3HULA

Structure of putative homoserine kinase thrb from listeria monocytogenes
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
291
structure length
277
Chain Sequence
SLRIRVPATTANLGPGFDSCGLALTLYLTLDIGAEADSWYIEHNIGGGIPHDETNVIIETALNLAPNLTPHHLVMTCDIPPARGLGSSSAAVVAGIELANTLAELNLSKEEKVRIAAEIEGHPDNVAPAVLGNWVVGAKLDGEDFYVRHLFPCALIAFIPKAELLPDTLPFKEAVQASSIANVMIAAILRNDMTLAGEMMERDLWSQLVPHLAQIRDVAKNQGAYAACLSGAGPTVLVFAPRNLANKLQTSLQTLEIDADVLLLDVEGSGAEVFREG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Homoserine kinase
publication title Structure of putative homoserine kinase thrB from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 75
structure length 277
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.1.39: Homoserine kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00288 GHMP_kinases_N GHMP kinases N terminal domain
A PF08544 GHMP_kinases_C GHMP kinases C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits GHMP kinase, C-terminal domain 3hulA02
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 3hulA01
4KHPI 3PYEA 4FWHA 4DR7E 4JV5E 4PU9A 1Z0WA 3PYDA 4LF6E 4DR6I 4LFAI 4LF7E 2XEXA 1QZRA 1Z0BA 4JI5E 3QT5A 5FLXC 1NZ0A 1PKPA 4GKJI 4X62I 5IWAE 1KKHA 2V34A 1HNXE 1FJGI 2E1RA 4DR5E 1ELOA 4P52A 1N33I 2V2ZA 4JI0I 4B3RI 4DUYE 4RPFA 4LF4I 4DV5E 2F4VE 1ZM2A 4JI1I 5LMUI 1MU5A 1N0UA 4DR1E 4X65E 3JAMC 4PRVA 4X66I 1H74A 4R1FA 2HHHE 4JI4I 1WUUA 5BR8I 3WU5A 2ZM6E 2UXDI 4DU8A 4JI6I 2E5LE 2R42A 5LMNE 1IBME 4WUCA 4KQVA 1EA6A 1KVKA 4DR3I 4DPWA 2A2DA 4LFCI 4X64E 3J81C 1D6TA 4WUBA 4USKA 4B3TI 4LF8I 4DXLA 3LTOA 4NXNE 2A2CA 3ZZ0A 4JV5I 1ZM4A 4YY3I 3OTOE 4GKKI 1EI1A 4HXZA 4DPYA 4JI7I 1HR0I 5FLXQ 4HYMA 4LF9I 1ZM3A 4NXMI 4DV6I 1B62A 2ZBKB 1Z59A 1XMQI 3QT7A 1HNXI 4HACA 4UT4A 1N32E 4Z7YA 4DV0E 1FNMA 2BM1A 1H72C 4DV5I 1XMOE 4DV7I 2F4VI 1VISA 5A2QC 4P7AA 3JAMQ 4X65I 5GMEA 1XHKA 4FWDA 2HHHI 4JYAE 3ZZTA 3H4LA 1XNQE 1OJ4A 2ZM6I 1FKAE 2E5LI 1HNZI 4LFBE 3WU6A 1S4EA 4B3SE 2DEJA 1IBMI 2NPFA 5L3JA 4MYTA 3J81Q 3V2UC 4JI3E 4X64I 1UEKA 1Z0VA 4AQYI 4DV2E 2HKJA 4DR4E 4M1KA 4YHHI 3ZKDA 3HULA 2VQEE 4NXNI 2VF3A 2UUCE 3OTOI 4JI8E 3T1YE 1RR9A 4DR2I 1FWKA 2UXBI 1IBKI 2UXCE 2HK2A 3B82A 1Z0EA 4DV1E 4FWGA 2V2QA 4JI2E 2UUAI 5IT9C 2ZITA 3T1HI 2OI2A 4ZVIA 1ZXNA 4OX9E 1ZXMA 5A2QQ 1XMOI 3Q1QA 1HNWE 4DV4I 3B78A 1I94E 3ZZUA 3GONA 4FN5A 3ZM7A 4DR7I 4HY1A 4LFAE 4K0KE 4LF6I 2J7KA 4XTJA 1B63A 4LF7I 1PIEA 4B3SI 2HFUA 2HKEA 2HK3A 4JI5I 3V5RA 4GKJE 4JI3I 4X62E 2DEIA 1N36E 2VQFE 4DV2I 5IWAI 1FJGE 2R3VA 1IBLE 2UUCI 2V8PA 1N33E 4DR5I 1S16A 4MYUA 3T1YI 4JI0E 2Q2EB 4B3RE 3D4JA 1N0VC 1Z0GA 4LF4E 4DUYI 3K1JA 4B3ME 4JI1E 1FI4A 4DUZE 2UXCI 2LJPA 3J80C 4DR1I 3QT6A 2X7IA 4FW9A 4DV1I 4I3HA 2UU9E 3PYFA 2BV3A 2BM0A 5LL6R 1Z5BA 1NHJA 4HACB 2CZ9A 4PRXA 3K17A 5LMNI 1U2RA 4OX9I 4DR3E 4DV3E 4DPTA 4LFCE 1BKNA 1N34E 1HNWI 3M6AA 4B3TE 4LF8E 1I94I 4LF5E 4YY3E 4GKKE 4K0KI 4JI7E 1HR0E 2UUBE 1ZM9A 4LF9E 4NXME 4DV6E 3LPSA 1N36I 4ED4A 2VQFI 1XMQE 1J5EE 1A6FA 1DARA 1IBLI 1H73A 4Z7CA 4UTGA 1N32I 3QT8A 4JG4A 4DV0I 1XNRE 4DV7E 4B3MI 3J80Q 2EFGA 4DUZI 1Z5AA 1Z5CA 3J7AM 4KHPE 4DPUA 2UU9I 4JYAI 1XNQI 3PYGA 4DR6E 1HNZE 2GS8A 4LFBI 4DPXA 1FWLA 2X36A 4DV3I 1N34I 4AQYE 2AJ4A 1MX0A 4YHHE 4URLA 3J7AG 4DU7A 4DR4I 1H7UA 1RREA 4LF5I 4USMA 3WU4A 2VQEI 1KIJA 1MG7A 2HFSA 3WU3A 4JI8I 2UUBI 1H7SA 3B8HA 2V2VA 4DR2E 1Z0TA 2UXBE 1IBKE 5GMDA 5LMUE 4EMDA 3LNUA 4X66E 1KTVA 1NHHA 1NHIA 1K47A 1J5EI 3CWVA 2UUAE 4JI4E 5IT9Q 5BR8E 4JI2I 3T1HE 2UXDE 2WW4A 4JI6E 1PVGA 1XNRI 4WUDA 3ZKBA 1Z0CA 4DV4E 3F0NA
chains in the Genus database with same CATH superfamily
1CLFA 2CQ3A 5C7PA 3W64A 1HW8A 1NU4A 4ZPAA 1V6HA 3VAKA 3R2CJ 3Q0AA 2PC6A 2H3EB 4HKQA 1VS3A 2YQ0A 2KRBA 2RDIA 2FC9A 5DO2A 3DM2B 1HNXE 1DY3A 2FY1A 1JJHA 4KHPF 4TNOA 1HHTP 2P6TA 3DOMB 1HNWJ 1NPKA 3CIMA 3R5JB 2X3DA 5BXIA 1KQGB 1BQNB 1ZM2A 1UL3A 2V4JB 3AFGA 4IZKB 3CUNA 4DJBA 1FERA 2V68A 3I0SB 1V3SA 5LXRA 4DSIA 4X62J 4YHHF 4B9SA 2E5LE 2R42A 5HMZA 1UDSA 2DGWA 5KOXA 1IBLJ 1NZAA 3OR1B 1DQ9A 4KO0A 5ETOA 3MCNA 3GJTB 5HVHA 4B9MA 2B43A 5FLXY 4DV0J 4WUBA 4B3TI 5H9FJ 2QX0A 3D3CJ 3PXGa 4CM0A 1ZM4A 2NQPA 3DD6A 2JVRA 3QAEA 3IBFB 4DPYA 5ADZA 2YVSA 5H9EK 2DH7A 1GQEA 3GCXP 5G0RA 1DZ5A 4LFBJ 2LEAA 2A0FB 2C39B 3CCSS 2Z5CA 1L3VA 2BJ7A 4M5IA 3SCJE 7FD1A 2VPYB 4OYOA 2MQQA 2QYGA 1XJWB 4LF7F 4JI7F 4IYQA 3R7SB 1YGYA 2UUBJ 2CQ4A 4XIUA 3C2PA 3J81Y 4NXMJ 3UFCX 1XMQJ 2AZ1A 1AFJA 4DR5F 3D6TB 1T0TV 3A8KA 3CB4A 3I96A 4OO1E 3U1KA 4DV5F 3HT3A 4DR4E 4M5GA 2UUWA 3J7Z5 3W9IA 1EX8A 2E1CA 2Z5BB 5KFGA 4DR2I 4QOTA 1W26A 4DR6J 2UXBI 4ZLJA 1P1LA 4CLPA 3PIPQ 1VC5A 5E3QA 1MNEA 2M88A 1KFSA 2PI5A 1JKHA 3D0IE 3T1HI 3NS7B 5D77A 2IMWP 2DGOA 5I4MA 1AUSL 1RT5B 1BLUA 4BCAA 3G9CA 4Q0BB 5A2QQ 4BC7A 4FF2A 2DHGA 4F4ZA 4LQ9A 3ZTSA 2PO2B 2CQBA 1YWXA 4XDDA 5H9EJ 1FESA 3ZZRA 2BUNA 3MEEB 2H4YB 3A3NB 3V5RA 1WF0A 3VVUA 1OY9A 1F9HA 1IKYB 4ZCLA 2DHSA 3W9JA 2MGZB 4RW4B 1YHQS 2E66A 5AJ3J 2PFDA 4WKYA 4DUYI 1Q5VA 1FI4A 3D0HE 1FKPB 2WP8B 4Z2XA 4JI5J 3CIZA 3D66A 3ILOA 4J9VA 1NHJA 2G2ZA 1RHRB 2GVDB 3OV7A 3WDOA 3T1YF 5GAGU 4OX9I 1KWMA 2D3UA 3WX4A 1X9SA 3VAGA 4NMXA 3C66A 1VJWA 4JI7E 2BE2B 1ZAWA 2CPEA 1K0TA 2G9OA 2YKAA 3W2VB 5D3GB 5F9LA 1SB6A 3IR5B 4R0JA 4JV0A 3LPSA 1WF1A 4QCLA 1Q86T 1NK0A 1J5EE 1REVA 4OO1C 1YJRA 4X64J 2R8JA 1I94F 1X4FA 4OJ1A 3GFZA 3CJKA 2FVPA 1X5PA 2HIYA 2NCKL 1RI7A 3MPDA 4NLQA 4CO4A 3MR3A 2J0QD 4DPUA 3NRBA 3PYGA 3HJFA 1F5BA 1TKZB 2OPPB 3B4DA 1RAGB 1IJEB 3KK2A 1N32J 1E6VA 2G2OA 1GEHA 2M8DB 4URLA 3ET6A 1H7UA 4ETXA 4LF5I 3P5BP 2VQEI 3W1YC 5CYQB 1UVNA 4OLPA 2XS7A 2HG4A 3DOLB 2C3UA 4G1QA 2M0GB 3QRPA 5LMUE 1UAWA 3T5JA 4IG0B 4B9LA 2YWFA 1S1WB 1Q16B 1KTVA 3DLKA 5IT9Q 4KT0C 5BR8E 2F1DA 5HQMA 4LF8F 2V8VA 5BYRA 1U1QA 5DRPA 2APOA 3LALA 4O4GB 3CEDA 1X9WA 3HXMA 3TEHB 1TU0B 2RKIA 1TL4A 2DJWA 4NLXA 2XYPB 2AEMA 4JV5E 2ZC4A 2N4CA 5LM7E 4F36A 1X9MA 1WG5A 2OAUA 4QWBA 1TAQA 5D0GA 3AAWB 3L7OA 2CYYA 4TLRA 1UWBA 2EG1A 3NEKA 2VH7A 4F0MA 3DLHA 3M6WA 3TUIC 3M32B 4JI1I 2P9CA 4DR1E 1RU2A 1H74A 1WUUA 2FPHX 4GKJJ 2JOQA 2ZM6E 3O1LA 5KFIA 3FBEA 5MLCV 4BBYA 1CS4B 5JVHQ 4OHYA 2ZWOA 4J5OA 1BGXT 3IS9A 2JRSA 2OO4A 1KHVA 4GC7A 3SQGB 2BRLA 4P9SA 4IR9A 1GNKA 1PKUA 3U1MA 2UU9J 2KB2A 1HR0I 4H4MA 3KLVA 4ZVSB 2NSCA 1H2VZ 4IFYA 3NCQA 4HYMA 1NMEB 4I2PB 2Z56B 3CD5A 3C15B 1NO8A 1X0PA 2AYBA 2MQNA 4B3TF 3M8WA 3UDCA 5D6GA 2IJRA 1FNMA 3MD1A 4I68A 3N6LA 4P2SA 3GIKA 3TRGA 5JUMA 1Y4UA 4ICLB 2M8HA 1SKSA 3O2IA 1R6VA 3WU6A 2AEJA 4K4ZA 5L3JA 2D3O1 2FJBB 3V6DB 1UEKA 3N6MA 3TVKA 2BW7A 3BREA 1QAYA 2J76E 4AT1B 4CO0A 1LXJA 2V8HA 1KNZA 1LXNA 1SJ3P 1FWKA 1RT4B 1U2FA 1UA1A 4C8MA 2LU1A 1SJFA 3MUVP 3R6LB 5CCMA 3Q22A 1TELA 4PG5A 1YTYA 1M1HA 1X4BA 2B51A 4MKAA 4LUBA 2BE7D 3HZEA 1NB7A 2KFNA 2ABYA 2Z4PA 3U1LA 4DV4I 1UP1A 1U1MA 2YH1A 5KT5A 3K58A 3NKYA 4U96A 4ZHRA 1F2HA 4B3SI 3MPUB 3M2VA 3MAQA 1F9EB 1S10A 3TAPA 2VKZG 2KYXA 1I51B 3R1HA 3O5TB 2QSWA 1O51A 4A8XA 2YKOA 3BBCA 3DU6A 1S16A 1R6YA 1HNVB 3EPGA 2LKZA 1N0VC 1KBRA 3TOQA 3P8BB 1JJCB 5G0RB 2HZAA 1S97A 4U3BA 1E6YA 4DV1I 5A8WA 4FS1A 5K36A 5KFYA 1YKWA 2O01C 1Q8LA 3PYFA 4J9LA 1Z5BA 2E7XA 4ITSA 3OTBA 3BSOA 1U2RA 5MAOA 2QEXS 2H5EA 4DUYF 3P06A 2ZOMA 2PDAA 3M6AA 4B3TE 3IA0A 1R8HA 1VI7A 4IZJA 5AT1B 4OI6A 4GQUA 4NLVA 3CD0A 1FHTA 2XB2D 4U95A 3J7ZT 1VQYA 4KGVB 4C0HA 4DF4A 1VQ8S 2XMKA 3TQEA 4OX9F 3UE2A 1KR4A 3BEGB 5ETSA 1IM6A 1F1BB 4DHVA 4URSA 4NXNJ 2ZOGA 5T7LA 1SVDA 2CDRB 2OSRA 2CVIA 3FRZA 3R1LA 3R5AA 2O1UA 2W4CA 3UWTA 4JUZA 3EMTA 1Y5YA 5BYSA 2A6MA 5DZ7A 2KT5A 1JKHB 1LFPA 3P6YC 3D68A 4EI2A 1WHYA 5J1EB 1VQKS 3SMZA 2NZ4A 3AY0A 1N34I 2LQ5A 4KBIA 5D4LA 4HHUA 4MU3A 3BO4A 3G82B 2VBYA 4DFPA 2ZHBA 3UR0A 5IS2A 3PS3A 4DR2E 2UXBE 4C48A 4PCQA 5J2PA 4DR3F 3P96A 2PNMA 4X66E 2G0JA 3T1HE 1YBTA 4LF5F 1WI6A 2VQEF 2PSZA 5I42A 1RT2A 3I9V9 4WZMA 2ROPA 5KG1A 2GQCA 5KT3A 2BXJA 3U7JA 1QAXA 5IC4B 4NLYA 1B70B 2HVEA 2A18A 4PQAA 4IKAA 3EZUA 3MHYA 5D4NA 1FFSB 1UFLA 3TYTA 3H5SA 2HFOA 3L3CA 4YP3A 2IRXA 2EK6A 3AD7C 2DNNA 4OI2A 4C11B 2V69A 1UVIA 3U02A 3EXCX 2XI3A 2M9KA 5SZTA 1U1PA 4OJ3A 4N47A 3IBWA 3R2DJ 1KEKA 4E8UA 1RWOB 4DUYE 3DKDA 1CJKA 4NASA 3QYYA 4OZJA 2FJXA 2DO0A 2D9PA 4ID5A 4IRCA 4Y2IA 3L95X 1AUDA 2IJNA 1OQ6A 5ITHA 1REVB 1UVMA 2EK1A 2J6SA 2JEIA 4IFDE 2GO9A 1KLNA 1OYPA 3PJXA 1KVKA 2QLXA 2L08A 3CJKB 3QSIA 2AYMA 1WNEA 2B4OA 1RDRA 2F3JA 1KSPA 2MPUA 1HMVA 3HX9A 3WBZA 1JLCA 1ZAVA 2ZHAA 4L72B 1YSJA 3BB5A 3CJQA 2EVZA 4LF2A 3VZHA 2P9EA 1Z4UA 3KK2B 2VDHA 4J9NA 3Q8QB 1FDDA 2GX8A 3RBZA 3I5BA 2IBKA 4HACA 4QWCA 4HDGA 3ET6B 2QL5B 3PW5A 2MY7A 2X1BA 3M8SA 2BM1A 4MDTA 3I0RA 2M3DA 4DV7I 2F4VI 1HR0F 3P76A 5A2QC 2UZAA 2ZNYA 1HA1A 1C0UA 4LF9J 5KT2A 1TAUA 3H4LA 2IM2A 3HD1A 3D6HB 2Z8QA 4DN9A 1NJIT 2NPIA 3FBBA 1TUVA 3LOUA 3H40A 1WI8A 2AEFA 1UW4A 3G6VA 1HHSA 2CPHA 2HAFA 1BC6A 1KVJA 3ISZA 2MJUA 2RKIB 2VQEE 3CW2C 2M4MA 2LQJA 3M6UA 1AROP 4EBDA 3BGOP 4NZ7A 2YWKA 2GHWA 3PCOB 1PYOB 1BWVA 1F5CA 4Q44A 1UWBB 2OI2A 1SJ1A 2COLA 4ZVIA 3LWLA 3FCWA 1ZH5A 2DIUA 1NDKA 3B4MA 1GK8A 2Q6CA 4RUCA 1NPRA 5HVFA 3N01A 2M2BA 1Y3KA 5KOWA 2HGLA 3D28A 5EL9A 2NN6A 2UXDJ 3G86A 2EEYA 4HL9A 5J2QA 4DX8H 2ALZA 4DV2I 2JL9A 1JB0C 4KC5A 3PO4A 4TXSA 1G3OA 1OMSA 3J7A1 1DRZA 4JI1E 4FW7A 4B3SF 2LJPA 4IFYB 3MM8B 2O5DA 1L3UA 2AV5A 1VBXA 4D3GA 3TUJC 2RSQA 2ZD1A 4DN0A 2DBBA 2CWXA 2WCXA 1RCOB 1M1GA 2PT0A 2XHCA 1TKDA 1HNXJ 4PRXA 4CH0S 2E1PA 4O3SA 2QGFB 2QMUB 4OHZA 1HNWI 2XI2A 1IN0A 3KDOA 5JEAA 1AW0A 1SKUB 4DV1F 2GO4A 2H65B 3MM7A 3RBEA 1RA7A 3IO1A 1HR0E 4R8UA 2HWIA 1XXEA 3LGNA 3UW1A 3NGDA 3PR5B 4YB1P 2E5LJ 1LK7A 4U67Q 4O4RA 5D78A 2Q66A 1H2TZ 4AL7A 1KS2A 2OPRA 2I9SA 2YWEA 1IBLI 4G1PA 1MN7A 3HJVA 5KFMA 2DNYA 1NSKL 2RRBA 3BKTA 3LAKA 1PBAA 1PCAA 4DV0I 1IQTA 4UW2A 2NREA 1RT7A 1FX2A 1LK5A 1RTJA 3TUZC 5HL7Q 1I1GA 4JYAI 3C19A 3D9BA 3GR1A 2Y8YA 2GS8A 5IQQA 4WP3A 5DDRC 4LFBI 3AODA 2XM3A 3NL0A 4CH7A 2HBQB 1T8EA 3CDWA 3L7ZA 2UUBI 1H7SA 3GSIA 2XWYA 1DURA 2J65A 4HH1A 3TNVA 2QO3A 2GQ0A 2XSJA 1S1TB 3OVBA 4AD6A 1K47A 4JI4E 1N34F 2ILYA 2KZMA 1TK0A 4RWWA 1G1XA 3QFWA 2UV8G 4K59A 1FDBA 4DV4E 1S99A 5A8WB 5K36B 4KPCA 4DR6I 4AL5A 5L46A 2RD5C 3QATA 1SV5A 5F8JA 2X1FA 1NZ0A 2NYHA 5KFLA 4IO9Q 1UPPA 3DDIA 4F2SA 1VQSA 1LW2A 2UUTA 1F3VA 5K8MA 1O5JA 2CQ2A 1SC1B 4B3RI 1KTQA 4UOCA 1WEYA 4OHVA 2Y0BB 3D1HA 3SI8A 4PRVA 4M5NA 4RUHA 2XSFA 1Q81T 4DU8A 1OO0B 4L76A 3PHEA 5KFCA 4DFKA 1Y9OA 3H5YA 5T7LB 4LFCI 2XGQA 3Q86A 2YX4A 1IBKF 3U1NA 1JLQB 1T9WA 1TUGB 1RWPB 4W98A 4P72A 4QR2A 4OI1A 5FLXQ 1T05A 3ELHA 2KFZA 4QNJA 2CJ9A 1F0XA 4QR0A 3CD7A 2JC0A 2D41A 4F2RA 4FXVA 3PX4A 2KZZA 3OUYA 2EC0A 3EJMA 2CADA 2MEWA 4LBIA 4JI7J 2FHKA 3K8VA 2W4DA 4USHA 4OZ1A 2ZOFA 1YDLA 2FLOA 1RP5A 1J5EJ 2MHNA 2QLFB 1U6ZA 2EBEA 1TVRB 5I42B 2MZJA 4UOGA 3J81Q 3HVRA 3DYAA 4X64I 3DOKB 2F4VF 4EEYA 1SIZA 2HKJA 3TUPA 2Y1JA 4MU0A 1RLDA 4DL2A 3FC9A 5LOQA 3KOAA 4ZJQA 2W25A 3C6UB 3A4TA 1FXLA 2ZZMA 4ID8A 2FZCB 1NKBA 2VHGA 2BA1D 4KV8B 1DQAA 2FYXA 2YBVA 5RUBA 1RWNB 1Y0HA 3W8PA 2WBRA 3EGVA 2BQ3A 3MMJA 3R7NB 1Q0NA 1CPZA 3OTEA 2BQRA 2RU3A 3MOZA 3KG0A 2XGPA 1C1CA 2PGCA 4XTTA 3VZIA 2JVOA 4ID5B 3K0JA 4FN5A 1QY7A 5LMUJ 2R7RA 1RCXB 3FSXA 3KJFB 3O3LA 1H98A 2MLXA 4ILMA 2JEBB 4LF6I 2J7KA 1G2EA 4DQIA 5BR8J 4P2XA 3RRGA 2NXEA 3S01A 4XO0A 2MZ1A 2DEIA 4LPFA 3MURP 1KONA 3HM9A 3Q6MA 1A6LA 2W7OA 1HMVB 4EGLA 4R5PA 3DNCA 1Q8KA 1V3RA 1JLCB 1TR0A 2KL8A 1S9EA 1QSYA 1Z0GA 4JV5J 3U27A 4FDFA 1JLEA 2WB1D 4R0EA 1BQXA 5K36F 3TAQA 3ENQA 1DTTB 2Y0SD 2BM0A 4DV2F 2CVEA 4HACB 1EQMA 2DO4A 5C0XC 3UCZP 1TL5A 4ECRA 4DV3E 3I0RB 2D7SA 4KPYA 1B0VA 5F8IA 2HNDB 4HDHA 1KQSR 3J81U 1VGYA 1IWAA 5IM0A 4DR1J 1S9GA 3RW7A 4A4JA 1Z2ZA 3I55S 4I6WA 4NCAA 4HHJA 5CZXA 3CVKA 4OV1A 2ZM6J 3VGVA 1EKRA 4NCGA 2B9YA 5T41A 4ED4A 3BQ1A 4O3OA 1YITS 2QIFA 4J9QA 4NEYA 1LEOA 3T6BA 1HNWF 4N77A 4AQYJ 2CQPA 4ZVQB 3FMBA 1RKIA 2HQFA 2BA0D 4DV7E 3I82A 1U8SA 1RAAB 4RU9A 3W61A 2QMXA 4OJGA 2VPXB 2UU9I 4X62F 1RACB 1IBLF 1RAIB 4J9MA 4MIAA 1MU2A 1RT3A 4DV0F 2V9KA 2GC8A 2KVIA 1U1KA 3J7AG 2WSEC 4F67A 4LSZB 2HBRB 3SCLE 1KOHA 3DDKA 3B8HA 2HHPA 2AW0A 2EFQA 3QIPA 4LFBF 4LRCA 5J2QB 1RWVB 4I2QA 3A1YG 1NHHA 1ZTWA 4KJIA 4M5DA 5KT6A 2R2SA 1T3OA 2XWXA 1FEEA 1K73T 2UUBF 2MHEA 1N54B 2AE8A 4NXMF 5ETNA 3JSBA 1QVGR 4RNHA 1LKZA 2ZD1B 2MYFA 3JQKA 3RBDA 3ENVA 2BX6A 7FDRA 2M5YA 1FFGB 5K36E 1USUA 2JLEA 5JJBA 4ECXA 4MFBA 4K4VA 4KE5A 2HEKA 4KAIA 3IWNC 8ATCB 4A8MP 5JEAB 3MM7B 3LQVA 1RZMA 4DR6F 2FGOA 2W2MP 3GJSB 3DLEB 2N82B 2KDOA 4CLTA 4QZVB 4OLOA 3UNYA 4CLUA 5HBMA 5ETRA 1VHFA 1JWWA 2OPRB 2EKNA 2IPOB 3X3UA 4F02A 4X4NA 2OIHA 1X7VA 3EE3A 5IFMA 1RTJB 4USKA 1TK8A 4DSKA 1CSJA 4LOMA 1CJUB 2AD9A 3I9ZA 1VK3A 4OKGA 3HHDA 3CJTA 3G4SS 2YX7A 3SBMA 3DLBA 3HHNB 4WU3A 3HKMA 3IFEA 8RUCA 3Q2SC 5DZ6A 5AJ3F 4PXDA 2AU0A 3HZGA 4UT4A 2HZCA 3PNIA 4B3TJ 4ZS6A 4HLBA 3ITHA 4DV0E 4NYZA 2I6WA 2KT3A 1XMOE 2CA9A 3POTA 2JJ4D 4JI5F 4ELUA 5KG4A 4FWDA 4JYAE 2Q79A 1VBZA 2YX1A 3TA1A 1VBKA 1HNZI 4LFBE 2VA2A 1MMDA 5EUHA 1CC7A 3KNAA 4N56A 3HVAA 2HWTA 4OZ0A 1RGVA 1BWEA 2X1AA 2WSFC 4F4KA 4X4PA 1VFJA 5BJRA 3QMQA 3KLGB 2QC3A 4NXNI 1TL3A 3QGPA 2J9CA 4KKOA 3SSSA 3CDBA 4U7UK 4ZLNA 4RX6A 2BE9B 1SV5B 2B6AA 2IDLA 3FEXB 2BANB 2ZKTA 4ES3A 1Z0EA 4D3HA 5HI7A 1SL0A 4L3NA 1YIJS 3G2XA 4X64F 4M5KA 1KRPA 2JEGA 4KFBA 3DRPA 2O1TA 4ZJLA 4PKDB 3OR2B 1GFWB 1OIAA 1RE1B 4JP8A 4CNYA 1QTNB 3BPSP 4C8ZA 3CJ0A 1CULA 4DR2J 2YNIA 4ES2A 2UXBJ 1FTCA 1DLOA 5E7OB 1NK6A 4X66J 2VKRA 3IAM9 3CJ8A 1VRTA 2DNKA 3GWCA 2ZDOA 3T1HJ 1N32F 5I3UA 4LF1A 5FIIA 1N36E 3EYZA 3HDSA 5A6PA 2RRAA 1B3TA 4B3RE 1S9FA 1HNIB 2HBZB 2JDJA 2L48A 4OO1A 1EETA 2MKJA 2CQ1A 1G4CA 2FGCA 2PO4A 1FTRA 4MIWA 1WOSA 4YUDA 3E01A 3JXOA 3VR1A 4ZP7A 5M2UA 4LFCE 5GAEU 3WC2A 3OUYB 2U1AA 3IAS9 1DAXA 4DX5A 3LO3A 1GMWA 1R31A 1YJNS 1T94A 1HQUA 1QUVA 1PC4A 3VGUA 1D09B 4PZVA 3ZZOA 2F9DA 2DT9A 2XMAA 2ZZTA 1TKXA 1GX5A 2FZGB 3QIDA 3DYAB 1VDHA 1S76D 1A6FA 4RO0A 4ED7A 2GO8A 1H73A 2RU9A 5CH7B 2ASJA 1R6LA 2U2FA 3BGRB 2KO1A 4IDKA 3IGVA 4USIA 3VAJA 3IWLA 2HRTA 1Q8IA 4GKJF 4PG7A 2LEPA 4WXWA 1VMBA 4FVCA 1WC1A 1NHUA 1HL6A 1DJ0A 3GE9A 5L9XA 3A3PB 3NS5A 2NUUG 3GCWP 1R8AA 2RB7A 4KHMA 3OFHA 4TYAA 2IJFA 4Y65A 2AKWB 2UU9F 3M6XA 3PDNA 2N3OA 1XC9A 2MXYA 5ETQA 1SJ4P 3N5FA 2YKMB 4RBVA 2JFDA 3TA2A 2B4PA 3M7ND 3EZ5A 2HVZA 2B0GA 2CJXB 1OYEA 3NS6A 4NLWA 3RGIA 5DROA 3K57A 1FK9B 5KFXA 2QV6A 2NN6E 4NLGA 1WC3A 2PNLA 3N28A 2CG4A 1WORA 2GVZA 2VQEJ 1S9EB 3QAUA 3A13A 2L9WA 1RHJB 2L9DA 2OD6A 2OPSB 3N9UC 1LWCA 1OYSA 1QUPA 2FHMA 3CC4S 4WWSA 2VJVA 3HFKA 1Y00A 9RUBA 4LF6E 3VAIA 5DG7A 2HBYB 3BKFA 3TZWA 3OSNA 4P7VA 5FLXC 4EBEA 4LRBA 1FJGI 1X5SA 3AJ2A 1ZYQA 5IM0B 1L3SA 1S9GB 3FEYB 3ZNJ1 4PG4A 4YOEA 1NHVA 3TAMA 5JEAE 2DIVA 3D54A 2BJEA 3M1VA 2BOAA 2VFVA 4R1FA 2BVZA 3VGTA 2DNRA 3OL6A 3HPOA 1HARA 2V94A 2UXDI 3FRYA 2HVDA 3JYTB 3TJ9A 4L3KA 4WUCA 2DHXA 2KHCA 3K89A 4DPWA 5A8RA 1R0AA 1KC8T 3J81C 2YWHA 3UN5A 1U6BA 5GAHI 1U0HA 4JI1J 1MMNA 2NR0A 3LTOA 5AXNA 4FF1A 3MAHA 4KGKA 1PSDA 3A3OB 2AQ4A 1R27B 2V2KA 1U7LA 1MU2B 1RT3B 3FDSA 1HBOB 4YB6A 1HNXI 3LAMA 1A9NB 1CEZA 1FA0A 5J2MA 1NH7A 3UVJA 5LSLA 5KFUA 4NX9A 5HP1B 2C3YA 3G87A 1HR0J 1BMQB 3TEGA 3QIPB 5E3RA 1AFIA 4I2QB 1OJ4A 4ZA1A 3CCUS 3DCAA 2E5LI 1S49A 1WC4A 2CJAA 4LQ3A 1S12A 1HBUA 3H4BA 3I5AA 5F41A 3PKMA 2DHHA 2QA4S 4F4YA 5EGYA 5LSRA 5ETKA 3HULA 1SC6A 3V6KA 3KLEA 1D8YA 1KHWA 1HNZF 4I67A 1YJUA 2RDDA 1WC6A 2HK2A 4RL1A 1A0OB 4OZ3A 3BBBA 3T41A 4OYPA 4MFBB 3PW7A 1RHUB 2AJ2A 2YWWA 1U26A 4K5RA 3ZTOA 2ZNZA 3H1CA 4NXNF 2RILA 4DMZA 4LRFA 3C8YA 2MZSA 3NGSA 1ZXMA 4O0IA 3MM5A 3Q1QA 2J5AA 2D3ZA 1VLOA 4HYKA 2RRNA 3DN9A 2HIQA 1SC4B 1P42A 4ER8A 5HBMB 5KG7A 2FB0A 5CZVA 4K0KE 4M8LA 1YRUA 1X4AA 4JI4J 5C2GA 3HKWA 1I3OB 2LLZA 4OJHA 2I0XA 5CQGA 3BJYA 4P74A 1RHQB 3MPYA 2E5IA 2BA1G 4DSJA 3BR9A 2VQFE 3GYNA 3CCLS 1NRKA 2V8PA 2OD4A 2MKCA 4EYHB 4DV4J 2WW8A 2HZVA 3H90A 4B3ME 2AYEA 3WIUA 4EO6A 4I3HA 4F4XA 1B0PA 2R2TA 4G1IA 2VASA 4F3QA 2OSQA 1P6TA 2WTFA 2AX0A 4QW8A 1HI8A 1YH8A 4F50A 1EZZB 3POTB 4K4TA 2V0NA 4QBUA 1WSVA 5DQIA 1YJVA 1JLGA 3Q8UA 4ZPCA 5B0AA 4PG6A 3R9LA 3LP2A 3SV3A 1S4FA 1ZA1B 3ZZPA 2QFIA 2HGMA 3J80Y 2VONA 4ZVTB 1TL3B 1UZDA 3QGHA 3S1TA 1GT8A 2JC1A 3P3CA 2B6AB 2Y1IA 2XZTB 3GR0A 3HLUA 3KYLA 3OL8A 1S0VA 2BKPA 4KFBB 1HNZE 3BR8A 1VQ6S 2K2PA 3V81B 2C37B 2G1DA 2JEFA 2V8GA 3TO8A 1CULB 3AJ1A 2HQ3A 2OTLS 2FVCA 1Y10A 2HFSA 2XS2A 4JI8I 1DLOB 2WRMA 1S6OA 2A6OA 1SJQA 4ECYA 1FT8A 2DGSA 2VA3A 1VRTB 5CD4H 1VQ5S 4EMDA 3H2UB 5I3UB 3QJPA 2CPXA 3NP5A 1WOOA 1J5EI 3CWVA 4QWAA 3M8ZA 4FKXA 3TZZA 4UOHA 2HNZB 3NOCA 5HVGA 3BF4A 3KK3A 2R7WA 4QJVA 4WUDA 3EGZA 3OSPA 4LF9F 3UDEA 4USUA 2VZ9A 2VOPA 2OTJS 2K8GA 3TWZA 3J7YU 2DNLA 4PU9A 4OO1B 2AP6A 2SXLA 3IM8A 1EETB 4PXBA 3IBCB 4C2MA 4RNMA 4O3RA 5HO4A 4DFMA 2BJ1A 1PG5B 1PKPA 3E01B 1Q4RA 3RU0A 1KD1T 3NWRA 3M2UB 3VVTA 1HQUB 4C8LA 2BJ9A 2CQDA 3CDUA 1S57A 2DGUA 4LSNA 4LF4I 5K8NA 1LV5A 3DHWC 5LMUI 1MU5A 2B9WA 4X65E 1XMBA 2WONA 2UVVA 3H4DA 3F41A 3MZIA 1TKXB 4NRUA 2HHHE 2D69A 5BR8I 1S6PA 4U8YA 3HSJA 2DRAA 1KN6A 2DD8S 2I1RA 2MKIA 2DGVA 2MKKA 1AB8A 4DCPB 5B0GA 2A2DA 5CD4A 4IDKB 3ILIA 4ECSA 3DRSB 3GYGA 5IZHA 4GO7X 3D3BJ 4JV5I 3H59A 2MZRA 2LA6A 3M30A 1S0NA 1XBWA 1YRXA 3ZTPA 4HXZA 2YKQA 2UXDF 3KG1A 3KLFB 3K5MA 2BDPA 1ZM3A 3R3TA 2JEAA 2LCWA 4DZDA 1S0MA 3V6HA 3G71S 4DV3J 3JAMY 3LW5C 1C0TA 4Q8EA 3GIRA 2GMHA 1N5QA 4NLTA 1NJWA 3RTVA 1IQZA 2YNGA 2OPQA 1VISA 1GMUA 1K9MT 4RKUC 5GMEA 1JLBA 4DQQA 2ZM6I 3CWJA 1HNXF 3ZZYA 5E3CA 3T6JA 1WDDA 2B8QA 5KFKA 2GVZB 2XMMA 5KFFA 4AQYI 1XN9A 5GADU 1RA6A 4DV7J 3E51A 2HMIA 3CO9A 2VF3A 2UUCE 1LWCB 2GMLA 1TL7A 4IRDA 4ZVPB 2E5LF 3MF5A 3FZBA 2ZJPQ 3T5LA 5CAAA 4FWGA 3SCIE 1FJ7A 1AYEA 1JLAA 1URRA 4DQRA 4J9UE 2VG5A 3HHLD 4ES1A 1IM4A 3R8YA 3MCSA 1TKTB 3GONA 1AXQA 4HI1A 4DR7I 2CRLA 3MUMP 5L1LA 2VBXA 2OHDA 4XPEA 4K4UA 2QT7A 4KGZB 3FFIA 5AE1A 1UDOA 4NLUA 2LVWA 2G13A 5KG2A 2FVQA 5A8RB 3J81j 3H98A 1FJGE 3IM9A 5DETA 4IS9A 2ROGA 1FJCA 2J7WA 2ZH6A 3RYLA 1UJ5A 2Q2EB 5C25B 3RR7A 2MKHA 2HHSA 5DNLA 3V4IA 4GKKJ 4DUZE 3A8IA 4RZRA 5CHCB 1B7YB 1SCJB 4OO1F 4FYVB 1RT1A 2BBEA 2H54B 4PR6A 1UFWA 5J2MB 2PNZA 2QYCA 3UVJB 3RB4A 4DPTA 5B0EA 4P75A 3TX0A 3MM6A 4DL5A 3RR8A 3H5UA 5U47A 5DGBA 1N5TA 4YN3B 2QJ3A 2P6SA 4OQJA 4LMZA 4FNIA 4EZ6A 2F5GA 1WSRA 2I38A 1SH2A 1VBYA 2DY1A 2XY6A 3KLEB 3FBFA 3CF5Q 3CJ2A 5D8HB 4IH5A 1XTZA 3G6ES 4OYXA 1MN9A 2XLKA 2IY5B 4ZN1A 5G4DA 1MWQA 1XNQI 5DRRA 3UO0A 4ERDA 2X51A 1FRLA 5L8RC 3BN4A 1R8PA 2W9AA 1W2BR 3R5BA 1M5OC 4TKTA 3MM5B 2CPYA 4IQXA 3MFIA 3PACA 4AIDA 3LP1A 4DU7A 1XMOJ 1QVFR 3WU4A 1UKUA 2XLJA 3PEJA 4JYAJ 4IG3A 5IT4A 1O8BA 1R6MA 1OY8A 3PG9A 3P45B 1RWMB 2GZOA 3VALA 4AM3A 3G96A 1NHIA 3Q8RB 3Q2TC 5GAGI 2M70A 1U6FA 3UDLA 3QWPA 2V9WA 4JI6E 2VC1A 1PVGA 3Q24A 4A8SA 3NMRA 4C8KA 2EW9A 2IESA 6AT1B 3QRRA 2QA4G 1NEEA 2VPWB 1Q5YA 3PYEA 3LF0A 4OZ5A 3ILJA 1UJ4A 2ZC3A 2B3TB 1J5EF 3LP0A 1UA0A 1UCNA 3NNHA 4O3QA 4PRFA 5HN0A 3KXDA 3CJ5A 2NXUA 1IKVB 3P4UB 4I4BA 4ZIVA 3M7NG 4TY8A 1N33I 4JI0I 1JLGB 4ECUA 1SIWB 3LP2B 3W5XA 4FZVA 1HD0A 4X66I 2CQHA 2QL9B 4YS2A 2RUGA 1U02A 4ECZA 4LBPA 3PHTA 3KTQA 3GILA 1N36J 4C8NA 4ED3A 2VL1A 1HYSA 1LW0A 3CCES 3PR4A 1EA6A 3MEKA 4DG1A 1FVQA 2VC0A 4B3RJ 2CNOB 2KXFA 2JWNA 1D6TA 3NLCA 5LMUF 2W8KA 3EZOA 3ZZ0A 4YY3I 3OTOE 4YMEA 2ASDA 5BR8F 1EI1A 1FNXH 4RBUA 3BM7A 4LRDA 3DC2A 3CSKA 2RNEA 3IWXA 6FD1A 3E8OA 4OI4A 1VQ9S 4A8FA 1APSA 4DV6I 2CG8A 1K44A 4LFCJ 2CJYB 2H48B 4MJKA 4JV5F 2V4QA 1EAYC 1YZ6A 3HF5A 3OXGA 5F3TA 1UVLA 2DXEA 4NZ6A 3ZZTA 2VFRA 2VU5A 2WOMA 3M2RA 1NCLA 3BO3A 4IO1A 2HVHA 1W2IA 4Y3CA 1OYDA 2NPFA 3MM9A 1JJ2R 5GMKa 4JI3E 2CJQA 4DR1F 5KFZA 3CJ4A 4LSLB 2Y1RI 4JI8E 3O8WA 3BH7B 2ZM6F 3F56A 1RR9A 4Y6IA 1JX4A 2GJFA 5DQGA 3AQOA 1NSAA 2UXCE 1EP4A 5DRKA 1TL1A 2QLWA 4AQYF 2EBGA 2W2OP 5A8KB 3FVYA 2YNHA 4IFVA 4F3MA 4CP5A 2GHVC 2K3IA 2VFTA 5F3ZA 2P5VA 1WKKA 2KI2A 4LSNB 5A2QU 2IYIA 3MCOA 4WFYA 2WONB 1Y4SA 2OKQA 5HROA 3UD4P 1QD1A 3DFEA 1S6PB 3K5OA 3FEZA 2AJFE 2PO0A 5C0XA 2YTCA 3G6YA 3CJRA 2FY8A 3BO2A 3KUEA 3GJQB 4RW7A 4AXJA 4A47A 1Y4ZB 3KHLA 5IWAI 3MR7A 4YB7A 4K5SA 2R3VA 3MMBA 2DTJA 4OYIA 4A8YA 4LREA 3M30B 4LF4E 4IRKA 3GIIA 2G4BA 2DKOB 5EHHA 4LF6J 4PABA 5CYMB 4JBCA 2L9NA 4CLLA 1S1XA 4DL7A 2FD2A 2NXNA 2ZJQQ 3N0VA 2JEAB 4Z37A 2AGPA 3QLHB 4B9NA 2OFGX 5HQLA 1C0TB 4A48A 4A8OA 5LMNI 3K5LA 2QL7B 2G0CA 2YNGB 2V6AA 4U6PA 4KRWA 3MMCA 2K3KA 1JLBB 1D9DA 1SL2A 1ZPVA 2F7VA 3ADAC 4YR2A 2GHPA 1S72S 4N7TA 2HURA 5K8PA 3OFGA 2HMIB 2D1CA 2XY5A 1X5TA 1S59A 3PJWA 1XNRE 1TL7B 4B3OA 5THWA 4ANEA 4B9VA 4P71A 2VUGA 3LGMA 3FQKA 4IFDB 5B08A 2BKNA 4A8WA 1KVIA 3JSRA 2BJ8A 3BV8A 3QJLA 2IC3A 3H8YA 1JLAB 4PPZA 1WELA 3P49B 1OWXA 1ZZNA 3NAHA 5T14A 3C16B 2IERA 1UVKA 2I5JA 2JE6B 2RHSB 3CD6S 4AQYE 4DOZA 2AJ4A 4Q7AA 5IV4A 1RREA 2V67A 3THVA 4USMA 1LQ9A 2J8AA 3NBPB 1FD2A 1REGX 2B8PA 1XR7A 1XNQF 4JB8B 3CDIA 3EWGA 3OTCA 1Z0TA 1VK8A 3FFIB 2IHR1 2YQ1A 5CYJA 5HMWA 4PG8A 4WCEQ 1VC6A 3S8SA 4XAKA 4RNFA 5IT9U 2MSSA 1WEZA 4ANDA 2ZUGA 3V4IB 4YEAA 2AZ3A 3ZNUA 3TJ8A 1K1SA 2G1HA 2BMBA 4ZPVR 4DR7E 4U7UD 4AXIA 1H2UX 3PYDA 4LFAI 1RT1B 4BA2A 4TU7A 2C2NA 4NOHA 3K85A 4IFDD 3HVTA 1H0HB 3KJQB 2CZVC 2C3PA 1BXNA 3I0SA 3DMJA 2ZHOA 3RZAA 4K8RA 2CPDA 2QE5A 1D9FA 1ELOA 2ZH3A 4ZN3A 3OR1A 3MM6B 1WWHA 1BQMA 3D0GE 2CQCA 1I5OB 4K0KJ 1LNQA 2CQGA 2DNOA 4C4WA 4JI4I 2R2RA 2J8SA 1RB0A 1N48A 4OI0A 2VQFJ 3QFHA 1EKSA 2C3OA 4CZCA 4DR2F 3JTPA 5EWEA 2UXBF 2XS5A 5DM6Q 2FJAB 4H4KC 1XEZA 2Z0GA 4B3MJ 2DNZA 4FS2A 2CFXA 1QM9A 4J9PA 4X66F 2KM8C 2DITA 3Q8SB 4ALZA 3T1HF 1Q8BA 5C5JA 4L73A 4KO0B 3BGLA 1PAUB 1NHKL 1JJ4A 3OJSA 1CVJA 1P8GA 3QT7A 4DQPA 5KFOA 3LP1B 3ILLA 3UN2A 4QQBA 4CQ1A 1RJJA 2LDYA 2K06A 2W4PA 3MCMA 4YY3F 4MK9A 4IG3B 2AT1B 2UP1A 4ZDNA 4ED1A 1RWUA 2O1PA 1XNQE 4C3MA 4WYLA 1YVFA 4OX8A 4DV6F 2Z5CB 1FKAE 4YQWA 5FWKA 1RWXB 4CM2A 1XR5A 2Z5BA 3VQSA 2Z57B 5KFQA 4WXOA 2QG9B 1RXOB 4ED8A 1RAOA 2ZH2A 3Q8PB 3PJ9A 4YHHI 2MY8A 5I3PA 4WIIA 2R7XA 3LP0B 5KFJA 1OSCA 2XMVA 2WB4A 1HNZJ 4IFDF 1RWKB 1YJWS 4OZNA 2N3LA 1KQKA 1UJ6A 1ITPA 2ZITA 1FXDA 4TY8B 3BPDA 1X4GA 4U9RA 9ATCB 1V9OA 2PD1A 3THPA 1QSLA 1Y5LB 5HMYA 3PRBA 4P2FA 4RW4A 3PS1A 1CBKA 3KHRA 1IKWA 4LF7I 3DRRA 1RKJA 1PIEA 1ROFA 2UV8A 1ZS6A 1HYSB 1LW0B 1LWFA 5F8MA 1FKPA 2WP8A 1FO1A 1S48A 4AFFA 4M5JA 3OD2A 3EGNA 2BR2A 1N33E 4DR5I 4JI0E 3OTDA 1E3PA 2GVDA 1VQPS 1WHXA 1HLWA 3Q6NA 2WK4A 2VDIA 2DR5A 3F44A 1XK8A 2YKPA 3SQOP 4C9DA 2W1BA 1ZETA 3TZXA 5IWAF 1FVSA 3GG0A 5D3GA 1PILA 4PWWA 2D74B 2BA9A 4YY3E 3L4BC 4X65J 1JIHA 2FHJD 2WOMB 3JTNA 2HHHJ 2KN4A 1ZM9A 3QGGA 2Z2LA 2KT2A 4E0DA 2ZUAA 3MM9B 3KJVA 1N5SA 4DV6E 4H54A 4WP9A 2OMLA 2MQ8A 3FKBA 1TKZA 3H25A 1F6TA 5C2CA 1TZ0A 4MH8A 2IYGA 3J80Q 3W5ZA 3AB4B 1EP4B 4Y2AA 3GLLA 1IVZA 3CULA 4KSEB 4C98A 1NKCA 4N8OA 3UR3C 2CXEA 2YNHB 1KQFB 3M85G 4IFVB 4CH1A 2E1AA 5ETVA 4DV3I 2ZJRQ 1TP7A 2C38A 4JI1F 4O3PA 4EK2A 1VRUA 2W7PA 4EO8A 2EFVA 2A1BA 4O4GA 2WVBA 3M6VA 2MZQA 4RU2A 3NOGA 4CO2A 5C0XB 3PVXA 2GJIA 2BOPA 1E6VB 2RDJA 2VV5A 1S6QA 2AWZA 4RW7B 3P3DA 3MMBB 4CLSA 3NAIA 1JXEA 3R5CA 4QIGA 4EFAC 2UUCJ 4O0NA 2QA2A 4NA1A 2DCUB 4G1QB 2MLZA 1JK9B 1Z1ZA 2NYIA 2RF2A 1GMVA 2BKOA 3HHEA 5HATA 4AE5A 2VJUA 3RUBL 2GAHC 2ASLA 4WFAQ 5L9NA 3GB0A 3DLKB 3JQMA 1DBDA 2HWHA 3EM1A 3VGSA 4NLOA 4OX6A 5IV3A 4H4OA 3HI9A 3RW6A 3I6PA 2O3DA 1WOPA 2R7OA 2E5HA 1BHNA 2W24A 5DG8A 5IWAE 1KKHA 4AL6A 3PTWA 4ETZA 3MMCB 3IR7B 1CS4A 2GA7A 4WFXA 3SIPB 1YX2A 3BSNA 4CCHA 3DU5A 3CMAS 4LFAF 4A8QA 2DXDA 3J80U 1RT6A 4ELVA 2W2NP 3QJJA 4Q2LA 1RABB 3T5HA 2W01A 3W66A 4LRAA 4NLRA 3VF0B 1FJGJ 5LMNE 2K7KA 3PRVA 1IBME 1RTDA 3HKZD 2B4UA 4B3OB 3KLIA 2CIMA 2XNQA 3CCQS 4LF8I 2CPJA 3AD9C 3OFEA 4DUZJ 4ZP8A 4GKKI 4JI4F 4CLYA 2DH8A 5DLFA 4NYOA 2O3ZA 2QRRA 2VODA 3T9NA 2QZ8A 2XC9A 4CYUA 3IS9B 3OW2R 5KFBA 3IG1A 3BKUA 2KJVA 3Q23A 3K8WA 3KDNA 1X8DA 4DV4F 1D1UA 5D0RA 2Z2YB 1IKXA 2GIFA 2DRDA 4H4MB 3V6DA 3JAMQ 3TW0A 3HSDA 3KK1A 2F4FA 2HS3A 5E33A 4FXDA 3H20A 2KXHA 3ISND 1RWWB 1RT4A 1IR0A 2HQGA 1UMJA 5KFVA 1RHYA 5B09A 2VB6A 3AJDA 4C6AA 1TQLA 4KGXB 3GG1A 2N7CA 3E2EA 2CZ4A 1PJ6A 1USVA 2IAJA 4PEOA 4B02A 3DXSX 2Q3PA 4BA2B 1PJ5A 4KR0B 4MU4A 4BC9A 3B4TA 3HK2A 2AIRB 2OLWA 4AYBD 4PUOA 2RJZA 3HVTB 4PXCA 4F8RA 3DMJB 2ROEA 5IT9C 5FD1A 3W3SA 4WZQA 3FZ2A 2J0XA 4QIWD 4X4SA 4HT7A 4ECTA 4J7CA 2W2PP 3B54A 2LXUA 2BYCA 2EFNA 1HBNA 2IVFB 1XMOI 1BQMB 4KYZA 3NGKA 1HWKA 1Z2LA 4ZVUB 3HFVA 2RQCA 2HNYA 3ZZUA 1NJXA 1HNVA 4HR2A 4LFAE 2DK2A 5C0XF 4G65A 2IVMA 3MXHP 3AOCA 2XBPA 3HD2A 4HVZA 4JI6J 2P9GA 3GU0A 3KKFA 5F8NA 3N5BA 2KKHA 2NXJA 4ENOA 3BGUA 4FW3A 1F60B 4ZHRB 4IQMA 1FRXA 5J1NA 5FJ4A 4K4YA 3M2VB 3HVWA 2XYHB 3QT6A 1Y5IB 2LYVA 2NUHA 3JAMU 1Q53A 2Y3YA 2DISA 1SQEA 2XZDB 2J0WA 2W7AA 2XO7A 2E5GA 3GJRB 2FLLA 5D0HA 3UI3A 4F0HA 5DNXA 5KFWA 4RR5A 2CJBA 4NLDA 1HFEL 1NK9A 1N8RT 5KG3A 1E6YB 6FDRA 1I6JA 2IMOA 2ZBRA 3EUNA 3I4HX 2MB0B 3P3EA 4ZPBA 2FHJA 3OHAA 3LA0A 1T03A 3LANA 1N36I 3RRHA 1DARA 4IZJB 2FTRA 4Y00A 4HTIA 4CI0B 3KUHA 4DL0C 3C46A 3DHXA 4KH0B 5J1EA 4DQSA 1YHCA 3M8QA 3OTOJ 4OYMA 3F73A 1PBUA 1D8ZA 2H51B 7AT1B 2J7UA 1Z5CA 1B64A 4IR1A 3S6EA 3GV8B 4KHPE 3G82A 3EVOA 2DNQA 4OL8A 3FQLA 3AHPA 4ZPDA 4LIWA 2A3JA 1FWLA 2R7QA 1F5AA 4YHHE 5AE2A 5KAKA 4QR1A 4IUFA 1M5PC 4BS2A 5LL6d 5ETTA 4YR0A 1QAJA 3HFZB 3CC2S 1IKWB 2AYGA 3DRRB 3W7BA 5K36D 2LMIA 2GIQA 1LWFB 4J9OA 3T9ZA 2AHOB 2J9DA 4DV3F 2JSXA 5C0XE 2KH9A 3AA9A 4JI3J 1T9TA 2WZ1A 3PW0A 1C2PA 2BR2B 3J7AN 1OPIA 4JI8J 5F8LA 4IZJD 5J2PB 3F0NA 4C11A 1EHWA 4MQYA 2UXCJ 4J37A 4OZ2A 2R2UA 2EC2A 1Z0WA 3E3XA 2OUGA 4LF7E 4EYIB 1WC0A 3CCJS 1RT2B 1YK9A 5HAOA 2C2RA 5KFDA 4QYRA 5A0YA 2ERRA 4DV7F 1WACA 1Q95G 4FYYB 2QN6B 2V34A 4GRSA 5EN1A 1X0FA 3TARA 2B9XA 1M5KC 4DR5E 3O44A 4C0OC 1HBMA 1UVJA 1RYSA 5ETPA 4WFBQ 1P1TA 3OL9A 3OXFA 4DV5E 1H7XA 4K2XA 3KJVB 4Q2MA 1QTMA 1T11A 2FZKB 3QZ7A 1R0CB 2NLWA 2ZFHA 4L6V3 1BUXA 4DS5A 1CJKB 4DR3I 2D9OA 2C2DA 2IM3A 1Q79A 1Y3JA 4LF4J 1FF2A 5E0OA 4USVA 2HFZA 2ZZNA 2CNKB 3KWMA 2J9EA 2AMCB 2UVWA 3CJSA 3VQTA 2FQQB 3C14A 4QPTA 5E2QA 3GPAA 1VQOS 3N4WA 3UHMA 3PFOA 5FLXU 3BS9A 3BYPA 1NK8A 4NEZA 2C2MB 2PI4A 2BQUA 2E29A 1QLNA 1Z59A 2C38B 1RHKB 3OQ2A 1KLMA 3CO0P 1VRUB 2ACMA 2RVJA 3NMAA 4GKKF 2LU2A 1QE1A 3W62A 4DCJB 1U47A 3HHLC 2WHOA 5C24A 2F1FA 5KG5A 4RW9A 4WBFA 1S6QB 4TLQA 1HWUA 1S4EA 4P2MA 4X4TA 5LJ3Y 4G6VB 3OL7A 2F8MA 3WQPA 1FRMA 2HHQA 3DLJA 2RAQA 3CC7S 1XNRJ 2QFJA 2RF2B 1C0UB 3EDRB 1U1LA 1VQLS 5B0BA 4QPXA 3T1YE 1UWAA 5HANA 3BQ0A 2HLUA 5JVGQ 4ZVFA 5KFHA 4HT5A 2VD3A 4H4OB 1X31C 1HI1A 4MKBA 3ZTRA 1S77D 2RQ4A 1T3NA 4CO3A 3NGRA 2FDNA 4BWMA 3LWMA 3MR2A 3T3FA 4OZEA 4OZLA 2CG9A 2MDAA 1I94E 1RT6B 2ZE2A 1RTHA 4R25A 3EPIA 4B08A 3ICLA 2XMUA 2OP5A 1TFYA 2V4RA 2HK3A 2KVQE 4KH1B 3IMQJ 3HCXA 3MM8A 3M4XA 5DJBA 1RTIA 1RTDB 4YR3A 1XMOF 3KLIB 5IXUA 3G6XA 3RAMA 4JYAF 3SCKE 1H38A 2ATCB 4DR7J 2DB1A 2NN6B 4X4UA 3J80C 1XQIA 2IA6A 4CYUB 2NS1B 1JLFA 2GO3A 4FW4A 3UN3A 3IG1B 2OH2A 1SUQA 2F9JA 2VESA 2C28A 3GIMA 2ZBCA 4IOCQ 4ZVGA 3HJCA 2E1MC 2I2YA 1IKXB 4FVMA 5AE3A 3WZ0A 2R7VA 4W4MA 2MJNA 4CT8A 4Q45A 3HT0A 2LQ8A 4LF8E 3P5TL 3KK1B 3N79A 4GKKE 3N6NA 4LIRA 4K0KI 1VRQC 5KFTA 2C2ZB 4ZLPA 4JOUA 4WKRA 2VQFI 2HRYA 5KFSA 1U4BA 4KTQA 2IAJB 3C6TA 2HW3A 3MTKA 1UW9A 2UVRA 4R8UB 2GV1A 4B3MI 4K7QA 4K50A 3JS9A 4ISAA 5KG6A 3VWSA 4PUOB 2NXCA 3MPVA 1N36F 2R4FA 5CXTA 2AX1A 1RHMB 2NN6D 1JQGA 4I7FA 5EX0A 4DUTA 4HEA9 2C1EB 5HK4A 1NBEB 4KHRA 1R43A 3AXMA 3AA8A 4B3RF 8AT1B 1HBNB 1TV6A 1S1TA 1RT7B 2PA8D 1XWLA 1FJEB 1J2VA 3W2WA 2HNYB 3K5NA 1MG7A 3D6FB 1B99A 4K4XA 2ZVSA 3PV8A 1XNQJ 5L1IA 3LNUA 4O23A 3PIOQ 4LFCF 3AOAA 2R7TA 1YBAA 1DQ8A 2POKA 3DDNA 5GAEI 1VIOA 3WC0A 4ED0A 3L7ZB 1RAFB 3MPWA 4PAAA 5JEAD 4ZMMA 4HTJA 3DXBA 2XSJB 2KHDA 3PFEA 4WF9Q 3M8YA 1FDAA 4CIOA 1IWGA 1R0BG 4M5LA 2V5HG 2YWGA 3RB6A 4ILRA 4N5SA 1FDNA 2C22A 4P73A 1DTQA 2XZWA 1GXLA 3CGIA 1V5IB 4W90B 3CCRS 2F40A 4MTPA 1NM2A 1T03B 1JLQA 1F2GA 1Y5NB 3JAMC 2PO1A 1SBRA 5B0CA 2MKYA 3W60A 1GTHA 1LW2B 2OEKA 5KG0A 4TN2A 2LP4A 1SXLA 1N33J 2XMTA 4JI0J 3M8QB 2DNGA 2IDEA 1U48A 3CDJA 5HQ8A 1N5YA 2FJDB 4DXLA 1IBCB 1NDLA 2GMJA 4QNKA 3LGHA 3DI6A 2ZH7A 2NN6F 2B5JA 4ATNA 4XDCA 1R8CA 4DX7A 2OFHX 4DI6A 5LSOA 1NXIA 3ENAA 1YJTA 4K2JA 4M5HA 4ZCKA 2DY9A 1QSSA 3MECA 1O0PA 3ZXWA 1TVRA 3AOBA 4YY3J 4LF6F 4ED5A 1T05B 4P7AA 3DOKA 4X65I 3KMSA 1X4EA 1OS5A 3QGIA 1GH8A 5HJYA 1XHKA 3A8JA 2HHHI 1L3TA 2CQ0A 3THTA 3D2WA 4DV6J 3C6UA 1UEUA 4JI2J 3BZQA 1N6QA 2K1RA 4KV8A 3FBCA 3H2VE 4MYTA 1HWLA 1LOUA 5JEAF 1YBUA 2KG1A 2WNRA 1GXTA 4RNOA 2KG0A 1W25A 4ZVHA 1M1KT 4NWBA 3CNQP 3MGJA 4DZ6A 3BBFA 1FCAA 2RHQB 1MWZA 4PXEA 2HQCA 4BDPA 2WSCC 4RWXA 3R5GA 1IBKI 1S7HA 2WBMA 2HYIB 5DDQC 1VHIA 3GMEA 2IRYA 1P9QC 2DPIA 5A0YB 3IN5A 3KG4A 2E7WA 2JEBA 1HBMB 3ETOA 3AT1B 1Q82T 4X4VA 1TK5A 2LXFA 4LT6A 4OX9E 4F4WA 2WVFA 2PMWA 1KFDA 3BDEA 1HWJA 3GV5B 5L38A 4XTJA 2V50A 1VQ7S 2LXIA 4ZJOA 4DLEA 1DTTA 1C1CB 4NYPA 3GMGA 3RRKA 3MI7X 2UUCI 4G3IA 1MWYA 3SDEA 3D4JA 4ZK7M 5F9NA 3C14B 1TUWA 5D4PA 4A8KA 2HNDA 3IRXA 4FW9A 2XCAA 2ZH1A 5IT0A 4R5PB 1KLMB 3IP0A 5IWAJ 2KXNB 1FRJA 3JQJA 3CCMS 1NB2A 3K17A 4DR3E 1QE1B 1JLEB 3OT9A 3Q8YA 1WTBA 1M0SA 4BA1A 5C24B 2BRKA 4UUXA 4LF5E 2DRBA 4RW9B 1VYAA 2CJKA 1SH3A 1ZZFA 3I31A 4PYDA 3BQ2A 1VOMA 2XULA 3RG6A 5LMNJ 2Y9HA 1IBMJ 2CWKA 3IGNA 4RUAA 1AT1B 4TVAB 3L09A 4Z7CA 2HFNA 2WAQD 3FSYA 4LR9A 4UOFA 1NKEA 4K0KF 1GTEA 3R7BB 1OQ3A 3QO9A 4ZLLA 4DUZI 2FHOB 5IC6B 1KP6A 1OSDA 2ACYA 2AJ1A 2QA1A 4NCGB 4BHQA 3P3GA 1GX6A 2VQFF 4F0KA 1RAJA 4UQTA 4B9UA 3QWUA 2V8DA 2UUAJ 5JXSA 1ZPWX 2JLGA 2X36A 4B9TA 1SPBP 2YQ3A 1V3ZA 4DL6A 4B3MF 4IFDC 1H7WA 1IR2A 3O6QA 4TQSA 2ZE2B 1MMLA 1RTHB 1FXRA 3RJMB 1N5VA 4OIXA 5M2RA 3QSYB 1FE4A 1ZBTA 5IQ6A 3S7RA 2WVCA 4DL4A 4OHXA 2HHUA 2HPUA 4ECVA 2GW8A 1RTIB 1K8AT 3A8EA 1SQGA 3ZC4A 1P27B 2RQKA 4MK7A 3EGWB 2W9BA 3L7PA 4Y28C 3ZKBA 4RW8A 4Y2CA 4FWHA 2HHVA 1JLFB 1PJ7A 1SUQB 4NPOA 4M5DB 2IOQA 2FIUA 1QZRA 2X3GA 3DLEA 1URNA 1Z0BA 1RBAA 3QT5A 4MK8A 3EVWA 1ACMB 4NZ0A 3MWBA 4DPOA 4KGMA 4X62I 4H4KA 2R8HA 3QRQA 2DNMA 4CLFA 4PWDA 4I6YA 5AXLA 4LFAJ 4OV6A 2DNHA 5M2PA 3GCMA 2EWHA 1KOOA 1U0SA 3D7SB 4W92B 3WU5A 4MIBA 3Q8VA 1PO6A 1CJUA 4JI6I 2FVSA 2XO6A 2YNFA 3C6TB 1ULRA 2JT2A 1WC5A 3JB9k 3H42A 5IOLA 5D0EA 2B7BB 2VICA 3EICA 3M8RA 3QZ8A 4ECWA 4I7FB 2QMWA 5BYQA 1T02A 1NJYA 1DFDA 3KLHA 1OY6A 5EX3A 1H3DA 2IA0A 3NNCA 3SFUA 4V19X 4NXMI 1TV6B 4LR8A 2EG2A 1TMMA 1XMQI 2QLBB 3W2WB 2VFUA 4LJMA 4DR4J 2MQMA 2V63A 1H72C 1HI0P 2C42A 3J7YI 3KJNB 4Q5VA 4ZCMA 3IRWP 3KLGA 2XMWA 2GGPA 4ZVRB 3HO1A 4CTAA 2XHWA 4URQU 1U1RA 5CABA 2CPIA 2PEBA 4B3SE 2KYZA 1M5HA 2DEJA 2J9DE 1WDTA 1NPPA 3ITHB 2BANA 2ZH5A 2N4DA 4J9KA 3ZZZA 3AXKA 3MD3A 2RE1A 4DSFA 4X65F 3I4PA 2Q6BA 3OTOI 3OR2A 3LUYA 2HHHF 3RB3A 1NLKL 4KHPJ 4FNHA 3PM9A 2W9CA 5LJ5Y 5KFNA 2EFOA 3BDPA 3G8TA 1CJTA 4NRTA 1B7FA 3B82A 4DV1E 2ATLA 2JFKA 4F3OA 2DYAA 1PYTA 2ZVIA 2BW2A 3UQSA 3M9MB 1O6XA 1WKJA 4YHHJ 3R5DA 2R8KA 2C2KB 1Y11A 1DTQB 1ZXNA 4KKOB 2CNLB 1UFKA 2DR6A 3GFYA 2VG6A 4Y34A 1XR6A 5F0WA 4Y2MA 2DNPA 4L74A 4EWTA 2PO1B 4HH0A 1DHMA 5HLFA 1S7IA 2Y1LB 5E3PA 4V19J 3DRPB 3OPKA 4DS4A 2HAIA 1D0EA 4ZPTR 3OXLA 3NG8A 2F63A 1HNIA 2HHXA 2HFUA 2M52A 2HKEA 5DM7Q 3HMJG 3PX6A 4JI5I 1Q78A 5DG9A 4JI3I 4FBUA 2YNIB 1YQHA 3ZFVA 2DR8A 1N5YB 2F8HA 4J90A 2VPZB 4MYUA 3VAHA 3D1OA 1CG2A 3ZTQA 3Q83A 3DI6B 4U8VA 3GP9A 2LQ9A 2O66A 2B5JB 3GLJA 1E3HA 4WE1A 2UXCI 2G2YA 4LF7J 4RW6A 3T5KA 3M8PA 1VQMS 2BV3A 1X5OA 2FJWA 2F65A 1SI9A 2UUCF 5GADI 1UDQA 4ED2A 4NI2A 3MECB 4Y0FA 4DR5J 2KRRA 3QNWB 1RQ0A 1BKNA 2CGEA 1N34E 4FF3A 5EKWA 4KY3A 3MTJA 2XYGB 4DV5J 2DPJA 5DQHA 3D6MB 1K0VA 3I32A 2H5IB 4FF4A 1NNDA 2L3MA 3BGRA 2GNKA 1N6QB 2K1RB 3SSQA 2FUG9 3CTRA 2YH0A 3R6GB 4U7CA 2WNRB 1WKLA 2MTLA 2LDIA 4UTGA 3G8QA 1G7CB 1M90T 1N32I 3L7UA 3QT8A 1HKAA 4CT9A 3SSRA 2PIIA 5J2NA 2R8IA 3TANA 4TY9A 4ELTA 3J7AM 1NZ8A 2B9EA 3TZYA 3HSGA 3T19A 1UPMB 1HHQA 1HQ2A 1FJGF 2RIJA 3LH2S 1CC8A 4OYAA 4LVOP 2YKMA 1N4LA 2YPZA 2YKNA 4KQZA 2EKYA 1BE4A 2DR7A 5LT5A 1VCTA 2HSEB 4DUZF 1FK9A 3VCDA 5HMXA 3U1YA 4N8NA 1RAHB 4OHWA 5E41A 2Z2MA 3SFGA 2IRUA 2N7YA 2DGQA 4DX6A 5CA5A 1ZAXA 1IBKE 1PGZA 1T9XA 4GVLA 4OO1D 2OPSA 2MLYA 3BH6B 2PE8A 1C4AA 4OYBA 2WVEA 1WG4A 2ZKUA 1MSWD 2ASYA 3SDEB 3GIJA 1S5ZA 2IM0A 1XNRI 3PS2A 3T1YJ 1Z0CA 3H7HB 1WHVA 2OJ3A 1GMWD 4WTOB 3IRXB 4WFZA 5AXKA 3IC1A 2RMLA 2IVYA 2B7CB 2CAJA 1HWIA 2RT3A 5EWFA 2MSTA 2XEXA 4FXWA 1U1OA 2A10A 1IXKA 4F04B 4TU8A 1HPZA 1NK7A 3UD5A 2NZCA 3MAAA 3GQCA 4GKJI 1J5OA 4NLPA 1UZHA 4EBCA 5EWGA 4QIVA 3MUTP 4BA1B 1PYSB 3JYTA 5KT7A 4P52A 2V2ZA 2FLNA 1I94J 2Z5EA 2RUSA 4IH6A 2AGQA 4PYAA 2F4VE 4A46A 1N0UA 3OLAA 4OYZA 2OGUA 1QJHA 3DLGA 4LR7A 3FSIA 3DGPA 4KQVA 2HQIA 3KUGA 3ISNC 3TAMB 1RSCA 3QO9B 3D67A 1HBOA 3FMWA 4ZOSA 3M1VB 1UDNA 4YDDB 4MU1A 3DGVA 2A2CA 2GAGC 4F26A 3I5CA 5HP1A 1FRIA 4JI6F 3BN7A 4LCFA 4UY85 2OEMA 4ZIWA 1R0AB 1B4SA 2LA4A 1U0HB 1R8BA 3LPYA 4C97A 4U3DA 2YY3A 4NCBA 4P10A 4AIMA 5F0UA 4LF8J 4WU2A 5F8GA 3L9ZA 5GVQA 5D4OA 4EUVA 3HP6A 3ONQA 5DDOC 1IJFB 2DGXA 2ZBQA 2MQLA 2YXLA 3K5PA 2CDQA 1XMQF 3KHGA 4GC6A 1J27A 1BD6A 4IH7A 3DRYA 3K59A 3V4MA 4F25A 5KFPA 3CCTA 3DRXA 2W9BB 5B0FA 4RW8B 4DV2E 2GFFA 4M1KA 4PQUA 3PY8A 5L39A 3GYXB 3I56S 1RBOB 3M85D 4RLEA 2RH3A 2K7JA 2XMJA 4ILLA 1HBUB 3NZKA 4KB7A 4FW5A 2DR9A 4UUWA 4OYWA 3RAXA 2FVRA 2NSBA 5EDWA 3TA0A 1S0OA 1CJVA 1FWPA 1ZOTA 2V2QA 5A2QY 4BLGA 1FE0A 1ZTTA 2KM8B 2LFVA 2XTJP 3OTOF 4PWDB 5A76A 4O44A 1LWEA 3BSAA 1HNWE 2CPZA 3OBIA 4C0BA 3UPFA 1JNZB 4HHHA 2IIHA 4URGA 4EZ9A 4NMLA 2OELA 2YNFB 2RS8A 4FPRA 3GZ7A 1QAIA 4X62E 1N56A 3OVSA 4NA2A 2VBZA 2RQMA 1IBLE 1P9YA 4J91A 4PWUA 4RNNA 4NLSA 1HQEA 2BEFA 4WK1A 1T9UA 2W8LA 2ZBIA 4USJC 3KLHB 2FJVA 3MDFA 4JI3F 5LL6R 1PC5A 3LPEA 4ZVEA 3MR5A 4JI8F 3W65A 2MMYA 3W63A 3GFXA 1NSPA 1WG1A 2JEJA 2JNJA 1EJ7L 2IM1A 2UXCF 2GGPB 4X4RA 4CTAB 4FW6A 5HJXA 4V1Ak 1RK8A 1UETA 2UUBE 4QU6A 1H6KX 1S1UA 1JXLA 4UF4A 2J6TA 4O3NA 4NXME 3EDQB 4I1TA 5LXYA 1XMQE 5K36C 3MOJB 1HD1A 3D1QA 1XERA 5B7WA 3NNAA 3R27A 1B0TA 4FP9A 1HIYA 3V81A 2C37A 2E5JA 4DLGA 2W9CB 3TJAA 3TX8A 1RAEB 2CQIA 1Z5AA 4FBTA 2VOOA 1CJTB 3FK4A 4FYDA 2PA3A 3SYZA 2B4VA 1G6BA 1HW9A 4DR6E 2CUYA 2Y8WA 1F3FA 2PMZD 3RB0A 3ULHA 4DPXA 2C2OB 2E44A 2HS4A 4LF4F 4GVBA 1RU1A 1U45A 4WFNQ 4FYXB 2VG6B 1EQ0A 2HFVA 2KU7A 1UTAA 4DL3A 5HLFB 3UDVA 2HNZA 1MROA 1VJQA 1Q1KA 5K20B 2V2VA 2VFSA 5IT9Y 5KFRA 3H2LA 5GMDA 1VQNS 4UQGA 2XLIA 4QW9A 4TYBA 4JI2I 1CQMA 3BSCA 3V6JA 4JV1A 2DCLA 2H4WB 2P2CB 3TI0A 3AH6A 1L5UA 2DXFA 3PZPA 2EI5A 1BY9A 4CNZA 4WE1B 2IBOA 1R7IA 4DUYJ 4FYWB 4RW6B 3M8PB 3M2UA 2F8EX 1FEHA 3KNGA 4JI5E 4CWBA 3SEOA 4NI2B 2KTQA 2GJ2A 3KK3B 3X1LB 2O67A 4WJBA 1XNRF 1WHWA 2GQ2A 3Q89A 4OX9J 4NE9C 4Y2KA 1NJZA 1R3NA 5C42A 2E1RA 3CMES 4OX7A 2LECA 3CCZA 2CNNB 4RPFA 3W9HA 2JX2A 2VG7A 1S1VA 3CMQA 1FFWB 3DRSA 4P6QA 5ETMA 1VQ4S 4WIQA 3IR6B 5DGAA 3KLFA 2BABA 2ADBA 4WPAA 3AQPA 5J2NB 2RS2A 3HHLA 4X64E 3M7VA 1Y60A 4S0MA 2L41A 4X4QA 1LWXA 3K2YA 4N76A 4X84A 5L1KA 5K9FA 3HSZA 1U1NA 4USWA 1VC0A 2WVDA 4LF9I 5SUHA 4QWDA 4CLWA 2YKNB 3NCRA 2XG8A 5L1JA 4C8YA 1U8WA 2YPYA 2EXUA 1MW7A 1B62A 4DR3J 4HI2A 3GFHA 4E98A 4LCGA 1N32E 4DR7F 2JLFA 4MKYA 3NGUA 4LF5J 3OLBA 1JMTA 3FJ2A 4CRJA 2DH9A 1RADB 1SKRA 2CPFA 2ADCA 3CT9A 1TTHB 4EU0A 1RISA 2H9ZA 1IBMI 3M9OB 1FKOA 5HSPA 3TVYA 4M95A 3MEDA 2OPQB 1U25A 3V2UC 3KHHA 1Q7LB 3VTIA 3ZKDA 5DS7A 3CE8A 4NBQA 4NL5A 1OYRA 4DSEA 1RLCL 4M94A 1WF2A 1S6UA 5DLGA 3FGVA 4KIAA 4X2BA 4P7TA 4TU9A 4ED6A 1HPZB 3MAAB 2ALYB 1TKTA 3MEGA 1J5OB 2HLTA 4QYZK 2UUAI 2J0SD 4DWIA 4RJVA 5FDLA 1IUJA 3AB2B 2R9LA 3OFFA 1IR1A 4CDIA 1SL1A 3MR6A 3JSMA 1X60A 3KMQA 2MKSA 3PW2A 2G0IA 3B78A 4ZPWR 3ZM7A 3CCVS 2JH3A 5C25A 3NWGA 5K14A 1JNRB 5KFAA 1B63A 3DLGB 4X4OA 2VG5B 3NXZA 5E5NA 4F7VA 3TVZA 1YZ7A 3DGPB 1Y6ZA 4MT1A 4GKJE 2E9ZA 1EARA 2BJDA 1GAOA 1C1BA 3W5YA 4ZVOB 5B0DA 1NK5A 1UEVA 4FKYA 3M9NB 2E9TA 3MMAA 4UY8T 2P8IA 1HK7A 2J6UA 1FKAF 2XNRA 2GIRA 3PEHA 2FLPA 1AZSA 1PAEX 3HHKA 2UU9E 4IOBA 1ICEB 5D15A 1WJ9A 5H1SV 2CZ9A 1SH0A 3BGFA 2NN6C 1NDCA 3DM2A 3KFWX 5J1PA 2AJQA 2H1YA 3WX8A 1NAQA 2R7SA 3DOMA 2E9RX 3T1AA 3IXQA 1YG0A 2X1GA 1JXVA 4JV2A 1BQNA 2MQOA 3H0PA 2MQPA 3JSYA 2V4JA 1FRHA 2PNZB 3M05A 4IZKA 1FX4A 5JMNA 2O1WA 3ETMA 2PN6A 4QYZJ 1CQNA 3EX7B 4M63A 4I0WA 4PQUB 4CLKA 2M7SA 4LVNP 4JG4A 1U24A 1WD6A 4N41A 4C8OA 3OJUA 3CCWA 3UCUP 3PX0A 4I64A 5JEAC 2HGNA 1CJVB 1YJ9S 1VR6A 3WIVA 1R89A 1N33F 2CKWA 3AD8C 4JI0F 2FC8A 2C2EA 2AF6A 2C39A 3GTYX 1MX0A 4O44B 1LWEB 5I3QA 4DR4I 2PEHA 2Z30B 1F9FA 4XPCA 1KIJA 3PW4A 3WU3A 4YB5A 5K8OA 2W2QP 3TQ1A 4DFJA 1RTZA 5GAHU 3GSDA 1X4DA 2KFYA 4N3OA 2XY7A 4B3SJ 1YJ7A 2BACA 1AA1B 2WW4A 2R8GA 1RYRA 1HQEB 2JHEA 2AJ0A 3K7RA 1IKVA 2BJ3A 4QWEA 3PRYA 1YRTA 4KHPI 3BYRA 2HHWA 4DV1J 2B56A 3PRDA 4JI2F 3B6BA 2ZH8A 4CO5A 1VIXA 1X4CA 3CDEA 1X4HA 4ANCA 3NY0A 4LCHA 4ZP6A 1M5VC 1RT5A 4WP8A 4NA3A 4CO1A 1K1QA 4Q0BA 1NK4A 2HVIA 1S1UB 2HQDA 3A12A 4GO5X 2PO2A 1T9VA 4XK8C 3CPWR 1EIYB 3OHBA 3GV7B 4J9RA 5KT4A 3OVAA 2FJEB 4QIEA 1FNOA 3MEEA 1OPZA 1QDUB 1YLXA 3KRNA 2HHTA 5CCLA 1D9AA 1IKYA 2HRUA 4ZKAA 2MGZA 2D3OR 3CDAA 4GMKA 4NXNE 4FPIA 1LFWA 4DF8A 4TQRA 4JI7I 4F4AA 2ZWPA 4DG1B 2BA0G 2ZBKB 1D3WA 3SXLA 2Q43A 4GVBB 3NGTA 2UVUA 5F8HA 4M5MA 1N88A 1SC3B 1N34J 1TMJA 2BZ2A 4UZCA 1SKWA 4C3KA 4Z7YA 2PFFB 1NUEA 1MROB 4DDFA 1Q7YT 4DV5I 4DCOB 4K4WA 1A7GE 4Q43A 4OMFG 4LSLA 1NSQA 1NDPA 2ZH4A 2BE2A 3W2VA 3FNNA 3FCHA 4LBHA 5DDPC 1Z0VA 3ZO7A 5DRQA 4OFZA 2QSFA 5A8KA 1S79A 3M2RB 1T7PA 1C4CA 2GCFA 4I69A 5KFEA 3FUYA 1GXUA 5LMNF 4E2FB 1XIQA 4CLZA 1IBMF 3PO5A 2XCPA 1WEXA 3C3LA 3CJ3A 4WTYA 4JI2E 1YI2S 3UD3P 2Q1LA 4WK3A 5C42B 2OPPA 3TP2A 4USTA 3VAMA 3NCPA 1U09A 3W8GA 5K5MA 3FCVA 2VG7B 1S1VB 3QQCD 3PKYA 4ZP9A 1IBKJ 1TL1B 3RBXA 5CYQA 4HY1A 2ZH9A 2XQCA 4DBQA 2UUAF 3DOLA 2C3MA 4IOAQ 4MAKA 2QLJB 3VHQA 4IG0A 5CYMA 1L3KA 4YFUA 4MKVA 1S1WA 1T95A 2O1VA 1SJRA 2VIHA 1W7WA 3HHLB 2IOPA 1TFWA 5HROB 3QLHA 3G8SA 4B17A 3T1YI 1Y7PA 1V5VA 2DHAA 4J9SA 2PO0B 3K1JA 4WYWA 1M5SA 1ZA2B 4DR1I 2X7IA 3VV2B 1EB0A 4BWJA 3CXCR 2VBWA 3WHIA 3QPIA 3ENWA 2DVIA 4RBTA 4I56A 2IFXA 4K4SA 1RUSA 1U49A 3H5XA 3US5A 2R7UA 1RBLA 1S1XB 1I94I 1T9YA 2F4VJ 4L75A 4C3LA 1NH8A 5A6WA 4ZCIA 2HS0A 3M32A 2KJWA 4LF9E 3UCGA 5KTQA 2OEJA 1FKOB 2LEBA 3MEDB 4YDXA 4RUBA 2JZ5A 4IFDA 2LQBA 3EVMA 1VLYA 4QIFA 2PMHA 2Z2ZA 1MLAA 4I6AA 4AUKA 3C16A 2E7VA 2JE6A 2EFGA 3RAQA 2EFPA 3SZ2A 2H5JB 3UNGC 3SQGA 1WTFA 4DEZA 2EPIA 3NBPA 3MEGB 5C0XD 2Z58B 5FDLB 4I2PA 1FRKA 4J3DA 3C15A 3QBCA 4Q8FA 2ZBPA 2DGTA 3JSMB 4OI3A 5ELWA 3I87A 5E3AA 5ETLA 2ZEJA 3EXYA 5H9FK 3DLLQ 3D5MA 2IC3B 1N52B 5AXMA 3R97A 5K14B 2ILZA 2OMOA 1SQFA 3VAFA 4DSLA 2I8EA 4MMOA 2I5JB 2ZDPA 4ICLA 4UZBA 1KDNA 2AGOA 1C1BB 2MZTA 2QTWA 3TR5A 2UUAE 4ZITA 1FD8A 3MFHA 4PPDA 2UXDE 4QU7A 3MMAB 4DR4F 4DV2J 1U2CA 2GQQA 2BR0A 3JTOA 3SV4A 4C7QA 1AZSB 4ECQA
chains in the Genus database with same CATH topology
4KHPI 3PYEA 4FWHA 4DR7E 4JV5E 4PU9A 1Z0WA 3PYDA 4LF6E 4DR6I 4LFAI 4LF7E 2IOQA 2XEXA 3K85A 1QZRA 1Z0BA 4JI5E 3QT5A 1USUA 5FLXC 1NZ0A 1PKPA 4GKJI 4X62I 5IWAE 1KKHA 2V34A 1HNXE 1FJGI 2E1RA 4DR5E 1ELOA 4P52A 1N33I 2V2ZA 4JI0I 4B3RI 2Z5EA 4DUYE 4RPFA 4LF4I 4DV5E 2F4VE 1ZM2A 4JI1I 5LMUI 1MU5A 1N0UA 4DR1E 4X65E 4IZKB 3JAMC 4PRVA 4X66I 1H74A 4R1FA 2HHHE 4JI4I 1WUUA 5BR8I 3WU5A 2ZM6E 2UXDI 4DU8A 4JI6I 2E5LE 2R42A 5LMNE 1IBME 4WUCA 4KQVA 1EA6A 1KVKA 4DR3I 4DPWA 2A2DA 4LFCI 4X64E 3J81C 1D6TA 4WUBA 4USKA 4B3TI 4LF8I 4DXLA 3LTOA 4NXNE 2A2CA 3ZZ0A 4JV5I 1ZM4A 4YY3I 3OTOE 4GKKI 1EI1A 4HXZA 4DPYA 4JI7I 1HR0I 5FLXQ 4HYMA 4LF9I 1ZM3A 4NXMI 4DV6I 1B62A 2ZBKB 1Z59A 1XMQI 3QT7A 1HNXI 2Z5CA 4HACA 4UT4A 1N32E 4Z7YA 4DV0E 1FNMA 2BM1A 1H72C 4DV5I 1XMOE 4DV7I 2F4VI 1VISA 5A2QC 4P7AA 3JAMQ 4X65I 1Y4UA 5GMEA 1XHKA 4FWDA 2HHHI 4JYAE 3ZZTA 3H4LA 1XNQE 1OJ4A 2ZM6I 2Z5CB 1FKAE 5FWKA 2E5LI 1HNZI 2Z5BA 4LFBE 3WU6A 1S4EA 4B3SE 2DEJA 1IBMI 2NPFA 5L3JA 4MYTA 3J81Q 3V2UC 4JI3E 4X64I 1UEKA 1Z0VA 4AQYI 4DV2E 2HKJA 4DR4E 4M1KA 4YHHI 3ZKDA 3HULA 1USVA 2VQEE 4NXNI 2VF3A 2UUCE 3OTOI 4JI8E 3T1YE 1RR9A 2Z5BB 4DR2I 1FWKA 2UXBI 1IBKI 2UXCE 2HK2A 3B82A 1Z0EA 4DV1E 4FWGA 2V2QA 4JI2E 2UUAI 5IT9C 2ZITA 2O1TA 3T1HI 2OI2A 4ZVIA 1ZXNA 4OX9E 1ZXMA 2CG9A 5A2QQ 1XMOI 3Q1QA 1HNWE 4DV4I 3B78A 1I94E 1Y4SA 3ZZUA 3GONA 4FN5A 3ZM7A 4DR7I 4HY1A 4LFAE 4K0KE 4LF6I 2J7KA 4XTJA 1B63A 4LF7I 1PIEA 4B3SI 2HFUA 2HKEA 2HK3A 4JI5I 3V5RA 1Y6ZA 4GKJE 4JI3I 4X62E 2O1VA 2DEIA 1N36E 2VQFE 4DV2I 3Q6MA 2IOPA 5IWAI 1FJGE 2R3VA 1IBLE 2UUCI 2V8PA 1N33E 4DR5I 1S16A 1HK7A 4MYUA 3T1YI 4JI0E 2Q2EB 4B3RE 3D4JA 1N0VC 1Z0GA 4LF4E 4DUYI 3K1JA 4B3ME 4JI1E 1FI4A 4DUZE 3Q6NA 2UXCI 2LJPA 3J80C 4DR1I 3QT6A 2X7IA 4FW9A 4DV1I 4I3HA 2UU9E 3PYFA 2BV3A 2BM0A 5LL6R 1Z5BA 1NHJA 4HACB 3HJCA 2CZ9A 4PRXA 3K17A 5LMNI 1U2RA 4OX9I 4DR3E 4DV3E 4DPTA 4LFCE 1BKNA 2CGEA 1N34E 3P06A 1HNWI 3M6AA 4B3TE 4LF8E 1I94I 4LF5E 4IZJA 4YY3E 4GKKE 4K0KI 4JI7E 1HR0E 2UUBE 1ZM9A 4LF9E 4IZKA 4NXME 2O1WA 4DV6E 3LPSA 1N36I 4ED4A 2VQFI 1XMQE 1J5EE 1A6FA 1DARA 1IBLI 4IZJB 1H73A 4Z7CA 4UTGA 1N32I 3QT8A 4JG4A 4DV0I 1XNRE 4DV7E 4B3MI 3J80Q 2EFGA 4DUZI 1Z5AA 2O1UA 1Z5CA 3J7AM 4KHPE 4DPUA 2UU9I 4JYAI 1XNQI 3PYGA 4DR6E 1HNZE 2GS8A 4LFBI 4DPXA 1FWLA 2X36A 4DV3I 1N34I 4AQYE 2AJ4A 1MX0A 4YHHE 4URLA 3J7AG 4DU7A 4DR4I 1H7UA 1RREA 4LF5I 4USMA 3WU4A 2VQEI 1KIJA 1MG7A 2HFSA 3WU3A 4JI8I 2UUBI 1H7SA 3B8HA 2V2VA 4DR2E 1Z0TA 2UXBE 1IBKE 5GMDA 5LMUE 4N3OA 4EMDA 3LNUA 2GQ0A 2PNMA 4X66E 1KTVA 1NHHA 1NHIA 1K47A 1J5EI 3CWVA 2UUAE 4JI4E 5IT9Q 5BR8E 4JI2I 3T1HE 2UXDE 2WW4A 4JI6E 1PVGA 2PNLA 1XNRI 4WUDA 3ZKBA 1Z0CA 4IZJD 3PRYA 4DV4E 3F0NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP I;  3PYE A;  4FWH A;  4DR7 E;  4JV5 E;  4PU9 A;  1Z0W A;  3PYD A;  4LF6 E;  4DR6 I;  4LFA I;  4LF7 E;  2XEX A;  1QZR A;  1Z0B A;  4JI5 E;  3QT5 A;  5FLX C;  1NZ0 A;  1PKP A;  4GKJ I;  4X62 I;  5IWA E;  1KKH A;  2V34 A;  1HNX E;  1FJG I;  2E1R A;  4DR5 E;  1ELO A;  4P52 A;  1N33 I;  2V2Z A;  4JI0 I;  4B3R I;  4DUY E;  4RPF A;  4LF4 I;  4DV5 E;  2F4V E;  1ZM2 A;  4JI1 I;  5LMU I;  1MU5 A;  1N0U A;  4DR1 E;  4X65 E;  3JAM C;  4PRV A;  4X66 I;  1H74 A;  4R1F A;  2HHH E;  4JI4 I;  1WUU A;  5BR8 I;  3WU5 A;  2ZM6 E;  2UXD I;  4DU8 A;  4JI6 I;  2E5L E;  2R42 A;  5LMN E;  1IBM E;  4WUC A;  4KQV A;  1EA6 A;  1KVK A;  4DR3 I;  4DPW A;  2A2D A;  4LFC I;  4X64 E;  3J81 C;  1D6T A;  4WUB A;  4USK A;  4B3T I;  4LF8 I;  4DXL A;  3LTO A;  4NXN E;  2A2C A;  3ZZ0 A;  4JV5 I;  1ZM4 A;  4YY3 I;  3OTO E;  4GKK I;  1EI1 A;  4HXZ A;  4DPY A;  4JI7 I;  1HR0 I;  5FLX Q;  4HYM A;  4LF9 I;  1ZM3 A;  4NXM I;  4DV6 I;  1B62 A;  2ZBK B;  1Z59 A;  1XMQ I;  3QT7 A;  1HNX I;  4HAC A;  4UT4 A;  1N32 E;  4Z7Y A;  4DV0 E;  1FNM A;  2BM1 A;  1H72 C;  4DV5 I;  1XMO E;  4DV7 I;  2F4V I;  1VIS A;  5A2Q C;  4P7A A;  3JAM Q;  4X65 I;  5GME A;  1XHK A;  4FWD A;  2HHH I;  4JYA E;  3ZZT A;  3H4L A;  1XNQ E;  1OJ4 A;  2ZM6 I;  1FKA E;  2E5L I;  1HNZ I;  4LFB E;  3WU6 A;  1S4E A;  4B3S E;  2DEJ A;  1IBM I;  2NPF A;  5L3J A;  4MYT A;  3J81 Q;  3V2U C;  4JI3 E;  4X64 I;  1UEK A;  1Z0V A;  4AQY I;  4DV2 E;  2HKJ A;  4DR4 E;  4M1K A;  4YHH I;  3ZKD A;  3HUL A;  2VQE E;  4NXN I;  2VF3 A;  2UUC E;  3OTO I;  4JI8 E;  3T1Y E;  1RR9 A;  4DR2 I;  1FWK A;  2UXB I;  1IBK I;  2UXC E;  2HK2 A;  3B82 A;  1Z0E A;  4DV1 E;  4FWG A;  2V2Q A;  4JI2 E;  2UUA I;  5IT9 C;  2ZIT A;  3T1H I;  2OI2 A;  4ZVI A;  1ZXN A;  4OX9 E;  1ZXM A;  5A2Q Q;  1XMO I;  3Q1Q A;  1HNW E;  4DV4 I;  3B78 A;  1I94 E;  3ZZU A;  3GON A;  4FN5 A;  3ZM7 A;  4DR7 I;  4HY1 A;  4LFA E;  4K0K E;  4LF6 I;  2J7K A;  4XTJ A;  1B63 A;  4LF7 I;  1PIE A;  4B3S I;  2HFU A;  2HKE A;  2HK3 A;  4JI5 I;  3V5R A;  4GKJ E;  4JI3 I;  4X62 E;  2DEI A;  1N36 E;  2VQF E;  4DV2 I;  5IWA I;  1FJG E;  2R3V A;  1IBL E;  2UUC I;  2V8P A;  1N33 E;  4DR5 I;  1S16 A;  4MYU A;  3T1Y I;  4JI0 E;  2Q2E B;  4B3R E;  3D4J A;  1N0V C;  1Z0G A;  4LF4 E;  4DUY I;  3K1J A;  4B3M E;  4JI1 E;  1FI4 A;  4DUZ E;  2UXC I;  2LJP A;  3J80 C;  4DR1 I;  3QT6 A;  2X7I A;  4FW9 A;  4DV1 I;  4I3H A;  2UU9 E;  3PYF A;  2BV3 A;  2BM0 A;  5LL6 R;  1Z5B A;  1NHJ A;  4HAC B;  2CZ9 A;  4PRX A;  3K17 A;  5LMN I;  1U2R A;  4OX9 I;  4DR3 E;  4DV3 E;  4DPT A;  4LFC E;  1BKN A;  1N34 E;  1HNW I;  3M6A A;  4B3T E;  4LF8 E;  1I94 I;  4LF5 E;  4YY3 E;  4GKK E;  4K0K I;  4JI7 E;  1HR0 E;  2UUB E;  1ZM9 A;  4LF9 E;  4NXM E;  4DV6 E;  3LPS A;  1N36 I;  4ED4 A;  2VQF I;  1XMQ E;  1J5E E;  1A6F A;  1DAR A;  1IBL I;  1H73 A;  4Z7C A;  4UTG A;  1N32 I;  3QT8 A;  4JG4 A;  4DV0 I;  1XNR E;  4DV7 E;  4B3M I;  3J80 Q;  2EFG A;  4DUZ I;  1Z5A A;  1Z5C A;  3J7A M;  4KHP E;  4DPU A;  2UU9 I;  4JYA I;  1XNQ I;  3PYG A;  4DR6 E;  1HNZ E;  2GS8 A;  4LFB I;  4DPX A;  1FWL A;  2X36 A;  4DV3 I;  1N34 I;  4AQY E;  2AJ4 A;  1MX0 A;  4YHH E;  4URL A;  3J7A G;  4DU7 A;  4DR4 I;  1H7U A;  1RRE A;  4LF5 I;  4USM A;  3WU4 A;  2VQE I;  1KIJ A;  1MG7 A;  2HFS A;  3WU3 A;  4JI8 I;  2UUB I;  1H7S A;  3B8H A;  2V2V A;  4DR2 E;  1Z0T A;  2UXB E;  1IBK E;  5GMD A;  5LMU E;  4EMD A;  3LNU A;  4X66 E;  1KTV A;  1NHH A;  1NHI A;  1K47 A;  1J5E I;  3CWV A;  2UUA E;  4JI4 E;  5IT9 Q;  5BR8 E;  4JI2 I;  3T1H E;  2UXD E;  2WW4 A;  4JI6 E;  1PVG A;  1XNR I;  4WUD A;  3ZKB A;  1Z0C A;  4DV4 E;  3F0N A; 
#chains in the Genus database with same CATH topology
 1CLF A;  2CQ3 A;  5C7P A;  3W64 A;  1HW8 A;  1NU4 A;  4ZPA A;  1V6H A;  3VAK A;  3R2C J;  3Q0A A;  2PC6 A;  2H3E B;  4HKQ A;  1VS3 A;  2YQ0 A;  2KRB A;  2RDI A;  2FC9 A;  5DO2 A;  3DM2 B;  1HNX E;  1DY3 A;  2FY1 A;  1JJH A;  4KHP F;  4TNO A;  1HHT P;  2P6T A;  3DOM B;  1HNW J;  1NPK A;  3CIM A;  3R5J B;  2X3D A;  5BXI A;  1KQG B;  1BQN B;  1ZM2 A;  1UL3 A;  2V4J B;  3AFG A;  4IZK B;  3CUN A;  4DJB A;  1FER A;  2V68 A;  3I0S B;  1V3S A;  5LXR A;  4DSI A;  4X62 J;  4YHH F;  4B9S A;  2E5L E;  2R42 A;  5HMZ A;  1UDS A;  2DGW A;  5KOX A;  1IBL J;  1NZA A;  3OR1 B;  1DQ9 A;  4KO0 A;  5ETO A;  3MCN A;  3GJT B;  5HVH A;  4B9M A;  2B43 A;  5FLX Y;  4DV0 J;  4WUB A;  4B3T I;  5H9F J;  2QX0 A;  3D3C J;  3PXG a;  4CM0 A;  1ZM4 A;  2NQP A;  3DD6 A;  2JVR A;  3QAE A;  3IBF B;  4DPY A;  5ADZ A;  2YVS A;  5H9E K;  2DH7 A;  1GQE A;  3GCX P;  5G0R A;  1DZ5 A;  4LFB J;  2LEA A;  2A0F B;  2C39 B;  3CCS S;  2Z5C A;  1L3V A;  2BJ7 A;  4M5I A;  3SCJ E;  7FD1 A;  2VPY B;  4OYO A;  2MQQ A;  2QYG A;  1XJW B;  4LF7 F;  4JI7 F;  4IYQ A;  3R7S B;  1YGY A;  2UUB J;  2CQ4 A;  4XIU A;  3C2P A;  3J81 Y;  4NXM J;  3UFC X;  1XMQ J;  2AZ1 A;  1AFJ A;  4DR5 F;  3D6T B;  1T0T V;  3A8K A;  3CB4 A;  3I96 A;  4OO1 E;  3U1K A;  4DV5 F;  3HT3 A;  4DR4 E;  4M5G A;  2UUW A;  3J7Z 5;  3W9I A;  1EX8 A;  2E1C A;  2Z5B B;  5KFG A;  4DR2 I;  4QOT A;  1W26 A;  4DR6 J;  2UXB I;  4ZLJ A;  1P1L A;  4CLP A;  3PIP Q;  1VC5 A;  5E3Q A;  1MNE A;  2M88 A;  1KFS A;  2PI5 A;  1JKH A;  3D0I E;  3T1H I;  3NS7 B;  5D77 A;  2IMW P;  2DGO A;  5I4M A;  1AUS L;  1RT5 B;  1BLU A;  4BCA A;  3G9C A;  4Q0B B;  5A2Q Q;  4BC7 A;  4FF2 A;  2DHG A;  4F4Z A;  4LQ9 A;  3ZTS A;  2PO2 B;  2CQB A;  1YWX A;  4XDD A;  5H9E J;  1FES A;  3ZZR A;  2BUN A;  3MEE B;  2H4Y B;  3A3N B;  3V5R A;  1WF0 A;  3VVU A;  1OY9 A;  1F9H A;  1IKY B;  4ZCL A;  2DHS A;  3W9J A;  2MGZ B;  4RW4 B;  1YHQ S;  2E66 A;  5AJ3 J;  2PFD A;  4WKY A;  4DUY I;  1Q5V A;  1FI4 A;  3D0H E;  1FKP B;  2WP8 B;  4Z2X A;  4JI5 J;  3CIZ A;  3D66 A;  3ILO A;  4J9V A;  1NHJ A;  2G2Z A;  1RHR B;  2GVD B;  3OV7 A;  3WDO A;  3T1Y F;  5GAG U;  4OX9 I;  1KWM A;  2D3U A;  3WX4 A;  1X9S A;  3VAG A;  4NMX A;  3C66 A;  1VJW A;  4JI7 E;  2BE2 B;  1ZAW A;  2CPE A;  1K0T A;  2G9O A;  2YKA A;  3W2V B;  5D3G B;  5F9L A;  1SB6 A;  3IR5 B;  4R0J A;  4JV0 A;  3LPS A;  1WF1 A;  4QCL A;  1Q86 T;  1NK0 A;  1J5E E;  1REV A;  4OO1 C;  1YJR A;  4X64 J;  2R8J A;  1I94 F;  1X4F A;  4OJ1 A;  3GFZ A;  3CJK A;  2FVP A;  1X5P A;  2HIY A;  2NCK L;  1RI7 A;  3MPD A;  4NLQ A;  4CO4 A;  3MR3 A;  2J0Q D;  4DPU A;  3NRB A;  3PYG A;  3HJF A;  1F5B A;  1TKZ B;  2OPP B;  3B4D A;  1RAG B;  1IJE B;  3KK2 A;  1N32 J;  1E6V A;  2G2O A;  1GEH A;  2M8D B;  4URL A;  3ET6 A;  1H7U A;  4ETX A;  4LF5 I;  3P5B P;  2VQE I;  3W1Y C;  5CYQ B;  1UVN A;  4OLP A;  2XS7 A;  2HG4 A;  3DOL B;  2C3U A;  4G1Q A;  2M0G B;  3QRP A;  5LMU E;  1UAW A;  3T5J A;  4IG0 B;  4B9L A;  2YWF A;  1S1W B;  1Q16 B;  1KTV A;  3DLK A;  5IT9 Q;  4KT0 C;  5BR8 E;  2F1D A;  5HQM A;  4LF8 F;  2V8V A;  5BYR A;  1U1Q A;  5DRP A;  2APO A;  3LAL A;  4O4G B;  3CED A;  1X9W A;  3HXM A;  3TEH B;  1TU0 B;  2RKI A;  1TL4 A;  2DJW A;  4NLX A;  2XYP B;  2AEM A;  4JV5 E;  2ZC4 A;  2N4C A;  5LM7 E;  4F36 A;  1X9M A;  1WG5 A;  2OAU A;  4QWB A;  1TAQ A;  5D0G A;  3AAW B;  3L7O A;  2CYY A;  4TLR A;  1UWB A;  2EG1 A;  3NEK A;  2VH7 A;  4F0M A;  3DLH A;  3M6W A;  3TUI C;  3M32 B;  4JI1 I;  2P9C A;  4DR1 E;  1RU2 A;  1H74 A;  1WUU A;  2FPH X;  4GKJ J;  2JOQ A;  2ZM6 E;  3O1L A;  5KFI A;  3FBE A;  5MLC V;  4BBY A;  1CS4 B;  5JVH Q;  4OHY A;  2ZWO A;  4J5O A;  1BGX T;  3IS9 A;  2JRS A;  2OO4 A;  1KHV A;  4GC7 A;  3SQG B;  2BRL A;  4P9S A;  4IR9 A;  1GNK A;  1PKU A;  3U1M A;  2UU9 J;  2KB2 A;  1HR0 I;  4H4M A;  3KLV A;  4ZVS B;  2NSC A;  1H2V Z;  4IFY A;  3NCQ A;  4HYM A;  1NME B;  4I2P B;  2Z56 B;  3CD5 A;  3C15 B;  1NO8 A;  1X0P A;  2AYB A;  2MQN A;  4B3T F;  3M8W A;  3UDC A;  5D6G A;  2IJR A;  1FNM A;  3MD1 A;  4I68 A;  3N6L A;  4P2S A;  3GIK A;  3TRG A;  5JUM A;  1Y4U A;  4ICL B;  2M8H A;  1SKS A;  3O2I A;  1R6V A;  3WU6 A;  2AEJ A;  4K4Z A;  5L3J A;  2D3O 1;  2FJB B;  3V6D B;  1UEK A;  3N6M A;  3TVK A;  2BW7 A;  3BRE A;  1QAY A;  2J76 E;  4AT1 B;  4CO0 A;  1LXJ A;  2V8H A;  1KNZ A;  1LXN A;  1SJ3 P;  1FWK A;  1RT4 B;  1U2F A;  1UA1 A;  4C8M A;  2LU1 A;  1SJF A;  3MUV P;  3R6L B;  5CCM A;  3Q22 A;  1TEL A;  4PG5 A;  1YTY A;  1M1H A;  1X4B A;  2B51 A;  4MKA A;  4LUB A;  2BE7 D;  3HZE A;  1NB7 A;  2KFN A;  2ABY A;  2Z4P A;  3U1L A;  4DV4 I;  1UP1 A;  1U1M A;  2YH1 A;  5KT5 A;  3K58 A;  3NKY A;  4U96 A;  4ZHR A;  1F2H A;  4B3S I;  3MPU B;  3M2V A;  3MAQ A;  1F9E B;  1S10 A;  3TAP A;  2VKZ G;  2KYX A;  1I51 B;  3R1H A;  3O5T B;  2QSW A;  1O51 A;  4A8X A;  2YKO A;  3BBC A;  3DU6 A;  1S16 A;  1R6Y A;  1HNV B;  3EPG A;  2LKZ A;  1N0V C;  1KBR A;  3TOQ A;  3P8B B;  1JJC B;  5G0R B;  2HZA A;  1S97 A;  4U3B A;  1E6Y A;  4DV1 I;  5A8W A;  4FS1 A;  5K36 A;  5KFY A;  1YKW A;  2O01 C;  1Q8L A;  3PYF A;  4J9L A;  1Z5B A;  2E7X A;  4ITS A;  3OTB A;  3BSO A;  1U2R A;  5MAO A;  2QEX S;  2H5E A;  4DUY F;  3P06 A;  2ZOM A;  2PDA A;  3M6A A;  4B3T E;  3IA0 A;  1R8H A;  1VI7 A;  4IZJ A;  5AT1 B;  4OI6 A;  4GQU A;  4NLV A;  3CD0 A;  1FHT A;  2XB2 D;  4U95 A;  3J7Z T;  1VQY A;  4KGV B;  4C0H A;  4DF4 A;  1VQ8 S;  2XMK A;  3TQE A;  4OX9 F;  3UE2 A;  1KR4 A;  3BEG B;  5ETS A;  1IM6 A;  1F1B B;  4DHV A;  4URS A;  4NXN J;  2ZOG A;  5T7L A;  1SVD A;  2CDR B;  2OSR A;  2CVI A;  3FRZ A;  3R1L A;  3R5A A;  2O1U A;  2W4C A;  3UWT A;  4JUZ A;  3EMT A;  1Y5Y A;  5BYS A;  2A6M A;  5DZ7 A;  2KT5 A;  1JKH B;  1LFP A;  3P6Y C;  3D68 A;  4EI2 A;  1WHY A;  5J1E B;  1VQK S;  3SMZ A;  2NZ4 A;  3AY0 A;  1N34 I;  2LQ5 A;  4KBI A;  5D4L A;  4HHU A;  4MU3 A;  3BO4 A;  3G82 B;  2VBY A;  4DFP A;  2ZHB A;  3UR0 A;  5IS2 A;  3PS3 A;  4DR2 E;  2UXB E;  4C48 A;  4PCQ A;  5J2P A;  4DR3 F;  3P96 A;  2PNM A;  4X66 E;  2G0J A;  3T1H E;  1YBT A;  4LF5 F;  1WI6 A;  2VQE F;  2PSZ A;  5I42 A;  1RT2 A;  3I9V 9;  4WZM A;  2ROP A;  5KG1 A;  2GQC A;  5KT3 A;  2BXJ A;  3U7J A;  1QAX A;  5IC4 B;  4NLY A;  1B70 B;  2HVE A;  2A18 A;  4PQA A;  4IKA A;  3EZU A;  3MHY A;  5D4N A;  1FFS B;  1UFL A;  3TYT A;  3H5S A;  2HFO A;  3L3C A;  4YP3 A;  2IRX A;  2EK6 A;  3AD7 C;  2DNN A;  4OI2 A;  4C11 B;  2V69 A;  1UVI A;  3U02 A;  3EXC X;  2XI3 A;  2M9K A;  5SZT A;  1U1P A;  4OJ3 A;  4N47 A;  3IBW A;  3R2D J;  1KEK A;  4E8U A;  1RWO B;  4DUY E;  3DKD A;  1CJK A;  4NAS A;  3QYY A;  4OZJ A;  2FJX A;  2DO0 A;  2D9P A;  4ID5 A;  4IRC A;  4Y2I A;  3L95 X;  1AUD A;  2IJN A;  1OQ6 A;  5ITH A;  1REV B;  1UVM A;  2EK1 A;  2J6S A;  2JEI A;  4IFD E;  2GO9 A;  1KLN A;  1OYP A;  3PJX A;  1KVK A;  2QLX A;  2L08 A;  3CJK B;  3QSI A;  2AYM A;  1WNE A;  2B4O A;  1RDR A;  2F3J A;  1KSP A;  2MPU A;  1HMV A;  3HX9 A;  3WBZ A;  1JLC A;  1ZAV A;  2ZHA A;  4L72 B;  1YSJ A;  3BB5 A;  3CJQ A;  2EVZ A;  4LF2 A;  3VZH A;  2P9E A;  1Z4U A;  3KK2 B;  2VDH A;  4J9N A;  3Q8Q B;  1FDD A;  2GX8 A;  3RBZ A;  3I5B A;  2IBK A;  4HAC A;  4QWC A;  4HDG A;  3ET6 B;  2QL5 B;  3PW5 A;  2MY7 A;  2X1B A;  3M8S A;  2BM1 A;  4MDT A;  3I0R A;  2M3D A;  4DV7 I;  2F4V I;  1HR0 F;  3P76 A;  5A2Q C;  2UZA A;  2ZNY A;  1HA1 A;  1C0U A;  4LF9 J;  5KT2 A;  1TAU A;  3H4L A;  2IM2 A;  3HD1 A;  3D6H B;  2Z8Q A;  4DN9 A;  1NJI T;  2NPI A;  3FBB A;  1TUV A;  3LOU A;  3H40 A;  1WI8 A;  2AEF A;  1UW4 A;  3G6V A;  1HHS A;  2CPH A;  2HAF A;  1BC6 A;  1KVJ A;  3ISZ A;  2MJU A;  2RKI B;  2VQE E;  3CW2 C;  2M4M A;  2LQJ A;  3M6U A;  1ARO P;  4EBD A;  3BGO P;  4NZ7 A;  2YWK A;  2GHW A;  3PCO B;  1PYO B;  1BWV A;  1F5C A;  4Q44 A;  1UWB B;  2OI2 A;  1SJ1 A;  2COL A;  4ZVI A;  3LWL A;  3FCW A;  1ZH5 A;  2DIU A;  1NDK A;  3B4M A;  1GK8 A;  2Q6C A;  4RUC A;  1NPR A;  5HVF A;  3N01 A;  2M2B A;  1Y3K A;  5KOW A;  2HGL A;  3D28 A;  5EL9 A;  2NN6 A;  2UXD J;  3G86 A;  2EEY A;  4HL9 A;  5J2Q A;  4DX8 H;  2ALZ A;  4DV2 I;  2JL9 A;  1JB0 C;  4KC5 A;  3PO4 A;  4TXS A;  1G3O A;  1OMS A;  3J7A 1;  1DRZ A;  4JI1 E;  4FW7 A;  4B3S F;  2LJP A;  4IFY B;  3MM8 B;  2O5D A;  1L3U A;  2AV5 A;  1VBX A;  4D3G A;  3TUJ C;  2RSQ A;  2ZD1 A;  4DN0 A;  2DBB A;  2CWX A;  2WCX A;  1RCO B;  1M1G A;  2PT0 A;  2XHC A;  1TKD A;  1HNX J;  4PRX A;  4CH0 S;  2E1P A;  4O3S A;  2QGF B;  2QMU B;  4OHZ A;  1HNW I;  2XI2 A;  1IN0 A;  3KDO A;  5JEA A;  1AW0 A;  1SKU B;  4DV1 F;  2GO4 A;  2H65 B;  3MM7 A;  3RBE A;  1RA7 A;  3IO1 A;  1HR0 E;  4R8U A;  2HWI A;  1XXE A;  3LGN A;  3UW1 A;  3NGD A;  3PR5 B;  4YB1 P;  2E5L J;  1LK7 A;  4U67 Q;  4O4R A;  5D78 A;  2Q66 A;  1H2T Z;  4AL7 A;  1KS2 A;  2OPR A;  2I9S A;  2YWE A;  1IBL I;  4G1P A;  1MN7 A;  3HJV A;  5KFM A;  2DNY A;  1NSK L;  2RRB A;  3BKT A;  3LAK A;  1PBA A;  1PCA A;  4DV0 I;  1IQT A;  4UW2 A;  2NRE A;  1RT7 A;  1FX2 A;  1LK5 A;  1RTJ A;  3TUZ C;  5HL7 Q;  1I1G A;  4JYA I;  3C19 A;  3D9B A;  3GR1 A;  2Y8Y A;  2GS8 A;  5IQQ A;  4WP3 A;  5DDR C;  4LFB I;  3AOD A;  2XM3 A;  3NL0 A;  4CH7 A;  2HBQ B;  1T8E A;  3CDW A;  3L7Z A;  2UUB I;  1H7S A;  3GSI A;  2XWY A;  1DUR A;  2J65 A;  4HH1 A;  3TNV A;  2QO3 A;  2GQ0 A;  2XSJ A;  1S1T B;  3OVB A;  4AD6 A;  1K47 A;  4JI4 E;  1N34 F;  2ILY A;  2KZM A;  1TK0 A;  4RWW A;  1G1X A;  3QFW A;  2UV8 G;  4K59 A;  1FDB A;  4DV4 E;  1S99 A;  5A8W B;  5K36 B;  4KPC A;  4DR6 I;  4AL5 A;  5L46 A;  2RD5 C;  3QAT A;  1SV5 A;  5F8J A;  2X1F A;  1NZ0 A;  2NYH A;  5KFL A;  4IO9 Q;  1UPP A;  3DDI A;  4F2S A;  1VQS A;  1LW2 A;  2UUT A;  1F3V A;  5K8M A;  1O5J A;  2CQ2 A;  1SC1 B;  4B3R I;  1KTQ A;  4UOC A;  1WEY A;  4OHV A;  2Y0B B;  3D1H A;  3SI8 A;  4PRV A;  4M5N A;  4RUH A;  2XSF A;  1Q81