3HULA

Structure of putative homoserine kinase thrb from listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
277
Chain Sequence
SLRIRVPATTANLGPGFDSCGLALTLYLTLDIGAEADSWYIEHNIGGGIPHDETNVIIETALNLAPNLTPHHLVMTCDIPPARGLGSSSAAVVAGIELANTLAELNLSKEEKVRIAAEIEGHPDNVAPAVLGNWVVGAKLDGEDFYVRHLFPCALIAFIPKAELLPDTLPFKEAVQASSIANVMIAAILRNDMTLAGEMMERDLWSQLVPHLAQIRDVAKNQGAYAACLSGAGPTVLVFAPRNLANKLQTSLQTLEIDADVLLLDVEGSGAEVFREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine kinase
publication title Structure of putative homoserine kinase thrB from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 75
structure length 277
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.1.39: Homoserine kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3hulA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hulA01
2VQEI 2ZITA 2EFGA 4DR3I 3ZKBA 1XMQE 4MYUA 2UUCI 2DEJA 1QZRA 4DR1E 3F0NA 3M6AA 2VF3A 2UXBI 5BR8E 1N34I 4X66I 1ZM3A 3OTOI 2X36A 4JV5I 4WUCA 1HNXI 1RR9A 1PVGA 3QT5A 3ZKDA 3K1JA 4OX9I 4RPFA 1XNQE 4WUDA 4DV1E 4DV6E 4LFBI 4K0KI 4JI8I 3H4LA 1Z5BA 1N36I 1FWKA 4MYTA 4DXLA 2E1RA 4DU8A 4DV3I 3QT7A 4JI6E 1XNRE 2V2ZA 2HFUA 1Z5CA 1FNMA 4AQYI 4YHHI 2R3VA 2UU9I 4R1FA 4X65E 2F4VE 4DR2E 4YY3E 4JI0E 3Q1QA 4NXNI 1H7UA 1A6FA 2ZM6I 5A2QQ 1KVKA 1OJ4A 4JI4I 1N0UA 4UTGA 4B3TI 2NPFA 1I94E 4LF8I 4LF6E 5LL6R 5IT9C 1XMQI 4LF7E 4PU9A 1B62A 4DR4E 5GMEA 3V5RA 3LNUA 1Z5AA 3GONA 4KHPE 1Z0TA 3JAMQ 4LF5E 4FN5A 3K17A 3PYFA 2V8PA 1XNQI 1ELOA 3QT6A 4LFAE 4DV1I 4DV6I 2WW4A 3B8HA 4PRVA 1K47A 4X62E 2X7IA 2J7KA 4JI3E 1Z0GA 4HYMA 1MG7A 3QT8A 1HR0I 1FI4A 4DV7E 4JI5E 2UUBE 3PYGA 2VQFE 1U2RA 4JI6I 3J7AM 3WU5A 1PIEA 1XNRI 1IBME 4DR6E 4DV2E 2V34A 4B3RE 3J80C 4DUZE 4X65I 2F4VI 3J7AG 4DR2I 3ZZTA 1DARA 5GMDA 4ZVIA 4YY3I 4JI0I 3T1HE 3JAMC 2HFSA 4LFCE 4UT4A 1N0VC 1I94I 3WU4A 4LF6I 4DUYE 5IT9Q 2LJPA 3WU6A 4LF9E 1WUUA 2AJ4A 3PYDA 4LF7I 1N33E 2UUAE 4DR7E 2UXCE 4KQVA 1FKAE 2GS8A 5LMUE 4DR4I 4WUBA 2VQEE 4KHPI 4DPXA 4XTJA 4DR3E 3ZZ0A 1H74A 4LF5I 1B63A 1J5EE 4DV0E 4FWDA 1S4EA 1H7SA 4LFAI 4X62I 1IBKE 4JI3I 4FWGA 2HHHE 2OI2A 4JYAE 5FLXQ 1N34E 2ZBKB 4DV7I 4EMDA 4JI5I 2UUBI 2VQFI 5LMNE 1D6TA 1XMOE 1RREA 4B3ME 1IBMI 4DR6I 3J80Q 4I3HA 4DV2I 4DR1I 4B3RI 4URLA 4DUZI 4DV5E 4LFBE 5BR8I 2CZ9A 4DPYA 3T1HI 3ZM7A 4LFCI 4PRXA 4HACA 4DU7A 1Z0VA 2UXDE 2UU9E 4P52A 1KIJA 2BV3A 4DUYI 2BM0A 4HXZA 4LF9I 3ZZUA 5IWAE 5FLXC 3B82A 4DPWA 1FJGE 2HKJA 1N33I 2UUAI 4JI1E 4DR7I 1Z59A 3T1YE 3PYEA 1NZ0A 1HNZE 4GKKE 1ZM9A 5LMUI 1ZM4A 4LF4E 4DPUA 1ZXMA 1J5EI 4NXME 4DV0I 1NHHA 3J81Q 1H73A 1H72C 1IBKI 4DV4E 2HHHI 4X64E 4JYAI 2A2CA 1KTVA 4USKA 4JI7E 4JI2E 4B3SE 2A2DA 4DPTA 5LMNI 1HNWE 1ZM2A 1XMOI 4B3MI 4GKJE 1IBLE 1ZXNA 4DV5I 2E5LE 1N32E 1NHJA 4DR5E 4FW9A 4M1KA 2HK2A 2DEIA 1HR0E 1XHKA 4ED4A 2UUCE 1UEKA 3LTOA 2HKEA 3B78A 3J81C 2UXDI 4HACB 2UXBE 2V2VA 2Q2EB 4X66E 3OTOE 4JV5E 5IWAI 1HNXE 1Z0CA 4HY1A 1NHIA 1FJGI 1EI1A 4JI1I 1Z0BA 3WU3A 3T1YI 1FWLA 1S16A 4OX9E 2R42A 4P7AA 1HNZI 4GKKI 1Z0EA 1PKPA 4Z7YA 4K0KE 4JI8E 1BKNA 3D4JA 4LF4I 1MX0A 5L3JA 1N36E 2V2QA 1KKHA 4NXMI 3HULA 3LPSA 4DV3E 2BM1A 1MU5A 4JG4A 1Z0WA 4DV4I 4X64I 4AQYE 4YHHE 2XEXA 4FWHA 3CWVA 4JI7I 4JI2I 1VISA 3V2UC 4B3SI 1HNWI 4NXNE 4USMA 4GKJI 1IBLI 2ZM6E 2UXCI 2HK3A 4Z7CA 4JI4E 2E5LI 1N32I 1EA6A 5A2QC 4B3TE 4DR5I 4LF8E
chains in the Genus database with same CATH superfamily
1SI9A 3GQCA 1H2TZ 5ADZA 4DR3I 2YVSA 3OHBA 2LECA 1S77D 3UCZP 3QFHA 2XG8A 3D6MB 1SJ4P 3ILLA 2J5AA 1RT3A 1BWEA 3CSKA 4GKJJ 1GTEA 1RSCA 4E8UA 4J90A 3TP2A 4KBIA 4DV4F 4X64F 2CG8A 5DROA 2AEFA 4LIWA 4P7VA 2J9DE 4OI3A 1FHTA 4ZJLA 2CQ3A 1S72S 3A1YG 2HQ3A 1FWKA 4CO0A 5JMNA 3C14B 3SSRA 3IMQJ 3EICA 1Z5CA 1VFJA 2AEJA 2F4VE 5KFUA 1VK8A 2AT1B 4ERDA 5M2PA 4K59A 3LWLA 1UWAA 1EQMA 4KSEB 3LAMA 5G0RA 5A2QQ 3KWMA 4ED2A 3G2XA 4F2SA 3DLEB 2B4PA 2Y1RI 3BR8A 2IERA 4M63A 4C48A 2FHOB 1YHQS 3DCAA 4OX9F 4LF7E 1UZDA 2CGEA 4K0KF 2R2SA 1SJRA 2DXEA 5J2NB 1X4AA 3PCOB 2LCWA 2BANA 2R8IA 1UJ5A 3CCLS 5DO2A 1R6MA 1F9HA 2HGMA 2PGCA 2XSFA 4O3QA 1UMJA 4OJHA 4PRVA 1MG7A 1YG0A 1QVFR 4CO3A 4TYBA 3CD7A 5F3TA 1HBNA 2LXUA 3UDCA 4CCHA 3SCIE 3W5YA 4DV7E 3JB9k 2X1BA 5HVHA 3PYGA 4MQYA 3TUIC 4RNHA 5ETRA 1SJFA 2VG5A 3I5BA 2JZ5A 2YH1A 4PUOB 4WP9A 3UN5A 2F8MA 3IRXB 3MHYA 3FNNA 1SL0A 3Q89A 4I68A 1UP1A 4ELUA 5D4OA 2ZVSA 5DG8A 3W9HA 2CQIA 1FVSA 1NKBA 2JEAA 1SQEA 2GAHC 4N3OA 2CADA 3G71S 1UVJA 4LRCA 4DL7A 5L46A 2FJAB 1W2BR 3I9ZA 1LFPA 2BKOA 1IQZA 4QR1A 4DR4I 2E5JA 3B54A 3HSZA 5HAOA 1RHUB 2GGPB 4CLZA 1OYEA 5D0HA 2COLA 5H9FK 2ZVIA 3H8YA 1GTHA 4A47A 4NZ0A 2QZ8A 2HWIA 2Z2MA 3Q6MA 2ZE2A 3GFHA 3R7SB 1IKXB 3W66A 1RT5A 2DITA 4LSNB 2B8PA 4DR4J 1C1CB 1ZH5A 3KRNA 3K5MA 3CULA 2AMCB 4DFMA 4ECZA 4WKRA 2QT7A 3M1VB 3MM8B 2EKNA 2QX0A 1U0HA 4OI0A 3B4DA 2ASYA 2B7BB 2IAJB 5KFKA 3T19A 2EBGA 2GHPA 1CVJA 5HROB 5KFMA 4OZNA 2GCFA 2IA0A 3L7OA 1J5OA 2V9WA 1TVRA 4NXME 2WRMA 3QZ8A 2ILZA 1PC5A 5IV3A 2FJXA 4P9SA 3NGSA 1WC4A 4IDKB 1GH8A 1XR5A 3MECB 2YQ0A 2Y0BB 4DS4A 1FK9B 2UZAA 4ZVUB 4RBUA 2VD3A 5KFGA 4OZ3A 3R7BB 4DV5I 2Y3YA 4BWJA 4R5PA 1G7CB 4C9DA 1XHKA 4U9RA 2WONA 2DNHA 1FFSB 3LTOA 3UD3P 4WP3A 4WP8A 1JNZB 1HD0A 2Q2EB 1S59A 4DV0F 1Z0CA 2RQCA 1H38A 5ETVA 2RMLA 1SUQA 4P71A 1U1OA 4DV5J 1S16A 4P7AA 2C2RA 1RT6B 3CJ2A 1N5QA 1K44A 4NOHA 4Q2LA 5LMNF 1VI7A 3J80Y 1FX2A 4YB5A 2HFZA 5THWA 4LR8A 4RW9B 3IM8A 2P5VA 3JYTA 2AYGA 2XEXA 4CO5A 1VBXA 2W9BA 4M95A 5C42A 4BA2B 2N82B 3W65A 2A10A 1HNWI 1WDTA 2KFZA 1LW2A 3FCWA 4LCGA 2YNIA 1SL2A 1XMQE 3QATA 3GV8B 4YOEA 2DISA 4RW8B 2VL1A 3OUYB 4J9MA 4MK9A 1JXLA 1HNWJ 4WUCA 1T94A 2L08A 4H4OB 2DR7A 2ZZMA 2U1AA 2CNKB 5KFOA 1RYSA 1GMVA 1RTIB 2OPRA 1HR0J 2W7PA 1W25A 1H7XA 1MLAA 1YJ9S 1OPIA 5J2PB 4MYTA 2BE9B 2JC0A 4ZCMA 3K5NA 3LP2B 3MAAA 1R7IA 3PJ9A 5F8LA 4NLSA 1ZTTA 1PO6A 2BXJA 2ZOMA 2RF2A 1MNEA 1OPZA 2GNKA 1BE4A 3KG1A 3TJ8A 2GQ2A 5DETA 1VRTA 5RUBA 3UHMA 5M2UA 1OJ4A 4LIRA 4AM3A 1ZZNA 1JLGB 5FD1A 2NPFA 3CCES 3S01A 3CDJA 2XBPA 4DX8H 5KT5A 1AFIA 5K8MA 3LP1B 2KVIA 2IMWP 2CPYA 1WACA 2JLGA 4IO1A 2NN6E 2GMLA 1PSDA 4QQBA 1C0UB 2MEWA 1YDLA 3CCZA 3CCMS 5CYJA 1ACMB 4I2QB 2XO6A 5LL6d 1RHKB 1GMWD 2HNZA 5DJBA 3KYLA 4DV3F 3UN3A 1LWFB 1YQHA 3WC0A 4LCFA 4ZP9A 3M2VA 3TUZC 4DG1A 3M4XA 1I3OB 2RKIB 2JC1A 4YHHF 1DTTA 4DL5A 2RH3A 1M1KT 2GJ2A 4OYMA 3PTWA 5CZVA 4X62E 2JNJA 4NLXA 4OZ1A 3C8YA 4CP5A 5HBMB 3FUYA 4KB7A 1N6QB 2VQFE 2RU3A 1I1GA 4KHRA 2HQDA 1RTZA 2DRDA 1G6BA 1JB0C 3DLJA 1M5VC 4LREA 2QA2A 1TFWA 3CMQA 1VQSA 4RU9A 1WOOA 3IS9A 3ULHA 1V3RA 3CUNA 2UVWA 5KFCA 4XAKA 3M8ZA 3KHRA 1JIHA 4KYZA 1F9FA 2KT2A 3G86A 2M8DB 2B4UA 2GS8A 2P9CA 4HT7A 3SV3A 1ROFA 1IR0A 5F0UA 5MAOA 3C3LA 1OMSA 3V6HA 1UETA 1SIZA 5T7LA 4DBQA 3TEHB 2XZWA 1H7SA 2N3OA 4DG1B 4LFAI 2PO1A 3OT9A 4DR2F 1UFWA 3C15A 2PMHA 2IRXA 2UUBI 1VQ8S 4IFDA 3C2PA 1D6TA 5J1PA 3GR0A 4DR6I 4CH1A 2V67A 3RJMB 4I3HA 3KLFB 4QOTA 5A8WA 4F0KA 4DPYA 1UAWA 1RZMA 4Y00A 4LFAJ 2VICA 3TZZA 4HACA 4KC5A 1DJ0A 2K06A 2ABYA 2BV3A 2GA7A 2UUBJ 5HATA 3AFGA 4ZVGA 5IWAE 4KGMA 2V68A 2JEBB 4DR6J 5GADI 3DHXA 3BV8A 3FBFA 1O51A 2LDIA 1WC5A 1JNRB 4CLFA 1ZM9A 3TW0A 1SVDA 4JI5F 4ZPAA 4GVBB 3ITHA 3HVTA 3MEGA 1PCAA 4OHVA 2QTWA 5DRPA 1AUDA 2BQ3A 1XN9A 3CC4S 5AJ3F 2KZZA 1XEZA 3SMZA 2AKWB 4DN0A 1ICEB 3K5OA 3RGIA 1REVA 2YNHB 1ZXNA 1KQGB 2C2KB 3QQCD 4YB7A 1NK4A 3HKWA 4Q0BB 1RB0A 5B09A 5HVFA 3I87A 4QNJA 3T5JA 4QWEA 2NS1B 2F63A 4KTQA 4FNHA 3IXQA 4HACB 1N34J 2R8HA 3EVMA 5IS2A 4IOBA 2YWFA 4PEOA 5GAEI 3J7ZT 3OTOE 3THPA 3D0IE 4C11A 1QSLA 3HF5A 2Y0SD 3I4HX 5JEAC 2VFUA 2EVZA 1Z0EA 3LALA 2YH0A 2W2PP 1BGXT 1MX0A 4H4MA 3EPGA 4B3MF 2FJBB 2VHGA 1RT1B 3LPSA 5IT9U 3N6MA 3FZ2A 4LQ9A 2AE8A 1U2FA 1P27B 2VPWB 1C0TB 3V4MA 2LEAA 3W8GA 2C3YA 3OTEA 4CYUA 4ZK7M 1V3ZA 1D1UA 2ZJQQ 2R7VA 2E5LI 3N9UC 2ZUAA 5EGYA 2KHDA 3MEKA 2CG9A 5DRQA 3RTVA 3GILA 3ET6A 4OZJA 5L9XA 1RT7B 4DSJA 4B3OB 1XTZA 4WWSA 6FD1A 3PW7A 2J9DA 2MKKA 2DTJA 2WZ1A 4CI0B 4CH0S 2E5LJ 1TQLA 4OMFG 1VQYA 2EFOA 1UFKA 2W9AA 2MLZA 4JI7F 3X1LB 3LGNA 1QTMA 2YX7A 2E1CA 1Z5BA 4NASA 2E1RA 1ZS6A 3DGVA 2C3OA 4JI6E 3EDQB 2WW8A 4RW6B 4UF4A 3G82A 1VDHA 3TA1A 4Z37A 2DRBA 4R1FA 3EZ5A 3P49B 2UV8G 4ZPWR 2KM8B 4NMLA 4DQSA 4ISAA 3AT1B 4Y34A 4NXNI 5A6PA 2HRTA 4PG6A 3MM5B 1I94E 4X66F 1HNXF 1NBEB 2A6MA 4LF6E 2HG4A 3PY8A 5C25B 2O1PA 3EYZA 2PO0A 1GMUA 1UA1A 2QA1A 1JX4A 4KV8A 4MKVA 2LEBA 1VBYA 5KT2A 2JHEA 4F67A 5KG3A 1KS2A 3TAMB 3OD2A 4UOHA 5A8RA 4B9UA 2MQQA 5DRRA 1M90T 4KPYA 4NXNJ 2QL7B 4C8KA 4Q2MA 4ZVPB 3CD0A 1BQMA 3UDVA 4U7UD 4PG4A 1TTHB 3PIPQ 4IO9Q 2J7KA 1HWJA 5AE1A 4DZDA 2BR2B 4PCQA 1U4BA 1RBLA 4OZEA 3LW5C 3A3OB 1JLBA 3J7AM 4DSFA 3HD2A 1PJ7A 3BB5A 3BPSP 3W61A 4DUZE 1FEEA 3FFIA 3J81Y 2XCAA 2MB0B 3CD5A 1JQGA 5C24A 4YY3I 1B7FA 4JI0I 3IR5B 1FFGB 1GNKA 3BQ1A 1CS4A 4BLGA 3MMBA 2QG9B 3WU4A 2Q1LA 4WIQA 4RBVA 1RLCL 1TL5A 2LJPA 3WU6A 3BSCA 4WKYA 2O3DA 4F2RA 1CULA 2H48B 2M52A 4WFXA 4MT1A 5HANA 1JLEB 4OI1A 3H5UA 5HP1A 4YY3J 4JI0J 1NJIT 4OZ5A 2UUCF 3CMES 3GMEA 1KDNA 1LQ9A 4ATNA 1Q8BA 3FBBA 3PVXA 4FWDA 1E6VA 3M9NB 2CXEA 4WE1B 5FLXQ 3CIZA 5K14A 4QYRA 1MMDA 2IM1A 3T3FA 1R0AA 1URNA 2HHQA 1WNEA 1RP5A 4EZ9A 1HWUA 4OJ3A 4NZ6A 2MKSA 1LOUA 1RTDB 1TELA 4N76A 1R89A 4YUDA 4HHUA 4HLBA 1NPPA 2RHSB 3O2IA 2UXDE 3AOBA 2JE6A 3FDSA 4ZKAA 4F4YA 1S97A 4LF5F 3RBDA 3GIIA 5FLXC 1OYSA 2DH7A 3KLGA 4OHZA 2A0FB 2E1PA 2XNRA 1TKXA 2DNKA 2ZD1B 2MSSA 5E7OB 4TQRA 2WTFA 3HLUA 1UPPA 3LO3A 3EZOA 2N3LA 2AZ3A 3R5CA 3GG1A 2B51A 3MI7X 2ROPA 1H72C 2MKIA 3DRYA 3RBXA 4FBTA 2FIUA 1GMWA 2AWZA 2H5EA 2DH9A 4JI2E 4J3DA 4N41A 4M5HA 2RDJA 4PR6A 3OFFA 4ZLNA 4GC7A 5CCMA 3FZBA 2VQEJ 5C2GA 1T05B 4M1KA 4D3GA 2DEIA 2Z2ZA 5JEAD 5KFBA 3P3CA 3LGMA 4ED4A 1WKKA 4OJ1A 3TJ9A 2V94A 4BDPA 4OYAA 4MIBA 2CIMA 3DLLQ 3HT3A 1KOOA 1FDAA 4S0MA 4ELTA 1Z0BA 5HI7A 2PNZB 1F1BB 1SV5B 3UVJA 1KLNA 1TKXB 3QSYB 2A6OA 4QIEA 4AXJA 3OVAA 3U27A 4NI2B 3IBWA 2MZSA 1N36E 2V2QA 4R0JA 1KKHA 3R5BA 2HQIA 3C46A 3RUBL 3GSIA 1F5CA 4DV4I 2L48A 4X64I 1EQ0A 2KG0A 4AQYE 1RWOB 3UWTA 4DFPA 1S1TB 2P2CB 3P45B 2D69A 4NA1A 1RA6A 2DB1A 5KFLA 2HQFA 3C66A 4IZJB 3M2RB 5IM0A 1HI0P 5B0GA 2H4YB 4LOMA 4DQIA 5KFHA 2EFGA 3BZQA 2LLZA 4MH8A 2DEJA 4DV4J 3W2WA 4X64J 4QCLA 5L9NA 4OJGA 4Y6IA 5LM7E 2Z2YB 2X36A 3J80U 1JJCB 4ECWA 3QT5A 3BN4A 2PI4A 4OX9I 4U67Q 4DV6E 4K0KI 5E5NA 4ECTA 1R8BA 3FSIA 1YJUA 1F5AA 4DN9A 5DGAA 2WOMA 2CJ9A 2M3DA 2NPIA 1X5PA 3RG6A 2RU9A 3NWRA 5HMZA 2HFUA 3M05A 4RW7A 3CJTA 3GSDA 1O5JA 1SCJB 3MPUB 4TN2A 3OFHA 4ZN3A 1U47A 1HBMB 3I4PA 2X51A 4OX9J 1KVKA 1W26A 4NCGB 4Q7AA 2ZJPQ 5I3UA 4K0KJ 2NN6A 3G8TA 3DD6A 4CLKA 3PJXA 4OYBA 2WVFA 1LWEB 5HJYA 3Q8SB 2V63A 4TU7A 4I67A 3EM1A 2V8DA 3EWGA 4I2PA 1JLQA 2D3O1 3U1LA 1U1NA 4KE5A 3CCVS 4HVZA 4PWDB 4O0IA 3UNYA 2VPZB 2EEYA 2KXHA 1B7YB 2WBRA 3TAQA 4FN5A 4NZ7A 1HW8A 4ZVEA 3WHIA 4CWBA 2A18A 1U1KA 2Q3PA 2E5IA 4K2XA 4NL5A 4JI4F 1JKHB 3VCDA 2VOPA 2D3UA 2V4JA 4DV2E 1HFEL 2W7OA 3KG4A 5DQIA 5CH7B 2ZH6A 1B0VA 2XGQA 2OH2A 1V5VA 2MQPA 4ZPDA 4LF2A 2GQQA 3C6TA 3VAIA 3L7ZA 3BN7A 4UT4A 3POTA 1FJCA 2CPFA 2QN6B 1T3NA 2NN6B 1WC1A 3GJTB 1NK9A 3PYDA 2VIHA 2IC3B 2CZVC 2ZC4A 4DR7E 2I5JA 5F8IA 1KLMA 1FKAE 1PG5B 3EUNA 4YFUA 2D1CA 3BM7A 1JXVA 1XIQA 4B9TA 1RHYA 2QIFA 1T95A 4PKDB 4J9RA 2W2MP 4NX9A 3I6PA 4K4YA 4ICLA 3S8SA 5DRKA 4KAIA 1TV6B 1YJNS 2BDPA 3MR7A 4DJBA 2NLWA 1WEZA 3D3BJ 1RQ0A 1KONA 4Y28C 2PC6A 3MD1A 4A8YA 4ECVA 2PO2B 3PW2A 1FJ7A 1C1BB 3KJVB 2CZ9A 5K8PA 1JLAB 4M94A 4L3NA 2ASDA 3C6TB 2VFSA 3ZM7A 4BA1B 2DK2A 2C1EB 4MFBB 2OJ3A 3CCJS 2OGUA 3POTB 2CPDA 5DZ7A 1SQFA 2R7WA 4RNOA 3D2WA 2BJDA 5A0YA 4KT0C 2XWYA 3OL8A 3HJFA 2QJ3A 3TZWA 2JFKA 3OTCA 2Z58B 1RCXB 5EUHA 1NDLA 1VK3A 2OD4A 1ZXMA 1G3OA 2D9PA 4DR1F 4DV0I 1UEVA 1KFDA 1X31C 2HAIA 5CA5A 4IH6A 2G13A 3QAUA 4WBFA 1KTVA 3MCMA 2CPZA 4HHJA 4FXWA 1LXNA 4ZHRA 3GPAA 4MIAA 3GYGA 5LMNI 1CJTA 1ZM2A 4IG3A 1LFWA 1A6LA 4DUYF 1N32E 2B9YA 1R43A 3UN2A 1VIXA 4O3RA 4FS2A 1HYSB 3PKMA 4DV0J 2UUAF 1TKZB 3FGVA 2ALYB 2Z0GA 2LA4A 4I1TA 4ED8A 2FGOA 1Y0HA 3ZTRA 4F25A 3DM2A 4C98A 4OX6A 5FDLB 3AHPA 5ETMA 4EBCA 5LMNJ 1IJFB 2NR0A 1QDUB 2ZBIA 2CDQA 3Q86A 4IQXA 1HQEA 1QUVA 4KKOB 5A0YB 4U6PA 2OEKA 4JI8E 3PRVA 2UP1A 2L9WA 3TZYA 4K4SA 3MR6A 3EXYA 1MWQA 2MKCA 2HIQA 4Y2AA 3HO1A 1K1SA 4ED5A 3CJ5A 1RAFB 2FD2A 9ATCB 1NSAA 3CW2C 4QJVA 4OKGA 4ZHRB 4ILMA 1YHCA 2V5HG 2HS4A 2KXFA 2ZM6E 4Z7CA 4ES2A 2M7SA 4KGVB 2G1HA 3RZAA 1VQKS 2KN4A 3J81j 3TRGA 1VC5A 4MYUA 5IZHA 3ZZZA 2G2OA 2YKMB 3C6UB 2KT3A 1HA1A 2OPSA 5KOXA 4YN3B 3ZTQA 3UPFA 2HVHA 2K3IA 4L72B 4PRFA 3MPDA 4H4KC 3GWCA 3TA0A 4BC9A 5F3ZA 1RTJA 4LSLA 2JH3A 3NS5A 2DNPA 1HBOA 4L75A 4RZRA 4U95A 1X4EA 4DV3I 2ZWPA 2V2ZA 3PACA 5MLCV 3HHLC 4YHHI 5ETOA 1LK5A 4ZCKA 4DLGA 3ONQA 1RAIB 2G1DA 2AYMA 4B9NA 5HMXA 3JS9A 1A6FA 2WBMA 2QL5B 3K59A 2I2YA 3HP6A 1K73T 1SPBP 3CJKA 1E3HA 3RAMA 4WJBA 3NGUA 4DV3J 1RLDA 2F7VA 3MMCA 4YHHJ 4XPEA 3Q83A 5E3RA 1T9UA 1FJEB 2DNGA 3N4WA 4U8YA 3GJRB 2NYIA 3K17A 2HNYA 1Y00A 3PS2A 2ZEJA 2G0JA 2GO3A 2XWXA 2F65A 1R31A 2WW4A 1VHIA 2X7IA 1S1VB 1KNZA 4JI3E 2MY8A 2GVDA 1RTJB 1FDDA 1GFWB 3TAPA 4OO1E 2FJEB 4B3TF 3WU5A 1IBME 2VDHA 1N52B 3FQLA 1A7GE 3BBBA 2DNOA 3OBIA 2XYPB 4WU3A 2CJBA 5BYSA 4DR2I 4EU0A 2CRLA 1M5PC 3IR7B 1N4LA 1F2GA 1S7HA 3BF4A 5BJRA 3DDNA 1FRMA 3R8YA 1UVIA 1RAGB 3FEXB 4F4AA 2CPEA 2Y8WA 1RWUA 4LF9E 3N79A 2AU0A 3F73A 1H3DA 4DDFA 4F0HA 2YWWA 4DX6A 4DR2J 3KDOA 3G87A 1N56A 1DBDA 2DYAA 3E01A 4DPXA 5GAGU 3SV4A 1S1UA 3NG8A 2KRBA 3OHAA 2F4VF 4OV1A 4FWGA 5KFVA 1TUGB 1TL3A 1CJUA 3DFEA 3W3SA 4JI5I 3JSYA 4YR0A 3HX9A 1RREA 2DGTA 1ZA2B 1HWLA 2CQPA 3KKFA 1XR7A 1WDDA 1X4DA 1UTAA 3M8SA 4GO7X 3KDNA 2DVIA 4J9LA 2JLFA 4ZPBA 3UR0A 3EGVA 4RWXA 2DR6A 4XPCA 2KFNA 1YKWA 2YWKA 4KFBB 4JI5J 2EW9A 1C4AA 5KT6A 4Y2KA 2XO7A 2VODA 3M8QB 4BHQA 2JRSA 3V4IB 2KXNB 3CCQS 2W01A 3MEEB 2H4WB 2FQQB 1H0HB 1P1LA 4ZVRB 3NCQA 2DPJA 1HNZE 3ZC4A 2CVIA 1U7LA 4QBUA 2NXCA 4TNOA 4DV7F 2JEGA 2EXUA 3GB0A 4DPUA 5AJ3J 3C19A 3K8VA 1S6UA 3E01B 2HWTA 2CJYB 2JEFA 3L7UA 4QU6A 3NY0A 2MLYA 1X9SA 4ANCA 3MOJB 2LQ9A 3VF0B 4KH1B 1NK5A 2C37A 4ZCIA 2UXCJ 5KFWA 4B3MI 3M32B 3QJPA 2GHVC 3DOMB 3JAMU 4DR5E 2FZKB 3ZFVA 1K0VA 1CC8A 3VAGA 3K7RA 2C39A 3VZHA 2AJQA 2UUCE 2W2QP 2BJ1A 3NMRA 4F04B 1WC3A 1Q7LB 1WF1A 3N5FA 3G4SS 3BYRA 4ED1A 2W2NP 3T6JA 1FO1A 4F0MA 4OFZA 3Q8YA 5KT4A 4B3MJ 2EK1A 4RW4A 4N47A 3WU3A 3R5AA 1HBUB 3LGHA 1DHMA 2R42A 2OHDA 3SI8A 4Z7YA 1TZ0A 3D4JA 3GLLA 2HRUA 3P5BP 3M9OB 3P96A 1EKSA 5DDPC 5H9EJ 2EPIA 1Z0WA 2NSCA 3T5HA 2J6SA 4RNNA 2ZKUA 4J9SA 4FWHA 1ZAXA 3KLHB 4PWWA 1N5TA 3T5KA 4JI7I 4MAKA 2XMVA 4NLGA 1S9GB 1SH3A 3IP0A 2ZH1A 2WP8A 2ZBCA 3PNIA 2DR9A 2M9KA 1FE0A 3KLEA 2B5JA 1Y5YA 2E66A 3BYPA 3M7VA 2KKHA 3NAHA 3BBFA 3R5DA 4RUAA 3LH2S 2C38A 2HAFA 2N4DA 4JI7J 4IFVA 2VBWA 3RB4A 2HHSA 4X66I 4FNIA 4NXMF 3S7RA 3RRGA 1HNXI 1UZHA 3HHLD 3DN9A 1KC8T 1LWXA 3FC9A 4DV1E 2HFNA 4E2FB 2AGQA 3IO1A 1CJVA 2EC0A 3NL0A 3RYLA 4RNFA 2OELA 1DTQB 3VR1A 1X9WA 4O3SA 4BBYA 1AXQA 4EBDA 3KHHA 1EIYB 1WG5A 4DI6A 5ELWA 4NLUA 4X66J 4IFYA 1HNXJ 2MQ8A 3KJFB 2GQ0A 5I42A 3M30A 2VBYA 3BPDA 2QRRA 4X4NA 2B4OA 3DOLA 1N48A 3HFZB 5A8KB 1ZPVA 4PPDA 1VC0A 1HNIB 4F4WA 3L09A 2MKYA 2KRRA 3MMAA 2XB2D 3UFCX 3KLEB 2CPXA 2K7KA 3AD7C 3AXMA 1X4FA 3FJ2A 2CQ1A 2JWNA 1WHWA 2SXLA 1S1WB 4JV2A 2CFXA 3IFEA 3VGVA 3IWNC 4HHHA 4PPZA 5IQQA 1PILA 1YRXA 3CDWA 4TVAB 1VIOA 4ENOA 2HBYB 2ZOFA 4NYOA 2DNRA 1KVIA 4N8OA 1EKRA 3AA9A 4O44A 4MJKA 3AJ2A 4B3RE 2K1RA 4OZ2A 4OZLA 1P42A 1XMQF 4G1QB 5KFJA 1XR6A 3T1HE 1F2HA 3M30B 1U6BA 4WFAQ 5E3CA 5F8NA 4NMXA 3RB6A 5IT9Q 3BQ2A 2RT3A 2QMWA 3WX8A 2WNRA 1WSVA 3FMBA 4K4WA 1NH7A 1FRLA 4FDFA 2BKNA 1Q95G 3QLHB 1Q8LA 2R7RA 2CVEA 3MDFA 4A48A 3VWSA 3ZZRA 1JLCB 3JQMA 4G1PA 4YDXA 5DDOC 4LF5I 1J5EE 5L8RC 1Q82T 4J9QA 2WK4A 2RDDA 2PEHA 3FSXA 2LDYA 1D09B 3VAJA 1USVA 4F50A 5D77A 1A9NB 3JSMB 2HSEB 1NDPA 1S6OA 4Y0FA 2MHNA 3A3NB 1BHNA 3KLVA 2J0QD 2QLXA 2J8AA 2K1RB 3AB2B 5HMWA 4LF5J 2DNZA 3Q22A 1ZBTA 3OR2A 3S6EA 2Q6CA 1X5TA 3VGUA 2LU1A 1B4SA 2CQCA 3HJCA 5KG0A 1OYDA 1XWLA 4JI1E 2O67A 5EWEA 4LF8F 5LMUI 5ETPA 2XMMA 1S6PB 2JSXA 1FVQA 5HLFA 2IOPA 1BMQB 2F4FA 2D74B 1S9EB 5I3PA 4IKAA 3BO3A 3RB0A 3I96A 1SC4B 3TX8A 3NNCA 3ISNC 1IBKI 3QIPA 3W5ZA 2MPUA 5A76A 2O01C 4A4JA 5D8HB 1N8RT 4Q45A 1X0FA 3D28A 3OV7A 3TA2A 1IBLE 5LMUJ 2QSFA 3LP0A 2V2KA 1QAXA 3P4UB 2AD9A 3QO9A 1Y60A 2CKWA 2HK2A 1W7WA 2WSCC 1IBKJ 3MWBA 4WF9Q 3HZGA 4OV6A 4IFDC 3VV2B 4EO6A 4OQJA 4USUA 2NYHA 3VQSA 4HEA9 1PYSB 4HY1A 1E6YA 2MZ1A 2YKQA 3QSIA 2ZH2A 2IY5B 4P2XA 2CPIA 4PWUA 3EPIA 1BKNA 2H5JB 5A6WA 1HHTP 4NLVA 2E29A 3JTPA 4HDHA 4Q5VA 2UU9J 1SKWA 4KHPF 4TYAA 2MSTA 3JTNA 2VG6A 1DAXA 1TL7B 1M5SA 2YNGA 5EN1A 3H4DA 4Q43A 1R6LA 2KT5A 5CYQA 1RHQB 3CCSS 3CT9A 4EYIB 1VQLS 5KFNA 5IWAF 3PEHA 2R8KA 2GIRA 1DQ8A 4OLPA 3PR4A 3I0RB 1FFWB 1YRUA 5K8NA 3DI6A 3KLIB 4DR1E 4BWMA 1TKTA 4DOZA 3M6AA 3M85D 3VVUA 3CCRS 1IKVA 2UXBI 2MGZA 1X5OA 2RB7A 2BRKA 1WF0A 2DXDA 3K58A 2YX4A 1ZAVA 2EBEA 1N88A 1QM9A 4AT1B 4KQZA 1RABB 3OSPA 1QY7A 3M6WA 3BGFA 3H4LA 2HMIB 4ZA1A 1IXKA 4ER8A 2CNNB 5CYMA 2UXBJ 2ZKTA 2BEFA 1FRKA 1UW9A 4X65E 4DHVA 5KFQA 3H0PA 2VG6B 3A3PB 3IWLA 3KTQA 4M5GA 4JI4I 5FLXY 1N0UA 1SJQA 1TUWA 3FRYA 3OTOF 1RWPB 3BH6B 2H5IB 2VG7A 2KM8C 1U8SA 2IRYA 3PW4A 1Q4RA 2HEKA 4J9OA 4LFBF 4G6VB 3SCJE 1P6TA 4ETXA 3Q8QB 3J7AN 3CXCR 1M1GA 1TKTB 5KG2A 4F7VA 1TL4A 4FS1A 3D1HA 3GONA 2ZHAA 4EGLA 5SZTA 1UDQA 4YB6A 2AHOB 5F41A 4OI2A 4UQGA 4PQAA 4JI4J 3MTJA 6AT1B 3QNWB 2AYEA 2F3JA 5B0BA 1LV5A 2U2FA 3DYAA 2AJ0A 3MM6A 3JQJA 4MDTA 1NNDA 1VQ9S 3U7JA 3I9V9 3QMQA 2Y1JA 2VZ9A 2DNQA 4V1Ak 1U2RA 5KFTA 5KG7A 3KK2B 2FY1A 5BR8J 2V34A 4P73A 3R97A 2DHXA 2F1FA 4R0EA 4E0DA 3OJUA 4JOUA 3DU6A 4LFCE 4M5DA 4OZ0A 2L41A 3NS6A 3G8QA 2VFTA 1HQUB 5AXLA 3V81B 1MWZA 2A3JA 5J2MB 2YPZA 4TXSA 4CNZA 1N33E 2J76E 1R8PA 3GIJA 3TEGA 2BACA 3P06A 2BJ7A 1WEXA 3FKBA 3IA0A 3CCTA 1UVMA 5ETKA 3M8PB 1NZAA 1M0SA 3MUMP 4H4KA 1G1XA 2DNMA 2Z5BB 2L9NA 2C28A 4OO1B 2OI2A 1CQNA 4EMDA 3M8RA 3MCOA 1UA0A 1XMOE 1SC1B 3CWJA 1I94F 2R7OA 3HFVA 2BQUA 3J80Q 3ILIA 4DR1I 1KEKA 4LF6F 2IDEA 1TKDA 2E7VA 4LSZB 3PW5A 3PX4A 2RJZA 3OR1B 4YDDB 3C14A 5LT5A 3P6YC 2EWHA 2YKNA 4L6V3 4LMZA 2JT2A 3OXGA 4BCAA 2AF6A 5B0EA 4DU7A 4EO8A 1Z0VA 4DUYI 4HXZA 1EETA 5EL9A 3PHTA 3NGTA 3TUPA 3ISND 1FJGE 2CPHA 2QMXA 2UUAI 1Z59A 3EGWB 5C0XE 1V9OA 3DLEA 3Q2SC 4ZVFA 4GKKE 1C2PA 3CJSA 4XTTA 1ULRA 2XLIA 1PGZA 3BGUA 2Z57B 1DFDA 3SBMA 4DUZF 3AOAA 5J2NA 2B9EA 1NK8A 4B3SE 1VMBA 2UUAJ 1YWXA 2CZ4A 4IFDD 1EB0A 4O4GB 4EI2A 4X4QA 2MDAA 2E5GA 2C2DA 3MCNA 4CLSA 4DR3J 3GIKA 2ADBA 5LSRA 4DX5A 2ROEA 1IKYB 4PXDA 2OSQA 2FLNA 4PUOA 3CJRA 4AIMA 1RKJA 5F8MA 1F0XA 3WZ0A 3IRXA 2YKNB 2KH9A 4K7QA 2XMTA 4O3OA 1LEOA 4O0NA 5K36E 3FCHA 4JV5E 3A8EA 1T03B 1EETB 3ZO7A 4CNYA 2VJVA 3DLGB 1IUJA 6FDRA 2KL8A 3NBPB 3T41A 2B6AB 2ZC3A 1HWKA 3NWGA 2PE8A 3MUVP 5F8JA 3FEZA 1QSSA 1RWXB 4B08A 1LKZA 3V6DB 2GGPA 1VISA 2UXDF 1OIAA 3B4MA 1D8ZA 5A2QC 4NLYA 3PXGa 3L95X 1IKXA 3MZIA 4IS9A 2QSWA 1ZA1B 4TU9A 4WXWA 4LSNA 1SKSA 1C1CA 4ZIVA 2M2BA 3ZTSA 4F3MA 1Y6ZA 2VF3A 5EX3A 4ZMMA 3R6LB 2Z2LA 3M1VA 3MM8A 3OTBA 1RK8A 3HVAA 1XNQE 1YX2A 3D6HB 5L1IA 1S5ZA 3IG1B 4JI2F 2X3DA 2ZH8A 3BDPA 2IAJA 2M70A 2VV5A 2UUTA 5HROA 2JFDA 5B0FA 3QT7A 3MGJA 1XNRE 3R5GA 2GJIA 3PDNA 3IN5A 3BJYA 4ID5B 2EC2A 1EARA 1TMMA 4WCEQ 5T14A 1FCAA 4B3TI 4TY8B 1MSWD 4KR0B 2ACYA 2ZBRA 4IDKA 3I5CA 3G96A 3MECA 4Y3CA 1NHUA 1FK9A 3NS7B 1WKJA 3MM9B 1FKPB 3KK3A 4AXIA 4USWA 1AFJA 1N36F 5AXNA 1HMVB 3ETMA 3DDIA 1O0PA 3U02A 3PYFA 2WSFC 4I6AA 3BSOA 5G4DA 4B3TJ 4AQYF 2E9RX 3QT6A 4QIWD 2G2ZA 2YWEA 2Z56B 1D9AA 3QT8A 1SKUB 2RIJA 3CIMA 1RKIA 3D7SB 3EGNA 3TOQA 2H54B 1RT6A 3OL9A 1NJXA 1SC6A 2F4VI 2ZZNA 2BABA 4KGKA 2CYYA 4FXDA 1KVJA 2RS8A 2IVYA 4RW9A 1RT2B 2ZBQA 2DO0A 3D3CJ 4PABA 4BA2A 1XQIA 2DXFA 3H5YA 2RRNA 4LF7I 1IKWA 2VOOA 2R7XA 4DV6F 1EHWA 1TK5A 3LPYA 2X1FA 5GVQA 2QMUB 3TANA 3KK3B 2F4VJ 1HR0F 3D67A 3QGIA 1VBKA 2NN6C 1WORA 1QE1A 4P10A 2GZOA 1G4CA 4U3DA 4RW8A 1D9FA 1S48A 3OUYA 4RX6A 3QZ7A 3PIOQ 5EHHA 1NU4A 2XS5A 5JVGQ 1DQ9A 3W64A 2C2OB 4J9KA 2HHHE 2DR5A 4JYAE 1PYTA 1BLUA 5HO4A 4H4OA 3BGRB 4LF7J 4DV7I 4I64A 4QWAA 3IRWP 1RTIA 1KHVA 4URLA 3MFHA 3IBCB 4JV1A 1HPZB 5J2PA 5LSOA 1H98A 2AX0A 3LP2A 4QWDA 2KB2A 4FYYB 3UR3C 2DGWA 3CB4A 2XSJB 4KO0B 1AZSB 4PRXA 8ATCB 2HURA 1RWKB 3GJSB 2LU2A 4IOAQ 4P52A 4DV7J 2QA4S 1CC7A 2BW7A 2IM0A 1GXTA 2FGCA 2W25A 5IOLA 2JVOA 2AGOA 2QLWA 3DRSB 7FDRA 2D3OR 4LCHA 3KHLA 5F0WA 1JLGA 1IKWB 3T1YE 3NNHA 3F44A 2RVJA 2BA0G 2Y1IA 3LP1A 4LF4E 3HHDA 3PFEA 1QE1B 2LMIA 4YMEA 1OQ6A 4DV2F 1CEZA 4FW3A 1C0UA 2QL9B 4I2QA 3TARA 1Q5YA 4ECYA 1X0PA 3FEYB 3M6VA 4CO1A 1LWFA 4USKA 2CWKA 3GV5B 3QPIA 5FIIA 2RKIA 3KUEA 4AFFA 4EWTA 3E3XA 1RJJA 1FRXA 5HBMA 2V50A 1NHJA 4N77A 4O4RA 3IBFB 5I3QA 1N6QA 2LQBA 4DR7F 2IESA 5LJ3Y 1FKAF 2DIVA 3AJ1A 3DKDA 3MR2A 2XYHB 2ZHBA 1RHJB 3PO4A 7FD1A 2BYCA 2W9CB 2YBVA 1H2UX 2RD5C 1EI1A 3H2VE 2VJUA 3R7NB 1N5YA 5HK4A 5B0CA 1TK0A 2FJDB 4R8UB 3CF5Q 5K9FA 4ZJOA 5L3JA 1UW4A 4OHYA 4NXMI 2CQ0A 2DGXA 1GX6A 1RT4B 2LA6A 4LJMA 2OIHA 2RRBA 5HQMA 3CWVA 4G65A 2PEBA 1LWCB 2KDOA 2B9XA 1WG4A 4Z2XA 4LBIA 1Y3JA 5E3AA 3AA8A 3VGTA 4RU2A 2NXEA 3MCSA 1HK7A 2PNMA 3MM7B 2BQRA 4NPOA 2UVRA 4LF8E 1T9XA 4NXMJ 4RJVA 4ZDNA 2Y1LB 2EG2A 3KLFA 2FLLA 4EFAC 2E7XA 2HHUA 1TL1B 1EP4B 1LW0B 1D0EA 3TVZA 3TR5A 2RHQB 4P6QA 2MMYA 2XI3A 1S49A 3ZKDA 1A0OB 1YBAA 1N5YB 2MXYA 4X4OA 3SSSA 4W92B 2F9DA 2MYFA 2JEBA 2ZZTA 5H9EK 4A8XA 3P76A 3IGVA 1I51B 1N32F 1NSPA 2HVZA 4J37A 4TLRA 1FNXH 3NKYA 1NRKA 3NGKA 5HJXA 1UCNA 4GVBA 1SBRA 2XI2A 3CC7S 2V6AA 3CMAS 3MPYA 4PYAA 1MMLA 3Q1QA 2DGQA 1VRQC 1QVGR 3M2UB 2DGVA 2DNLA 2DPIA 4TU8A 1N34F 2FVPA 2WVDA 1PJ5A 4G1IA 2E7WA 2WB4A 3DMJB 1XMQI 1Y3KA 4I69A 2YNHA 2KFYA 3NNAA 2W4PA 1Z2LA 5E3QA 4JI8F 1H7WA 1B62A 4Q0BA 4OYIA 2YKPA 3M7NG 1NJWA 2VC0A 5F9NA 4DQRA 5D0EA 4KHPE 3KOAA 3MAHA 3JAMQ 1PKUA 4PXBA 4DL4A 3B6BA 5J1EB 3CDAA 1C4CA 2BOAA 4MK8A 3HM9A 1S7IA 1XMQJ 2PD1A 1FI4A 3NEKA 3VAFA 2ZM6F 3N6LA 3CJQA 2H65B 3B4TA 4C3KA 2LVWA 3KG0A 3MXHP 1AYEA 4F4XA 2QYGA 4ECUA 1MU2B 3QWUA 2Q79A 4AL5A 2AGPA 2W24A 3CJ3A 1Q86T 2VASA 1RT1A 2IM2A 4ZVIA 2BE2B 3QJJA 2RDIA 1FWPA 5E3PA 5IT4A 3JAMC 2AX1A 2NN6D 4X4SA 3CVKA 1C0TA 4J9PA 1U1RA 4R25A 2OTJS 4ZVSB 4C8ZA 4N8NA 5DM6Q 1NJZA 1R8CA 2ATLA 1IVZA 1OY8A 5KG4A 3LANA 4DLEA 1IR1A 1KWMA 5DQHA 4CLTA 1RT7A 4ZITA 4B3OA 1F6TA 4X62I 4ED7A 3DRPB 2HHTA 4ILRA 2DRAA 1IBCB 1MROB 1YGYA 1UFLA 9RUBA 4PQUB 2VQFI 4FF3A 1DLOB 2YQ3A 1S0VA 5K20B 3DOKB 1JJ2R 1QAIA 4LFBE 3THVA 2JOQA 2B0GA 3N28A 4NBQA 1YH8A 2WB1D 3L4BC 3CC2S 3GTYX 3J7YU 4RW6A 4ZS6A 2EFVA 5KFEA 3Q6NA 4X62J 1YVFA 2BBEA 3DGPA 3W7BA 4ECSA 2IIHA 3D6TB 4I0WA 2VQFJ 2L3MA 1E3PA 5T41A 3AD8C 4V19X 1KRPA 3H5SA 3MR5A 3MM5A 1VRUB 4JI3F 3AQOA 4ED6A 5C25A 2ZFHA 5CQGA 4CH7A 3RRKA 3HVRA 1PAUB 4DF4A 4OO1F 2DY9A 3UDLA 1SJ3P 1IBMF 2NUHA 2EK6A 1H73A 2C3UA 3TAMA 3RU0A 4CZCA 1NB2A 2D41A 4C8YA 1CSJA 2W4DA 4GC6A 3EJMA 3OJSA 4UOCA 3NOCA 3GCMA 1TK8A 4QR2A 3CE8A 1IN0A 4GKJE 4CTAB 1L3TA 2PMZD 1UWBB 2KYXA 2PSZA 4LF9F 2BR2A 4QNKA 4K50A 1RTHB 3D1QA 1U2CA 2HNDB 2MKHA 4DL3A 4W90B 3OW2R 3H40A 3BSNA 1R8AA 5D3GB 4HYKA 1WC6A 3DGPB 1RWMB 2QA4G 5C0XB 5IWAI 1RHRB 2J65A 4LT6A 4P7TA 1B70B 2NREA 4P75A 2APOA 2IJNA 3QJLA 3SDEB 3BS9A 3HKMA 5EWFA 4IFDE 4ZLLA 4ED3A 3W60A 1JLEA 2BM1A 3W2VB 4UW2A 1K9MT 2V8GA 3CO0P 2HW3A 3W5XA 5IWAJ 2YPYA 1Y5IB 2CJXB 3I0SB 2BA1G 2R7TA 2RSQA 4QIFA 4WE1A 3DLHA 3P3DA 2MQMA 4K2JA 2XYGB 2CQ4A 3ELHA 2WHOA 3D1OA 5IQ6A 5AXKA 1WHYA 1HNZF 2HHPA 1QZRA 5K36B 2P6SA 2HIYA 3F0NA 4AL6A 1FNOA 3PJWA 2W1BA 4USJC 1KSPA 4EZ6A 4CRJA 2O66A 1RTDA 3OTOI 4K5RA 1CG2A 1X5SA 4ECRA 5GAGI 3ISZA 4IG0B 4IZKA 2G0IA 4LFBI 4FVCA 3P5TL 3FSYA 5K5MA 4FP9A 4DU8A 2ZD1A 4A8SA 4DR5F 4F3QA 1FNMA 1BWVA 2VQEF 3OTOJ 3L3CA 2FLOA 3VGSA 4NLRA 2ZH3A 2W2OP 2YTCA 1H7UA 1ZYQA 3U1KA 2CJAA 2GVZB 4A8OA 1Y4ZB 4JBCA 3QRQA 5K8OA 1XMBA 2CQBA 1T05A 8AT1B 2POKA 5J2QB 2FLPA 2DCUB 4DR4E 2UV8A 3V5RA 1KQKA 2Z5CB 1R6YA 4OYPA 1HNVB 2V8VA 2DO4A 3H59A 2ZHOA 1ELOA 5L38A 5JEAF 1S79A 1L3VA 3KK1B 4IZKB 3BQ0A 2MKJA 2M5YA 1Q7YT 2FTRA 1NK6A 2IJFA 1N54B 4JI6I 1S6QB 2PNZA 1SV5A 2PO4A 3GP9A 3QBCA 4NI2A 5LJ5Y 1Q8IA 2ZDPA 4U8VA 3O44A 2RQKA 3K85A 4OIXA 4ZP8A 3ZZTA 1RADB 2A1BA 1RBAA 3HHLB 1MW7A 1I94I 1S1TA 2OO4A 2FJWA 4LF6I 4ILLA 1NCLA 2F8HA 1ZOTA 2PDAA 4JI6J 3WX4A 5GMKa 1NHKL 2AJFE 2AJ4A 4IZJA 2DD8S 3M2RA 4DV1F 3JXOA 1OSCA 2YNFB 2QFJA 2KVQE 4WUBA 2PI5A 2ZOGA 1RAOA 1P9QC 4HR2A 1FERA 3VTIA 4I7FB 3OFEA 1I94J 2ZUGA 4QW8A 4LF6J 2R2TA 2PA8D 2C3MA 1I6JA 3AJDA 3HCXA 3IAS9 1YSJA 2DY1A 4DSKA 4J91A 3QGGA 2BR0A 4DUZI 4DV5E 3AY0A 1RUSA 1RT3B 3RR7A 2FZGB 1DY3A 3DNCA 2QGFB 4ALZA 4IR9A 1WOPA 1NK0A 5E2QA 3H1CA 4L3KA 2VB6A 1GXLA 1HI8A 1KIJA 3BSAA 1HBMA 5LOQA 4WZMA 4NCGA 3D54A 4DUZJ 4X84A 1V3SA 4Q44A 1LWEA 2R7UA 1NZ0A 2KHCA 2JL9A 4UUXA 1KQFB 2M0GB 2VFVA 5CAAA 1DURA 4B3RF 1VCTA 5G0RB 4MKBA 4PWDA 1NXIA 2P9GA 3SQGA 2VFRA 1YJ7A 3M85G 3LUYA 3ZZYA 4P2SA 5LXRA 3GJQB 3T1HF 1VGYA 1U09A 4WFZA 5SUHA 4NRTA 3D0HE 1HNWE 2H3EB 5L39A 1VQ6S 4K4UA 1YBUA 3PRBA 1JXEA 2IBKA 1HR0E 4QYZJ 2CQDA 1JKHA 2BANB 4C8MA 1UEKA 1F3VA 3LPEA 4FVMA 1U02A 2UXDI 1IR2A 2V2VA 1J5EF 1YJWS 1HBNB 3V6KA 3SQOP 2RRAA 3EZUA 4ZVOB 2VG5B 3EMTA 2KJVA 5KG1A 2GX8A 3BH7B 1J27A 2IC3A 2PMWA 3F41A 2AZ1A 3HULA 4CT8A 3GFZA 2UXDJ 5AE3A 3PG9A 5KG5A 3DHWC 4ZPCA 3QIDA 2FVRA 3TUJC 4NA2A 3SQGB 2KYZA 2OPPA 1U25A 4JI2I 5JJBA 1WF2A 5KFRA 2HHVA 2JEAB 3H2UB 3AAWB 2Z8QA 2O5DA 4USMA 2NSBA 1TV6A 1APSA 4A8WA 4CLLA 2DCLA 2N7CA 4JI1F 3ZKBA 3ETOA 1WI6A 2EKYA 1J2VA 2PO2A 4URGA 1C1BA 2DNYA 2WAQD 1JLFA 1WSRA 5DGBA 3OQ2A 3KJVA 4JI2J 1JLAA 1WHXA 2D9OA 5D4NA 2VBXA 4FYVB 4FKXA 3SYZA 2ZE2B 4BA1A 3RBZA 4DFJA 4MFBA 1TUVA 1RT5B 3G6YA 4I6YA 2HVDA 4USVA 1N36I 1NAQA 3NOGA 2ACMA 1VS3A 1IBLF 1V5IB 4X4TA 4RUHA 4IRKA 2XZDB 1Y4UA 3R1LA 1SXLA 1U0HB 4AQYI 2MJUA 3PS1A 3H25A 2OPPB 1R0CB 3H7HB 5HN0A 1RWWB 4Y2MA 3CJ8A 4KGXB 3UDEA 2MHEA 1N36J 4CM0A 4X4UA 1RE1B 2C2NA 1AROP 2R4FA 4FYXB 1WTBA 4YEAA 3R2DJ 4PU9A 1J5OB 1TVRB 4AQYJ 2VPXB 1HYSA 1JLFB 2GHWA 1TKZA 2CNOB 4RNMA 2V8PA 1RBOB 5FDLA 4NLTA 2J6UA 1UPMB 5IV4A 3BDEA 5KFYA 4LFAE 4DV6I 3GE9A 2GIFA 1HR0I 4R5PB 4DCPB 4DZ6A 2UUBE 2WONB 3ENQA 2O3ZA 4KKOA 3F56A 4MU1A 1FDBA 4DR6E 1WEYA 2NZCA 5DZ6A 2WVEA 4KHMA 2LKZA 4LQ3A 5D78A 1SUQB 4DV6J 4KH0B 1VYAA 3BKFA 1CJKA 1JJHA 2XCPA 3TQEA 1BUXA 2CG4A 4CQ1A 5CZXA 1HWIA 2D7SA 1FXLA 5IC6B 1XXEA 2Z5EA 3JYTB 1S4FA 1O6XA 3ZZ0A 1WKLA 4DSLA 1R27B 2W9BB 4XK8C 5C42B 3D68A 4OLOA 2YKMA 2Q6BA 3C6UA 2OFGX 4X65F 1LW2B 1UVLA 3LQVA 4FF1A 3OVSA 1N34E 3OLBA 2MQLA 5A2QY 1YZ7A 1GX5A 4J9UE 4LBHA 2YNIB 4DV2I 4OI6A 3ILOA 4LPFA 4OO1C 1U1MA 3VHQA 2PFDA 4KGZB 1U49A 2QYCA 1VQNS 3CJ0A 4U3BA 2OPRB 2BM0A 1VQ4S 1CJKB 4ES1A 2MZTA 4PAAA 5EKWA 1YLXA 1NZ8A 4DV2J 1GXUA 4DR7I 3MAAB 3HK2A 2J6TA 2H51B 2XLKA 3NCRA 4RWWA 2OEMA 4ECQA 5J1NA 5HVGA 2RF2B 4DQQA 1OY9A 3H90A 3W62A 3MOZA 5KFAA 5ETLA 1VRTB 2VDIA 3GR1A 3CCWA 5KFSA 2YQ1A 4LVOP 3SFGA 4NLWA 3DLKA 3THTA 2KI2A 3HHNB 4LFCF 4DR7J 4X2BA 1PBUA 2MJNA 4EYHB 1SH0A 1YJTA 3PHEA 4LRBA 1S1VA 4N56A 2E5LE 3AOCA 1ZTWA 1L3SA 1XJWB 3CDEA 1N33F 1U45A 2HNZB 1Q8KA 3M2VB 1YJRA 1T9WA 4ZVQB 2XMKA 3IAM9 1FX4A 1UDSA 1DTTB 3GIMA 1HL6A 1VQOS 2MQNA 4NWBA 5D0GA 1URRA 3ENAA 4OX8A 2DHGA 1RXOB 5KT3A 1K1QA 2LQ8A 3HD1A 1AA1B 1FESA 2DGOA 3NCPA 4A8FA 1XMOF 4BC7A 4IH5A 1CQMA 2IHR1 1S76D 3ZZOA 3DLBA 4MU4A 3NGDA 1W2IA 1K8AT 3OVBA 3IS9B 3O5TB 3DLKB 3AB4B 5B08A 4NXNE 1OQ3A 3KFWX 1X4GA 2DGSA 4B17A 2O1WA 1UKUA 2IM3A 1N32I 1B99A 2V8HA 3D66A 2G0CA 4QZVB 1FJGF 2HZVA 5DNXA 2XMAA 1R3NA 1Y11A 4EK2A 5C0XF 1XBWA 2CDRB 3T1AA 4GKKF 2XHCA 2G2YA 4FYWB 4HL9A 4WFBQ 5T7LB 4ETZA 1TAUA 3EVOA 3KNGA 5HSPA 2PO1B 3JTOA 1N34I 2HQCA 1WWHA 2EI5A 3UCUP 1RR9A 3PX0A 3C15B 1PC4A 2GMHA 2CNLB 4FPIA 1K0TA 1N32J 1RDRA 5HQ8A 4IFDB 4KFBA 2FVCA 4WUDA 4LUBA 5KFDA 4JI8I 1U1QA 4B3SF 3M8QA 3V4IA 3AQPA 3TYTA 5A8WB 4DXLA 3MEEA 1HI1A 2UXCF 1QSYA 5GAHU 2C2MB 1B0PA 3UI3A 3G6VA 2RS2A 4YY3E 4JI0E 1NK7A 2ZM6I 4JI8J 1U6FA 2JEJA 2XGPA 5K36F 1SKRA 4JV5F 2HLTA 3SCLE 4M5NA 2PA3A 3J81U 1S57A 2CQHA 2ZH9A 5U47A 3NMAA 3ITHB 3HVTB 3M32A 4FW5A 3MEGB 5DLGA 3DOMA 1UDOA 3ZNJ1 3CNQP 2B7CB 1B0TA 4IRDA 4A46A 1Z5AA 1FRHA 3OL6A 2HQGA 1GK8A 2V9KA 5CCLA 2ZM6J 4WK1A 1NHVA 3PZPA 3KMQA 2ASJA 1SIWB 4OL8A 2I9SA 1O8BA 4U96A 1K47A 1REVB 4HYMA 1RAAB 4DUTA 1OYRA 4WYLA 4XIUA 4F4ZA 4CLPA 3W9IA 2VA2A 1HBUA 3L9ZA 5AXMA 4ZOSA 5IXUA 4FF4A 1PIEA 1S0OA 3J7AG 3ENVA 4LRDA 2OP5A 1FRIA 1JMTA 4C11B 4YQWA 2HFSA 1BQXA 2IVFB 4DPOA 5JUMA 1VC6A 3KLHA 2IVMA 1RAHB 3H2LA 3L7PA 1S9GA 2ROGA 1Z4UA 1FTRA 4H4MB 2HVEA 4WK3A 1XNQF 5BXIA 4AYBD 3HKZD 1FF2A 1AUSL 2C2EA 1MN7A 3R27A 2VQEE 3T6BA 1XNRF 5KFZA 2HBRB 3D0GE 4MTPA 2Y9HA 4OO1D 4CYUB 3GMGA 2OMOA 3WIUA 4JI3I 3GYNA 4WU2A 1IQTA 5L1JA 1NKCA 2WVBA 4B9SA 1P8GA 2KO1A 3MFIA 1WD6A 2DT9A 1IBMI 3GCWP 5F8HA 2R8JA 2V0NA 3ET6B 1DTQA 2FVSA 1P9YA 3QAEA 3J7Z5 1I5OB 4LBPA 2QLBB 3ZZPA 4JI3J 3H98A 3TVKA 3S1TA 2X1AA 2BX6A 3TNVA 5JEAE 4ZJQA 4LF9I 2EFNA 2QEXS 3M6XA 3G8SA 3B82A 3TX0A 4DPWA 1ZETA 2L9DA 1IBMJ 2K2PA 5A8KA 4DSIA 1GT8A 5FJ4A 2J0SD 4LRAA 5DG9A 1HNIA 2R9LA 3G82B 1WJ9A 2RNEA 2GO8A 2RQ4A 2H1YA 4CLUA 2GFFA 1S1WA 4DV4E 1F9EB 2HZCA 3GG0A 4X64E 3KNAA 2O1UA 4LF9J 5KFFA 3I31A 2ZJRQ 5CABA 1B3TA 4B9VA 2PO0B 4A8KA 3MEDA 4RLEA 2VA3A 4KV8B 2QE5A 1NDKA 4ZVHA 1YJVA 2V69A 1LK7A 3HSJA 4C3LA 3I55S 5A8RB 2PNLA 3OXLA 3SZ2A 4KJIA 3LA0A 2CJKA 1KN6A 3M6UA 5DQGA 5HMYA 1Q16B 5CD4H 3K5LA 1RA7A 2EG1A 5B7WA 1BQMB 4RL1A 2IYGA 1XK8A 3R1HA 4G1QA 5L1KA 4PG8A 2K3KA 5D4PA 2CA9A 3KHGA 1KHWA 4RUBA 1LXJA 2UUWA 1NHIA 3HVWA 4HKQA 4O23A 3SEOA 2HHHF 2KJWA 1JLBB 4OX9E 1EX8A 4JYAF 1HNZI 5EX0A 4K0KE 4X4RA 3OL7A 1S10A 3FFIB 1RWNB 3QLHA 4P74A 3PO5A 5C24B 4RO0A 1CS4B 1U6ZA 2Q66A 1GAOA 1T9YA 3MMBB 3JAMY 1JLCA 3GU0A 2R7QA 1T3OA 1MWYA 3OTDA 2XHWA 1HNZJ 5JVHQ 5DS7A 1CULB 3MEDB 4J7CA 1BC6A 4RR5A 2CQ2A 4DS5A 4DR5I 2FJVA 1UEUA 1MN9A 4JB8B 2VQEI 4MKYA 3H4BA 2XZTB 5HP1B 3JSMA 1RU1A 3T1YF 2IMOA 4CM2A 2UUCI 2KTQA 2JLEA 4JP8A 1EZZB 4A8MP 2AP6A 4LF4F 1E6VB 1SH2A 1S9FA 4NA3A 2AV5A 4X4VA 5CD4A 1FEHA 4NCBA 1VQ5S 3K1JA 5K14B 4DR5J 2IDLA 2LP4A 4C3MA 3IWXA 3TJAA 1OYPA 1WC0A 1R0AB 4DQPA 4YB1P 3VAKA 2UUCJ 4URQU 4GRSA 1Q0NA 5LMUF 2C22A 4Y2CA 1S6PA 1NDCA 2JE6B 3FBEA 1EJ7L 2VPYB 3MMJA 1S9EA 4XO0A 1IBKF 2XMWA 1M5KC 3R9LA 4ANDA 5C7PA 1S99A 3ILJA 3KLGB 2J7UA 2OAUA 4ZCLA 4QW9A 3P3GA 1KP6A 5KFXA 2E5HA 1SQGA 2IFXA 1H2VZ 5IT9C 1RWVB 2HRYA 4UZBA 5AE2A 2HGLA 2C3PA 2ATCB 1M5OC 4W4MA 3PFOA 3QGHA 1NH8A 5F8GA 4NE9C 2HHWA 1FE4A 4C7QA 3I82A 4K4ZA 1SJ1A 4TLQA 1NMEB 2UU9F 2UVUA 3FK4A 4DV1I 1X4BA 2QLJB 3K57A 4WZQA 1NB7A 2KG1A 2J0WA 3CDBA 4Y65A 3WDOA 5D15A 3R3TA 4FW4A 2FUG9 2OPQA 2RQMA 1HLWA 1ZZFA 3QYYA 3G6XA 2GJFA 4DL2A 3EDRB 4L74A 1DARA 3HSDA 4C0OC 2YXLA 3HI9A 4DV1J 5EWGA 4M8LA 3UVJB 3EXCX 1NPRA 1Y9OA 2NUUG 1UVKA 2YKAA 4UUWA 3U1MA 1TL7A 3Q24A 1IWAA 3WC2A 1WUUA 3WBZA 3FRZA 2R8GA 1F60B 5JXSA 3BEGB 1BD6A 4PG7A 4XTJA 3I0RA 2CUYA 2GMJA 3GLJA 3KLIA 3QRRA 4DV0E 3I56S 2UXBF 3G6ES 5IC4B 4MU3A 2DH8A 3US5A 5IM0B 2MTLA 3QRPA 2RUGA 2NXJA 4F8RA 2HFVA 2B43A 4EBEA 5LMNE 3VAMA 2HS0A 2XQCA 2B4VA 4MU0A 4OI4A 4B3RI 2OPQB 3RBEA 3W2WB 1UJ6A 2HMIA 3CGIA 1MMNA 2JDJA 4L76A 4AE5A 3T1HI 1TMJA 2FC8A 3HZEA 2HBZB 4OYZA 3W9JA 4C0BA 1HARA 3N5BA 4CLYA 3GV7B 2FHJD 4IR1A 4C6AA 3OXFA 1Q1KA 3I5AA 4B3RJ 1F3FA 3MF5A 4QR0A 3A8JA 2WOMB 4NCAA 4LF1A 4P2MA 4F36A 1XC9A 2IOQA 3NP5A 4RW7B 3T1HJ 4M5KA 3GFXA 1WELA 5A2QU 1J5EI 3J7A1 2X1GA 2MY7A 3RRHA 2Y8YA 2F1DA 1CBKA 4J5OA 5BR8F 4F26A 2C2ZB 5I3UB 3VZIA 2KZMA 3VALA 5DG7A 3O1LA 3WIVA 1VLYA 2ZWOA 3DU5A 2HBQB 4I2PB 1JLQB 2BE7D 1Q5VA 3SCKE 4C2MA 2LXFA 4P2FA 2BKPA 1QLNA 5D0RA 4K4XA 2AQ4A 4FW9A 4OHWA 1J5EJ 1Y5LB 4OYWA 1RAEB 3KK2A 3LF0A 1F5BA 4OYOA 4V19J 3A13A 2JEIA 2I6WA 1Z1ZA 1WI8A 3A8KA 3KUHA 1ZAWA 1WOSA 4JI1I 1PYOB 2CPJA 1HQUA 2E9ZA 4G3IA 3V81A 4HTIA 2V4JB 4ELVA 2MZRA 3UQSA 1FT8A 4FPRA 5J2MA 4NLQA 3R6GB 3JSRA 4ES3A 5C0XC 2FC9A 1IWGA 4DV3E 3AD9C 4DF8A 3L7ZB 1TU0B 3CJ4A 1NSQA 1YTYA 4YHHE 3M8PA 1GQEA 4FW6A 3V2UC 3TZXA 2EFQA 2ADCA 4JI1J 2Z5BA 1IBLI 1YK9A 4OO1A 1VJQA 2I5JB 1SB6A 3RR8A 4QYZK 1KLMB 1KD1T 4HI1A 3TO8A 2KU7A 3RW7A 4NYPA 2HLUA 5KOWA 2AIRB 3GFYA 1UDNA 5LXYA 4M5JA 3I32A 4ICLB 3VVTA 1TP7A 2K8GA 3OR1A 3EX7B 1ZM3A 2E9TA 3JSBA 4E98A 1IBLJ 5GADU 3HT0A 2XY6A 2OFHX 5K36C 5ETSA 4N7TA 3T9ZA 1D9DA 4WTYA 5KTQA 1QTNB 3A8IA 4GKJF 2MQOA 4NRUA 1HHQA 3EE3A 1HHSA 2K7JA 3BGLA 3RW6A 2UVVA 2AEMA 4FKYA 4TY9A 4QWBA 4DR3F 4WYWA 4OYXA 2FHKA 3NGRA 1X60A 4DR2E 3SFUA 3J7YI 4C8LA 2IPOB 1FA0A 4W98A 2BJ3A 2VKRA 4LR9A 3DRXA 4MIWA 4O4GA 3FMWA 3UD5A 1FD2A 1USUA 2IBOA 4PYDA 4FYDA 3NAIA 4IFDF 1IKYA 5GAEU 1VQMS 1L3KA 1Z0TA 4FW7A 5KG6A 2NQPA 2B3TB 1JWWA 2HS3A 2X3GA 3CEDA 1UVNA 1CJTB 4NYZA 4IG3B 5H9FJ 3IGNA 2BA0D 5DM7Q 4F4KA 3MR3A 1T03A 4ZLPA 2HGNA 3K89A 4JI5E 3DLGA 3M9MB 3BREA 2N7YA 4WXOA 1SC3B 2WVCA 4DR1J 4QIVA 5DDQC 3NBPA 3SXLA 1T02A 3KUGA 4H54A 3PKYA 4UOGA 2ZH5A 3G9CA 3J80C 2B6AA 3DM2B 4MK7A 4X65I 3ICLA 3BO4A 3SSQA 5B0DA 2P6TA 2XS2A 3V6DA 1HQEB 4DUYJ 2P9EA 1OSDA 4URSA 3E2EA 3CD6S 4IH7A 5L1LA 1PBAA 3X3UA 2GAGC 3GCXP 2G4BA 1AT1B 4HH0A 2UXCE 1Y7PA 4O3PA 4X65J 2QFIA 5CXTA 2ZH4A 1KQSR 5H1SV 4PXCA 4RUCA 3PRYA 3Q0AA 2V4QA 4YS2A 4U7CA 1GEHA 1OS5A 2ZH7A 5E0OA 1KR4A 1OO0B 1YITS 4IRCA 4B3ME 2GO4A 2Z4PA 3IG1A 4KRWA 1SL1A 2BZ2A 3MPWA 2W7AA 4YR3A 2W8KA 2VC1A 5JEAA 1U26A 1JJ4A 2OPSB 4LFCI 4ZPVR 3IM9A 4DR4F 1N5VA 1QJHA 5D6GA 1TFYA 2XNQA 2YWHA 4ID5A 3A12A 3Q23A 1IJEB 3ZZUA 4LSLB 2OUGA 2HKJA 3FVYA 1N33I 1HBOB 4OX7A 3AH6A 4IUFA 2FHMA 4TY8A 2XMUA 2AJ1A 1HIYA 3V6JA 4ECXA 1U48A 4NLPA 5EDWA 2G9OA 1P1TA 3H5XA 3CPWR 3MM9A 1FKPA 2VESA 4LFCJ 1NHHA 2BVZA 1QAJA 4CO2A 2O1TA 2ERRA 3PR5B 2R2RA 4DFKA 3CJKB 3QFWA 1HMVA 4JI7E 1N33J 4I56A 2R2UA 4DPTA 4IOCQ 1Q81T 1XMOI 2RAQA 3MMCB 4UOFA 1Y10A 3TQ1A 2AJ2A 3D6FB 3K2YA 1U0SA 3BBCA 3DXBA 1RGVA 2V4RA 3WQPA 2BJ9A 5JEAB 2JX2A 1X4CA 3UO0A 1PJ6A 2HYIB 2HNYB 2OTLS 2OD6A 3BO2A 5F9LA 4GQUA 1IM4A 4FBUA 5C0XD 4QPXA 1L5UA 3RAQA 4X66E 2ASLA 1XMOJ 3HPOA 1HNXE 2VONA 1FJGI 2GVDB 4WTOB 1RT2A 2B8QA 4IYQA 1FWLA 4GKKI 3H42A 3M7ND 4USIA 2ILYA 3W63A 4LF7F 4DCJB 2XM3A 4Q8EA 4DV5F 1MU5A 2VBZA 4JG4A 4USTA 3U1NA 1ZPWX 1QAYA 4A8QA 1FJGJ 4B3SI 3T5LA 1Q53A 2C42A 1T7PA 4GKKJ 4ZIWA 2UXCI 1EA6A 2DR8A 2AYBA 3ZTPA 3BGRA 5ETQA 2ZITA 2WSEC 3RB3A 3U1YA 1CLFA 5K36D 5HQLA 2YY3A 1Y5NB 2WCXA 2PIIA 4D3HA 1H6KX 1HPZA 1RISA 2LYVA 5KT7A 1NPKA 1S1UB 4B3SJ 4DMZA 2RILA 3HHKA 3KMSA 4KPCA 2XLJA 4JV5I 1TL3B 1CJUB 2BA9A 2XSJA 2OLWA 5KAKA 5IFMA 2OEJA 4KO0A 1AZSA 3D9BA 2Z30B 1L3UA 4DL6A 3MUTP 5CHCB 2FHJA 4K4VA 3JQKA 3O8WA 4HDGA 4C0HA 1HNWF 5LSLA 3UD4P 4F02A 4DEZA 3DRSA 1M5HA 2CJQA 4PG5A 3NLCA 4USHA 2H9ZA 2F9JA 2R3VA 2I0XA 4JV5J 1RCOB 2LXIA 4NEYA 1U1LA 4RKUC 3VAHA 5DNLA 4DSEA 5LL6R 1NKEA 3OPKA 3R5JB 1X9MA 4CO4A 4CLWA 2PT0A 2M4MA 2XTJP 2HWHA 4HT5A 2NXUA 5GMEA 2GV1A 2I38A 2LQ5A 2FPHX 4LF5E 3AXKA 4JUZA 2C37B 3K5PA 2ALZA 2E1AA 1XNQI 4FXVA 1BXNA 2VH7A 4IQMA 2ZDOA 2W9CA 1RYRA 4I4BA 4P72A 1R8HA 2BOPA 2E1MC 2C39B 3AODA 1NEEA 1VQPS 1Z2ZA 1XNRI 1ITPA 2OSRA 4R8UA 4PZVA 1FKOA 3EGZA 4QPTA 4O3NA 5DLFA 1RT4A 1XNQJ 4C8NA 4RW4B 3CCUS 3PEJA 3Q2TC 4NLDA 1LWCA 4FF2A 3T9NA 3RAXA 1XNRJ 2W4CA 4RBTA 3MM7A 3A4TA 5LMUE 4AL7A 3N6NA 4TKTA 4B9LA 4CIOA 2IYIA 1B63A 1S0NA 1S4EA 3BR9A 1TL1A 2DIUA 2LFVA 2N4CA 1IBKE 2FYXA 1EP4A 1LW0A 1LNQA 2WP8B 4WFYA 3IC1A 4YP3A 1U24A 2VU5A 3P3EA 2B5JB 4ED0A 3N0VA 2XS7A 3VQTA 1X7VA 1YIJS 5E41A 2C38B 2QV6A 2FDNA 2NZ4A 4IFVB 1FKOB 3TVYA 2BA1D 3GYXB 7AT1B 1Q78A 2HZAA 3PS3A 1X4HA 1M1HA 3H20A 3OFGA 5DDRC 2UU9E 2DHHA 3ZTOA 5B0AA 1CJVB 2DNNA 2YWGA 2M88A 3M2UA 4B9MA 4ZPTR 4LFAF 1V6HA 4IZJD 4KIAA 1OY6A 3R2CJ 4WFNQ 3HJVA 2FY8A 1XERA 1AB8A 3DMJA 2UUBF 1AW0A 4IFYB 1NLKL 3UNGC 2LQJA 4DR6F 2QLFB 5I42B 3J81Q 1REGX 4QWCA 3MURP 3DC2A 2QO3A 3MAQA 2HHHI 3DOLB 2ZNZA 1HQ2A 2A2CA 2QC3A 4JYAI 2DKOB 3K0JA 4ZVTB 1S1XA 2ZBPA 2VKZG 4BS2A 2CWXA 2A2DA 3MMAB 1RHMB 1FXDA 5J1EA 1QUPA 4CDIA 3MPVA 2GC8A 1T8EA 4GVLA 4LRFA 1VOMA 2FB0A 3Q8PB 5KFPA 2DBBA 5HL7Q 1WTFA 3UCGA 4AUKA 5D4LA 2HHHJ 3J81C 1MU2A 4JYAJ 3MTKA 4AD6A 2UXBE 3DRRA 3CO9A 3FQKA 1NM2A 2BE2A 2MZQA 4NLOA 3BKTA 4UY8T 4OHXA 2XY5A 3T1YI 4QIGA 2F8EX 1NSKL 1PKPA 4O44B 2GW8A 4LF4I 4NEZA 3CDIA 2NN6F 3KJQB 1Q79A 3M8YA 2XMJA 4ID8A 1FD8A 8RUCA 3LOUA 4M5LA 4U7UK 4C97A 4LVNP 1S1XB 4XDCA 2WNRB 2D3ZA 4UQTA 3T1YJ 1RACB 3Q8RB 2GO9A 4X62F 2O1VA 2HK3A 4JI4E 3DRPA 4LF4J 2IJRA 1Y4SA 4DL0C 2YKOA 1MROA 2VQFF 2JVRA 4PQUA 3KJNB 2OKQA 1DLOA 1KOHA 4Q8FA 1DZ5A 4X4PA 3DOKA 4Y2IA 1JK9B 5FLXU 2R7SA 4AIDA 4GMKA 2BRLA 2BW2A 5BR8E 2B9WA 3W1YC 3TI0A 3E51A 3BKUA 2GQCA 3DRRB 3IR6B 4PXEA 1PVGA 1HW9A 2E44A 2RE1A 4RPFA 4FZVA 4K8RA 4EEYA 1TR0A 4LR7A 3KXDA 1VRUA 1PAEX 3HFKA 5C5JA 2VUGA 4HH1A 2E5LF 3OR2B 5E33A 2UU9I 4J9NA 2F40A 5ETTA 3MD3A 3LWMA 3GIRA 2J0XA 1KBRA 5ETNA 1FRJA 4UZCA 4UTGA 4LF8I 2J9EA 3Q8VA 3DXSX 1CPZA 5HLFB 4CTAA 4HI2A 3M8WA 2DGUA 2J8SA 1UWBA 1VJWA 2BMBA 1RAJA 3HHEA 4F3OA 3HMJG 1RTHA 2F5GA 3LNUA 2HNDA 2YX1A 3QIPB 4WPAA 4QU7A 2I1RA 1NO8A 2ZNYA 5D3GA 4LF8J 4UY85 3B8HA 1TAQA 3NZKA 1Z0GA 5C0XA 3FCVA 3LP0B 3QO9B 3UE2A 4NXNF 2PFFB 2CAJA 1T9VA 3SDEA 4WIIA 1UJ4A 4XDDA 2XY7A 1S0MA 2AW0A 2DHAA 5GMDA 4ANEA 2Q43A 3W2VA 1BQNA 1E6YB 3PM9A 3NXZA 3CDUA 1N0VC 4YR2A 5FWKA 3ADAC 1U8WA 3GZ7A 4MMOA 3W8PA 4DUYE 1FTCA 3EVWA 2IRUA 3E8OA 1NJYA 3I0SA 2XULA 2UUAE 3NRBA 4KY3A 4KQVA 3PRDA 1VLOA 1DRZA 2MZJA 5IT0A 2BJEA 4KHPI 3Q8UA 4DR3E 1H74A 5AT1B 4JV0A 4C4WA 5K36A 3ZXWA 2PN6A 1VQ7S 1NUEA 2YNGB 4GO5X 3C16A 4TQSA 1S12A 5CYQB 3HSGA 4YY3F 4JI0F 1HKAA 2ZBKB 4DCOB 4IG0A 3D5MA 1KFSA 4MKAA 1EAYC 4EUVA 3DI6B 4M5IA 4N5SA 2DHSA 5BR8I 1QD1A 4KHPJ 1B64A 1IKVB 2MGZB 2EFPA 1KTQA 1D3WA 3BGOP 1VHFA 5C2CA 1BQNB 4I6WA 3PX6A 4ZP7A 4J9VA 1BY9A 2I8EA 5I4MA 1UL3A 2B56A 3HXMA 3P8BB 3O6QA 1N5SA 4DWIA 2HFOA 2FZCB 1HD1A 1RI7A 2BUNA 4K5SA 2J7WA 5CYMB 3PYEA 2GVZA 1YI2S 1ZM4A 2J9CA 3DDKA 1FDNA 1IM6A 3ZNUA 3OSNA 2BJ8A 3O3LA 1VBZA 1R0BG 2HPUA 5J2QA 1RU2A 5GAHI 2Z5CA 4ZN1A 3C16B 3SIPB 3UW1A 4ZLJA 1HNVA 5KFIA 5ITHA 2VG7B 4ITSA 4C8OA 2DJWA 2M8HA 5IT9Y 5BYRA 3OLAA 3KK1A 2LEPA 3PV8A 2FVQA 3PW0A 5M2RA 1DQAA 2NCKL 1OWXA 3QWPA 4JI6F 1YRTA 1S6QA 1WG1A 1YBTA 2HKEA 3B78A 3QGPA 2MLXA 1D8YA 1T11A 3N01A 3MM6B 3DYAB 4M5MA 3LAKA 3HHLA 4LFBJ 1T9TA 2JJ4D 2GIQA 4CT9A 2XC9A 4ZP6A 2IA6A 1R6VA 2P8IA 3TWZA 4K4TA 2YNFA 4L73A 1VR6A 4B02A 4M5DB 2OMLA 1U1PA 3HDSA 3ENWA 3K8WA 2HVIA 2W8LA 1T0TV 3FBCA 2NXNA 4I7FA 4HTJA 2RUSA 1WHVA 1X8DA 3CTRA 4GKJI 1YZ6A 1FXRA 5BYQA 4B3TE 1G2EA 4DX7A 2CQGA 2HHXA
chains in the Genus database with same CATH topology
2VQEI 2ZITA 2EFGA 4DR3I 3ZKBA 2CG9A 1XMQE 4MYUA 2UUCI 2DEJA 1QZRA 4DR1E 3F0NA 3M6AA 1Y6ZA 2VF3A 2UXBI 5BR8E 1N34I 4X66I 1ZM3A 3OTOI 2X36A 4JV5I 4WUCA 1HNXI 1RR9A 1PVGA 3QT5A 3ZKDA 3K1JA 4OX9I 4RPFA 1XNQE 4WUDA 4IZKA 4DV1E 4DV6E 4LFBI 4K0KI 4JI8I 3H4LA 1Z5BA 1N36I 1FWKA 4MYTA 4DXLA 2E1RA 4DU8A 4DV3I 3QT7A 4JI6E 1XNRE 2V2ZA 2HFUA 1Y4UA 1Z5CA 1FNMA 4AQYI 4YHHI 2R3VA 2UU9I 4R1FA 4X65E 2F4VE 2GQ0A 4DR2E 4YY3E 4JI0E 3Q1QA 4NXNI 1H7UA 1A6FA 2ZM6I 5A2QQ 1KVKA 1OJ4A 4JI4I 1N0UA 4UTGA 4B3TI 2NPFA 1I94E 4LF8I 4LF6E 5LL6R 5IT9C 1XMQI 4LF7E 4PU9A 2CGEA 1USUA 1B62A 4DR4E 5GMEA 3V5RA 3LNUA 1Z5AA 2Z5CB 3GONA 4KHPE 1Z0TA 3JAMQ 4LF5E 4FN5A 3K17A 3PYFA 2V8PA 1XNQI 1ELOA 3QT6A 4LFAE 4DV1I 4DV6I 2WW4A 3B8HA 4PRVA 1K47A 4X62E 2X7IA 2J7KA 4JI3E 1Z0GA 4HYMA 1MG7A 4IZKB 3QT8A 1HR0I 1FI4A 4DV7E 4JI5E 2UUBE 3PYGA 2VQFE 1U2RA 4JI6I 3J7AM 3WU5A 1PIEA 1XNRI 1IBME 4DR6E 4DV2E 2V34A 4B3RE 3J80C 4DUZE 4X65I 2F4VI 3K85A 3J7AG 4DR2I 3ZZTA 1DARA 5GMDA 4ZVIA 4YY3I 4JI0I 3T1HE 3JAMC 2HFSA 4LFCE 4UT4A 1N0VC 1I94I 5FWKA 3WU4A 4LF6I 4DUYE 5IT9Q 4N3OA 2LJPA 3WU6A 4LF9E 1WUUA 2AJ4A 3PYDA 4LF7I 4IZJA 1N33E 2UUAE 4DR7E 2UXCE 3P06A 4KQVA 1FKAE 2GS8A 5LMUE 4DR4I 2Z5EA 4WUBA 2VQEE 4KHPI 3PRYA 4DPXA 4XTJA 4DR3E 3ZZ0A 1H74A 4LF5I 1B63A 1J5EE 4DV0E 4FWDA 1S4EA 2Z5BB 1H7SA 4LFAI 4X62I 1IBKE 4JI3I 4FWGA 2HHHE 2OI2A 3Q6MA 4JYAE 5FLXQ 1N34E 2ZBKB 4DV7I 4EMDA 4JI5I 1USVA 2UUBI 2VQFI 5LMNE 1D6TA 1XMOE 1RREA 4B3ME 1IBMI 4DR6I 3J80Q 4I3HA 4DV2I 4DR1I 4B3RI 4URLA 4DUZI 4DV5E 4LFBE 5BR8I 2CZ9A 4DPYA 3T1HI 3ZM7A 3Q6NA 4LFCI 4PRXA 4HACA 4DU7A 1Z0VA 2UXDE 2UU9E 4P52A 1KIJA 2BV3A 4DUYI 2BM0A 4HXZA 4LF9I 3ZZUA 5IWAE 5FLXC 3HJCA 3B82A 4DPWA 1FJGE 2HKJA 4IZJD 1N33I 2UUAI 4JI1E 4DR7I 1Z59A 3T1YE 2IOQA 3PYEA 1NZ0A 1HNZE 4GKKE 1ZM9A 5LMUI 1ZM4A 4LF4E 4DPUA 2IOPA 1ZXMA 1J5EI 4NXME 4DV0I 1NHHA 3J81Q 1H73A 2O1TA 1H72C 1IBKI 4DV4E 2HHHI 2Z5CA 4X64E 2O1UA 4JYAI 2A2CA 1KTVA 4USKA 4JI7E 4JI2E 4B3SE 2A2DA 4DPTA 5LMNI 1HNWE 1ZM2A 1XMOI 4B3MI 4GKJE 1IBLE 1ZXNA 4DV5I 2E5LE 1N32E 1NHJA 4DR5E 4FW9A 4M1KA 2HK2A 2DEIA 1HR0E 2PNLA 1XHKA 4ED4A 2UUCE 1UEKA 3LTOA 2HKEA 3B78A 3J81C 2UXDI 4HACB 2UXBE 2V2VA 2Q2EB 4X66E 3OTOE 4JV5E 5IWAI 1HNXE 1Z0CA 4HY1A 1NHIA 1FJGI 1EI1A 4JI1I 1Z0BA 3WU3A 3T1YI 1FWLA 1S16A 4OX9E 2R42A 4P7AA 1HNZI 4GKKI 1Z0EA 1PKPA 4Z7YA 4K0KE 4JI8E 1BKNA 3D4JA 4LF4I 1MX0A 5L3JA 1N36E 2V2QA 1KKHA 4NXMI 3HULA 3LPSA 4DV3E 2BM1A 1MU5A 4JG4A 1Z0WA 4DV4I 4X64I 4AQYE 4YHHE 2XEXA 4FWHA 3CWVA 4JI7I 4JI2I 1VISA 3V2UC 4B3SI 2Z5BA 1HNWI 4NXNE 4USMA 4GKJI 1IBLI 2O1VA 2O1WA 4IZJB 2ZM6E 2UXCI 2HK3A 4Z7CA 4JI4E 1HK7A 2E5LI 1N32I 2PNMA 1EA6A 5A2QC 1Y4SA 4B3TE 4DR5I 4LF8E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE I;  2ZIT A;  2EFG A;  4DR3 I;  3ZKB A;  1XMQ E;  4MYU A;  2UUC I;  2DEJ A;  1QZR A;  4DR1 E;  3F0N A;  3M6A A;  2VF3 A;  2UXB I;  5BR8 E;  1N34 I;  4X66 I;  1ZM3 A;  3OTO I;  2X36 A;  4JV5 I;  4WUC A;  1HNX I;  1RR9 A;  1PVG A;  3QT5 A;  3ZKD A;  3K1J A;  4OX9 I;  4RPF A;  1XNQ E;  4WUD A;  4DV1 E;  4DV6 E;  4LFB I;  4K0K I;  4JI8 I;  3H4L A;  1Z5B A;  1N36 I;  1FWK A;  4MYT A;  4DXL A;  2E1R A;  4DU8 A;  4DV3 I;  3QT7 A;  4JI6 E;  1XNR E;  2V2Z A;  2HFU A;  1Z5C A;  1FNM A;  4AQY I;  4YHH I;  2R3V A;  2UU9 I;  4R1F A;  4X65 E;  2F4V E;  4DR2 E;  4YY3 E;  4JI0 E;  3Q1Q A;  4NXN I;  1H7U A;  1A6F A;  2ZM6 I;  5A2Q Q;  1KVK A;  1OJ4 A;  4JI4 I;  1N0U A;  4UTG A;  4B3T I;  2NPF A;  1I94 E;  4LF8 I;  4LF6 E;  5LL6 R;  5IT9 C;  1XMQ I;  4LF7 E;  4PU9 A;  1B62 A;  4DR4 E;  5GME A;  3V5R A;  3LNU A;  1Z5A A;  3GON A;  4KHP E;  1Z0T A;  3JAM Q;  4LF5 E;  4FN5 A;  3K17 A;  3PYF A;  2V8P A;  1XNQ I;  1ELO A;  3QT6 A;  4LFA E;  4DV1 I;  4DV6 I;  2WW4 A;  3B8H A;  4PRV A;  1K47 A;  4X62 E;  2X7I A;  2J7K A;  4JI3 E;  1Z0G A;  4HYM A;  1MG7 A;  3QT8 A;  1HR0 I;  1FI4 A;  4DV7 E;  4JI5 E;  2UUB E;  3PYG A;  2VQF E;  1U2R A;  4JI6 I;  3J7A M;  3WU5 A;  1PIE A;  1XNR I;  1IBM E;  4DR6 E;  4DV2 E;  2V34 A;  4B3R E;  3J80 C;  4DUZ E;  4X65 I;  2F4V I;  3J7A G;  4DR2 I;  3ZZT A;  1DAR A;  5GMD A;  4ZVI A;  4YY3 I;  4JI0 I;  3T1H E;  3JAM C;  2HFS A;  4LFC E;  4UT4 A;  1N0V C;  1I94 I;  3WU4 A;  4LF6 I;  4DUY E;  5IT9 Q;  2LJP A;  3WU6 A;  4LF9 E;  1WUU A;  2AJ4 A;  3PYD A;  4LF7 I;  1N33 E;  2UUA E;  4DR7 E;  2UXC E;  4KQV A;  1FKA E;  2GS8 A;  5LMU E;  4DR4 I;  4WUB A;  2VQE E;  4KHP I;  4DPX A;  4XTJ A;  4DR3 E;  3ZZ0 A;  1H74 A;  4LF5 I;  1B63 A;  1J5E E;  4DV0 E;  4FWD A;  1S4E A;  1H7S A;  4LFA I;  4X62 I;  1IBK E;  4JI3 I;  4FWG A;  2HHH E;  2OI2 A;  4JYA E;  5FLX Q;  1N34 E;  2ZBK B;  4DV7 I;  4EMD A;  4JI5 I;  2UUB I;  2VQF I;  5LMN E;  1D6T A;  1XMO E;  1RRE A;  4B3M E;  1IBM I;  4DR6 I;  3J80 Q;  4I3H A;  4DV2 I;  4DR1 I;  4B3R I;  4URL A;  4DUZ I;  4DV5 E;  4LFB E;  5BR8 I;  2CZ9 A;  4DPY A;  3T1H I;  3ZM7 A;  4LFC I;  4PRX A;  4HAC A;  4DU7 A;  1Z0V A;  2UXD E;  2UU9 E;  4P52 A;  1KIJ A;  2BV3 A;  4DUY I;  2BM0 A;  4HXZ A;  4LF9 I;  3ZZU A;  5IWA E;  5FLX C;  3B82 A;  4DPW A;  1FJG E;  2HKJ A;  1N33 I;  2UUA I;  4JI1 E;  4DR7 I;  1Z59 A;  3T1Y E;  3PYE A;  1NZ0 A;  1HNZ E;  4GKK E;  1ZM9 A;  5LMU I;  1ZM4 A;  4LF4 E;  4DPU A;  1ZXM A;  1J5E I;  4NXM E;  4DV0 I;  1NHH A;  3J81 Q;  1H73 A;  1H72 C;  1IBK I;  4DV4 E;  2HHH I;  4X64 E;  4JYA I;  2A2C A;  1KTV A;  4USK A;  4JI7 E;  4JI2 E;  4B3S E;  2A2D A;  4DPT A;  5LMN I;  1HNW E;  1ZM2 A;  1XMO I;  4B3M I;  4GKJ E;  1IBL E;  1ZXN A;  4DV5 I;  2E5L E;  1N32 E;  1NHJ A;  4DR5 E;  4FW9 A;  4M1K A;  2HK2 A;  2DEI A;  1HR0 E;  1XHK A;  4ED4 A;  2UUC E;  1UEK A;  3LTO A;  2HKE A;  3B78 A;  3J81 C;  2UXD I;  4HAC B;  2UXB E;  2V2V A;  2Q2E B;  4X66 E;  3OTO E;  4JV5 E;  5IWA I;  1HNX E;  1Z0C A;  4HY1 A;  1NHI A;  1FJG I;  1EI1 A;  4JI1 I;  1Z0B A;  3WU3 A;  3T1Y I;  1FWL A;  1S16 A;  4OX9 E;  2R42 A;  4P7A A;  1HNZ I;  4GKK I;  1Z0E A;  1PKP A;  4Z7Y A;  4K0K E;  4JI8 E;  1BKN A;  3D4J A;  4LF4 I;  1MX0 A;  5L3J A;  1N36 E;  2V2Q A;  1KKH A;  4NXM I;  3HUL A;  3LPS A;  4DV3 E;  2BM1 A;  1MU5 A;  4JG4 A;  1Z0W A;  4DV4 I;  4X64 I;  4AQY E;  4YHH E;  2XEX A;  4FWH A;  3CWV A;  4JI7 I;  4JI2 I;  1VIS A;  3V2U C;  4B3S I;  1HNW I;  4NXN E;  4USM A;  4GKJ I;  1IBL I;  2ZM6 E;  2UXC I;  2HK3 A;  4Z7C A;  4JI4 E;  2E5L I;  1N32 I;  1EA6 A;  5A2Q C;  4B3T E;  4DR5 I;  4LF8 E; 
#chains in the Genus database with same CATH topology
 1SI9 A;  3GQC A;  1H2T Z;  5ADZ A;  4DR3 I;  2YVS A;  3OHB A;  2LEC A;  1S77 D;  3UCZ P;  3QFH A;  2XG8 A;  3D6M B;  1SJ4 P;  3ILL A;  2J5A A;  1RT3 A;  1BWE A;  3CSK A;  4GKJ J;  1GTE A;  1RSC A;  4E8U A;  4J90 A;  3TP2 A;  4KBI A;  4DV4 F;  4X64 F;  2CG8 A;  5DRO A;  2AEF A;  4LIW A;  4P7V A;  2J9D E;  4OI3 A;  1FHT A;  4ZJL A;  2CQ3 A;  1S72 S;  3A1Y G;  2HQ3 A;  1FWK A;  4CO0 A;  5JMN A;  3C14 B;  3SSR A;  3IMQ J;  3EIC A;  1Z5C A;  1VFJ A;  2AEJ A;  2F4V E;  5KFU A;  1VK8 A;  2AT1 B;  4ERD A;  5M2P A;  4K59 A;  3LWL A;  1UWA A;  1EQM A;  4KSE B;  3LAM A;  5G0R A;  5A2Q Q;  3KWM A;  4ED2 A;  3G2X A;  4F2S A;  3DLE B;  2B4P A;  2Y1R I;  3BR8 A;  2IER A;  4M63 A;  4C48 A;  2FHO B;  1YHQ S;  3DCA A;  4OX9 F;  4LF7 E;  1UZD A;  2CGE A;  4K0K F;  2R2S A;  1SJR A;  2DXE A;  5J2N B;  1X4A A;  3PCO B;  2LCW A;  2BAN A;  2R8I A;  1UJ5 A;  3CCL S;  5DO2 A;  1R6M A;  1F9H A;  2HGM A;  2PGC A;  2XSF A;  4O3Q A;  1UMJ A;  4OJH A;  4PRV A;  1MG7 A;  1YG0 A;  1QVF R;  4CO3 A;  4TYB A;  3CD7 A;  5F3T A;  1HBN A;  2LXU A;  3UDC A;  4CCH A;  3SCI E;  3W5Y A;  4DV7 E;  3JB9 k;  2X1B A;  5HVH A;  3PYG A;  4MQY A;  3TUI C;  4RNH A;  5ETR A;  1SJF A;  2VG5 A;  3I5B A;  2JZ5 A;  2YH1 A;  4PUO B;  4WP9 A;  3UN5 A;  2F8M A;  3IRX B;  3MHY A;  3FNN A;  1SL0 A;  3Q89 A;  4I68 A;  1UP1 A;  4ELU A;  5D4O A;  2ZVS A;  5DG8 A;  3W9H A;  2CQI A;  1FVS A;  1NKB A;  2JEA A;  1SQE A;  2GAH C;  4N3O A;  2CAD A;  3G71 S;  1UVJ A;  4LRC A;  4DL7 A;  5L46 A;  2FJA B;  1W2B R;  3I9Z A;  1LFP A;  2BKO A;  1IQZ A;  4QR1 A;  4DR4 I;  2E5J A;  3B54 A;  3HSZ A;  5HAO A;  1RHU B;  2GGP B;  4CLZ A;  1OYE A;  5D0H A;  2COL A;  5H9F K;  2ZVI A;  3H8Y A;  1GTH A;  4A47 A;  4NZ0 A;  2QZ8 A;  2HWI A;  2Z2M A;  3Q6M A;  2ZE2 A;  3GFH A;  3R7S B;  1IKX B;  3W66 A;  1RT5 A;  2DIT A;  4LSN B;  2B8P A;  4DR4 J;  1C1C B;  1ZH5 A;  3KRN A;  3K5M A;  3CUL A;  2AMC B;  4DFM A;  4ECZ A;  4WKR A;  2QT7 A;  3M1V B;  3MM8 B;  2EKN A;  2QX0 A;  1U0H A;  4OI0 A;  3B4D A;  2ASY A;  2B7B B;  2IAJ B;  5KFK A;  3T19 A;  2EBG A;  2GHP A;  1CVJ A;  5HRO B;  5KFM A;  4OZN A;  2GCF A;  2IA0 A;  3L7O A;  1J5O A;  2V9W A;  1TVR A;  4NXM E;  2WRM A;  3QZ8 A;  2ILZ A;  1PC5 A;  5IV3 A;  2FJX A;  4P9S A;  3NGS A;  1WC4 A;  4IDK B;  1GH8 A;  1XR5 A;  3MEC B;  2YQ0 A;  2Y0B B;  4DS4 A;  1FK9 B;  2UZA A;  4ZVU B;  4RBU A;  2VD3 A;  5KFG A;  4OZ3 A;  3R7B B;  4DV5 I;  2Y3Y A;  4BWJ A;  4R5P A;  1G7C B;  4C9D A;  1XHK A;  4U9R A;  2WON A;  2DNH A;  1FFS B;  3LTO A;  3UD3 P;  4WP3 A;  4WP8 A;  1JNZ B;  1HD0 A;  2Q2E B;  1S59 A;  4DV0 F;  1Z0C A;  2RQC A;  1H38 A;  5ETV A;  2RML A;  1SUQ A;  4P71 A;  1U1O A;  4DV5 J;  1S16 A;  4P7A A;  2C2R A;  1RT6 B;  3CJ2 A;  1N5Q A;  1K44 A;  4NOH A;  4Q2L A;  5LMN F;  1VI7 A;  3J80 Y;  1FX2 A;  4YB5 A;  2HFZ A;  5THW A;  4LR8 A;  4RW9 B;  3IM8 A;  2P5V A;  3JYT A;  2AYG A;  2XEX A;  4CO5 A;  1VBX A;  2W9B A;  4M95 A;  5C42 A;  4BA2 B;  2N82 B;  3W65 A;  2A10 A;  1HNW I;  1WDT A;  2KFZ A;  1LW2 A;  3FCW A;  4LCG A;  2YNI A;  1SL2 A;  1XMQ E;  3QAT A;  3GV8 B;  4YOE A;  2DIS A;  4RW8 B;  2VL1 A;  3OUY B;  4J9M A;  4MK9 A;  1JXL A;  1HNW J;  4WUC A;  1T94 A;  2L08 A;  4H4O B;  2DR7 A;  2ZZM A;  2U1A A;  2CNK B;  5KFO A;  1RYS A;  1GMV A;  1RTI B;  2OPR A;  1HR0 J;  2W7P A;  1W25 A;  1H7X A;  1MLA A;  1YJ9 S;  1OPI A;  5J2P B;  4MYT A;  2BE9 B;  2JC0 A;  4ZCM A;  3K5N A;  3LP2 B;  3MAA A;  1R7I A;  3PJ9 A;  5F8L A;  4NLS A;  1ZTT A;  1PO6 A;  2BXJ A;  2ZOM A;  2RF2 A;  1MNE A;  1OPZ A;  2GNK A;  1BE4 A;  3KG1 A;  3TJ8 A;  2GQ2 A;  5DET A;  1VRT A;  5RUB A;  3UHM A;  5M2U A;  1OJ4 A;  4LIR A;  4AM3 A;  1ZZN A;  1JLG B;  5FD1 A;  2NPF A;  3CCE S;  3S01 A;  3CDJ A;  2XBP A;  4DX8 H;  5KT5 A;  1AFI A;  5K8M A;  3LP1 B;  2KVI A;  2IMW P;  2CPY A;  1WAC A;  2JLG A;  4IO1 A;  2NN6 E;  2GML A;  1PSD A;  4QQB A;  1C0U B;  2MEW A;  1YDL A;  3CCZ A;  3CCM S;  5CYJ A;  1ACM B;  4I2Q B;  2XO6 A;  5LL6 d;  1RHK B;  1GMW D;  2HNZ A;  5DJB A;  3KYL A;  4DV3 F;  3UN3 A;  1LWF B;  1YQH A;  3WC0 A;  4LCF A;  4ZP9 A;  3M2V A;  3TUZ C;  4DG1 A;  3M4X A;  1I3O B;  2RKI B;  2JC1 A;  4YHH F;  1DTT A;  4DL5 A;  2RH3 A;  1M1K T;  2GJ2 A;  4OYM A;  3PTW A;  5CZV A;  4X62 E;  2JNJ A;  4NLX A;  4OZ1 A;  3C8Y A;  4CP5 A;  5HBM B;  3FUY A;  4KB7 A;  1N6Q B;  2VQF E;  2RU3 A;  1I1G A;  4KHR A;  2HQD A;  1RTZ A;  2DRD A;  1G6B A;  1JB0 C;  3DLJ A;  1M5V C;  4LRE A;  2QA2 A;  1TFW A;  3CMQ A;  1VQS A;  4RU9 A;  1WOO A;  3IS9 A;  3ULH A;  1V3R A;  3CUN A;  2UVW A;  5KFC A;  4XAK A;  3M8Z A;  3KHR A;  1JIH A;  4KYZ A;  1F9F A;  2KT2 A;  3G86 A;  2M8D B;  2B4U A;  2GS8 A;  2P9C A;  4HT7 A;  3SV3 A;  1ROF A;  1IR0 A;  5F0U A;  5MAO A;  3C3L A;  1OMS A;  3V6H A;  1UET A;  1SIZ A;  5T7L A;  4DBQ A;  3TEH B;  2XZW A;  1H7S A;  2N3O A;  4DG1 B;  4LFA I;  2PO1 A;  3OT9 A;  4DR2 F;  1UFW A;  3C15 A;  2PMH A;  2IRX A;  2UUB I;  1VQ8 S;  4IFD A;  3C2P A;  1D6T A;  5J1P A;  3GR0 A;  4DR6 I;  4CH1 A;  2V67 A;  3RJM B;  4I3H A;  3KLF B;  4QOT A;  5A8W A;  4F0K A;  4DPY A;  1UAW A;  1RZM A;  4Y00 A;  4LFA J;  2VIC A;  3TZZ A;  4HAC A;  4KC5 A;  1DJ0 A;  2K06 A;  2ABY A;  2BV3 A;  2GA7 A;  2UUB J;  5HAT A;  3AFG A;  4ZVG A;  5IWA E;  4KGM A;  2V68 A;  2JEB B;  4DR6 J;  5GAD I;  3DHX A;  3BV8 A;  3FBF A;  1O51 A;  2LDI A;  1WC5 A;  1JNR B;  4CLF A;  1ZM9 A;  3TW0 A;  1SVD A;  4JI5 F;  4ZPA A;  4GVB B;  3ITH A;  3HVT A;  3MEG A;  1PCA A;  4OHV A;  2QTW A;  5DRP A;  1AUD A;  2BQ3 A;  1XN9 A;  3CC4 S;  5AJ3 F;  2KZZ A;  1XEZ A;  3SMZ A;  2AKW B;  4DN0 A;  1ICE B;  3K5O A;  3RGI A;  1REV A;  2YNH B;  1ZXN A;  1KQG B;  2C2K B;  3QQC D;  4YB7 A;  1NK4 A;  3HKW A;  4Q0B B;  1RB0 A;  5B09 A;  5HVF A;  3I87 A;  4QNJ A;  3T5J A;  4QWE A;  2NS1 B;  2F63 A;  4KTQ A;  4FNH A;  3IXQ A;  4HAC B;  1N34 J;  2R8H A;  3EVM A;  5IS2 A;  4IOB A;  2YWF A;  4PEO A;  5GAE I;  3J7Z T;  3OTO E;  3THP A;  3D0I E;  4C11 A;  1QSL A;  3HF5 A;  2Y0S D;  3I4H X;  5JEA C;  2VFU A;  2EVZ A;  1Z0E A;  3LAL A;  2YH0 A;  2W2P P;  1BGX T;  1MX0 A;  4H4M A;  3EPG A;  4B3M F;  2FJB B;  2VHG A;  1RT1 B;  3LPS A;  5IT9 U;  3N6M A;  3FZ2 A;  4LQ9 A;  2AE8 A;  1U2F A;  1P27 B;  2VPW B;  1C0T B;  3V4M A;  2LEA A;  3W8G A;  2C3Y A;  3OTE A;  4CYU A;  4ZK7 M;  1V3Z A;  1D1U A;  2ZJQ Q;  2R7V A;  2E5L I;  3N9U C;  2ZUA A;  5EGY A;  2KHD A;  3MEK A;  2CG9 A;  5DRQ A;  3RTV A;  3GIL A;  3ET6 A;  4OZJ A;  5L9X A;  1RT7 B;  4DSJ A;  4B3O B;  1XTZ A;  4WWS A;  6FD1 A;  3PW7 A;  2J9D A;  2MKK A;  2DTJ A;  2WZ1 A;  4CI0 B;  4CH0 S;  2E5L J;  1TQL A;  4OMF G;  1VQY A;  2EFO A;  1UFK A;  2W9A A;  2MLZ A;  4JI7 F;  3X1L B;  3LGN A;  1QTM A;  2YX7 A;  2E1C A;  1Z5B A;  4NAS A;  2E1R A;  1ZS6 A;  3DGV A;  2C3O A;  4JI6 E;  3EDQ B;  2WW8 A;  4RW6 B;  4UF4 A;  3G82 A;  1VDH A;  3TA1 A;  4Z37 A;  2DRB A;  4R1F A;  3EZ5 A;  3P49 B;  2UV8 G;  4ZPW R;  2KM8 B;  4NML A;  4DQS A;  4ISA A;  3AT1 B;  4Y34 A;  4NXN I;  5A6P A;  2HRT A;  4PG6 A;  3MM5 B;  1I94 E;  4X66 F;  1HNX F;  1NBE B;  2A6M A;  4LF6 E;  2HG4 A;  3PY8 A;  5C25 B;  2O1P A;  3EYZ A;  2PO0 A;  1GMU A;  1UA1 A;  2QA1 A;  1JX4 A;  4KV8 A;  4MKV A;  2LEB A;  1VBY A;  5KT2 A;  2JHE A;  4F67 A;  5KG3 A;  1KS2 A;  3TAM B;  3OD2 A;  4UOH A;  5A8R A;  4B9U A;  2MQQ A;  5DRR A;  1M90 T;  4KPY A;  4NXN J;  2QL7 B;  4C8K A;  4Q2M A;  4ZVP B;  3CD0 A;  1BQM A;  3UDV A;  4U7U D;  4PG4 A;  1TTH B;  3PIP Q;  4IO9 Q;  2J7K A;  1HWJ A;  5AE1 A;  4DZD A;  2BR2 B;  4PCQ A;  1U4B A;  1RBL A;  4OZE A;  3LW5 C;  3A3O B;  1JLB A;  3J7A M;  4DSF A;  3HD2 A;  1PJ7 A;  3BB5 A;  3BPS P;  3W61 A;  4DUZ E;  1FEE A;  3FFI A;  3J81 Y;  2XCA A;  2MB0 B;  3CD5 A;  1JQG A;  5C24 A;  4YY3 I;  1B7F A;  4JI0 I;  3IR5 B;  1FFG B;  1GNK A;  3BQ1 A;  1CS4 A;  4BLG A;  3MMB A;  2QG9 B;  3WU4 A;  2Q1L A;  4WIQ A;  4RBV A;  1RLC L;  1TL5 A;  2LJP A;  3WU6 A;  3BSC A;  4WKY A;  2O3D A;  4F2R A;  1CUL A;  2H48 B;  2M52 A;  4WFX A;  4MT1 A;  5HAN A;  1JLE B;  4OI1 A;  3H5U A;  5HP1 A;  4YY3 J;  4JI0 J;  1NJI T;  4OZ5 A;  2UUC F;  3CME S;  3GME A;  1KDN A;  1LQ9 A;  4ATN A;  1Q8B A;  3FBB A;  3PVX A;  4FWD A;  1E6V A;  3M9N B;  2CXE A;  4WE1 B;  5FLX Q;  3CIZ A;  5K14 A;  4QYR A;  1MMD A;  2IM1 A;  3T3F A;  1R0A A;  1URN A;  2HHQ A;  1WNE A;  1RP5 A;  4EZ9 A;  1HWU A;  4OJ3 A;  4NZ6 A;  2MKS A;  1LOU A;  1RTD B;  1TEL A;  4N76 A;  1R89 A;  4YUD A;  4HHU A;  4HLB A;  1NPP A;  2RHS B;  3O2I A;  2UXD E;  3AOB A;  2JE6 A;  3FDS A;  4ZKA A;  4F4Y A;  1S97 A;  4LF5 F;  3RBD A;  3GII A;  5FLX C;  1OYS A;  2DH7 A;  3KLG A;  4OHZ A;  2A0F B;  2E1P A;  2XNR A;  1TKX A;  2DNK A;  2ZD1 B;  2MSS A;  5E7O B;  4TQR A;  2WTF A;  3HLU A;  1UPP A;  3LO3 A;  3EZO A;  2N3L A;  2AZ3 A;  3R5C A;  3GG1 A;  2B51 A;  3MI7 X;  2ROP A;  1H72 C;  2MKI A;  3DRY A;  3RBX A;  4FBT A;  2FIU A;  1GMW A;  2AWZ A;  2H5E A;  2DH9 A;  4JI2 E;  4J3D A;  4N41 A;  4M5H A;  2RDJ A;  4PR6 A;  3OFF A;  4ZLN A;  4GC7 A;  5CCM A;  3FZB A;  2VQE J;  5C2G A;  1T05 B;  4M1K A;  4D3G A;  2DEI A;  2Z2Z A;  5JEA D;  5KFB A;  3P3C A;  3LGM A;  4ED4 A;  1WKK A;  4OJ1 A;  3TJ9 A;  2V94 A;  4BDP A;  4OYA A;  4MIB A;  2CIM A;  3DLL Q;  3HT3 A;  1KOO A;  1FDA A;  4S0M A;  4ELT A;  1Z0B A;  5HI7 A;  2PNZ B;  1F1B B;  1SV5 B;  3UVJ A;  1KLN A;  1TKX B;  3QSY B;  2A6O A;  4QIE A;  4AXJ A;  3OVA A;  3U27 A;  4NI2 B;  3IBW A;  2MZS A;  1N36 E;  2V2Q A;  4R0J A;  1KKH A;  3R5B A;  2HQI A;  3C46 A;  3RUB L;  3GSI A;  1F5C A;  4DV4 I;  2L48 A;  4X64 I;  1EQ0 A;  2KG0 A;  4AQY E;  1RWO B;  3UWT A;  4DFP A;  1S1T B;  2P2C B;  3P45 B;  2D69 A;  4NA1 A;  1RA6 A;  2DB1 A;  5KFL A;  2HQF A;  3C66 A;  4IZJ B;  3M2R B;  5IM0 A;  1HI0 P;  5B0G A;  2H4Y B;  4LOM A;  4DQI A;  5KFH