;  1SL0 A;  1WC4 A;  3DLK B;  4ID5 A;  1J2V A;  4OO1 C;  4RW6 B;  1XNR E;  3G8Q A;  1HFE L;  3BGR B;  4LFB F;  3PXG a;  1NJW A;  1DTT B;  5B0F A;  4CLT A;  4IFD C;  4DSL A;  1T9X A;  5B0A A;  4WII A;  1S5Z A;  1S57 A;  1R3N A;  1V9O A;  2QLW A;  2QLX A;  3MR3 A;  4O0N A;  4JP8 A;  1RXO B;  1XMO F;  3HP6 A;  4K50 A;  5K36 C;  1VQY A;  2HHH J;  3U02 A;  4DV2 J;  1RT7 B;  2QEX S;  2MLY A;  1ZM3 A;  3Q8R B;  4K0K J;  2LU2 A;  3EVM A;  2G0I A;  1FKO A;  2GVZ A;  2JLF A;  1ARO P;  1SB6 A;  5I42 B;  1U1P A;  2JL9 A;  3G6V A;  4OKG A;  4OV6 A;  3BPS P;  5FLX Q;  3EIC A;  3MAQ A;  4DV1 E;  1X0P A;  2XWY A;  3A3P B;  2DNH A;  1Q7L B;  2WNR B;  2UVU A;  2HBZ B;  3GTY X;  4OJ1 A;  2YQ0 A;  4HL9 A;  4LRB A;  2WBR A;  4LRE A;  4KV8 A;  3BZQ A;  2E9R X;  2UXD J;  2I2Y A;  1L3T A;  2XMA A;  3H20 A;  3TJ8 A;  3H40 A;  2VL1 A;  4UZB A;  4FXW A;  1HW8 A;  1U2F A;  2JEA A;  1RTH A;  3PJX A;  4WFA Q;  1RBO B;  4LF7 I;  5ELW A;  1X5T A;  1WC1 A;  4DR6 F;  1IKX A;  5IV4 A;  1R8A A;  3MCO A;  1S0O A;  3WX4 A;  3QZ7 A;  3DDI A;  3EDQ B;  1YJV A;  1RP5 A;  4U9R A;  5DO2 A;  1NZ0 A;  5EKW A;  2WVF A;  2BA9 A;  2HVD A;  2CVE A;  2RB7 A;  3RB0 A;  5D4O A;  3CDJ A;  3HVT B;  1Z0B A;  3KLI B;  3U1Y A;  4IH6 A;  1PJ6 A;  2HND B;  4ZCI A;  4FS1 A;  3OSP A;  1S0M A;  2W7O A;  2E5L E;  4OHX A;  5HAN A;  3RRG A;  4DR3 F;  5GVQ A;  4N5S A;  1XEZ A;  3TI0 A;  2WAQ D;  3C6T B;  1T9U A;  3RAM A;  2ACY A;  3ZZT A;  4JV5 F;  2DNL A;  5FJ4 A;  3NKY A;  2YNI A;  3LF0 A;  1JLQ A;  3KDN A;  2DNR A;  4YB5 A;  5G0R A;  2OKQ A;  4C7Q A;  4QWE A;  4AXJ A;  2XO7 A;  3VQT A;  3W5X A;  3NBP A;  5GAG U;  1M1K T;  3GJT B;  4C8M A;  1R0C B;  2Z8Q A;  1FNO A;  4DSJ A;  4ZVO B;  1R0B G;  3OTO I;  1NRK A;  3HFZ B;  4JBC A;  4USM A;  3I5C A;  3M7N G;  4DUY J;  4ID5 B;  4LRC A;  4PPZ A;  3WIV A;  2HNZ A;  3CJ0 A;  5B0C A;  4DWI A;  1TL3 A;  2R7S A;  4JI5 F;  4HXZ A;  1N33 E;  3CO9 A;  2GIF A;  1X4F A;  4ZVH A;  4RNF A;  3MD1 A;  3FEZ A;  4DV7 J;  4HYK A;  4DR5 I;  3DN9 A;  2CFX A;  3WBZ A;  1D3W A;  4AQY J;  3JSR A;  2IYG A;  5JEA F;  3VVT A;  3KG1 A;  1QUP A;  3POT A;  5HMY A;  1NK6 A;  2B6A A;  4C8O A;  1FXD A;  4B3T E;  3UD5 A;  1IQZ A;  5CD4 H;  3CCR S;  2ZHO A;  3EPI A;  2DHS A;  4PRV A;  1U7L A;  4B3R J;  3QPI A;  2E9T A;  1FWP A;  4GO5 X;  2F4V F;  1FKO B;  3JB9 k;  5A6W A;  2B43 A;  2HIQ A;  3CD0 A;  2HQI A;  3NEK A;  4P6Q A;  2CNK B;  1SJQ A;  5KFF A;  2J8S A;  2C2D A;  1PIE A;  1U2R A;  4LBP A;  4HDH A;  2G1D A;  3ISN C;  3R2D J;  4X65 F;  4W4M A;  2ACM A;  1U6Z A;  2UUC F;  3SXL A;  2CJB A;  4I56 A;  4FW6 A;  1EQM A;  1OYE A;  2EKY A;  2J6T A;  3GIR A;  4KV8 B;  4ED6 A;  2OEM A;  2H4W B;  3A1Y G;  3KUE A;  2XGQ A;  2ATL A;  3TUP A;  2IY5 B;  2UUB F;  4KIA A;  2W01 A;  4ED2 A;  4DX7 A;  4X66 F;  1O6X A;  4DN0 A;  5KT6 A;  4ELT A;  2JEA B;  5EWF A;  1RTH B;  1HIY A;  3T1H F;  1R8C A;  4JI0 E;  3S7R A;  1W7W A;  2CWX A;  2XMW A;  4CO5 A;  4O3O A;  3CXC R;  4J3D A;  3UR3 C;  1WC6 A;  2R42 A;  1PIL A;  3LAK A;  2ZH1 A;  1JLF A;  1USU A;  1NKE A;  5E0O A;  4ZS6 A;  3M9O B;  5CD4 A;  5C2G A;  4JI6 E;  5C42 A;  2NQP A;  1M5O C;  4RUB A;  3R8Y A;  3MPV A;  4M5J A;  4HT5 A;  5D0G A;  3BO2 A;  1Z1Z A;  3PFE A;  3EJM A;  4HT7 A;  3A8I A;  4N7T A;  2VBZ A;  1YQH A;  2YNI B;  4B9S A;  3SIP B;  1JLQ B;  3V6J A;  1BY9 A;  3DCA A;  3HPO A;  2QV6 A;  5G0R B;  2ZDP A;  2ZNY A;  4GKJ J;  1FJE B;  3NBP B;  6FD1 A;  1N34 F;  2I1R A;  4LPF A;  4FF3 A;  4MJK A;  1HR0 J;  2IOP A;  2AX0 A;  4LF8 I;  3M7V A;  4ZP6 A;  1MU2 A;  1Q5Y A;  1Q79 A;  2JFK A;  4C8Y A;  4KR0 B;  3W9J A;  2DR8 A;  2HNZ B;  2NS1 B;  1A0O B;  1PAE X;  4X62 E;  1TL3 B;  4ZP7 A;  5BJR A;  4GKK F;  4UOG A;  2KB2 A;  2B51 A;  1KIJ A;  4P7V A;  4B3M F;  2KXF A;  1SCJ B;  4DR1 J;  2BR0 A;  1QUV A;  4ATN A;  3I9V 9;  2G2Y A;  2EPI A;  1IM6 A;  3POT B;  2ERR A;  4KGM A;  2WSF C;  5K8M A;  2ALY B;  4XPE A;  2JEG A;  2KFZ A;  4I7F A;  4ED3 A;  4X4P A;  4IKA A;  1EIY B;  2FB0 A;  3ADA C;  1UKU A;  4LCF A;  3MM7 B;  2U1A A;  1R0A A;  3FMB A;  1ZBT A;  2CDR B;  1L3V A;  4V19 X;  4ZVQ B;  3MOZ A;  2DIV A;  4TNO A;  1N6Q A;  3BQ1 A;  1VQN S;  5MLC V;  4KT0 C;  4TU9 A;  3NS7 B;  4USK A;  1VBK A;  3M6A A;  3TOQ A;  4PG4 A;  4WWS A;  2V4J A;  1N32 E;  4FW4 A;  4YB7 A;  2YWF A;  1U6F A;  2BA1 D;  2OIH A;  4ZN1 A;  2V69 A;  5B08 A;  3KHR A;  1EA6 A;  1HQE A;  4I2Q A;  3OSN A;  4DL5 A;  3LAM A;  3HCX A;  3JSY A;  3D0G E;  5KT3 A;  4KPY A;  2IA0 A;  3V6D A;  3HMJ G;  1HLW A;  2GQQ A;  2NN6 D;  2E5I A;  4HR2 A;  5KT7 A;  2CAD A;  4LFA F;  3UVJ A;  2XS7 A;  1VHF A;  1PKU A;  1YBT A;  2OPS A;  3ILJ A;  1Y10 A;  3W5Y A;  4FWG A;  1C0U B;  3CWV A;  2BOP A;  3J7Y U;  1S1T A;  3HHL C;  2YKM A;  4G3I A;  4KHP J;  2B4V A;  4TYB A;  3K57 A;  3HSJ A;  2IMW P;  4NLS A;  2P9E A;  4NL5 A;  2MKI A;  2YQ3 A;  1EHW A;  1YDL A;  4J37 A;  1VC0 A;  1JLF B;  3T5L A;  1RWW B;  5EHH A;  4TLR A;  2ZH2 A;  3W7B A;  3OFH A;  3JAM C;  5C42 B;  4F7V A;  4DV3 F;  2ASD A;  2ZBP A;  1HK7 A;  4Q44 A;  3HT3 A;  3K0J A;  3HFK A;  5DLG A;  1TMJ A;  2NN6 A;  4CT8 A;  4NXN E;  4NLG A;  2VQF E;  4P2M A;  3T1A A;  2CJK A;  4KHM A;  3Q6N A;  3J81 U;  4M5H A;  2JEI A;  2UXC J;  3Q2S C;  2CNO B;  3QT7 A;  5HQL A;  4OX7 A;  5ETR A;  1L3S A;  1N33 I;  4IZJ D;  1FFS B;  1W2I A;  1YJ7 A;  3MCM A;  1MU2 B;  2HKJ A;  4H4M A;  2KYX A;  3VGS A;  2PEB A;  1ELO A;  5A76 A;  4A48 A;  4M95 A;  2VDI A;  1UVL A;  5DLF A;  4B3T I;  3GLJ A;  1MW7 A;  4QYZ J;  3RW7 A;  2OLW A;  2OPQ A;  5IWA J;  4KGV B;  4WTO B;  4NWB A;  5DRO A;  4JB8 B;  4HTI A;  2UV8 A;  2FLL A;  2IJF A;  2AJ2 A;  1URR A;  3T1Y J;  3JAM Y;  3ICL A;  4LF1 A;  2CQ2 A;  1HNI B;  4I7F B;  3ZC4 A;  4LBI A;  3HSZ A;  2ZHA A;  1FWK A;  1X9M A;  1R0A B;  1IBC B;  2IJR A;  4LF8 J;  1OO0 B;  3JS9 A;  2Y1I A;  3W2V B;  1UJ6 A;  4LF9 F;  3IWX A;  1MNE A;  4IFD D;  1WG5 A;  4JI1 J;  2V4J B;  4IZJ A;  1RAE B;  4O3R A;  3H5S A;  1R8H A;  2V0N A;  4G1I A;  4YOE A;  2NSC A;  2PNZ A;  3RU0 A;  4RKU C;  1HQE B;  4I2Q B;  2B4U A;  4RUC A;  4P2X A;  3KHL A;  1TKT B;  1RT6 B;  1GMV A;  1JMT A;  4OZ2 A;  2DXF A;  3RW6 A;  3V6D B;  2V2Q A;  4DJB A;  3UWT A;  3AA8 A;  3OTC A;  3UVJ B;  4JI0 I;  4G1P A;  4GRS A;  3A8K A;  5J2N B;  4DZD A;  2OPS B;  3PJW A;  4HKQ A;  2NZC A;  3MMJ A;  4C98 A;  1Y4Z B;  1IBL J;  3NGS A;  4OZ5 A;  3GR1 A;  4HY1 A;  5GAH I;  1S1T B;  4NYO A;  4USW A;  3HDS A;  4OO1 A;  1QSS A;  4C4W A;  3WDO A;  4DR2 I;  2YKM B;  5HL7 Q;  5AJ3 F;  4A4J A;  4A8M P;  1SL1 A;  4KBI A;  1OYP A;  4IFD A;  4OFZ A;  4RW7 A;  3LA0 A;  1BQM A;  4LFB E;  1XQI A;  2RF2 A;  3AY0 A;  1KOH A;  4ENO A;  1JJ2 R;  3MCS A;  1WHX A;  3PTW A;  3K8V A;  1XNQ F;  3MMB A;  2GHV C;  4CNZ A;  5K36 A;  2B56 A;  4KQV A;  1URN A;  4B3S E;  2KO1 A;  3H5Y A;  5GMK a;  1IWG A;  2NN6 B;  2RS2 A;  2W8L A;  1B70 B;  4F50 A;  4H54 A;  2JDJ A;  4O4G A;  4CO2 A;  1SKW A;  3FUY A;  2O66 A;  1S4F A;  1FX2 A;  2QA1 A;  4ED5 A;  2ZC3 A;  2GQ2 A;  3EDR B;  4O0I A;  5D15 A;  4DV5 J;  1O5J A;  2LXI A;  4RNO A;  2HLU A;  3QRP A;  1RHR B;  1DQA A;  2VZ9 A;  2F5G A;  1FRJ A;  1RT5 A;  2C2R A;  1FVQ A;  4H4M B;  1YZ7 A;  3I5B A;  3HJF A;  5HJY A;  3TO8 A;  2EK1 A;  4BC9 A;  2ZUG A;  3TA1 A;  3VAJ A;  2CNN B;  3QFH A;  3PS3 A;  5KFN A;  3T41 A;  2HSE B;  2V8H A;  1WKJ A;  5LSR A;  1JJH A;  5E5N A;  3KDO A;  3MM6 A;  3N79 A;  2B4P A;  1PGZ A;  1O8B A;  2V8V A;  2XYH B;  3LWL A;  1N32 I;  3IG1 A;  2DR7 A;  3CJ4 A;  4CP5 A;  4LF4 I;  1NHH A;  2R7T A;  2C2Z B;  1Y5L B;  2CQB A;  2B9W A;  1T05 A;  2XNQ A;  2FVR A;  5DRP A;  2CQG A;  3GFZ A;  4NLW A;  1N