3HULA

Structure of putative homoserine kinase thrb from listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
277
Chain Sequence
SLRIRVPATTANLGPGFDSCGLALTLYLTLDIGAEADSWYIEHNIGGGIPHDETNVIIETALNLAPNLTPHHLVMTCDIPPARGLGSSSAAVVAGIELANTLAELNLSKEEKVRIAAEIEGHPDNVAPAVLGNWVVGAKLDGEDFYVRHLFPCALIAFIPKAELLPDTLPFKEAVQASSIANVMIAAILRNDMTLAGEMMERDLWSQLVPHLAQIRDVAKNQGAYAACLSGAGPTVLVFAPRNLANKLQTSLQTLEIDADVLLLDVEGSGAEVFREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative homoserine kinase thrB from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords Homoserine kinase
total genus 75
structure length 277
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.1.39: Homoserine kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3hulA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hulA01
4LF9E 3T1HI 1VISA 4USKA 5L3JA 1EA6A 3WU6A 4DPXA 5LMNI 1N33E 2X7IA 5BR8E 2F4VE 1K47A 2ZM6I 2R3VA 3QT8A 1RR9A 1Z0BA 4P7AA 2LJPA 4ED4A 3ZZTA 4DV2E 5IT9Q 1J5EI 3K1JA 1D6TA 2X36A 4FN5A 4DPTA 1B63A 2DEJA 4ZVIA 4LF5I 2V2QA 1ZM4A 2VQFE 4HYMA 4DV1I 4DV6I 4Z7CA 4OX9E 4HY1A 4DV0I 4LF8I 4JI6E 1Z59A 1Z0CA 5A2QC 5A2QQ 1N34E 2DEIA 4JYAI 1PVGA 4NXME 2A2CA 2BV3A 3GONA 4X62E 4JI1I 2HK3A 3PYFA 2F4VI 3F0NA 5IT9C 1HNXE 3J7AM 5FLXC 1XNQE 5GMEA 3WU4A 4RPFA 4JI1E 2OI2A 1ELOA 1DARA 1MG7A 4DR5I 1IBLI 3CWVA 4DV5E 3PYGA 4GKJI 4JI4E 4DV3I 1KIJA 1Z5AA 2UU9E 1IBMI 4KHPI 4DR6E 4LFCE 1NHJA 4DU8A 1NHIA 1WUUA 2CZ9A 4PRXA 3J7AG 3PYEA 4B3SI 2VF3A 4LFCI 4KQVA 3B82A 4PRVA 4LFAI 2Q2EB 4UT4A 1OJ4A 1IBKI 5LMNE 4JG4A 4LF4E 2BM0A 3V2UC 1XMOE 3JAMQ 4WUBA 3H4LA 4LFAE 1H7SA 3ZZ0A 1RREA 2ZBKB 4B3TI 2HFSA 4YY3E 4X65E 1HNXI 1NHHA 2HHHI 4JI5E 4KHPE 2UU9I 4MYTA 4DR6I 2ZITA 3B78A 4R1FA 4YY3I 2E1RA 1H7UA 4DU7A 4DR4E 4LF6I 4LF4I 1IBKE 3WU3A 4HXZA 1XMOI 3ZZUA 4LF7E 4DV2I 4AQYE 1N34I 1KKHA 1H74A 1H72C 1B62A 1EI1A 4NXNI 4B3ME 4X65I 4B3RE 1N36I 1Z0GA 4AQYI 3M6AA 2A2DA 4LF7I 4DV6E 5BR8I 3J81C 3J80Q 2V34A 1Z5CA 3T1YI 4GKJE 4DV3E 3WU5A 3QT5A 4MYUA 4DUZI 2WW4A 4B3SE 2UUAE 1KTVA 2HHHE 1FWLA 4WUDA 3LPSA 3QT7A 3ZKBA 2EFGA 4M1KA 1BKNA 4HACB 2HFUA 3LNUA 4JI5I 4DV1E 2UXDI 3ZM7A 3B8HA 4JI7I 1HR0I 3T1YE 1J5EE 4DR4I 2BM1A 4X66I 1ZM9A 1FJGI 1XNQI 5IWAI 2ZM6E 2HKJA 1MX0A 1Z0VA 2UUBE 5LL6R 4JI6I 4PU9A 2UUCI 3J81Q 1UEKA 4FW9A 4K0KE 4FWGA 4LF5E 4JI2E 4DR5E 4DV7E 4DPUA 4JYAE 3OTOE 2UXCI 4DV5I 2UUCE 1ZM3A 4DPYA 4I3HA 4JI3I 1XMQE 4OX9I 4X64I 5IWAE 4DUYI 1XHKA 1Z0EA 1HR0E 4NXMI 1MU5A 1KVKA 4JI4I 2NPFA 4DV7I 4JI2I 1HNZE 1N0UA 4K0KI 4DPWA 4JV5I 1PIEA 1ZM2A 4WUCA 1Z0WA 4GKKE 2R42A 1ZXNA 4LFBI 1U2RA 4DR1I 4JI0E 4JV5E 2UUBI 1Z0TA 1HNZI 3K17A 4DUZE 2AJ4A 1S4EA 3Q1QA 2XEXA 4X66E 1IBLE 4X62I 2E5LE 4DR2I 4LF9I 1FWKA 1I94I 1PKPA 4FWDA 1XNRE 4DV4E 4JI3E 3ZKDA 2V8PA 4DUYE 4UTGA 1XNRI 4X64E 1XMQI 3J80C 4FWHA 5GMDA 2UUAI 4URLA 4USMA 1HNWE 3D4JA 1IBME 2GS8A 3PYDA 3HULA 4JI8E 4HACA 5FLXQ 5LMUI 3T1HE 1FNMA 1NZ0A 3OTOI 2UXCE 1ZXMA 4P52A 3QT6A 2UXDE 2UXBE 4JI8I 4DR7I 1H73A 1HNWI 4XTJA 2VQEI 4LFBE 3V5RA 4GKKI 1N0VC 4YHHI 1N36E 1S16A 4DR7E 4B3MI 2UXBI 1N32E 4EMDA 1FJGE 1N33I 1FKAE 5LMUE 2V2ZA 1FI4A 4LF6E 2E5LI 4DR2E 2HKEA 4JI7E 2J7KA 2HK2A 1N32I 2V2VA 4B3RI 1A6FA 3JAMC 4DR3E 4NXNE 4DXLA 1QZRA 4JI0I 4LF8E 3LTOA 4DV4I 4DV0E 4DR1E 4YHHE 4DR3I 4Z7YA 1Z5BA 2VQEE 4B3TE 1I94E 2VQFI
chains in the Genus database with same CATH superfamily
1FDAA 3LP2A 3H40A 4J9RA 2UUAJ 4QCLA 2PNMA 3GTYX 1RHMB 3BR8A 2FJDB 2FY8A 4C8NA 3RG6A 3TO8A 4O0NA 4RJVA 1EAYC 2DR9A 2G1DA 1R6MA 4DPXA 4M5HA 1I51B 4NI2A 3UI3A 1C1BB 2U2FA 2MXYA 2DGSA 4FYXB 5A6WA 2Z0GA 4N56A 1N33E 5LMNF 3QRRA 1S6QB 1MMDA 2GCFA 4KGZB 2HPUA 5AE1A 3V6JA 3UCUP 1YH8A 1WC5A 3GYNA 2QL5B 2WZ1A 1RTHA 2XC9A 2F4VE 4X64F 5DNLA 3CCUS 1K47A 1SL1A 2XSJA 2B9WA 1F2HA 4OZ2A 4KFBA 1B64A 4Q45A 2R3VA 1RE1B 4RWXA 1U45A 4NXMF 3H7HB 1CJKB 1U6FA 1RR9A 1Z0BA 2MTLA 4C0HA 3QGIA 1IKVB 4MT1A 4URGA 4JI8F 1OIAA 4AIMA 4C7QA 2IY5B 4IRKA 1PGZA 1NSPA 3ZZTA 3NBPA 5LT5A 1SKRA 5D8HB 1T03A 1RDRA 3DD6A 2F7VA 2B6AA 1K1SA 4P74A 1JLCA 1ZS6A 3DHWC 3KUEA 2QEXS 4DR6J 4FN5A 1HBUA 2V0NA 3HVTB 3GWCA 3IGVA 4I64A 3TJ9A 1MU2B 3GJRB 4RZRA 4YB1P 3Q23A 3CDWA 1KSPA 3OFHA 3RRGA 4KFBB 1Y3KA 3IRWP 4DV4F 2C3MA 3SXLA 4GC6A 1QVFR 2VBXA 2ZDPA 3CJ8A 4LF5I 1NZ8A 1FX2A 2CDQA 4L3KA 4ZP6A 3CC2S 2FLNA 1Q5YA 4B3MF 1ICEB 3JTNA 4AE5A 5GADU 4LCFA 4URSA 5M2UA 3MEEA 2WNRB 4CLLA 2ZFHA 1XNRJ 4V19J 3RBDA 1PBUA 2NR0A 4CNYA 4DV6F 1JLCB 1I3OB 3Q8PB 1Q82T 2AJ0A 1VBKA 2B4VA 2G2ZA 3AODA 3HVTA 1SH0A 3SQOP 4HY1A 5C25A 1FCAA 1XK8A 1Y0HA 2C2ZB 2VFUA 1WHWA 2V2KA 3QJJA 4C3KA 5HSPA 2FQQB 1Z59A 1TUVA 3OR2A 1FKAF 2H5EA 4MKAA 2PMWA 5A2QC 2DCUB 1JLQB 4MH8A 3ZZOA 4XDDA 1X60A 4DFMA 3PX6A 3BH7B 4I7FA 1AUDA 4B9UA 1WC1A 4ILRA 4USIA 1YRXA 4U96A 2XSFA 3LGNA 5EX0A 3PDNA 4NXME 3GFHA 1J5OB 3KJFB 2VIHA 3K7RA 4B3TF 1LQ9A 2A2CA 1NJXA 4YP3A 2OMOA 4LF2A 2CQ0A 3V6DB 1HQ2A 2CYYA 2V68A 4YB7A 2YPYA 4JI1I 2PN6A 2VZ9A 2L48A 2EKNA 1BE4A 3F73A 3KG4A 4IYQA 1NU4A 3K5LA 4DX6A 1QUVA 2QFIA 4H4MB 3BYPA 1A0OB 3SFUA 3UN5A 3PYFA 1HD0A 2IJRA 3MCMA 3VQTA 1R8HA 4PXDA 4ANDA 3PR5B 3LUYA 2J9EA 3HJCA 1S12A 5CQGA 1KQKA 3UO0A 2DIUA 3J7ZT 2YBVA 2GQQA 2HGNA 4WPAA 5BR8F 3RRHA 1PYOB 4DCOB 3F0NA 3TAPA 4KRWA 2N4DA 9ATCB 2AD9A 1HNXE 1H2UX 3S7RA 5GMEA 1B7YB 4RPFA 3OVSA 4OL8A 2NN6C 3P3GA 1ELOA 3O44A 3OLAA 3S01A 3UCGA 3LO3A 3VAKA 4K2JA 1KFSA 4W90B 2XYPB 3ZTOA 2ZHBA 5CD4A 1LW2B 3KLVA 3ADAC 2UUTA 3BPDA 1KQSR 5KFOA 4Q8EA 1Q81T 4DR5I 3PFEA 4NRUA 1SBRA 1C1CB 1RHRB 3R5GA 3A3NB 1UWBB 2E29A 3CTRA 3GYXB 4KYZA 1LW0B 2BKOA 4ZPCA 1RT4B 4HDHA 1HYSB 5D4NA 2JH3A 2L41A 3MPDA 1S0MA 1FESA 3GSDA 5AT1B 4DV3I 1U47A 1KIJA 3BSCA 1SJFA 2JRSA 2B43A 3Q83A 1KEKA 1OQ6A 2ALYB 2IM0A 5A2QU 1VQ8S 1Z5AA 2J0XA 3QPIA 2DPJA 2HAFA 1LFPA 4Q2LA 5F8HA 2UU9E 2LP4A 1S99A 1RAAB 1TL1B 2MKHA 2DGWA 3DGPA 4BCAA 2WB1D 2MGZA 2C38A 2IFXA 1T9UA 2JT2A 3H1CA 4IG0B 1GNKA 2MQOA 2BJ9A 2CPIA 4DR2F 2VOOA 3MAQA 2XI3A 2CZ9A 4OYZA 4B3SF 4PQUA 2JEIA 1NSQA 3TZWA 2A1BA 3ZNUA 1J2VA 3Q8SB 2BDPA 4FW7A 3KG1A 3UW1A 2B51A 5ETVA 1FE0A 4LF5F 1FNXH 1RQ0A 1OYEA 3HHDA 5F8LA 1TK5A 2ZH4A 1OQ3A 2NSCA 4P2MA 4PRVA 1FJ7A 2E5JA 1XMBA 2HFVA 4N8NA 4J9OA 5B0BA 3G2XA 3HT0A 2GQCA 3VALA 4DV3F 1N5YB 2WB4A 1OJ4A 2GC8A 3MOZA 5JEAC 4PR6A 2VD3A 2Q3PA 3BYRA 1IBKI 4LSNA 2DNPA 5HROB 4LF4E 1T05A 3BKFA 3V2UC 1YBUA 3HZGA 1KQFB 3TOQA 2Y0BB 3NNAA 3JAMQ 4W92B 4DCPB 3KK3A 2F5GA 3GR1A 2CPYA 2EFPA 2HHSA 2RQMA 3NP5A 3LAKA 2VONA 2Q6CA 1XMQF 2BQ3A 3BO3A 4J7CA 1YJ9S 2DNNA 1RT5B 2E7VA 4ZVSB 3ZTPA 1OY8A 2KVQE 1DURA 1DY3A 4GO7X 4QWEA 2ZBKB 3CMES 2IMOA 4ECZA 1WTBA 1Y5NB 6AT1B 4B3TI 4IFDC 3UN2A 2YVSA 3QFHA 5H9FK 2MY7A 1W25A 2ZBPA 4OV6A 3D2WA 1NHHA 4L3NA 1N33F 1HNXI 2HHHI 2QIFA 1OO0B 2EW9A 2QT7A 4DL6A 2B4OA 2AGQA 1KTQA 3NRBA 3QIDA 2ZITA 5D15A 4LCHA 3B78A 4LREA 1Q7LB 2RF2B 1N34I 4WP8A 1U7LA 3WHIA 2ZD1A 2ZBRA 3HKWA 3PEHA 3G96A 2QA4S 3HDSA 3ICLA 5HMYA 4JI2J 3W9IA 3NGDA 1XNQI 2KT5A 1WC3A 2RKIA 5SZTA 2GO3A 3THTA 1KR4A 1XWLA 4DU7A 5C7PA 1UVNA 3M8QB 1VC0A 1NXIA 3THPA 5KFEA 4QNKA 4NZ6A 2CJKA 5DQIA 4DFKA 2BA9A 2RSQA 4WK3A 2P9EA 4RU2A 2MZJA 4HH1A 4QIWD 3D5MA 4DR5F 2VA2A 4LF7E 5J2PB 2E1MC 4DR1J 1VQ6S 2AP6A 5HBMB 1SB6A 5KFRA 4PCQA 5I3QA 3UNYA 3CE8A 3CXCR 1H74A 1NBEB 4ZVQB 4R5PB 2F4VJ 3KNAA 5K8NA 3S8SA 4RW8B 1H72C 4DUZI 3D0IE 4QYZJ 1KOOA 3QAEA 4PQAA 1EI1A 2GIFA 1CC8A 3OQ2A 2V4RA 4LF7J 3GB0A 2ILYA 1QAJA 2YY3A 4QIEA 2HFNA 4A46A 2VODA 3SV3A 1S9FA 4WP9A 3PEJA 2PO0B 4ED1A 1DTQB 1WELA 3IBWA 4PYAA 4DQQA 4LF7I 4OV1A 3OHAA 5IZHA 4A8MP 2LCWA 5G0RA 2B0GA 2FHOB 2V34A 2H9ZA 3LH2S 4QR0A 2QL9B 2RU9A 2WRMA 7AT1B 1HQUA 5GMKa 2HNDA 3DGVA 3RB4A 2D1CA 3P76A 4ECRA 1FF2A 4O3PA 2ZH8A 4ED5A 3CGIA 4M5KA 1Y60A 4GKJE 1SPBP 3E51A 2MKKA 4P75A 3AOAA 2NLWA 1NSKL 4DFPA 2DPIA 3QT5A 3MZIA 1MN7A 4TYBA 3S1TA 4AUKA 3CDUA 2KRRA 2WW4A 2PO4A 2HAIA 4RUAA 3M9MB 3D6MB 1U1NA 4PXBA 5ETPA 3KHLA 2JNJA 2XGQA 1H7XA 2XMJA 4RU9A 1AYEA 2VL1A 3FMWA 3V81B 4KPCA 3OVBA 2HHHE 2LA6A 3RR8A 2IAJB 5A8WB 1M1GA 1NPRA 1YRTA 4CLTA 3EWGA 2CVEA 1CVJA 4NXMI 2MHEA 5MAOA 2DGQA 2H5JB 2LXFA 4IDKA 4M5DB 4OX7A 4ED6A 2HFUA 5K36E 1GQEA 4PWWA 4OI0A 2N7YA 2B56A 3B4MA 4ZOSA 4DZDA 4QU6A 1YRUA 3VGSA 5J1PA 5DETA 3ZM7A 5J2NB 2JC1A 4X65E 1XR7A 2F8MA 3ISNC 3MMCB 3N79A 1HBUB 2MYFA 4OI6A 5BXIA 3QSYB 4N8OA 5KT5A 4KIAA 3VAJA 1K0VA 1E6YB 1Y4UA 4OI2A 4ZJLA 3T1YE 1YJUA 4EBCA 4LR9A 4C98A 3VGUA 4K4YA 2D69A 2HBQB 3EVOA 2OJ3A 2BM1A 2B8QA 1IBCB 2H4WB 4Y2IA 1V3ZA 1N36F 4PPDA 5G4DA 5JEAB 4ED7A 1R8CA 1RHKB 4HL9A 1LW0A 2QE5A 2HHQA 1XBWA 1YLXA 2K3IA 3HFZB 4JI4F 5A8KA 3TVZA 1VQMS 1Z0VA 4C0OC 2H3EB 3DOMA 1EETB 5A8RB 4L75A 2D9OA 5KFXA 1NAQA 3ZKBA 4IQXA 1VJWA 5K9FA 2UUBE 1E6YA 1RAGB 1K44A 1DQ8A 3AFGA 1QD1A 1R31A 2VJUA 3SV4A 1IBMJ 1NZAA 3MHYA 1VRUB 2KM8B 2XNRA 2NXUA 1H2VZ 3GV8B 5EUHA 2F1FA 3J81Q 3M30A 3CDEA 1DTTB 4CLYA 4D3GA 2UUCI 3RBZA 3I0SB 1IJEB 3R97A 1LXNA 2WONB 3LF0A 3CCSS 1N6QB 2HQGA 2YX4A 1HMVB 3M4XA 4FWGA 4OO1D 4KO0B 4OYBA 3ZC4A 3UD4P 4DR5E 1NHVA 4B02A 2R8GA 3AA9A 4GC7A 3DRPA 1JXVA 2DNKA 3LP0A 2UVRA 3DLLQ 1NDPA 2CJAA 2I5JA 1IWGA 4P72A 1HWKA 2VPXB 2NXNA 2CG9A 1MWQA 5C0XF 1FJGF 4WU3A 1RT7A 4PABA 3BGFA 4QPTA 1NKCA 2E5HA 3H59A 4UY85 1WC6A 4JI3J 1CS4B 3D6TB 2P6TA 3JSRA 4CLKA 1IBKJ 4C8ZA 2BA0G 1F1BB 1P1TA 2MLXA 1XMOF 2QC3A 2YQ1A 4DPYA 1S9EA 3MM6A 4RKUC 3RB3A 2DNOA 3HXMA 1OPZA 4S0MA 3NNHA 5L38A 5DDOC 5EWEA 1ZA2B 4JI7F 1TAQA 5SUHA 2CPDA 4K4SA 2DGVA 4NLDA 4R8UA 2ZZNA 4DR4F 4DQIA 3OL8A 4N47A 2R7UA 3KLIB 1UVIA 3MR2A 4QPXA 1PC4A 3MR7A 3QMQA 4LR8A 4GKJF 1OYDA 4DQRA 2Y8WA 3S6EA 2DNYA 1AB8A 2RDDA 1M5HA 3CCTA 2O67A 5E33A 4IRCA 4LF1A 3E8OA 1UDQA 1T95A 3PRYA 2QLWA 2Y1JA 3VR1A 5FLXU 1IQZA 4EO6A 2EK1A 5HQLA 3KXDA 2EFNA 1TL7B 4DF8A 3ZZPA 3W9JA 3V4IA 2Z5CB 4DPWA 1PIEA 1RCXB 4OX9J 2D3OR 4PPZA 4WZQA 4G3IA 2MLZA 2WBMA 3C14A 2KXFA 1QY7A 2R7XA 3IFEA 5HP1A 4NBQA 4GKKE 3ILIA 2R2TA 3BGUA 4YS2A 3NWRA 1TFYA 4LFBI 1RWVB 1WG5A 2QYGA 4U95A 2HYIB 2R7TA 5HBMA 3OD2A 1UDNA 2WOMA 4IZKA 1SUQA 4LF8F 1VHFA 4FVMA 4J9PA 4JI6J 4KGVB 2UUBF 2VPYB 3G82B 4X62J 1X4GA 3QZ8A 1D09B 3Q1QA 3GIKA 2AJ1A 2FVCA 4C2MA 2PO0A 4WFAQ 2IVFB 2UUCJ 1UVJA 3H5XA 3C66A 3L7ZA 2BANA 3PCOB 2IA6A 1NUEA 1XJWB 2E5LJ 3GMEA 3BSOA 3G9CA 2G4BA 2WHOA 1XNQJ 2XB2D 2OFHX 2R7VA 1S1WB 2ILZA 1HBOA 2DHSA 3IG1B 3TW0A 4RUHA 5GAHI 1VQ7S 1NKEA 4NI2B 2M8DB 2ZBQA 3W5ZA 3MAAA 4RW9B 3SBMA 4DV2F 1WEYA 2JVRA 3EE3A 4DR3F 4DL5A 4LF9J 2RB7A 2F63A 4FWDA 4IZKB 1E6VB 3MMCA 4Y65A 2GFFA 4JI0J 1FRHA 2MDAA 3C15B 2ZJPQ 3ZKDA 2Z58B 2V8PA 2VB6A 3DLJA 4OYXA 3U1YA 4LF8E 5ITHA 3PW4A 4EGLA 4WKRA 1NK6A 4TNOA 5C0XD 4NLYA 3QO9A 1HIYA 2BRLA 2RIJA 1S4FA 2UZAA 4H4MA 2XHWA 2QZ8A 4OHXA 4BWMA 5K36A 4IFYA 1NH7A 3FCHA 2DD8S 1HBNB 1RBAA 1U8SA 3NCPA 3P4UB 2FVRA 3O8WA 5GMDA 4ECXA 4DG1B 2UUAI 4OLOA 2HRTA 2MJUA 1R6VA 4RLEA 2JEBB 1K73T 1XQIA 5JJBA 2GS8A 4JI8E 3HULA 1S77D 3QYYA 1MU2A 1S7IA 1R7IA 3FSYA 4ELVA 2GV1A 4IOCQ 3FZBA 1FNMA 2GMHA 3H5SA 4KR0B 3WIVA 3SSQA 4LF6F 2HHUA 2XCPA 1CLFA 2UXCE 1N4LA 4XK8C 4AYBD 1QE1A 1SV5B 1WDDA 1N34F 3BS9A 3LGMA 4PG4A 4WE1A 1W26A 4K4XA 2VDHA 1L5UA 2ZNZA 3K2YA 1P27B 2UVWA 4JI8I 1L3TA 4DV7J 3GIIA 4R5PA 2IVYA 4DR7I 3W62A 5D78A 3TJAA 1V3RA 1CJKA 2EKYA 3M8PB 3BDEA 3MPUB 1NB7A 3L95X 4CLZA 2AEFA 1HPZB 4N7TA 2YNIA 1USUA 1IKVA 2J76E 2GNKA 2HNZA 2Y1RI 3CD7A 4DEZA 2QTWA 4KBIA 4ISAA 1XTZA 3Q0AA 1N36E 2HHPA 1NEEA 4TLQA 4TY8B 2OEJA 3DC2A 3GLJA 4OZ3A 4ZIWA 1PG5B 4FYYB 3BGRA 4WE1B 5LMUJ 1JIHA 3M2VB 1F3FA 1OY6A 2DBBA 3HD1A 2QA4G 1UEVA 1RABB 2V8GA 2OPQA 3D6FB 3MI7X 3R5JB 4FKYA 5HVFA 3CJKB 2WVFA 1WKKA 2M70A 5KFBA 1Y7PA 4EMDA 1M1KT 1N32E 5KG6A 2M52A 3IBCB 2HRUA 4TQRA 4GVLA 3BQ2A 1X0PA 3DLKA 3K8WA 4HHUA 4OZNA 1X8DA 4Q7AA 5LMUE 1HA1A 1U8WA 5A2QY 4ZLJA 5C42B 2HZVA 3I0SA 4H4OA 3DI6B 4QIFA 2V9WA 1FKPA 2CRLA 1UCNA 4ZLPA 2OPPB 4ZPWR 1R0BG 2LU1A 2ATCB 2CNNB 3UN3A 2HKEA 2P2CB 3IGNA 4HTJA 1KNZA 1UVMA 2BE2B 2BJEA 3IRXB 1RWXB 3NAIA 3G6ES 1T05B 3IS9A 2JHEA 3BH6B 1CC7A 1B0PA 3LGHA 1U0SA 4OZJA 1KHVA 2KG0A 2W7PA 3SCKE 3GZ7A 3DDIA 4EZ6A 1U0HA 4B17A 4B3RJ 4LRBA 3LTOA 3O3LA 4DV4I 2CA9A 3NOGA 3CB4A 4DR1E 1RYRA 4RW4B 1R8BA 5KFMA 4H54A 4X4NA 3MCSA 4I0WA 4MTPA 3OLBA 3KYLA 1UL3A 3IR7B 3I4HX 2UP1A 2QSFA 1YJTA 5HVGA 4YUDA 2B7CB 3PJWA 2VICA 1BQMA 2GVDB 1UKUA 2BE2A 3TYTA 5I4MA 4ZVFA 4I2QA 4LJMA 1S1TA 3IS9B 2R2UA 1TK8A 5A8RA 4DHVA 5T14A 4KT0C 2WK4A 1BWVA 1NK4A 3Q2SC 4PUOB 2HW3A 2UV8A 2PNZB 3R5AA 1NDKA 5ETKA 2MQNA 1U0HB 4I4BA 4LFAJ 1N32J 1YQHA 1X4HA 2VPWB 5L3JA 4A8FA 2OMLA 3WU6A 3R1LA 2RD5C 2R7QA 4EU0A 1MN9A 2FZKB 3AB4B 4J37A 1G7CB 4OZLA 2VG6A 2C38B 2R7OA 2AZ3A 2X7IA 2UV8G 4IFVA 2GIRA 3BKTA 1F9FA 3FSIA 2UXDF 4X4UA 4IZJB 2C3UA 2C37A 1RWKB 1D9FA 3UDCA 4AXIA 2RQKA 1TQLA 3MUVP 1HARA 1NDCA 2O1UA 2CPFA 2GJIA 1TUGB 4CLSA 4OIXA 3HKMA 1X4EA 3AXKA 1H98A 1TK0A 2W24A 2JE6B 2IVMA 4ZP7A 2FZGB 2R2SA 1NKBA 3VZHA 3CJ5A 3L7OA 4QW9A 2F9DA 3PW0A 2AV5A 2BQUA 2NUUG 1RAOA 4IKAA 3NOCA 4ED4A 2ERRA 3LPYA 5L8RC 5CAAA 3I5BA 5L39A 2CWKA 4C3MA 5KT2A 2ZH5A 2ADCA 1VQ5S 4DV2E 4CT9A 3K58A 1ITPA 4JI5J 2NZCA 3C16A 2YWWA 3NGUA 4ZVUB 3TNVA 2MQPA 1VHIA 4P7TA 3SMZA 4DPTA 1WOSA 4CI0B 4ED3A 1YTYA 2OEMA 3OPKA 1B63A 3NXZA 2HWTA 3EVWA 1CJVB 2YKAA 4K8RA 3SZ2A 2GAHC 4O23A 2GJFA 3JQJA 2H5IB 2HNDB 4HTIA 4NASA 5DRQA 3CJQA 1RTZA 2H54B 3TVYA 4HYMA 4DV1I 3CJSA 3MEGA 2POKA 1AUSL 1H3DA 1UJ5A 3FEXB 3H2UB 4YB6A 3V4MA 3VZIA 4E8UA 3OL6A 1U1OA 5CXTA 1PKUA 2IM1A 2PNLA 2ZZTA 2HQIA 3D0HE 1LKZA 3MAAB 4OX9E 3MR5A 5EKWA 3CCMS 2XMTA 4ED2A 1YZ7A 1UW4A 3VGTA 4F4WA 3CMAS 3OJSA 3QGPA 4U7CA 1NK5A 2E5LF 1KWMA 2LQ8A 4JI5F 3LP2B 2C3PA 2XCAA 2DO4A 3PKMA 2DEIA 1HLWA 3PW5A 2OUGA 2NN6A 1CG2A 1UJ6A 2QO3A 1VC5A 3FGVA 1RKJA 3DLEB 3JS9A 1G2EA 2PO1A 1LEOA 4J9NA 3P3EA 1RWWB 2C42A 3HK2A 2FJBB 3KK2A 1U6ZA 2PIIA 2EG1A 2Z2ZA 3OTBA 3KLEA 1U6BA 4O3QA 4ZLNA 3W2WB 3HF5A 4N41A 2BE7D 1GTHA 3AXMA 3OL7A 3UE2A 1Q86T 1VBYA 2YKPA 2BKPA 2HK3A 5A0YA 3KLGB 3D6HB 2J9DA 4LRCA 2ATLA 3KOAA 3GIRA 2XGPA 1CBKA 2ADBA 2RRNA 1HW9A 1L3VA 3M6AA 3H8YA 5BYRA 2CNKB 2XMVA 3DHXA 3TEGA 1X5PA 4KE5A 4ED0A 2UU9J 1N54B 2BACA 1MSWD 4ER8A 1PSDA 1WOPA 3Q6MA 1FO1A 2PO1B 3BBBA 3D3CJ 1N32F 1TU0B 5KTQA 2KG1A 3FBEA 3KK2B 3N6NA 5IT9C 4F3OA 2JEAB 4XPCA 3L4BC 2CUYA 5EWFA 2CJQA 1L3KA 1TUWA 1YX2A 1KVIA 2LDIA 4NZ7A 4L73A 2ASYA 4JI1E 2OI2A 3DOKA 2YNFA 2DYAA 2Z2YB 3C46A 1HHTP 4NLRA 1MG7A 2XWYA 4F04B 3IXQA 1A9NB 4I2PB 5ETQA 3KK1B 3CWVA 3PIOQ 5IWAJ 3NKYA 3IG1A 2ZHAA 3UVJA 5LSOA 1MWYA 1DTTA 1OPIA 2W2OP 3QATA 3OV7A 5KFNA 2PD1A 2KDOA 4AQYF 1PJ5A 2N7CA 2ZH3A 3NGKA 4JI4E 2MQLA 1SJ3P 3UNGC 3I9ZA 5I3UA 1R43A 4ETXA 3RGIA 5FLXY 3PY8A 2AE8A 4FF4A 4J91A 4XDCA 4WYWA 3H0PA 3NCQA 4XAKA 4YB5A 4AFFA 4LFCE 4MIBA 5A8WA 5HVHA 2YQ3A 2WNRA 3P3DA 1N5TA 1HD1A 3CO0P 2AEMA 3AOBA 2KO1A 4ZCLA 1NHIA 2BJ3A 4H4KC 1JLQA 4FPIA 4JP8A 4LR7A 2HHHF 3ET6B 3IAM9 5CHCB 3PIPQ 4EEYA 3PYEA 5KG0A 3TUPA 2MQMA 4B3RE 1M5OC 2VF3A 3CCZA 2JC0A 4X4TA 2O1VA 4RWWA 4KQVA 4L74A 4JV0A 1X4FA 4RW7B 5F9LA 1FTRA 1TL3A 1U2FA 5CZXA 4KKOA 4QIVA 4ZPDA 4ZA1A 4DQPA 2Q2EB 4LFAI 1Y00A 1FFSB 5E3RA 2NS1B 5FIIA 5HI7A 4R8UB 1NMEB 4OZ5A 1D9DA 3MM8B 3POTB 1LNQA 4USHA 4IH7A 2IC3A 1YZ6A 4K50A 4JG4A 5LMNE 3Q8VA 3M9NB 5K8PA 3BO4A 1Q8IA 2MZ1A 4WUBA 4EUVA 5I3PA 4HDGA 3KJVB 3GFXA 3H4LA 5HMXA 2SXLA 1S0VA 5KFCA 1H7SA 3AQOA 1GK8A 3IR6B 2XQCA 3B54A 1X5OA 3ZXWA 1RREA 4B9MA 5DRPA 4ES3A 5B0AA 3CCJS 4DV7F 4GRSA 1OSCA 1Q0NA 1YWXA 3W63A 1SKSA 2YKNB 2N3LA 3V6HA 2AX1A 2A3JA 4BBYA 1FKOB 2AW0A 4NYZA 3JQMA 4CH7A 1HBMB 4HR2A 5F9NA 4LIWA 3Q2TC 3R2DJ 4OO1E 3KLHB 1N34J 3KUHA 4FPRA 1S1UB 4CO2A 2KH9A 4JI5E 3ETMA 3NS5A 1T9YA 1UWAA 1CQMA 3N6LA 3RBXA 4MYTA 5AE3A 5JVHQ 3RB6A 2OHDA 2KB2A 1HR0F 4R1FA 3JTPA 3UR3C 2VFRA 2VBYA 2WONA 4FW6A 2C39A 1LWEB 2E1RA 3TVKA 4OO1C 1CJTB 2GAGC 2DR5A 3IM8A 5IT0A 2FHKA 2E1CA 1HI0P 1FRKA 1RT3A 4ECUA 2OTLS 1H7UA 2QRRA 1S6OA 4M8LA 1VQSA 1YGYA 4C6AA 9RUBA 5C0XA 2QLJB 1S6QA 3LOUA 1SC3B 2ASDA 4RUCA 4LF6I 2AYGA 1P8GA 1FKPB 2K2PA 2HRYA 4LF4I 1YJRA 1IBKE 2FHMA 2K7JA 3MD3A 4R25A 5T7LA 5DG7A 4HYKA 4FF3A 1AA1B 2EBEA 3CJRA 3ZZUA 4ZP9A 3JSYA 3HO1A 2Z2MA 4JI0F 4O4RA 1ROFA 4TKTA 1KKHA 3SSRA 2OH2A 2QN6B 1JLFB 2DTJA 3DOLB 1YVFA 2NZ4A 4ZVPB 5E3QA 4DR3J 2ZEJA 3G8QA 2E44A 3QIPA 3TZXA 1LXJA 1N5SA 3ITHA 3QAUA 2YX7A 4CTAA 4DV2J 4KPYA 4NXNI 1REVB 3R7SB 1NRKA 2IIHA 1F5BA 1E6VA 2L3MA 4JI1F 4CZCA 4DR7J 2UUAE 1Z0GA 3CDBA 4LRAA 4MJKA 2A2DA 2ACMA 2HIQA 2NYIA 3M6VA 4NL5A 5DS7A 1U24A 2FGOA 4HLBA 2GJ2A 5KFPA 1JK9B 4FYVB 4X65J 1L3UA 2DGOA 2VUGA 4DR6E 2VFTA 1EX8A 3I4PA 2NYHA 4LFBJ 2QMXA 5F8GA 3BSNA 2CFXA 4K4TA 4X62F 4KY3A 1Z5CA 4CYUB 4Y00A 4U3BA 2UUBJ 4JI6F 3T1YI 1JLFA 1UZHA 2QLXA 3R6GB 3MM5B 5THWA 2CQGA 3CJTA 4LF8J 4MKBA 4UY8T 1H0HB 1PBAA 3N01A 2UXBJ 3LQVA 2W9BB 3T5KA 1FWPA 1VI7A 2YTCA 1RT5A 1M0SA 5M2RA 5DLFA 4DBQA 2D41A 1C0TA 3A12A 5D0EA 2XS7A 2O3ZA 4MYUA 2KT2A 1HNVB 1SC1B 2AKWB 1GMVA 2BW7A 2OLWA 3MM7B 4MK9A 1YITS 3M8RA 2D9PA 1LK5A 4F4ZA 2BBEA 4IZJA 4KQZA 3N28A 1SVDA 1HI1A 2XS5A 1RACB 2HLTA 1Y4SA 2X3GA 3QLHB 2PE8A 3BBCA 3THVA 3LPSA 3QT7A 4WUDA 4IG3A 1VJQA 4LVOP 3HLUA 4NLOA 2PFDA 2VDIA 1FEHA 4M1KA 5D0HA 5L9XA 4ECSA 1NJIT 3NMRA 5IT4A 1APSA 2RHQB 4A8XA 1BKNA 2M2BA 4HACB 2E66A 5KOWA 4KH0B 1RBOB 2JVOA 2M0GB 1C0TB 1IBLJ 5HO4A 2RKIB 3RRKA 1WHVA 4GKJJ 1TKTB 4NCBA 3W5YA 1FRMA 4A8KA 4G6VB 1S0OA 4CNZA 3FFIA 3PZPA 2W01A 4CP5A 3RR7A 1VYAA 3EGZA 2B9EA 4DR4J 3PW2A 1HR0I 4NOHA 5C5JA 2R8HA 4B9NA 2ZC3A 1XERA 4Y2CA 2YNHB 3KJQB 1S1XA 3SEOA 2ZBIA 1VQ9S 2J0QD 4JI7J 5F8JA 3TJ8A 2Y1LB 1AFJA 4DR4I 2CNOB 4NEYA 2C22A 4RW8A 1B3TA 2GA7A 4X66I 2GGPB 3EX7B 3JSMB 3DLKB 1FJGI 4DPOA 1YG0A 3CJ0A 4NLUA 5ADZA 1XMOJ 4P9SA 5IWAI 4EBEA 1HHQA 2DNQA 1IBKF 4K4UA 3BR9A 1H6KX 2CQ2A 3W2VB 1N48A 4M95A 2I9SA 1FJGJ 4YR2A 3JB9k 1VGYA 3FK4A 2ZVIA 2ZWPA 4JUZA 3QWPA 4KV8A 4PG5A 4F0MA 2GW8A 3KJVA 2DRDA 2HHWA 2Y0SD 3GV7B 1ZA1B 4OO1A 2BJ1A 3G8TA 1XR5A 2VV5A 2N3OA 3J7A1 1GT8A 2FJEB 3NGRA 3KDNA 4WFYA 2AZ1A 2RJZA 1GXUA 4WWSA 3VCDA 1VIXA 1RT4A 1IBLF 3A13A 4ZVEA 3T9NA 3VAFA 4FW9A 2XMUA 1P1LA 3JSMA 1RK8A 4A8QA 1FX4A 4ZN1A 2QGFB 1JJ2R 2BEFA 3JQKA 1NH8A 4F25A 4USJC 4LF5E 1XIQA 2G13A 1GX6A 2AEJA 2WBRA 1JJCB 3A3OB 3FBFA 4OFZA 2J8SA 1IBMF 3OTOE 4ZVGA 1Y5YA 1M90T 2L08A 2IDEA 5DQGA 1SI9A 2XHCA 3G87A 2N82B 4PRFA 1FRLA 4DV5I 3FC9A 1MROB 3FBCA 5A6PA 4JI4J 2RT3A 1S1WA 3CW2C 4DF4A 2DITA 1RLDA 4DDFA 4WF9Q 3AA8A 1N36J 2UXBF 2BYCA 2NREA 1IKYB 4U8VA 3OXFA 3RTVA 4I3HA 5K5MA 2Z4PA 3NEKA 1NSAA 2AWZA 2BJ7A 3A8KA 2CQPA 5KFZA 3H25A 2BXJA 1U1RA 3V81A 3G71S 1DBDA 4IR9A 2PO2A 1S57A 4TXSA 4LFBF 4QWAA 2IAJA 2RAQA 1LWCA 2QA1A 4OZ1A 3HVWA 1JLAA 4U7UK 1S97A 2O66A 3ELHA 4AXJA 5DQHA 3SDEB 4X65F 1ZYQA 5B0DA 2JEGA 1UFLA 2FYXA 1EQ0A 4F3MA 4DR7F 1NHKL 1S1UA 1Z0EA 4JI1J 3M7ND 5CYQB 5IV4A 2W2NP 2P6SA 2HBYB 3O2IA 5K36D 3NY0A 1O8BA 1HQUB 3N6MA 4KGMA 5J2NA 2G0IA 4WIQA 3QQCD 1S76D 2KTQA 4WBFA 3IWNC 1S6PB 2GO4A 2VG5A 2MQQA 2EI5A 4M5LA 1XN9A 1M5PC 3M8PA 2I38A 3DOMB 2EVZA 3RUBL 4CYUA 4E98A 3RAQA 1RT2B 2OO4A 2JEJA 2MSTA 5F41A 4OHYA 4UF4A 5J1EA 2BJ8A 4CWBA 4LQ9A 3VAGA 2LMIA 2OSQA 2XNQA 2IJNA 3M6XA 1VS3A 5K8OA 5KFWA 2KYZA 2V50A 1FJCA 1ZXNA 1PJ6A 1O51A 4DR1I 4DQSA 2ZDOA 3GG0A 4JV5E 1FD8A 4C11B 1HNZI 3VGVA 1HMVA 3IBFB 4QR2A 3R1HA 3QIPB 3VAMA 1HR0J 1FERA 5CCMA 1J27A 2M3DA 2MJNA 1S4EA 1SH3A 2XEXA 3OR1B 3N5FA 4OI3A 4A8SA 4PUOA 2Z5BB 3JXOA 1RT2A 3GFYA 4X66E 1U09A 3DM2B 4X62I 3BSAA 2DGXA 3MEEB 1KN6A 5K36F 2YWFA 4LF9I 3Q89A 3UD3P 1EB0A 1X4DA 2VBZA 1HYSA 5ELWA 2XZDB 1I94I 1F6TA 1QM9A 5BJRA 2HEKA 1PKPA 2VG6B 4D3HA 4ZLLA 2A6MA 3M2RB 4CIOA 3ULHA 1FXLA 2KHCA 3DRPB 3H20A 4TYAA 4ZJOA 4URQU 5GAEI 1O5JA 1D9AA 3T19A 1F5CA 5E2QA 5KFTA 4WZMA 4DR1F 3VF0B 2W7AA 4PYDA 3CD5A 3KLHA 2OELA 4OMFG 1VQPS 1CS4A 4MFBB 2XS2A 4DUYE 2ROGA 4CDIA 3I32A 1EP4B 2QMWA 4X64E 2OFGX 4DI6A 1T0TV 1XMQI 2FTRA 3J80C 2O01C 5IQQA 5CABA 1VRUA 5L1JA 1M5KC 4URLA 1VDHA 4JI2F 4WFNQ 3D4JA 3OSPA 2HHHJ 1IBME 1PAUB 3PYDA 4WP3A 3G6VA 3D9BA 2XY7A 2XMMA 2W1BA 3EVMA 4UW2A 2XY6A 4HI1A 5M2PA 3T1HE 4YN3B 1TL7A 3CDAA 4FW3A 1WF2A 3CNQP 2JL9A 3EGVA 4ID8A 1N33J 2HFOA 4P52A 2QG9B 2DVIA 5IOLA 3LP0B 1RU1A 3MFIA 1N52B 2ASJA 4RNMA 2UXBE 1NO8A 2ZC4A 1K1QA 3DRRB 3RBEA 2W2PP 4IDKB 3X1LB 3T1AA 3CMQA 3EDQB 4QU7A 1B0TA 1R89A 5KFDA 4J9LA 4AQYJ 2CPXA 1U1KA 2ZBCA 2HHTA 2VQEI 2LXIA 5IWAF 1XMQJ 1REVA 4C9DA 5GVQA 4GKKI 4ID5B 4K4ZA 2GGPA 3OUYA 2PA8D 4ZPVR 1QUPA 4O44A 3RAXA 2MKJA 2FVSA 1S16A 2JEFA 2BUNA 3BDPA 2DGUA 1F9EB 1VLOA 3BEGB 1E3PA 2YH1A 5IT9U 5F3ZA 1RAHB 2OP5A 3U02A 3K5MA 1YJ7A 1A7GE 1TL5A 2GVZA 1DHMA 4EO8A 4DV3J 3B4DA 3HHLB 3MM5A 2JJ4D 1HL6A 3F56A 2V4JB 4DN9A 1SL2A 2KXHA 4X4VA 1VIOA 4OYPA 1G6BA 3GQCA 1ZTTA 1QSSA 2UU9F 4LF5J 1RP5A 4F8RA 4Y3CA 4IS9A 3GCMA 2FJAB 2M8HA 1JLAB 2V2ZA 1Q1KA 2YWEA 4Q5VA 2R2RA 2HQFA 4LF6E 1C2PA 1EETA 4DR2J 2VU5A 2CJ9A 2ROEA 3TANA 2CQIA 4JI7E 1T9WA 4CH0S 1UVLA 2W9CB 1IKXA 4OHVA 2HK2A 3GCXP 2ZE2A 4B9SA 2V2VA 4B3RI 4K0KI 3CT9A 3MDFA 3HSJA 4NLQA 2XLKA 5F3TA 2ACYA 3AD8C 4OQJA 1R6LA 3M30B 4DXLA 3JAMC 1RCOB 4JI0I 1WSRA 4IFDF 3Q6NA 3E2EA 4DV0E 4M94A 2FIUA 2HZCA 3D1OA 2BABA 4UOCA 2WSCC 4Z7YA 4YR3A 1YIJS 2B8PA 3C6UB 3PJXA 3CPWR 1QDUB 1TVRA 1FRIA 1U25A 2VQEE 1F0XA 1Y9OA 2FHJA 3A4TA 4DX7A 2LEPA 4J9KA 4FBTA 2BA1G 3I0RA 2DY1A 2RDIA 2PGCA 4USTA 2VQFI 2YWKA 1RAJA 3ONQA 3T6BA 2RH3A 2JEBA 1URRA 2A10A 2IJFA 4ERDA 3SFGA 5BR8J 1JLBA 3QRPA 1CJTA 4ECQA 4RBTA 2U1AA 1G3OA 3ZZZA 4A4JA 3UPFA 1U1PA 3PS3A 5LMNI 5E7OB 1GMWD 1ZAXA 2ZUGA 4RW9A 4NLTA 1C0UB 4UOGA 3GV5B 2GIQA 2HZAA 1U1LA 3OFEA 2MY8A 2DNHA 4NLSA 1RTDB 4O4GA 5BR8E 3DXSX 4OLPA 3NLCA 1JNRB 2F9JA 3KLFB 4YEAA 1HNIA 1NJZA 1V9OA 2XWXA 1JLEB 4FS1A 4LOMA 1QSYA 2MKIA 3W66A 4B3TJ 2HQDA 4M5DA 4USVA 1F9HA 1N8RT 1Y6ZA 4P7AA 1A6LA 1DQ9A 5ETNA 3AOCA 2EC2A 3TP2A 3T3FA 1GX5A 2J9CA 1VC6A 3R5CA 3GCWP 3P06A 2Q6BA 5L1LA 4DG1A 3ILOA 4OHZA 2LQJA 2C3YA 2IC3B 2AGOA 4R0EA 4FF2A 3K0JA 2X36A 3HJFA 1CPZA 2D7SA 3W65A 4U67Q 2IM2A 3CJ2A 2XSJB 3W8GA 4Y2MA 1LFWA 2LQBA 4P6QA 4DMZA 7FD1A 3KLFA 2RQCA 2PMZD 2UXDJ 2J65A 3MPWA 3KHGA 2XI2A 5KFKA 4Q8FA 4ZVIA 4DV6J 3K5PA 1T9VA 2H4YB 3BN4A 4NWBA 1ZM4A 3ZTSA 2MZRA 1X5SA 2BOPA 1CEZA 4J3DA 5AE2A 2O5DA 2J0WA 1RI7A 4LFAF 4DV6I 2R8JA 1Q4RA 3VTIA 4NLWA 4G1QB 3J81U 4ECVA 4PG6A 2YQ0A 4B3MJ 3FNNA 3MWBA 1VRTA 4CLUA 1VK3A 2B9XA 3AB2B 2W9AA 5KG4A 5LXYA 1S0NA 4KTQA 1TKDA 3CEDA 4LF8I 1P9YA 2M88A 2HG4A 4KKOB 5C2CA 5DGBA 3R27A 1S1TB 1K9MT 3EPGA 3Q86A 1Z0CA 2W7OA 3UDLA 1NM2A 4P2FA 4UUWA 3M2UB 5A2QQ 5EX3A 1P42A 3I56S 5HK4A 2FD2A 1KONA 3OW2R 3U27A 4B3RF 1M1HA 1NPPA 4KH1B 4CM0A 2FLLA 4QQBA 4JI8J 4G1QA 2CQCA 5BYQA 2Q43A 3OHBA 4AL7A 4Y28C 2IRYA 3RJMB 3C15A 2BV3A 2JLEA 1Q78A 2MKCA 5KT3A 2BQRA 1SXLA 2VPZB 4X62E 3O5TB 4DL0C 4X64J 2YKNA 3M9OB 3K59A 2G2YA 3WU5A 1DJ0A 1IM4A 1FKOA 4CRJA 4MK7A 3HHLC 3I55S 1TTHB 5IM0B 5KG2A 2V4JA 3AD7C 5LMNJ 1IVZA 3M7NG 2HHXA 2NN6E 4R0JA 1UWBA 2CPEA 1RLCL 4HH0A 4DS4A 1Z1ZA 2BZ2A 2OPSB 3KUGA 3TUIC 3AJ2A 2Y8YA 4F67A 2V63A 3UWTA 1OYRA 2YNGB 3HSZA 3WC0A 5EN1A 3TX8A 2CJYB 4G1PA 4QZVB 3H42A 1H7WA 1IWAA 6FD1A 2W25A 4LT6A 4H4KA 3WU4A 1WOOA 5LMUF 2UUAF 3OXLA 4DSKA 1DFDA 1MWZA 2PDAA 5HJYA 4YR0A 1RJJA 3DMJB 2XMAA 1DARA 4LUBA 2ZVSA 2FVPA 4C4WA 3EPIA 2PA3A 2ZOMA 3T5HA 2WVCA 4P73A 1AFIA 2AJ2A 4DV5E 4UQGA 1FXDA 1VBXA 2OPRB 1MW7A 1J5EJ 2BA0D 4MDTA 3NZKA 4OI1A 3T41A 3N4WA 1U1QA 2MQ8A 1KVJA 4G65A 4I1TA 2QFJA 5EDWA 4B9LA 2F1DA 1NNDA 2DHXA 3ENVA 4M5GA 5DLGA 4M5MA 4YHHF 4FXVA 2Z5CA 2K06A 3EZUA 3H4DA 1NHJA 1TR0A 2W4DA 3Q8YA 3M2VA 4DU8A 1EIYB 1UFWA 3MCOA 1VR6A 3JAMU 2AX0A 2HBRB 2XO7A 1I6JA 3KTQA 4EZ9A 2CWXA 4PRXA 5B0FA 3J7AG 1GMUA 2E5GA 2RS2A 1WACA 2HVHA 1Q8BA 5DZ6A 1X5TA 5B08A 4FF1A 4B3SI 3P49B 4B9VA 4J9SA 1RHQB 1WSVA 3D68A 4AL5A 1FHTA 4ECYA 2FC8A 1QJHA 2KT3A 4M5IA 2A6OA 4IFDB 4NLPA 4UT4A 2ZNYA 5C0XE 4LBIA 1UZDA 1TL1A 2PEHA 5CD4H 4CO0A 4I67A 4OX6A 3D3BJ 1YBAA 4F0HA 5D4LA 3N5BA 1S79A 1X4BA 4GMKA 1TKZB 2VQEF 5KT4A 4ZS6A 1YK9A 4OJ3A 1HBOB 5C0XC 4LFAE 4IOBA 2PFFB 5IS2A 4LF9F 4ZVTB 4L6V3 4DS5A 4DSEA 1H38A 1MMLA 3K57A 4DWIA 1WTFA 3CUNA 4DLGA 2RRBA 4ZN3A 2E7XA 3JTOA 3LAMA 4KV8B 1PCAA 2V5HG 1BD6A 1S1VA 1YBTA 2NXJA 5FDLA 2EFVA 1LWXA 2W2MP 2OIHA 4J9MA 3P5BP 3ZZRA 4EWTA 4RNNA 2RNEA 2UUCF 4ZITA 3P5TL 2L9DA 4I2QB 4CO5A 1X0FA 2KJWA 1C4CA 1HHSA 1TKZA 3TZYA 2UU9I 3C8YA 3PACA 2P5VA 3CDJA 3KRNA 2I5JB 4YY3I 2QL7B 4DSIA 4OYMA 1R0CB 2BRKA 1RA6A 1MLAA 4KSEB 3JYTB 2E5IA 4QJVA 5K14A 5D0RA 1URNA 3GIMA 2CJXB 1S1XB 4CLWA 1S72S 2RUSA 2LLZA 2VJVA 5KG7A 1TKXA 4FYWB 2YNFB 4DR4E 5DDPC 3FKBA 1KQGB 2E1PA 1B7FA 4C8YA 2P9CA 2ZOGA 2OSRA 3CSKA 4OX9F 2OKQA 3PG9A 3KLEB 2Y9HA 4HXZA 1JKHB 3WU3A 2HS0A 4U8YA 5GAGU 5AXMA 3NAHA 4ILMA 5IT9Q 2DHHA 4DL3A 1BLUA 1XC9A 3M32A 4ZPTR 6FDRA 4OKGA 5IV3A 1RHUB 3R8YA 4LF6J 2OEKA 1LOUA 4Q43A 2O1WA 5B0GA 2RVJA 1HW8A 1HPZA 2V69A 1O0PA 2VQFF 4J9QA 5LXRA 1LWCB 1GXLA 1D8ZA 1RWPB 1N36I 2Z56B 3ETOA 1WEZA 4FVCA 1U48A 2EPIA 2HGLA 1SH2A 3TA0A 2UUWA 5IQ6A 3TZZA 4DSLA 3DRSA 3UR0A 1HFEL 4DV6E 2HNYB 3BGRB 4DUTA 4YDDB 3TQEA 5BR8I 3G4SS 3J81C 5E3PA 3GMGA 4Q44A 3J80Q 1SJQA 3SCJE 3H4BA 5HMWA 3FBBA 1EHWA 3CC4S 4E0DA 4YFUA 1YSJA 1B70B 1S6PA 1NK0A 4DV3E 1LK7A 1U1MA 1FFGB 1RGVA 3WC2A 4JI3F 3R2CJ 3MPVA 4KGXB 1RHJB 4LFCF 1R0AA 2WCXA 5FJ4A 2L9WA 5C24A 4NLGA 3L09A 4Q0BB 3T5JA 4B3SE 1XNQF 1IKWB 1RZMA 3KG0A 5ETLA 4I68A 1KTVA 4F50A 5T41A 3V6KA 1R27B 1FWLA 1ACMB 1MROA 1BQNA 1SIWB 3NS7B 1FK9B 3U1LA 4CM2A 1IR1A 2OPRA 2W4PA 3SQGA 1JMTA 4NEZA 3TAMB 2K8GA 2EFGA 3BPSP 3IR5B 3OSNA 3TAQA 1D3WA 3OFFA 1TFWA 1S9GB 1U49A 4UUXA 2JZ5A 4ZPAA 4JI5I 3VWSA 1WI6A 4HHHA 2VFSA 4PXCA 5DGAA 2NN6F 3QGHA 4DV1E 4C97A 1XEZA 1VK8A 3MEKA 2PO2B 4RO0A 2OD6A 4F3QA 3FJ2A 3WZ0A 2VHGA 2F40A 2UXDI 4OYIA 5C24B 1S10A 1OYSA 1LWFB 2GO9A 1WF0A 3EMTA 4NRTA 5GADI 3OVAA 4EYIB 1LV5A 4PQUB 3M85G 1J5EI 4JI7I 2C39B 5B0EA 3J7YI 4KGKA 3PRVA 1KRPA 4UOFA 1J5EE 3GR0A 1RU2A 3TA2A 4DX5A 2AU0A 3RAMA 4UOHA 1ZPWX 3CD6S 1S5ZA 4WYLA 4A8WA 4BA2A 2IA0A 4YY3F 2HWIA 1HBNA 2RMLA 2XG8A 3DLGA 4DV5F 1U26A 1N6QA 2XULA 3T5LA 1BY9A 2WSEC 5D6GA 3HSGA 2R7WA 3PHEA 1T11A 4MFBA 4RR5A 5HATA 1BWEA 4IH5A 1HWUA 2P8IA 5H9FJ 2E1AA 5AXNA 3TX0A 3W60A 2BJDA 4WXOA 1EP4A 2MSSA 3W1YC 4B08A 3KK3B 3BM7A 5J2MA 1RAFB 8RUCA 2GHVC 1GFWB 2V6AA 3GU0A 2CJBA 2YKMA 3M1VA 1USVA 2IESA 3OR1A 2ZH2A 1QE1B 3BF4A 3G86A 1D0EA 3D7SB 3H2LA 3CULA 5HQ8A 1VCTA 1GMWA 2OGUA 2CKWA 1CQNA 1W7WA 4DLEA 1VQNS 3HHNB 4C11A 2ROPA 5JEAF 1KDNA 2F8EX 4PG8A 4F02A 1Q8LA 5AXKA 3W64A 3P3CA 1HNWF 3DRXA 2H48B 3EDRB 3C6UA 3F44A 3UFCX 2C2NA 4DPUA 4RBUA 1HWIA 3DFEA 3HM9A 1ZH5A 4Z37A 5H9EJ 2NQPA 2AJQA 2Q1LA 2YKMB 3M1VB 2FHJD 2RUGA 3GP9A 5T7LB 4ECTA 1JLGA 2Q79A 3KDOA 3PX0A 1SQEA 2G0JA 3HCXA 3ISZA 1IM6A 4N76A 3MM7A 2OPQB 1HI8A 3M8QA 3M8ZA 5ETMA 2G0CA 2KU7A 3CJKA 3RW7A 5LJ3Y 4XPEA 3MFHA 3BO2A 1T7PA 2QX0A 8ATCB 1XMQE 4JI3I 3MURP 2G1HA 2GVDA 4QOTA 4ZCMA 4F4AA 4X64I 1UPMB 2QJ3A 2KM8C 3E3XA 2DJWA 5IWAE 4JV2A 2JX2A 3DU6A 3ZTRA 3CCVS 5CYMA 4DUYI 2AGPA 2GVZB 3V4IB 5C42A 3DXBA 2Q66A 3EYZA 4ZCIA 2HVEA 4V19X 3AJDA 3TA1A 1SJ4P 4ANCA 2MZQA 1QAIA 3CDIA 1ZPVA 3R6LB 2RQ4A 4RNHA 4U9RA 4RNFA 4K4WA 2AQ4A 2VESA 3FMBA 4P2XA 4DJBA 4O3OA 1OSDA 4CO4A 1FNOA 4MKVA 4LF7F 4DZ6A 1HR0E 3DN9A 5I42A 1X4CA 1KVKA 3HI9A 2F3JA 4JI4I 5DZ7A 1PYSB 1U02A 2F4VF 3QFWA 3MXHP 4YOEA 5ETRA 3P6YC 1RB0A 1RTIA 1WG1A 4TLRA 5G0RB 3X3UA 2FJVA 4DR5J 2KL8A 1N0UA 4NLVA 1BXNA 1CSJA 1ZM2A 3D28A 3GJTB 1WEXA 2DIVA 2DKOB 4TY9A 4ID5A 1NJWA 2JE6A 2F8HA 1DAXA 4U6PA 1NHUA 4PWUA 4C0BA 2EC0A 4ICLB 2BR2A 4BC7A 1C4AA 1RWNB 1JKHA 2DNRA 4IFDD 2R42A 2DRAA 2G9OA 2J7WA 5HANA 3W2VA 3M32B 4Q2MA 3MPYA 2JOQA 3EZOA 3FVYA 3L7PA 4K5SA 4OJGA 4PZVA 4ZDNA 1R0AB 1W2BR 1Z0TA 2UUBI 5C0XB 3U7JA 2XMWA 3BGLA 5HQMA 5F8NA 4J90A 3LW5C 4LRFA 1P6TA 1IJFB 2AJ4A 5DG8A 2MB0B 3W3SA 1NLKL 3UDEA 5IC6B 1SKWA 1FK9A 2FY1A 1KLNA 5KG1A 1IBLE 2CQDA 2E5LE 3I5CA 3QO9B 3OR2B 5JEAD 4DR2I 1FWKA 2AYEA 4TVAB 4FYDA 2Y3YA 2VKZG 2HNYA 3CVKA 4FNHA 2X3DA 4ZK7M 1GXTA 4ES1A 1T3NA 5E0OA 5B7WA 4N3OA 1FXRA 4RL1A 4DN0A 4X4OA 5KFHA 3M8SA 1HNXJ 3C3LA 4MKYA 4WU2A 2KFZA 2EG2A 1XNRE 1LWFA 3QSIA 3OTOF 2BR0A 1P9QC 4F7VA 3PFOA 3BQ0A 3PV8A 2FJWA 5GAGI 4HKQA 4JI3E 3V6DA 3SCIE 2C2EA 2VOPA 3H2VE 2AMCB 1ZTWA 3L7ZB 3UHMA 4AIDA 2LVWA 4J9VA 5D3GB 2B4PA 5GAHU 2DH7A 4X4RA 1WD6A 3DLHA 1QLNA 3HFKA 4K2XA 3Q8QB 1EARA 1N5VA 4ZJQA 4FWHA 3JYTA 5JEAE 4K5RA 4OYWA 5IXUA 3MUTP 3PXGa 2CVIA 4F26A 1EZZB 3AAWB 4USMA 1YDLA 4IO9Q 2HSEB 4QWDA 1HNWE 2X1BA 2HQ3A 1WORA 3IP0A 4B3SJ 2CDRB 4LIRA 3SDEA 4IQMA 5CH7B 3EXCX 5CYJA 1KD1T 1XMOE 5ETSA 1IN0A 3DYAA 1C1BA 2ZH7A 1NZ0A 4NA1A 3OTOI 4FW4A 3PNIA 3QLHA 2H1YA 5D3GA 2LA4A 3MCNA 1SJ1A 3QGGA 2VFVA 4TN2A 1ZXMA 3MD1A 2WP8B 5U47A 2NN6D 1RTHB 3J7YU 2JSXA 2C3OA 1BUXA 4A8YA 2HMIB 4I69A 2Z30B 1FD2A 2V8HA 5KFJA 4XTJA 1WDTA 2IRXA 4M5NA 2FLPA 2R7SA 1WKLA 3W5XA 4Z2XA 4LFBE 1YJNS 3V5RA 1N0VC 1S49A 1VRQC 2BOAA 1F60B 3CJ3A 2E7WA 3ENAA 5DJBA 3ILLA 5L1IA 1RTDA 3DYAB 4IR1A 4B3OA 1T03B 3DGPB 4I2PA 1WNEA 1KBRA 4KAIA 3PS1A 1V3SA 2B6AB 2BKNA 4MIWA 2WP8A 3GG1A 3DM2A 3NCRA 2XM3A 3QZ7A 3PVXA 4DV0J 4LQ3A 3JAMY 3M6UA 4HHJA 3BB5A 3SIPB 2M7SA 1FJGE 1B0VA 1W2IA 1XR6A 2LQ5A 3CD0A 3D0GE 3FRYA 3WDOA 4M5JA 1TMJA 4QNJA 1Y5LB 4P7VA 3U1KA 4GO5X 3NBPB 3PRDA 4K0KJ 1T9TA 3TUJC 5KOXA 1OS5A 1FI4A 5HAOA 3QBCA 4X66F 2E5LI 3M8WA 3MMAB 2KJVA 2FDNA 4B3OB 3LA0A 4ZHRB 2YH0A 2VG5B 2PI4A 1NPKA 4YDXA 4C8MA 5KFLA 4OO1B 1VQLS 1N32I 4M63A 3HT3A 2ZH6A 3BQ1A 2DRBA 2JLFA 3T9ZA 3M2RA 4C48A 2PNZA 1TV6A 2E9RX 2WW8A 2FGCA 2LXUA 4TU7A 3M7VA 1KP6A 2QA2A 4ED8A 4NZ0A 3CCLS 2HQCA 2ALZA 1GTEA 3SSSA 2QYCA 3ENQA 1Q16B 1UJ4A 2DO0A 4ZP8A 1QTNB 2ZJQQ 3FUYA 1KHWA 1KC8T 3PHTA 3DMJA 3VV2B 1NK7A 4NYOA 5FDLB 5B09A 4DUYF 2K1RB 7FDRA 3PO5A 4C8OA 1Z5BA 2NXEA 3C14B 2C28A 4B3TE 3WX4A 2FJXA 2KFNA 2FC9A 4ICLA 4ATNA 2LECA 3W9HA 2BR2B 1I94E 3RU0A 3A8EA 1RSCA 4LF9E 4FDFA 3GIJA 1VISA 3T1HI 3CIMA 1RTJB 1WJ9A 3MGJA 2Z8QA 4WFBQ 4WTYA 3Q24A 3NL0A 4USKA 1SL0A 1EKSA 2DH8A 3AQPA 2KYXA 1G4CA 2F4FA 3HHEA 1OMSA 2DISA 2HS3A 4N77A 4ZCKA 2WTFA 1XNRF 4JYAI 2RRAA 2DB1A 4NCAA 2DCLA 1EA6A 1FDDA 5E5NA 5H1SV 1J5OA 2ZJRQ 2DY9A 2H51B 3E01A 4KC5A 5KFVA 4TU9A 4B9TA 3J7Z5 5GAEU 4LF4F 4DV4J 4N5SA 2NUHA 3C19A 3OT9A 1TL3B 2RHSB 4O44B 3TR5A 5HMZA 1YKWA 2D3O1 4E2FB 2J5AA 4Y0FA 4OJHA 5K36C 1R3NA 3H5YA 4NA2A 1M5VC 1V5VA 2ZM6I 4DR6F 4J9UE 4DL2A 3QT8A 3MM8A 3POTA 3WX8A 3DLBA 1FDBA 2QMUB 2XYGB 2B3TB 4JV1A 1WHXA 1B4SA 2HFZA 3HHLA 4HT5A 2X1GA 1UVKA 5F8MA 2LJPA 4X4PA 1KS2A 1SKUB 3P8BB 2MLYA 1RA7A 5HP1B 2KI2A 1FT8A 1RWUA 2CQ1A 1UA1A 3PX4A 2DR8A 3MM9B 3MTKA 2MMYA 3KHRA 4AL6A 2IYIA 8AT1B 4F0KA 4C8LA 2UXCF 3K1JA 5HROA 2AT1B 3MUMP 2BVZA 2YWHA 1TELA 1VMBA 3A8IA 1SC6A 1WC0A 1LW2A 2ZKUA 3UD5A 2LKZA 4FZVA 2DEJA 2ZUAA 1TAUA 4GQUA 2LDYA 1D1UA 1FE4A 2V2QA 4NE9C 3G6XA 2VQFE 3NS6A 4I6AA 3Q8RB 1FJEB 4BDPA 2OAUA 1RT1B 3ISND 3DRRA 4HI2A 1X9SA 5KFSA 2IOPA 5FD1A 1HWLA 1IR2A 2ZZMA 3HSDA 4HT7A 3FZ2A 3R7NB 4Z7CA 4CLPA 2J7UA 4BWJA 3F41A 4Y34A 2J9DE 1QSLA 3TRGA 2VA3A 4DV0I 3WIUA 2O1TA 1H2TZ 1S48A 3PW7A 4Y2KA 3IC1A 1RBLA 3CC7S 4JI6E 4ZVHA 1JB0C 3MEDB 4RBVA 4RW6B 5E3AA 3G8SA 2FVQA 2W9BA 2WVEA 2C2KB 2HMIA 3R7BB 2UXCJ 4WJBA 2GMJA 4LSNB 4LBPA 1N34E 2Y1IA 2F4VI 2I1RA 3MR6A 1M5SA 5DG9A 2HNZB 2JLGA 1PVGA 5K36B 2APOA 1S7HA 3OL9A 3K85A 2ABYA 2CIMA 3ITHB 2VC1A 3KNGA 3OTEA 4CTAB 3MR3A 3UCZP 4JYAJ 1G1XA 4LRDA 1U4BA 2DT9A 3GONA 3EICA 2I6WA 5J2PA 2KRBA 4OZ0A 5DDQC 1B99A 1CJUB 1DLOA 4JBCA 3T1HF 4NXNF 1ZAVA 3GJSB 3OTCA 3CJ4A 4LF4J 3MMBA 5KG5A 3ZTQA 2CPHA 1TZ0A 3GE9A 1IKXB 5HLFB 1RAIB 2CG4A 1ZZFA 1UPPA 4DUZJ 3OTDA 1EJ7L 2VBWA 1TKTA 4W98A 3SCLE 1NJYA 1BC6A 2D3ZA 2G2OA 1KLMB 1X7VA 3PKYA 2I0XA 1VLYA 2XO6A 1SQFA 2WVBA 4JV5J 4F2RA 5FLXC 1UDSA 2LU2A 2RS8A 1S1VB 3MMJA 3J7AN 1XNQE 3J7AM 1JJHA 2YX1A 2HURA 1Q8KA 4IZJD 2YNIB 2IPOB 2GO8A 4GKKJ 2PT0A 5J2MB 1RT6B 4WK1A 5KFQA 3I82A 3TEHB 2X1FA 2LYVA 1WF1A 2K7KA 4DUYJ 4F4KA 2V9KA 3D67A 2HGMA 3BN7A 2Z2LA 3I0RB 3M8YA 5HLFA 1JX4A 2ZD1B 2DR7A 2LEBA 4U7UD 3PYGA 1IBLI 3I96A 1JXLA 1R8PA 2FB0A 4IG3B 2ZM6F 4FW5A 1RXOB 3IWLA 2FLOA 3L7UA 2C2RA 2CQHA 3AY0A 3VQSA 4CQ1A 1RUSA 2LFVA 2X51A 3IWXA 4ZHRA 2JFDA 2MKSA 5A76A 2XLJA 5J2QA 3FEYB 4MAKA 3HMJG 1IKWA 1YHQS 1IBMI 1N5QA 3OBIA 3PS2A 1HK7A 4KHPI 1Y5IB 2GHPA 2IRUA 2VG7A 3H90A 1SIZA 3UDVA 2DK2A 1AROP 1RT6A 2GZOA 3KFWX 1BGXT 4H4OB 3WQPA 4TU8A 5IC4B 1WUUA 1K0TA 3FFIB 5J1EB 2XBPA 4X66J 2HVZA 3AHPA 2HBZB 1YHCA 3DRSB 5D4OA 2CZVC 3U1MA 1MMNA 4IFYB 1I94F 5IT9Y 1FDNA 2BX6A 4I7FB 5KFUA 1VQ4S 1HNIB 1SQGA 4K0KF 1VRTB 2B7BB 4FS2A 5JXSA 1VQOS 2CPJA 3LWMA 4LFCI 3GLLA 3T1YJ 1I5OB 1UMJA 4RNOA 3B82A 2C37B 1J5EF 4BHQA 1JJ4A 4ECWA 2MEWA 2PEBA 3IAS9 5JUMA 4DV0F 1DTQA 2A18A 3MF5A 3TARA 4BS2A 1NCLA 3MOJB 2WSFC 5CYMB 3FRZA 1RISA 2IYGA 2A0FB 3KMQA 2YKQA 2RILA 2BM0A 3EM1A 5ETTA 1VFJA 2BW2A 4MMOA 2QSWA 1FEEA 2MZTA 3PR4A 4P71A 2B9YA 1IKYA 3LWLA 3A3PB 1BQMB 4Q0BA 2KN4A 1BHNA 2OTJS 2C2MB 3ZZ0A 2EXUA 2XYHB 3B6BA 2K3KA 4G1IA 4OX8A 3HPOA 3M05A 1RT3B 3HZEA 3MECB 5AXLA 3SQGB 3TAMA 2KKHA 3HX9A 1V5IB 2XZTB 2HFSA 3AJ1A 4O3SA 3HFVA 4PU9A 1CULB 4YY3E 2IBOA 4EBDA 4LSLA 1SCJB 1TVRB 4DV1F 3C2PA 2AYMA 3QJLA 2EFOA 3OFGA 2O3DA 4LSZB 3E01B 4EI2A 3MTJA 3R9LA 2GX8A 3QJPA 4KHPE 4IFVB 4BA1B 4DR6I 5DDRC 1WG4A 2IM3A 2OPSA 2V94A 4OZEA 2ASLA 5AJ3J 3HKZD 4NX9A 1NK8A 4MU4A 1F5AA 1JXEA 2YXLA 3DOLA 3MAHA 3EGWB 3NGSA 4NYPA 1GEHA 2KHDA 4ZVOB 4CO1A 2UVUA 3L9ZA 4KO0A 1HNZF 3RB0A 2EWHA 3T6JA 2XZWA 1SUQB 4CO3A 4FXDA 1IR0A 1F2GA 4LSLB 3DI6A 4WXWA 4DX8H 3FDSA 1Y11A 3NNCA 1WHYA 3ZNJ1 3VAIA 4P10A 4A47A 2I2YA 3IRXA 4IH6A 5BYSA 1VBZA 3ENWA 3OJUA 2J0SD 4ZKAA 4DV2I 4AQYE 1BMQB 3CCQS 4USUA 5JVGQ 2PSZA 3OTOJ 3N0VA 5A8KB 3G6YA 4BA2B 1VQYA 2W2QP 2LEAA 1HQEB 3FCWA 4NPOA 1HNXF 1B62A 4HVZA 3IN5A 4B3ME 5JEAA 3ZFVA 3WBZA 4ZIVA 1UA0A 5C2GA 5DRRA 4X65I 1I1GA 1T9XA 2AF6A 2GQ2A 3BZQA 4MIAA 2J6UA 2GQ0A 3GJQB 1KFDA 3DDKA 3MEGB 3OUYB 4A48A 4NMXA 4OJ1A 5A0YB 3CCRS 5F0WA 2K1RA 3AD9C 5HN0A 4XO0A 3VVUA 2R8IA 4DL4A 1QAYA 4BLGA 5CA5A 5LL6d 3KHHA 3H5UA 1S6UA 4Y2AA 1Z4UA 4U3DA 1XMOI 1Y10A 5F0UA 4CLFA 1UP1A 4XIUA 5KFAA 3HHLD 4FXWA 5DM7Q 2M9KA 2AIRB 4IFDA 2MPUA 4J5OA 5HL7Q 2VASA 1RAEB 5D0GA 5J1NA 4QYZK 3CF5Q 4WTOB 1S9EB 3MM6B 3A1YG 1JNZB 1FFWB 3KMSA 1SC4B 2E9TA 2CAJA 5K8MA 2E9ZA 2IERA 2FZCB 4MQYA 2DXEA 3L3CA 1RT7B 4PXEA 2Z5BA 2CGEA 4RX6A 1N88A 4MU1A 4DSJA 3SYZA 1RHYA 4WFZA 1GAOA 2H65B 3CIZA 4F4YA 3LNUA 2UVVA 4ELUA 2IHR1 2XMKA 4O0IA 4F36A 3VAHA 4O3RA 1HNVA 3EXYA 3I87A 3MM9A 2CPZA 4UQTA 4IO1A 1AZSB 2VH7A 3O1LA 2NPIA 4NCGA 3IM9A 2MKYA 3I9V9 5KFYA 5KAKA 5ETOA 3B8HA 1D6TA 2ZH1A 2JEAA 4K59A 3CWJA 1U2CA 3D66A 3Q8UA 4ELTA 5IM0A 4WCEQ 4KHPJ 3PM9A 3W7BA 5EWGA 2W8LA 2QV6A 1T3OA 1FA0A 4L72B 1TKXB 1ZOTA 3BKUA 4GVBB 2P9GA 4LBHA 4X4QA 3J81j 1ZM9A 5L1KA 2B5JB 1Z2ZA 2YPZA 3BREA 5LOQA 3SI8A 4PWDA 3VVTA 2FPHX 3M6WA 3CO9A 3UVJB 1WWHA 2ZM6E 3JSBA 2HKJA 1MX0A 1OY9A 4FKXA 4KHPF 4MU0A 3MMAA 1QAXA 1REGX 2FUG9 2OPPA 3FCVA 4NA3A 5LL6R 3P45B 3QNWB 2J8AA 4WIIA 5J2QB 4JI6I 4ITSA 4KB7A 3J80U 4DL7A 5HJXA 1HNWJ 3ILJA 3J80Y 2J6TA 1PO6A 4DSFA 3I6PA 4FNIA 1PILA 1FTCA 1TV6B 5D77A 5CCLA 1UEKA 2RF2A 4GVBA 2WVDA 4I6WA 3UQSA 1ZETA 4ILLA 1ULRA 1CULA 1RWOB 4HEA9 4PWDB 1R6YA 3BV8A 4LVNP 2WOMB 3NWGA 5LSLA 2DNMA 2RU3A 4RW4A 1QTMA 4LCGA 5KFFA 5DROA 4K0KE 4OI4A 2C2DA 4GKJI 5L46A 4JI2E 2PC6A 3DCAA 3W2WA 4DV7E 2UXCI 3TQ1A 4AM3A 3FEZA 3HP6A 5MLCV 1UAWA 2CQBA 3KLGA 3GILA 3A8JA 4EYHB 1DLOB 4YMEA 2UUCE 2BMBA 4RUBA 3AH6A 3C6TB 3B4TA 4FP9A 5E41A 1ZM3A 1WI8A 3HJVA 3K89A 3PTWA 4BC9A 1S9GA 4DV5J 3LP1A 1YJVA 4YY3J 2DXFA 1FVSA 1UEUA 2V8DA 3DU5A 4JB8B 1TMMA 1YI2S 1T8EA 2AYBA 2V8VA 4OX9I 1Q95G 1X4AA 3LANA 3BGOP 2N4CA 1PC5A 4C8KA 3K5OA 2O1PA 3PJ9A 3RYLA 3K5NA 4CCHA 2JWNA 4CT8A 1BQNB 2KXNB 1NK9A 1XHKA 4V1Ak 1AW0A 4QYRA 3R5DA 4K7QA 4PKDB 1EKRA 4QIGA 4OO1F 1WC4A 2GHWA 2DXDA 1ZAWA 4NXMJ 4NLXA 3NMAA 4I56A 4WFXA 1K8AT 4IOAQ 4O3NA 4UZBA 3IMQJ 2IBKA 2XY5A 1Y4ZB 2QLFB 1Q7YT 5RUBA 1V6HA 3GFZA 1MU5A 2KVIA 3DNCA 4O4GB 2HS4A 2NPFA 2X1AA 3TI0A 4DV7I 1F3VA 4ENOA 4AT1B 2EFQA 3KWMA 4JI2I 3BJYA 1TL4A 2M5YA 3O6QA 1HNZE 3C16B 2BE9B 2RE1A 2HIYA 2R7RA 1AT1B 5D4PA 4X2BA 1JLEA 1XXEA 4WUCA 1ZBTA 2CQ3A 2DH9A 1SV5A 1UW9A 4JV5I 1Z0WA 3Q22A 1QVGR 2IDLA 4LFCJ 1SJRA 5CYQA 3EUNA 1NDLA 1HNZJ 2COLA 3PO4A 2M4MA 2R4FA 2OD4A 4AD6A 1U2RA 3ZO7A 2YNGA 2HLUA 1UETA 4JI0E 3OXGA 5DNXA 2DNGA 2V67A 3K17A 2CADA 3P96A 5AJ3F 1HQEA 1IUJA 4ANEA 1Q5VA 5FWKA 2DNZA 3I31A 4ETZA 4I6YA 4TY8A 4WKYA 3DDNA 4F2SA 1OYPA 4DCJB 2CG8A 1RTJA 5LSRA 4DV1J 2XTJP 3MEDA 4W4MA 1T02A 2ZWOA 5H9EK 4JYAE 4YQWA 3EJMA 5DO2A 2CQ4A 2HWHA 1E3HA 1T94A 2ZHOA 1FRXA 4QBUA 5KT7A 4TQSA 2VQFJ 3DRYA 3BBFA 2PI5A 2VKRA 5IFMA 4DUZE 2DHGA 1AZSA 3FSXA 4PAAA 3EZ5A 4MK8A 3MECA 3TUZC 4IRDA 5KT6A 2VC0A 3CCWA 2B4UA 3DLGB 1RADB 3AT1B 4DOZA 2ZH9A 4DV4E 1HBMA 2F65A 4LMZA 2D74B 2HVIA 4MU3A 3I5AA 2NCKL 2YNHA 1JQGA 3M2UA 1PJ7A 1MNEA 3U1NA 3QRQA 1CJUA 4UTGA 4BA1A 4DFJA 1UTAA 2JFKA 3FQKA 2GMLA 3NG8A 1N56A 2CXEA 1XNRI 4QR1A 4KHMA 2B5JA 2CZ4A 3R3TA 4ES2A 3T1YF 1RYSA 1LWEA 1VQKS 1FVQA 2PMHA 1Z2LA 2DHAA 4EFAC 2KZMA 3RW6A 4Y6IA 2JDJA 4USWA 2KFYA 1WKJA 4K4VA 3HVRA 4X84A 1KLMA 2BA1D 5EGYA 1DZ5A 1I94J 3HHKA 3GPAA 4FBUA 1Q79A 2MZSA 4HACA 5FLXQ 5DRKA 3J81Y 5LMUI 1RTIB 4ALZA 1HKAA 3D1HA 4P2SA 5LM7E 2W8KA 2V4QA 1YJWS 1HWJA 4KJIA 2IOQA 2NXCA 3RZAA 4UZCA 3US5A 1IXKA 1Y3JA 3K8VA 1R8AA 2Z57B 1X9MA 1OWXA 5KFGA 1O6XA 3TWZA 5KG3A 2ZKTA 3D1QA 3QT6A 5B0CA 1ZZNA 4PEOA 3IO1A 4AQYI 3W61A 5C25B 5I42B 4F4XA 1GH8A 4KHRA 4IFDE 2EBGA 2Z5EA 2AHOB 3GSIA 5K20B 3PRBA 2D3UA 3R5BA 3KKFA 2L9NA 3KJNB 1JLGB 1H73A 1NB2A 5JMNA 2ZM6J 3DKDA 2R9LA 2CNLB 1HNWI 3M85D 4X4SA 2ZOFA 1X9WA 5I3UB 1RKIA 4QWBA 2QLBB 2UXBI 1UFKA 3CCES 1IQTA 4YHHI 1TP7A 2NSBA 5DM6Q 2VQEJ 4LPFA 4GKKF 5EL9A 2WAQD 2VG7B 3LALA 2UXDE 4DR7E 4B3MI 2C2OB 2HHVA 1X31C 3HVAA 3IA0A 2J6SA 2BANB 4OYAA 4EK2A 4OYOA 3KLIA 4QW8A 3LP1B 5LJ5Y 4JV5F 1JWWA 1AXQA 1DRZA 5K14B 2IMWP 5CZVA 3ET6A 2KZZA 2YWGA 1FKAE 1N33I 4QWCA 1CJVA 4ZPBA 1PAEX 4DUZF 3D54A 4C3LA 3VHQA 4L76A 3W8PA 2MHNA 5L9NA 1KOHA 4NMLA 2EEYA 1Q53A 4RW7A 2MGZB 1RT1A 2DNLA 1DQAA 3N9UC 3H98A 3LPEA 1S59A 4IG0A 4CH1A 3T1HJ 4NXNJ 4DR2E 3NGTA 4ZMMA 1N5YA 2EK6A 2DGTA 2RDJA 3MMBB 4ZVRB 4A8OA 2J7KA 1EQMA 3GYGA 3ZZYA 4YHHJ 4OHWA 3HD2A 4JYAF 2HVDA 2W4CA 5EHHA 1A6FA 4DR3E 4NXNE 1PYTA 5E3CA 1QZRA 1JLBB 3C6TA 4XTTA 1C1CA 2YKOA 4JOUA 2XLIA 3FQLA 4YHHE 2AJFE 1VOMA 2NN6B 5F8IA 1UDOA 1FRJA 4PG7A 3DOKB 2C1EB 2LQ9A 3EGNA 2I8EA 3QWUA 3DLEA 4IUFA 4DR3I 1C0UA 4NCGB 2DR6A 5KFIA 1L3SA 1RWMB 2W9CA 3G82A 2R8KA 3KK1A 1BQXA 4RW6A 2ZE2B 1D8YA
chains in the Genus database with same CATH topology
4LF9E 3T1HI 1VISA 2PNMA 4USKA 5L3JA 1EA6A 3WU6A 4DPXA 5LMNI 1N33E 2X7IA 4IZJB 5BR8E 2F4VE 1K47A 2O1UA 2ZM6I 2R3VA 3QT8A 1RR9A 1Z0BA 1Y6ZA 4P7AA 2LJPA 4ED4A 3ZZTA 3P06A 4DV2E 5IT9Q 1J5EI 3K1JA 1D6TA 2X36A 4FN5A 4DPTA 1B63A 2DEJA 4ZVIA 4LF5I 2V2QA 1ZM4A 2VQFE 4HYMA 4DV1I 2IOPA 4DV6I 2PNLA 4Z7CA 4OX9E 4HY1A 4DV0I 2O1TA 4LF8I 4JI6E 1Z59A 1Z0CA 5A2QC 5A2QQ 1N34E 2DEIA 4JYAI 1PVGA 4NXME 3K85A 2A2CA 2BV3A 3GONA 4X62E 4JI1I 2HK3A 3PYFA 3HJCA 3Q6MA 2F4VI 3F0NA 5IT9C 1HNXE 3J7AM 5FLXC 1XNQE 5GMEA 3WU4A 4RPFA 4JI1E 4IZJD 2OI2A 1ELOA 1DARA 1MG7A 4DR5I 1IBLI 3CWVA 4DV5E 3PYGA 4GKJI 4JI4E 4DV3I 1KIJA 1Z5AA 2UU9E 1IBMI 4KHPI 2Z5CA 4DR6E 4LFCE 1NHJA 4DU8A 1NHIA 1WUUA 2CZ9A 4PRXA 3J7AG 3PYEA 4B3SI 2VF3A 2O1VA 4LFCI 4KQVA 3B82A 4PRVA 4LFAI 2Q2EB 4UT4A 1OJ4A 1IBKI 5LMNE 4JG4A 4LF4E 2BM0A 3V2UC 1XMOE 3JAMQ 4WUBA 3H4LA 4LFAE 1H7SA 3ZZ0A 1RREA 2ZBKB 4B3TI 2HFSA 4YY3E 4X65E 1HNXI 1NHHA 2HHHI 4JI5E 4KHPE 2UU9I 4MYTA 4DR6I 2ZITA 3B78A 4R1FA 4YY3I 2E1RA 1H7UA 4DU7A 4DR4E 4LF6I 4LF4I 1IBKE 3WU3A 4HXZA 1XMOI 3ZZUA 4LF7E 4DV2I 4AQYE 1N34I 1KKHA 1H74A 1H72C 1B62A 2O1WA 1EI1A 4NXNI 4B3ME 4X65I 2GQ0A 4B3RE 1N36I 1Z0GA 4AQYI 3M6AA 2A2DA 4LF7I 4DV6E 5BR8I 3J81C 3J80Q 2V34A 1Z5CA 3T1YI 4GKJE 4DV3E 3WU5A 3QT5A 4MYUA 4DUZI 2WW4A 4IZJA 4B3SE 1Y4SA 2UUAE 1KTVA 2HHHE 1FWLA 4WUDA 3LPSA 3QT7A 2Z5BA 2CGEA 3ZKBA 2EFGA 4M1KA 1BKNA 4HACB 2HFUA 3LNUA 4JI5I 4DV1E 2UXDI 3ZM7A 3B8HA 4JI7I 1Y4UA 1HR0I 3T1YE 1J5EE 4DR4I 2BM1A 4X66I 1ZM9A 1FJGI 1XNQI 5IWAI 2ZM6E 2HKJA 1MX0A 1Z0VA 2UUBE 5LL6R 4JI6I 4PU9A 1USVA 2UUCI 3J81Q 1UEKA 4FW9A 4K0KE 4FWGA 4LF5E 4JI2E 4DR5E 4DV7E 4DPUA 4JYAE 3OTOE 2UXCI 2CG9A 4DV5I 2UUCE 1ZM3A 4DPYA 4I3HA 4JI3I 1XMQE 4OX9I 4X64I 5IWAE 4DUYI 1XHKA 1Z0EA 1HR0E 4NXMI 1MU5A 1KVKA 3PRYA 4JI4I 2NPFA 4DV7I 4JI2I 1HNZE 1N0UA 2Z5CB 4DPWA 4JV5I 1PIEA 1ZM2A 4WUCA 4K0KI 1Z0WA 4GKKE 2R42A 1ZXNA 4LFBI 1U2RA 4DR1I 4JI0E 4JV5E 2UUBI 1Z0TA 4IZKA 1HNZI 3K17A 5FWKA 4DUZE 2AJ4A 1S4EA 3Q1QA 2XEXA 2Z5BB 4X66E 1IBLE 4X62I 2E5LE 4DR2I 4LF9I 1FWKA 4N3OA 1I94I 1PKPA 4FWDA 4IZKB 1XNRE 4DV4E 4JI3E 3ZKDA 2V8PA 4DUYE 4UTGA 1XNRI 4X64E 1XMQI 3J80C 4FWHA 5GMDA 2UUAI 4URLA 4USMA 1HNWE 3D4JA 1IBME 2GS8A 3PYDA 3HULA 4JI8E 4HACA 5FLXQ 5LMUI 3T1HE 2IOQA 1FNMA 1NZ0A 3OTOI 2UXCE 1ZXMA 4P52A 3QT6A 2UXDE 2UXBE 4JI8I 2Z5EA 4DR7I 1HK7A 1H73A 1HNWI 4XTJA 2VQEI 4LFBE 1USUA 3V5RA 4GKKI 1N0VC 4YHHI 1N36E 1S16A 4DR7E 4B3MI 2UXBI 1N32E 4EMDA 1FJGE 1N33I 1FKAE 5LMUE 2V2ZA 1FI4A 4LF6E 2E5LI 4DR2E 2HKEA 4JI7E 2J7KA 2HK2A 1N32I 2V2VA 4B3RI 1A6FA 3JAMC 4DR3E 4NXNE 4DXLA 1QZRA 4JI0I 4LF8E 3LTOA 4DV4I 3Q6NA 4DV0E 4DR1E 4YHHE 4DR3I 4Z7YA 1Z5BA 2VQEE 4B3TE 1I94E 2VQFI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 E;  3T1H I;  1VIS A;  4USK A;  5L3J A;  1EA6 A;  3WU6 A;  4DPX A;  5LMN I;  1N33 E;  2X7I A;  5BR8 E;  2F4V E;  1K47 A;  2ZM6 I;  2R3V A;  3QT8 A;  1RR9 A;  1Z0B A;  4P7A A;  2LJP A;  4ED4 A;  3ZZT A;  4DV2 E;  5IT9 Q;  1J5E I;  3K1J A;  1D6T A;  2X36 A;  4FN5 A;  4DPT A;  1B63 A;  2DEJ A;  4ZVI A;  4LF5 I;  2V2Q A;  1ZM4 A;  2VQF E;  4HYM A;  4DV1 I;  4DV6 I;  4Z7C A;  4OX9 E;  4HY1 A;  4DV0 I;  4LF8 I;  4JI6 E;  1Z59 A;  1Z0C A;  5A2Q C;  5A2Q Q;  1N34 E;  2DEI A;  4JYA I;  1PVG A;  4NXM E;  2A2C A;  2BV3 A;  3GON A;  4X62 E;  4JI1 I;  2HK3 A;  3PYF A;  2F4V I;  3F0N A;  5IT9 C;  1HNX E;  3J7A M;  5FLX C;  1XNQ E;  5GME A;  3WU4 A;  4RPF A;  4JI1 E;  2OI2 A;  1ELO A;  1DAR A;  1MG7 A;  4DR5 I;  1IBL I;  3CWV A;  4DV5 E;  3PYG A;  4GKJ I;  4JI4 E;  4DV3 I;  1KIJ A;  1Z5A A;  2UU9 E;  1IBM I;  4KHP I;  4DR6 E;  4LFC E;  1NHJ A;  4DU8 A;  1NHI A;  1WUU A;  2CZ9 A;  4PRX A;  3J7A G;  3PYE A;  4B3S I;  2VF3 A;  4LFC I;  4KQV A;  3B82 A;  4PRV A;  4LFA I;  2Q2E B;  4UT4 A;  1OJ4 A;  1IBK I;  5LMN E;  4JG4 A;  4LF4 E;  2BM0 A;  3V2U C;  1XMO E;  3JAM Q;  4WUB A;  3H4L A;  4LFA E;  1H7S A;  3ZZ0 A;  1RRE A;  2ZBK B;  4B3T I;  2HFS A;  4YY3 E;  4X65 E;  1HNX I;  1NHH A;  2HHH I;  4JI5 E;  4KHP E;  2UU9 I;  4MYT A;  4DR6 I;  2ZIT A;  3B78 A;  4R1F A;  4YY3 I;  2E1R A;  1H7U A;  4DU7 A;  4DR4 E;  4LF6 I;  4LF4 I;  1IBK E;  3WU3 A;  4HXZ A;  1XMO I;  3ZZU A;  4LF7 E;  4DV2 I;  4AQY E;  1N34 I;  1KKH A;  1H74 A;  1H72 C;  1B62 A;  1EI1 A;  4NXN I;  4B3M E;  4X65 I;  4B3R E;  1N36 I;  1Z0G A;  4AQY I;  3M6A A;  2A2D A;  4LF7 I;  4DV6 E;  5BR8 I;  3J81 C;  3J80 Q;  2V34 A;  1Z5C A;  3T1Y I;  4GKJ E;  4DV3 E;  3WU5 A;  3QT5 A;  4MYU A;  4DUZ I;  2WW4 A;  4B3S E;  2UUA E;  1KTV A;  2HHH E;  1FWL A;  4WUD A;  3LPS A;  3QT7 A;  3ZKB A;  2EFG A;  4M1K A;  1BKN A;  4HAC B;  2HFU A;  3LNU A;  4JI5 I;  4DV1 E;  2UXD I;  3ZM7 A;  3B8H A;  4JI7 I;  1HR0 I;  3T1Y E;  1J5E E;  4DR4 I;  2BM1 A;  4X66 I;  1ZM9 A;  1FJG I;  1XNQ I;  5IWA I;  2ZM6 E;  2HKJ A;  1MX0 A;  1Z0V A;  2UUB E;  5LL6 R;  4JI6 I;  4PU9 A;  2UUC I;  3J81 Q;  1UEK A;  4FW9 A;  4K0K E;  4FWG A;  4LF5 E;  4JI2 E;  4DR5 E;  4DV7 E;  4DPU A;  4JYA E;  3OTO E;  2UXC I;  4DV5 I;  2UUC E;  1ZM3 A;  4DPY A;  4I3H A;  4JI3 I;  1XMQ E;  4OX9 I;  4X64 I;  5IWA E;  4DUY I;  1XHK A;  1Z0E A;  1HR0 E;  4NXM I;  1MU5 A;  1KVK A;  4JI4 I;  2NPF A;  4DV7 I;  4JI2 I;  1HNZ E;  1N0U A;  4K0K I;  4DPW A;  4JV5 I;  1PIE A;  1ZM2 A;  4WUC A;  1Z0W A;  4GKK E;  2R42 A;  1ZXN A;  4LFB I;  1U2R A;  4DR1 I;  4JI0 E;  4JV5 E;  2UUB I;  1Z0T A;  1HNZ I;  3K17 A;  4DUZ E;  2AJ4 A;  1S4E A;  3Q1Q A;  2XEX A;  4X66 E;  1IBL E;  4X62 I;  2E5L E;  4DR2 I;  4LF9 I;  1FWK A;  1I94 I;  1PKP A;  4FWD A;  1XNR E;  4DV4 E;  4JI3 E;  3ZKD A;  2V8P A;  4DUY E;  4UTG A;  1XNR I;  4X64 E;  1XMQ I;  3J80 C;  4FWH A;  5GMD A;  2UUA I;  4URL A;  4USM A;  1HNW E;  3D4J A;  1IBM E;  2GS8 A;  3PYD A;  3HUL A;  4JI8 E;  4HAC A;  5FLX Q;  5LMU I;  3T1H E;  1FNM A;  1NZ0 A;  3OTO I;  2UXC E;  1ZXM A;  4P52 A;  3QT6 A;  2UXD E;  2UXB E;  4JI8 I;  4DR7 I;  1H73 A;  1HNW I;  4XTJ A;  2VQE I;  4LFB E;  3V5R A;  4GKK I;  1N0V C;  4YHH I;  1N36 E;  1S16 A;  4DR7 E;  4B3M I;  2UXB I;  1N32 E;  4EMD A;  1FJG E;  1N33 I;  1FKA E;  5LMU E;  2V2Z A;  1FI4 A;  4LF6 E;  2E5L I;  4DR2 E;  2HKE A;  4JI7 E;  2J7K A;  2HK2 A;  1N32 I;  2V2V A;  4B3R I;  1A6F A;  3JAM C;  4DR3 E;  4NXN E;  4DXL A;  1QZR A;  4JI0 I;  4LF8 E;  3LTO A;  4DV4 I;  4DV0 E;  4DR1 E;  4YHH E;  4DR3 I;  4Z7Y A;  1Z5B A;  2VQE E;  4B3T E;  1I94 E;  2VQF I; 
#chains in the Genus database with same CATH topology
 1FDA A;  3LP2 A;  3H40 A;  4J9R A;  2UUA J;  4QCL A;  2PNM A;  3GTY X;  1RHM B;  3BR8 A;  2FJD B;  2FY8 A;  4C8N A;  3RG6 A;  3TO8 A;  4O0N A;  4RJV A;  1EAY C;  2DR9 A;  2G1D A;  1R6M A;  4DPX A;  4M5H A;  1I51 B;  4NI2 A;  3UI3 A;  1C1B B;  2U2F A;  2MXY A;  2DGS A;  4FYX B;  5A6W A;  2Z0G A;  4N56 A;  1N33 E;  5LMN F;  3QRR A;  1S6Q B;  1MMD A;  2GCF A;  4KGZ B;  2HPU A;  5AE1 A;  3V6J A;  3UCU P;  1YH8 A;  1WC5 A;  3GYN A;  2QL5 B;  2WZ1 A;  1RTH A;  2XC9 A;  2F4V E;  4X64 F;  5DNL A;  3CCU S;  1K47 A;  1SL1 A;  2XSJ A;  2B9W A;  1F2H A;  4OZ2 A;  4KFB A;  1B64 A;  4Q45 A;  2R3V A;  1RE1 B;  4RWX A;  1U45 A;  4NXM F;  3H7H B;  1CJK B;  1U6F A;  1RR9 A;  1Z0B A;  2MTL A;  4C0H A;  3QGI A;  1IKV B;  4MT1 A;  4URG A;  4JI8 F;  1OIA A;  4AIM A;  4C7Q A;  2IY5 B;  4IRK A;  1PGZ A;  1NSP A;  3ZZT A;  3NBP A;  5LT5 A;  1SKR A;  5D8H B;  1T03 A;  1RDR A;  3DD6 A;  2F7V A;  2B6A A;  1K1S A;  4P74 A;  1JLC A;  1ZS6 A;  3DHW C;  3KUE A;  2QEX S;  4DR6 J;  4FN5 A;  1HBU A;  2V0N A;  3HVT B;  3GWC A;  3IGV A;  4I64 A;  3TJ9 A;  1MU2 B;  3GJR B;  4RZR A;  4YB1 P;  3Q23 A;  3CDW A;  1KSP A;  3OFH A;  3RRG A;  4KFB B;  1Y3K A;  3IRW P;  4DV4 F;  2C3M A;  3SXL A;  4GC6 A;  1QVF R;  2VBX A;  2ZDP A;  3CJ8 A;  4LF5 I;  1NZ8 A;  1FX2 A;  2CDQ A;  4L3K A;  4ZP6 A;  3CC2 S;  2FLN A;  1Q5Y A;  4B3M F;  1ICE B;  3JTN A;  4AE5 A;  5GAD U;  4LCF A;  4URS A;  5M2U A;  3MEE A;  2WNR B;  4CLL A;  2ZFH A;  1XNR J;  4V19 J;  3RBD A;  1PBU A;  2NR0 A;  4CNY A;  4DV6 F;  1JLC B;  1I3O B;  3Q8P B;  1Q82 T;  2AJ0 A;  1VBK A;  2B4V A;  2G2Z A;  3AOD A;  3HVT A;  1SH0 A;  3SQO P;  4HY1 A;  5C25 A;  1FCA A;  1XK8 A;  1Y0H A;  2C2Z B;  2VFU A;  1WHW A;  2V2K A;  3QJJ A;  4C3K A;  5HSP A;  2FQQ B;  1Z59 A;  1TUV A;  3OR2 A;  1FKA F;  2H5E A;  4MKA A;  2PMW A;  5A2Q C;  2DCU B;  1JLQ B;  4MH8 A;  3ZZO A;  4XDD A;  1X60 A;  4DFM A;  3PX6 A;  3BH7 B;  4I7F A;  1AUD A;  4B9U A;  1WC1 A;  4ILR A;  4USI A;  1YRX A;  4U96 A;  2XSF A;  3LGN A;  5EX0 A;  3PDN A;  4NXM E;  3GFH A;  1J5O B;  3KJF B;  2VIH A;  3K7R A;  4B3T F;  1LQ9 A;  2A2C A;  1NJX A;  4YP3 A;  2OMO A;  4LF2 A;  2CQ0 A;  3V6D B;  1HQ2 A;  2CYY A;  2V68 A;  4YB7 A;  2YPY A;  4JI1 I;  2PN6 A;  2VZ9 A;  2L48 A;  2EKN A;  1BE4 A;  3F73 A;  3KG4 A;  4IYQ A;  1NU4 A;  3K5L A;  4DX6 A;  1QUV A;  2QFI A;  4H4M B;  3BYP A;  1A0O B;  3SFU A;  3UN5 A;  3PYF A;  1HD0 A;  2IJR A;  3MCM A;  3VQT A;  1R8H A;  4PXD A;  4AND A;  3PR5 B;  3LUY A;  2J9E A;  3HJC A;  1S12 A;  5CQG A;  1KQK A;  3UO0 A;  2DIU A;  3J7Z T;  2YBV A;  2GQQ A;  2HGN A;  4WPA A;  5BR8 F;  3RRH A;  1PYO B;  4DCO B;  3F0N A;  3TAP A;  4KRW A;  2N4D A;  9ATC B;  2AD9 A;  1HNX E;  1H2U X;  3S7R A;  5GME A;  1B7Y B;  4RPF A;  3OVS A;  4OL8 A;  2NN6 C;  3P3G A;  1ELO A;  3O44 A;  3OLA A;  3S01 A;  3UCG A;  3LO3 A;  3VAK A;  4K2J A;  1KFS A;  4W90 B;  2XYP B;  3ZTO A;  2ZHB A;  5CD4 A;  1LW2 B;  3KLV A;  3ADA C;  2UUT A;  3BPD A;  1KQS R;  5KFO A;  4Q8E A;  1Q81 T;  4DR5 I;  3PFE A;  4NRU A;  1SBR A;  1C1C B;  1RHR B;  3R5G A;  3A3N B;  1UWB B;  2E29 A;  3CTR A;  3GYX B;  4KYZ A;  1LW0 B;  2BKO A;  4ZPC A;  1RT4 B;  4HDH A;  1HYS B;  5D4N A;  2JH3 A;  2L41 A;  3MPD A;  1S0M A;  1FES A;  3GSD A;  5AT1 B;  4DV3 I;  1U47 A;  1KIJ A;  3BSC A;  1SJF A;  2JRS A;  2B43 A;  3Q83 A;  1KEK A;  1OQ6 A;  2ALY B;  2IM0 A;  5A2Q U;  1VQ8 S;  1Z5A A;  2J0X A;  3QPI A;  2DPJ A;  2HAF A;  1LFP A;  4Q2L A;  5F8H A;  2UU9 E;  2LP4 A;  1S99 A;  1RAA B;  1TL1 B;  2MKH A;  2DGW A;  3DGP A;  4BCA A;  2WB1 D;  2MGZ A;  2C38 A;  2IFX A;  1T9U A;  2JT2 A;  3H1C A;  4IG0 B;  1GNK A;  2MQO A;  2BJ9 A;  2CPI A;  4DR2 F;  2VOO A;  3MAQ A;  2XI3 A;  2CZ9 A;  4OYZ A;  4B3S F;  4PQU A;  2JEI A;  1NSQ A;  3TZW A;  2A1B A;  3ZNU A;  1J2V A;  3Q8S B;  2BDP A;  4FW7 A;  3KG1 A;  3UW1 A;  2B51 A;  5ETV A;  1FE0 A;  4LF5 F;  1FNX H;  1RQ0 A;  1OYE A;  3HHD A;  5F8L A;  1TK5 A;  2ZH4 A;  1OQ3 A;  2NSC A;  4P2M A;  4PRV A;  1FJ7 A;  2E5J A;  1XMB A;  2HFV A;  4N8N A;  4J9O A;  5B0B A;  3G2X A;  3HT0 A;  2GQC A;  3VAL A;  4DV3 F;  1N5Y B;  2WB4 A;  1OJ4 A;  2GC8 A;  3MOZ A;  5JEA C;  4PR6 A;  2VD3 A;  2Q3P A;  3BYR A;  1IBK I;  4LSN A;  2DNP A;  5HRO B;  4LF4 E;  1T05 A;  3BKF A;  3V2U C;  1YBU A;  3HZG A;  1KQF B;  3TOQ A;  2Y0B B;  3NNA A;  3JAM Q;  4W92 B;  4DCP B;  3KK3 A;  2F5G A;  3GR1 A;  2CPY A;  2EFP A;  2HHS A;  2RQM A;  3NP5 A;  3LAK A;  2VON A;  2Q6C A;  1XMQ F;  2BQ3 A;  3BO3 A;  4J7C A;  1YJ9 S;  2DNN A;  1RT5 B;  2E7V A;  4ZVS B;  3ZTP A;  1OY8 A;  2KVQ E;  1DUR A;  1DY3 A;  4GO7 X;  4QWE A;  2ZBK B;  3CME S;  2IMO A;  4ECZ A;  1WTB A;  1Y5N B;  6AT1 B;  4B3T I;  4IFD C;  3UN2 A;  2YVS A;  3QFH A;  5H9F K;  2MY7 A;  1W25 A;  2ZBP A;  4OV6 A;  3D2W A;  1NHH A;  4L3N A;  1N33 F;  1HNX I;  2HHH I;  2QIF A;  1OO0 B;  2EW9 A;  2QT7 A;  4DL6 A;  2B4O A;  2AGQ A;  1KTQ A;  3NRB A;  3QID A;  2ZIT A;  5D15 A;  4LCH A;  3B78 A;  4LRE A;  1Q7L B;  2RF2 B;  1N34 I;  4WP8 A;  1U7L A;  3WHI A;  2ZD1 A;  2ZBR A;  3HKW A;  3PEH A;  3G96 A;  2QA4 S;  3HDS A;  3ICL A;  5HMY A;  4JI2 J;  3W9I A;  3NGD A;  1XNQ I;  2KT5 A;  1WC3 A;  2RKI A;  5SZT A;  2GO3 A;  3THT A;  1KR4 A;  1XWL A;  4DU7 A;  5C7P A;  1UVN A;  3M8Q B;  1VC0 A;  1NXI A;  3THP A;  5KFE A;  4QNK A;  4NZ6 A;  2CJK A;  5DQI A;  4DFK A;  2BA9 A;  2RSQ A;  4WK3 A;  2P9E A;  4RU2 A;  2MZJ A;  4HH1 A;  4QIW D;  3D5M A;  4DR5 F;  2VA2 A;  4LF7 E;  5J2P B;  2E1M C;  4DR1 J;  1VQ6 S;  2AP6 A;  5HBM B;  1SB6 A;  5KFR A;  4PCQ A;  5I3Q A;  3UNY A;  3CE8 A;  3CXC R;  1H74 A;  1NBE B;  4ZVQ B;  4R5P B;  2F4V J;  3KNA A;  5K8N A;  3S8S A;  4RW8 B;  1H72 C;  4DUZ I;  3D0I E;  4QYZ J;  1KOO A;  3QAE A;  4PQA A;  1EI1 A;  2GIF A;  1CC8 A;  3OQ2 A;  2V4R A;  4LF7 J;  3GB0 A;  2ILY A;  1QAJ A;  2YY3 A;  4QIE A;  2HFN A;  4A46 A;  2VOD A;  3SV3 A;  1S9F A;  4WP9 A;  3PEJ A;  2PO0 B;  4ED1 A;  1DTQ B;  1WEL A;  3IBW A;  4PYA A;  4DQQ A;  4LF7 I;  4OV1 A;  3OHA A;  5IZH A;  4A8M P;  2LCW A;  5G0R A;  2B0G A;  2FHO B;  2V34 A;  2H9Z A;  3LH2 S;  4QR0 A;  2QL9 B;  2RU9 A;  2WRM A;  7AT1 B;  1HQU A;  5GMK a;  2HND A;  3DGV A;  3RB4 A;  2D1C A;  3P76 A;  4ECR A;  1FF2 A;  4O3P A;  2ZH8 A;  4ED5 A;  3CGI A;  4M5K A;  1Y60 A;  4GKJ E;  1SPB P;  3E51 A;  2MKK A;  4P75 A;  3AOA A;  2NLW A;  1NSK L;  4DFP A;  2DPI A;  3QT5 A;  3MZI A;  1MN7 A;  4TYB A;  3S1T A;  4AUK A;  3CDU A;  2KRR A;  2WW4 A;  2PO4 A;  2HAI A;  4RUA A;  3M9M B;  3D6M B;  1U1N A;  4PXB A;  5ETP A;  3KHL A;  2JNJ A;  2XGQ A;  1H7X A;  2XMJ A;  4RU9 A;  1AYE A;  2VL1 A;  3FMW A;  3V81 B;  4KPC A;  3OVB A;  2HHH E;  2LA6 A;  3RR8 A;  2IAJ B;  5A8W B;  1M1G A;  1NPR A;  1YRT A;  4CLT A;  3EWG A;  2CVE A;  1CVJ A;  4NXM I;  2MHE A;  5MAO A;  2DGQ A;  2H5J B;  2LXF A;  4IDK A;  4M5D B;  4OX7 A;  4ED6 A;  2HFU A;  5K36 E;  1GQE A;  4PWW A;  4OI0 A;  2N7Y A;  2B56 A;  3B4M A;  4ZOS A;  4DZD A;  4QU6 A;  1YRU A;  3VGS A;  5J1P A;  5DET A;  3ZM7 A;  5J2N B;  2JC1 A;  4X65 E;  1XR7 A;  2F8M A;  3ISN C;  3MMC B;  3N79 A;  1HBU B;  2MYF A;  4OI6 A;  5BXI A;  3QSY B;  4N8O A;  5KT5 A;  4KIA A;  3VAJ A;  1K0V A;  1E6Y B;  1Y4U A;  4OI2 A;  4ZJL A;  3T1Y E;  1YJU A;  4EBC A;  4LR9 A;  4C98 A;  3VGU A;  4K4Y A;  2D69 A;  2HBQ B;  3EVO A;  2OJ3 A;  2BM1 A;  2B8Q A;  1IBC B;  2H4W B;  4Y2I A;  1V3Z A;  1N36 F;  4PPD A;  5G4D A;  5JEA B;  4ED7 A;  1R8C A;  1RHK B;  4HL9 A;  1LW0 A;  2QE5 A;  2HHQ A;  1XBW A;  1YLX A;  2K3I A;  3HFZ B;  4JI4 F;  5A8K A;  3TVZ A;  1VQM S;  1Z0V A;  4C0O C;  2H3E B;  3DOM A;  1EET B;  5A8R B;  4L75 A;  2D9O A;  5KFX A;  1NAQ A;  3ZKB A;  4IQX A;  1VJW A;  5K9F A;  2UUB E;  1E6Y A;  1RAG B;  1K44 A;  1DQ8 A;  3AFG A;  1QD1 A;  1R31 A;  2VJU A;  3SV4 A;  1IBM J;  1NZA A;  3MHY A;  1VRU B;  2KM8 B;  2XNR A;  2NXU A;  1H2V Z;  3GV8 B;  5EUH A;  2F1F A;  3J81 Q;  3M30 A;  3CDE A;  1DTT B;  4CLY A;  4D3G A;  2UUC I;  3RBZ A;  3I0S B;  1IJE B;  3R97 A;  1LXN A;  2WON B;  3LF0 A;  3CCS S;  1N6Q B;  2HQG A;  2YX4 A;  1HMV B;  3M4X A;  4FWG A;  4OO1 D;  4KO0 B;  4OYB A;  3ZC4 A;  3UD4 P;  4DR5 E;  1NHV A;  4B02 A;  2R8G A;  3AA9 A;  4GC7 A;  3DRP A;  1JXV A;  2DNK A;  3LP0 A;  2UVR A;  3DLL Q;  1NDP A;  2CJA A;  2I5J A;  1IWG A;  4P72 A;  1HWK A;  2VPX B;  2NXN A;  2CG9 A;  1MWQ A;  5C0X F;  1FJG F;  4WU3 A;  1RT7 A;  4PAB A;  3BGF A;  4QPT A;  1NKC A;  2E5H A;  3H59 A;  4UY8 5;  1WC6 A;  4JI3 J;  1CS4 B;  3D6T B;  2P6T A;  3JSR A;  4CLK A;  1IBK J;  4C8Z A;  2BA0 G;  1F1B B;  1P1T A;  2MLX A;  1XMO F;  2QC3 A;  2YQ1 A;  4DPY A;  1S9E A;  3MM6 A;  4RKU C;  3RB3 A;  2DNO A;  3HXM A;  1OPZ A;  4S0M A;  3NNH A;  5L38 A;  5DDO C;  5EWE A;  1ZA2 B;  4JI7 F;  1TAQ A;  5SUH A;  2CPD A;  4K4S A;  2DGV A;  4NLD A;  4R8U A;  2ZZN A;  4DR4 F;  4DQI A;  3OL8 A;  4N47 A;  2R7U A;  3KLI B;  1UVI A;  3MR2 A;  4QPX A;  1PC4 A;  3MR7 A;  3QMQ A;  4LR8 A;  4GKJ F;  1OYD A;  4DQR A;  2Y8W A;  3S6E A;  2DNY A;  1AB8 A;  2RDD A;  1M5H A;  3CCT A;  2O67 A;  5E33 A;  4IRC A;  4LF1 A;  3E8O A;  1UDQ A;  1T95 A;  3PRY A;  2QLW A;  2Y1J A;  3VR1 A;  5FLX U;  1IQZ A;  4EO6 A;  2EK1 A;  5HQL A;  3KXD A;  2EFN A;  1TL7 B;  4DF8 A;  3ZZP A;  3W9J A;  3V4I A;  2Z5C B;  4DPW A;  1PIE A;  1RCX B;  4OX9 J;  2D3O R;  4PPZ A;  4WZQ A;  4G3I A;  2MLZ A;  2WBM A;  3C14 A;  2KXF A;  1QY7 A;  2R7X A;  3IFE A;  5HP1 A;  4NBQ A;  4GKK E;  3ILI A;  2R2T A;  3BGU A;  4YS2 A;  3NWR A;  1TFY A;  4LFB I;  1RWV B;  1WG5 A;  2QYG A;  4U95 A;  2HYI B;  2R7T A;  5HBM A;  3OD2 A;  1UDN A;  2WOM A;  4IZK A;  1SUQ A;  4LF8 F;  1VHF A;  4FVM A;  4J9P A;  4JI6 J;  4KGV B;  2UUB F;  2VPY B;  3G82 B;  4X62 J;  1X4G A;  3QZ8 A;  1D09 B;  3Q1Q A;  3GIK A;  2AJ1 A;  2FVC A;  4C2M A;  2PO0 A;  4WFA Q;  2IVF B;  2UUC J;