3HVAA

Crystal structure of fimx ggdef domain from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
b'VSSQDPVTGLYNRSHFLDLMDAAVQQAVTARKPSTLAYIHLNGYPSLQADHGLSGIDLLLGQLAGLMREQFGEEADLARFGDSIFAALFKGKTPEQAQAALQRLLKKVENHLFELNGRSAQATLSIGVAGLDEKTAKAQDVMNRAHRCADDAARKGGSQIKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein FimX
molecule tags Transferase
source organism Pseudomonas aeruginosa pao1
publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
total genus 53
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvaA00
2CKWA 4PQUA 2OPSB 3QZ7A 2ZKUA 1S1XB 2JC1A 3BREA 1S1TA 3V6JA 3KLEA 1JKHA 4RUCA 4DL7A 3ITHA 3GV7B 3LP0A 3KHGA 5F8NA 3LANA 3H59A 3M8PB 3IGVA 4NCGB 1S1UA 3NGDA 1IKVA 3KMSA 4EYIB 4WXOA 1IKXA 1TKXA 2HNDB 3KLGA 3KLFA 5CYQA 3DI6B 5I42B 4YQWA 4ED1A 1S6PB 3NMAA 3TAMA 1DTTA 3QLHA 2W9BB 5L1IA 4TQSA 3HVWA 2YKMA 1HQUB 2UUWA 4G1QB 2HAIA 4KHRA 4ED7A 3IRXA 4WFXA 3FFIA 3TVKA 3C6UA 1VRUB 4IG3A 2OPQB 1XR6A 4K4UA 5KT6A 4KV8A 4ECUA 4O3RA 1HQEB 5EWGA 2IMWP 3QZ8A 2E9TA 1KLMA 3V4IB 4RW6A 1VRUA 3CJ4A 2V4QA 2DPJA 4IKAA 3KHLA 2HMIA 4LQ3A 2XI3A 3E51A 3N6NA 4ZHRA 4RW7A 3VQSA 1S1VB 1RT6A 5KFVA 3BSNA 4X2BA 1JLAA 1EETB 4K4SA 4Q43A 4U7CA 2AU0A 2UVRA 4LSLB 4MKBA 1FK9A 4O4GA 4J9NA 4NRTA 4R0EA 3EPIA 1IKYB 2B6AA 2WTFA 3DRSB 3V6DA 5K14B 1JLEB 2WOMB 1FKPB 3NBPB 5FDLA 1JLQB 1EETA 3BQ0A 5KG5A 1WNEA 4IG0B 1RTIA 2RDIA 2WHOA 4NCGA 3M9NB 1T94A 3MR2A 3RB6A 4IQXA 3KLIA 5HLFA 4NLSA 5EUHA 5DG8A 3GIIA 2D3UA 4YR3A 4QWDA 1S9EA 1T05B 4WZMA 5KFSA 3CO9A 1K1QA 3CJ2A 3PW4A 2BE2B 4MK8A 2R8GA 4URQU 4KFBA 5KT4A 3NAIA 2OPRB 3IRXB 3BGRB 1TKZB 4LSNB 4TLRA 2ZD1A 3G6YA 4NLDA 1TVRB 1BQNB 2WRMA 3GQCA 2OPQA 5J2MB 2FVSA 2RKIB 5EWEA 1C2PA 1HPZB 4F4ZA 1TKTA 4KE5A 1ZETA 1TL3B 2JEGA 3BGRA 4ECWA 1LW0A 3QGHA 2UUTA 4NRUA 2UVWA 3DOKB 2IM3A 4R5PA 2E9RX 4KHMA 4XPEA 5KT3A 5J2NB 2FJVA 4O44A 5KG3A 3BJYA 2YNHA 3CJ5A 3CWJA 3PR5B 3KLFB 4DG1A 4Y3CA 2BQ3A 3H5UA 3I5AA 4EYHB 1S9FA 3CVKA 5F8IA 2QE5A 1JLEA 2WOMA 5FDLB 3NBPA 3GILA 2R8JA 4ICLB 4NLWA 3KLIB 5HLFB 1C1CA 2J6UA 4IRKA 5KFJA 1SH0A 3TQ1A 5C25B 1HNIA 1C0TB 1NHVA 3I0RB 2BANA 3PW0A 3RBEA 5HP1B 3PW5A 3N6LA 2XCPA 4IRDA 4RW6B 3EPGA 2JEIA 2HNYB 5C25A 2J6SA 1JLFA 1HNIB 4JV1A 3IG1B 4RW7B 2W7OA 2C2EA 1S1VA 3MECB 3V6HA 2AGQA 3ISNC 3LP2A 4O3NA 5HP1A 2FJWA 4WXWA 5J1EB 4EBEA 3FFIB 3C6UB 4RW4B 4WFZA 3FRZA 4IG3B 5T14A 1TL3A 5L1JA 1RT7B 1GX6A 2D7SA 1LWFA 1LWCA 4KKOA 5I3UB 2HNZB 3MR6A 3V6DB 1RT3A 4IH7A 3RB4A 1VRTA 4RNFA 3V4IA 4TY8B 3I5CA 4IFYA 2RF2A 4ECYA 2V9WA 1RT3B 1IM4A 4RW8B 1T3NA 2WB4A 5C24B 5KFWA 4IH5A 3OHBA 1IKVB 1KHVA 4QWBA 2C28A 5DG9A 4WZQA 1S0NA 5DGBA 3BSOA 3H5XA 1S49A 5KFFA 1D1UA 3QIPB 5KG4A 2ZD1B 1RTIB 2BRKA 2YKNA 3LALA 1R0AB 3FQKA 4NLQA 4NYZA 1S97A 4Q8FA 2B43A 3N6MA 2VG6B 5F9LA 2OPSA 2V4RA 3ISND 1HQUA 3KK3A 4MH8A 1N6QB 3LAKA 3QIDA 1S1TB 4K4VA 3GIMA 5C5JA 3Q8RB 3T5KA 3MR5A 3SI8A 4FS2A 1Z4UA 2ASLA 4MIBA 3MECA 2YNGB 3NL0A 3DRPA 2IM0A 1KLMB 5DQIA 1SUQB 1EP4A 4TXSA 2IJFA 3KHHA 4ECXA 4ECVA 3PW2A 4J9MA 3M8PA 4K4YA 4ZHRB 4ZVFA 4DEZA 2YNGA 4H4OB 4ZPBA 3DLGA 3JYTB 2W9CA 4J9OA 3OSPA 4ICLA 4ZP7A 4DL6A 2FVRA 1EP4B 2C22A 4ED3A 4URSA 4F4YA 5JUMA 1S48A 2RF2B 2I5JA 1C1BA 3RAXA 2HWHA 4NLGA 5DQHA 3T1AA 1LW2A 4G1QA 4K4XA 4KV8B 3UR0A 2XWYA 4DG1B 1HQEA 5HROB 4DL2A 4FBTA 3H4BA 4IR9A 3QGIA 4EBDA 4RNMA 3PJXA 3OL8A 1TL1A 3CDEA 3DLKA 3E01B 4ID5A 4IH6A 5J1EA 1S0OA 2YNFA 1RTDA 5HROA 2VA3A 5KT7A 1HARA 4Q0BA 1QE1B 2VG5B 1D0EA 2EC0A 5KFIA 4QWCA 1TKZA 4LSNA 5KFYA 3GYNA 2FVPA 1QUVA 3QO9A 1IKYA 4MFBA 5HBMA 4M95A 3IS9B 4IOBA 2RDJA 4HKQA 3LAMA 4I2PB 2WONB 1XR5A 3QYYA 5KFKA 4IG0A 1IKWA 5KFAA 2HNYA 4WE1B 4Y2CA 4J9LA 1S4FA 1SUQA 3DRSA 3BQ2A 2FLLA 3LP2B 3IS9A 1RT2A 5C42B 2BQUA 1J5OA 3MR3A 4K4ZA 3H5SA 4O4RA 3PW7A 3Q8SB 1SV5A 1ZTTA 2DPIA 4IR1A 1MMLA 4PWDA 5KFCA 5EDWA 1N4LA 1RT2B 3LP1A 1J5OB 3MEEB 5KFNA 4KSEB 4RW9B 2YKNB 3G86A 3OLAA 3NAHA 2BE2A 5F9NA 2R8IA 5KFEA 1RT5B 4NLRA 1SV5B 4B3OB 1RT1A 5J2MA 3M8QB 3T19A 3I5BA 1S9GB 5KT2A 1C1CB 1TQLA 4TY9A 4J9RA 1JX4A 1DLOB 1S6PA 5KFGA 4U6PA 3DLEB 4IRCA 4I2QA 1HPZA 5KG0A 2YKMB 4ECTA 3DOKA 1REVB 4R5PB 2FLNA 5KFOA 2AX1A 2YNFB 1RTDB 2IM1A 3HKWA 3HVTB 4RNNA 4O44B 1SH2A 4EEYA 3KJVB 4JV2A 1OS5A 1R0AA 5KFUA 3CIZA 4R8UA 4F4WA 1REVA 4QW8A 2I1RA 4I2PA 1LWEB 1IKXB 2YNHB 3MFHA 1T03B 1RTJB 1RT7A 4MK7A 4K4TA 5JXSA 3OL9A 2I5JB 4I7FB 4NLPA 3C6TA 1JLCB 3CJ0A 4J9KA 1RTHB 1TV6A 5EWFA 1RAJA 3GV8B 4Y2AA 3DMJB 2AQ4A 3OSNA 1S1WA 2O5DA 4ZPCA 2B6AB 4FS1A 4TYBA 2AGPA 2CJQA 1UWBB 1C0TA 3QGGA 1NHUA 3SFGA 5DQGA 3FSIA 4K4WA 2BANB 4NLXA 3KMQA 4URGA 3T5LA 3KHRA 2FJXA 3RB3A 4ZVGA 4NLVA 3MEDB 5F8HA 2ATLA 2IJNA 4ZVEA 1FKOB 3KK1A 1S9GA 4JV0A 2R2RA 1RT4B 1RYSA 3KNAA 3IG1A 4H4MA 4KAIA 3CDUA 3RBDA 3JSMB 2R8HA 1JXLA 3M9MB 3H40A 2ZE2B 3CDWA 4RW4A 5F8JA 3KK3B 1N6QA 1HNVA 2R2TA 1FKOA 1K1SA 4LSLA 2GIQA 4TY8A 2VA2A 4EO8A 3KJVA 3OL7A 2IA6A 1JLBA 4JUZA 2ILZA 3UQSA 1RDRA 2BR0A 1FKPA 2AGOA 5F8GA 4Q44A 3IGNA 1S0MA 2FVQA 2OH2A 1N48A 3H5YA 3MF5A 4ZVHA 1S10A 4OL8A 3H98A 1XR7A 5KFHA 3DYAB 5J2PB 2D41A 4IDKB 1T03A 3LP0B 3DM2A 2W7PA 2AX0A 5KG7A 2FLPA 5KFRA 2WCXA 4I7FA 1JLCA 4DL3A 2GIRA 1C0UB 2B5JB 3DYAA 3DMJA 2W8LA 4RNHA 5J2PA 1TKXB 3QIPA 2YNIB 3DRRA 1C1BB 4Q45A 3I0SA 4ZPAA 2R8KA 4I2QB 3TAMB 4WFYA 1LW2B 2B5JA 1HMVB 2V0NA 1CSJA 2HNDA 2XI2A 2IM2A 3KLGB 5CYQB 2XGQA 2C2DA 4O3PA 4YR2A 1SH3A 1JLGA 3I0SB 3G6XA 1DTTB 2W9BA 1RT5A 1QAJA 4R8UB 4B3OA 4NZ0A 4RU9A 4ID5B 2AWZA 4J9PA 4KBIA 3JSMA 3DRPB 4RZRA 4GC6A 4ED6A 3T5JA 1DLOA 3KLEB 3ITHB 2HMIB 1JLFB 3OL6A 3KLVA 4ED2A 2UVUA 3DOLA 4Q8EA 4O3SA 3SFUA 1DTQB 5KG2A 2W9AA 1U09A 3DLGB 1RTHA 4MKAA 1RT6B 2WONA 2HWIA 4QW9A 4ECQA 4IFVA 4DL5A 1GX5A 3HHKA 5KFPA 2C2RA 4ZP9A 4WE1A 1YVFA 2VG7A 4TQRA 3MTKA 2XGPA 5J2QB 5DG7A 5D3GB 1N56A 1DTQA 1JLAB 5C42A 3EZUA 5DGAA 3T5HA 3QLHB 4NLUA 4ED8A 1BQMA 4O4GB 5KFZA 1RTJA 3V81B 1C0UA 2BRLA 3NKYA 2XCAA 1RA7A 4RW8A 4YR0A 4TN2A 3GIJA 1HYSA 2YNIA 4RUAA 4RNOA 3E01A 1QAIA 1MU2A 2IC3A 5KT5A 3OHAA 3UDLA 1S1WB 5HBMB 5KFQA 3PR4A 4F50A 4F4XA 1HMVA 4Q0BB 2JLEA 4ZPDA 1IKWB 4NLTA 4ECRA 1LWFB 1HYSB 4K50A 2HNZA 2QV6A 5KFXA 1RYRA 2R2SA 4PUOA 3DLEA 3RAQA 3H2LA 4NLYA 4KFBB 2RKIA 3KK1B 2R2UA 2ASJA 1FK9B 5KFDA 2OPPA 2IBKA 3G6VA 1NNDA 1TVRA 4PWDB 4IDKA 1BQNA 4Y34A 3CJ3A 3DM2B 4O3OA 5L1KA 4DL4A 3DOLB 4PQUB 1JLQA 2WK4A 3LP1B 1S1XA 1TKTB 1HNVB 4MIAA 2JEJA 3MEGB 3GV5B 4YP3A 1JKHB 2FVCA 1RT1B 1JLBB 3M8QA 3KOAA 4EBCA 1S9EB 2D3ZA 2VG7B 1RA6A 3FDSA 5J2QA 1T05A 1JIHA 3C6TB 4H4OA 4MK9A 5KG6A 2W9CB 3M9OB 3JYTA 4NLOA 3MEGA 4XO0A 3H4DA 3DDKA 3ICLA 4GC7A 2VG6A 3BSAA 3FQLA 2JEFA 2E9ZA 3BSCA 4KB7A 4ZP8A 5L9XA 3UPFA 3KK2B 5KFMA 2ASDA 3V81A 1JLGB 1UWBA 4WYWA 4J9QA 5DLFA 3I0RA 3Q8PB 3HVAA 5CYMB 3MEDA 3KK2A 3HVTA 4QWAA 3DRRB 1LWEA 1ZTWA 1S6QA 5L1LA 2W8KA 1LW0B 3IN5A 4M94A 1TL1B 3DLKB 3PZPA 4H54A 4KO0A 2BQRA 5F8LA 2F8EX 4PUOB 3D5MA 5J2NA 2JC0A 1KHWA 1QE1A 1TV6B 2VG5A 3PHEA 1S6QB 3Q8QB 3KLHB 3MFIA 4HYKA 2OPPB 1LWCB 4KKOB 3V6KA 3PVXA 4J9SA 1S1UB 1N5YB 4KO0B 2ILYA 3OLBA 5F8MA 4O3QA 5KG1A 4TYAA 1W25A 3KLHA 2J6TA 2GC8A 4WYLA 5DLGA 4XPCA 5I3UA 4YMEA 4QWEA 3DI6A 4ZMMA 5I42A 3RB0A 1N5YA 5K14A 1VRTB 3PJWA 1RT4A 1TP7A 3BR9A 5C24A 2IAJB 1MU2B 4IFVB 2IC3B 4ECZA 2ALZA 4G3IA 4IFYB 2UVVA 5D3GA 2ZE2A 2XC9A 5KFBA 1I6JA 4H4MB 4LQ9A 5KFLA 3D28A 3MEEA 5KFTA 4RW9A 3BQ1A 4ECSA 3GIKA 2IAJA 1BQMB 4FBUA 3QO9B 4MFBB 4QPXA 5CYMA 4ED0A 4EO6A 2OPRA 4ZP6A
chains in the Genus database with same CATH superfamily
3DN9A 2COLA 2CKWA 1U6FA 3NG8A 2V2QA 2XM3A 4GO5X 1WG1A 2AHOB 2MY7A 4CNYA 2DRBA 3KLEA 4DR6F 3GLJA 3Q2SC 1ICEB 2QN6B 3QSIA 5BYQA 1SC6A 4DHVA 4EK2A 3IWNC 3LANA 5F8NA 2ZH1A 1SQFA 3IGVA 3PG9A 1F2HA 3ZO7A 5B0CA 1WC0A 2ZDPA 1PYOB 4Z2XA 2XS5A 2MZRA 2KG0A 5LMNJ 1H73A 2OTJS 3KLGA 2QG9B 2J7KA 5IV4A 1VHIA 4MAKA 2DH9A 4ELVA 5I42B 3HXMA 3HFZB 4FYYB 1J5EF 1IM6A 3B78A 3NMAA 3TAMA 2C2NA 1SJ3P 3BBBA 3I55S 3UE2A 1C4CA 3MDFA 4NXMJ 4F3MA 2UUWA 1UAWA 3C14A 4ZJLA 4PG8A 3IP0A 4ED7A 4DN9A 1Y7PA 3IRXA 4BC7A 2V2ZA 3G8QA 4KGXB 4F8RA 3OVBA 4KHPJ 2VZ9A 2KFNA 4IG3A 2U2FA 2YKOA 3GTYX 5HO4A 1NJYA 3LPYA 4C8KA 4EZ6A 1FTRA 4K4UA 3J81U 1WKLA 1EAYC 3AHPA 3HFVA 4IOCQ 3TX8A 4O3RA 2IMWP 3QZ8A 4Y2IA 2ALYB 3PKMA 4LRAA 1VRUA 3CJ4A 4I1TA 2V4QA 2HMIA 4BC9A 2DHGA 4WFNQ 1YBTA 3RG6A 2RU9A 3LTOA 3E51A 2E44A 4OZ2A 1CJUA 2HHPA 1FCAA 2JNJA 3CDAA 3L7PA 4ZPWR 1PO6A 4M1KA 3W5XA 1VC5A 1L3SA 2AU0A 3G9CA 1QVGR 4CLYA 2WAQD 1RAAB 4O4GA 2AYGA 3EGNA 2B6AA 1S99A 3NBPB 1EETA 4B3MJ 4WIQA 1RTIA 2RDIA 2RVJA 1XNRJ 1T94A 5A6PA 5HLFA 4FPIA 4NLSA 4PPZA 2P9CA 1U0SA 1WSVA 5E3PA 5CD4H 4ANDA 3GIIA 4YR3A 1NK9A 2PN6A 1S9EA 1FEEA 2CQ1A 2HURA 3PIPQ 4B9SA 2CZ4A 5SZTA 3CJ2A 4DI6A 4X62J 2QA4S 3GFHA 5GMDA 1IBCB 4URQU 4OX8A 3THPA 1WG4A 1U4BA 1G4CA 2E7VA 1NM2A 4LSNB 4OZLA 4TLRA 6FDRA 4TU9A 4O0IA 2NUUG 2ZHAA 3TJ8A 1BQNB 1N34F 3BBCA 2OPQA 1K0VA 1FESA 4UY8T 3TARA 4WWSA 2JEGA 3G71S 4HHHA 1GXTA 3BGRA 5C7PA 3GYGA 2VFRA 1MROB 2MKIA 1PCAA 3D0IE 1LW0A 2FC9A 1O5JA 2UUTA 3GPAA 2LQ5A 2QT7A 4NRUA 1NAQA 2UVWA 3DOKB 4F26A 1U6ZA 2KHDA 2W24A 2UXBJ 1LXJA 3QGPA 1NZAA 4YDDB 2AYBA 3RR7A 2UXCF 3D3CJ 3W62A 1WKKA 3F44A 2PMHA 3CWJA 4Y3CA 4FXDA 3I5AA 3AXKA 3FRYA 5F41A 3CVKA 1YJTA 1JLEA 3DDIA 5FDLB 3EX7B 1H0HB 3PYFA 1N54B 3QFWA 1V5VA 1CBKA 4P10A 1F6TA 4PEOA 2R42A 3VR1A 2VD3A 3KLIB 1C1CA 3NXZA 2AJ2A 2J6UA 1WF0A 5KFJA 1SH0A 1M1KT 1YJRA 3LQVA 3R5GA 5K9FA 1KTQA 3MM6A 2RE1A 2GVZB 2IVMA 1U1OA 3U1MA 3ULHA 3RBZA 3UCZP 3RBEA 5HP1B 4PYDA 3BF4A 4OHZA 3PW5A 2VPYB 5IT0A 1M90T 5ETOA 1YZ6A 5CAAA 4FF4A 4FNIA 2JEIA 1FFGB 2BW2A 1HNIB 2D69A 3D0HE 3O8WA 4LVNP 3IG1B 3UN5A 4RW7B 2E5IA 1AUDA 1S1VA 4C8YA 1Q16B 2FJBB 2O67A 4ZVOB 4O3NA 4DPYA 3BZQA 4RBTA 4DUYJ 4DV4F 4DFJA 1RP5A 1N8RT 2F9DA 3GCWP 3FRZA 3OUYB 3C3LA 5L1JA 2EWHA 1GX6A 4DV3J 4BCAA 1B64A 5IFMA 2HNZB 4C0HA 3RB4A 2YWHA 4CP5A 3DOMB 1OPZA 3MM7B 2DGXA 1F5CA 1TTHB 2CQCA 3NGKA 4KRWA 2KB2A 3N9UC 1B0VA 4TY8B 1CULB 5BR8F 2BDPA 1KR4A 2FY8A 4LF9J 2OO4A 1RT3B 4WIIA 4PYAA 3BKFA 4OYWA 3HT3A 3NNHA 4OFZA 1HA1A 4HH1A 1NPPA 2ZH9A 3J7YU 3R2DJ 1NK0A 1FVSA 3G82A 5DG9A 4B3SJ 2XEXA 4ZCLA 2VICA 5CQGA 3QIPB 1D1UA 1SC3B 5AJ3J 2EEYA 4ZPVR 2WSCC 4NLQA 2J5AA 4Q8FA 3HD2A 2V4RA 1N36F 2NYHA 2WSEC 3R7NB 4MH8A 5GVQA 4AL6A 2KZZA 3LAKA 3BKUA 4O0NA 1KOHA 3QIDA 5JVGQ 4K4VA 2CJBA 3TJAA 3OQ2A 4C7QA 5C5JA 3Q8RB 3CEDA 3OTOJ 3GG1A 2HLTA 4HTJA 1ZAXA 4Y2MA 2CUYA 3T5KA 2ASLA 1HNWF 4MIBA 4NA3A 2XLKA 3MECA 2P8IA 2YNGB 3QQCD 4ZVTB 1N33J 2EFNA 3B8HA 2EPIA 4W92B 1SUQB 2C2MB 4NI2A 1M0SA 3SMZA 3DRXA 2P9EA 3WZ0A 3KHHA 4FKXA 4X65J 4ECVA 3PW2A 2Y1JA 4Q7AA 1HWLA 2CJYB 4DEZA 4MIWA 2H4YB 1P9QC 3EMTA 2LEPA 4UOGA 1VQ8S 1FD8A 3JQJA 1L3VA 4ED3A 1QDUB 1HHSA 1P9YA 2GHPA 4DBQA 2UUBF 3BGOP 3P5BP 2RF2B 3FGVA 2E1MC 2F65A 3UDVA 2HWHA 4ED4A 2UUAJ 2V67A 4FYWB 4NLGA 1VR6A 1IWGA 2CDRB 1LW2A 1RLDA 2F40A 3FZBA 2HQDA 3A8EA 5HL7Q 5HROB 4DL2A 2J0QD 4DSKA 2CQGA 2H51B 2V2VA 2W1BA 1ROFA 3M1VA 2K2PA 3P45B 4NYPA 3UFCX 3H4BA 4JI2F 4Z37A 4EBDA 4IR9A 4KHPF 3KDOA 4JV5J 3DLKA 3CDEA 1R6VA 1Q5VA 5M2PA 2JWNA 2MKYA 2UUAF 1BQXA 3VCDA 4AYBD 8RUCA 5KT7A 1DHMA 2CRLA 1HARA 4C97A 2VG5B 4TU7A 4K8RA 1S72S 1YWXA 1AZSA 1RWXB 4C3KA 3QO9A 4MFBA 2A3JA 4OI3A 4DQSA 3IS9B 3TUJC 3M8YA 3A1YG 2WONB 3T9ZA 4CTAB 2B9EA 1K47A 1PBUA 2HNYA 3HHLB 2DNQA 3M30A 3VGSA 3ZNJ1 3TEHB 4J9LA 1R8HA 5MAOA 2HPUA 3EVMA 1Y4ZB 3LP2B 4AUKA 4DLEA 1RT2A 3M2RB 3UI3A 1LEOA 3IMQJ 4X4RA 2RS8A 1HI8A 3VAFA 4ILLA 1X4FA 4NCBA 4K4ZA 3H5SA 4JI8J 2E5JA 2W7AA 3R3TA 4DV0F 5KFCA 4LF8J 1N4LA 2Z8QA 1WDTA 3NGUA 3A13A 5KFNA 1RBAA 2BMBA 4F02A 2YKNB 2MHNA 4ZLPA 2ZC4A 1X4HA 1IQZA 1M5HA 3FSYA 4YEAA 1TFWA 3M8QB 3UD3P 1NPKA 4J9RA 1DLOB 1KOOA 4WCEQ 4B9TA 1DBDA 1S6PA 1SJQA 1H98A 2I8EA 2K3IA 4CI0B 3SCIE 4U6PA 2F3JA 5IC6B 3EXYA 1X5SA 4IRCA 1PBAA 2YKMB 2CA9A 3CCZA 3DOKA 1PGZA 1TUWA 3L09A 2RB7A 3BBFA 5CZVA 1RTDB 4LF6J 2IM1A 1D8ZA 4RNNA 3HJVA 4EEYA 3KJVB 4JV2A 1KTVA 3AQPA 1BHNA 4YHHF 4FF3A 1Q8LA 3QNWB 1OY9A 2NCKL 1VK3A 4F4WA 1DRZA 2BABA 3D6FB 4F67A 5GAGI 2D9PA 4HT5A 4I2PA 2J0SD 2CNNB 1LWEB 1HBMB 1YBAA 2K7JA 2Z58B 2X7IA 3GMGA 2HHXA 4GKJJ 1RTJB 1RT7A 1UTAA 3NS7B 4MK7A 5HK4A 2R7TA 4QIVA 1WKJA 2JL9A 2I5JB 2J7WA 4OZ1A 1S7HA 3TVZA 1JLCB 4J9KA 1DJ0A 1RTHB 1SBRA 2FGCA 3MM6B 4N47A 1YIJS 3OXFA 4Y2AA 3OSNA 3VAKA 1U1MA 1IVZA 1U48A 4DR3J 4TYBA 5BYSA 2A6MA 3QGGA 4OX6A 1NHUA 2HVZA 3AQOA 1U1KA 4NLXA 1RABB 4ZIWA 2IA0A 3VHQA 3KHRA 2HBRB 1ZBTA 2HWTA 4LBIA 3J81Y 4DR7J 2IJNA 2L9WA 1WEZA 4ZVEA 3RBXA 3MOZA 2CQ2A 2DRDA 2LCWA 1FA0A 2VFTA 1LOUA 4DS5A 1SL0A 4JI4J 1MMDA 2V6AA 3ET6A 3H20A 4LIWA 3HM9A 3A3OB 2ZE2B 2HHQA 1BGXT 4RW4A 2YH0A 1N6QA 1SL2A 2Y8YA 3BO3A 4TY8A 1T9TA 1UPMB 3WQPA 2XMJA 1G1XA 3OL7A 2R7SA 3KNGA 2UXCJ 2ILZA 3GE9A 2VODA 1FKPA 2AGOA 3PKYA 4HR2A 4W98A 3IGNA 2J9DA 2W2NP 3L7UA 4CLTA 5ITHA 1N48A 2FVQA 2OH2A 4ZVHA 2ZH6A 4BWJA 1XR7A 3V2UC 1IR2A 3M4XA 5J2PB 2DH8A 1K44A 2HIQA 3DM2A 5KG7A 4AQYF 4I7FA 2E7WA 4USWA 2FC8A 3GFYA 3TZXA 1KS2A 2B5JB 4W90B 1PG5B 3NWRA 1NDPA 2AJ1A 3DYAA 4RU2A 3EVWA 4TKTA 2QFJA 1C1BB 1U1LA 2YXLA 3ISZA 4HDGA 5IM0B 1S0VA 3D67A 2HVHA 2R8KA 4DV6F 3M8ZA 4ETXA 2KT5A 2KN4A 2IM2A 3X1LB 4IOAQ 2RNEA 2IVFB 4HT7A 4YR2A 3M2UA 4MYTA 3I0SB 5A2QU 3G6XA 4I6YA 1F9HA 3W65A 1RT5A 1QAJA 1P1TA 3IO1A 4J9PA 4B3MF 2AWZA 2Z0GA 4KBIA 2YKQA 5EGYA 4RZRA 4GC6A 5A2QY 1AYEA 3MMBA 1GEHA 3OTCA 1J27A 5G0RB 5HN0A 3KLEB 1HBOB 1XNQJ 2OEJA 1VBKA 2MPUA 4G6VB 3NS5A 4ED2A 3DOLA 2DNGA 2C2OB 3FCHA 3CCVS 3K5NA 1B70B 4OYIA 1DTQB 3SFUA 5KG2A 4DV6J 1U09A 3DLGB 1L3TA 4O3SA 2UZAA 2HG4A 2FTRA 3DU5A 2FHOB 4MKAA 1YZ7A 3OR1B 1TK5A 1HNZF 2CWXA 1VFJA 3DDNA 3SQGA 2VJUA 4ZP9A 4TQRA 1YVFA 1KVIA 3K58A 3MTKA 5J2QB 5D3GB 3K89A 3T1HF 1BD6A 4HHUA 3M1VB 5HJYA 1N32F 3FBEA 2L9DA 4PZVA 3PX0A 3KG1A 3KUEA 2F4VJ 3CJ8A 4WP9A 5L8RC 2UU9F 3V81B 5GMEA 5ETNA 1RA7A 2F9JA 1TU0B 2ZWPA 1HYSA 1VCTA 2YNIA 3BYPA 3E01A 3IR5B 3VGUA 1M5PC 1X5TA 2IC3A 1HD0A 1TL7B 1PJ6A 2DNMA 1R0BG 3DFEA 4DLGA 1HMVA 1NDKA 2C3UA 3ZTPA 3GR1A 2MDAA 3KJQB 4P71A 2QMWA 1KC8T 2KM8B 2AZ1A 1RYRA 4D3GA 3DLEA 4JI8F 3H2LA 3HPOA 3RAQA 4KFBB 1DQ8A 2BKOA 3KK1B 1AA1B 4YUDA 2ASJA 1VQ7S 4FN5A 3G6VA 4C98A 1NRKA 4IDKA 4Y34A 5RUBA 2CYYA 1VQPS 5L1KA 4O3OA 2OMLA 4J7CA 4D3HA 3GIRA 3RRHA 5LMUF 1TL5A 2B4VA 3PCOB 3PNIA 3CJKB 1AROP 3MXHP 4W4MA 3GV5B 5ETPA 4LR9A 5HJXA 1WHWA 4TLQA 3M8QA 9RUBA 1S9EB 2VFSA 3FDSA 3HHDA 1O51A 3UDEA 1RQ0A 3ADAC 3C6TB 1WELA 2VQFJ 4DV7F 2G4BA 3MEGA 5AT1B 2AJ0A 3ICLA 3OTEA 1RWPB 4OHWA 2UP1A 3MAAB 4OV1A 3L7OA 2Y8WA 1JLGB 3JSYA 2GAHC 1UWBA 1SKRA 3ZTRA 4WYWA 3OXLA 4J9QA 1E6YB 5I4MA 1NPRA 3I0RA 2YWKA 4USKA 2DD8S 2XLJA 2J9DE 2N4CA 1LWEA 2ZOGA 3HSZA 1S6QA 1F9FA 1LW0B 1VQYA 2EW9A 3W61A 1WC4A 3L4BC 4F3QA 2G1DA 4DV1F 3O2IA 4FVMA 3PO4A 2F8EX 3I6PA 4DQIA 3QT7A 4FDFA 2RSQA 4S0MA 1X4GA 5B7WA 2K8GA 3DNCA 4P2SA 4QU7A 3Q8QB 4K0KJ 2R7VA 1FTCA 3DXBA 1TAQA 2OPPB 2H48B 3PDNA 1LWCB 4KKOB 5E3QA 3R6GB 5GADU 1S1UB 1JNRB 3RW7A 2HS0A 4CYUA 2OKQA 4TYAA 1GMWD 3QRRA 4I64A 2JRSA 3KLHA 2I2YA 1XK8A 3I96A 3T3FA 5I3UA 1QTMA 2DR5A 3H2VE 4BDPA 2QL9B 4ZMMA 2YWFA 1FXLA 1G2EA 3PJWA 4AFFA 2GHWA 1VQLS 1Q5YA 3BR9A 2ZHBA 5E2QA 2IAJB 1AUSL 2XWXA 2ATCB 4JI0J 4LR7A 3VVTA 2ZBRA 1TFYA 2ZE2A 4LFCF 1GTEA 2RD5C 4IO9Q 2XC9A 2A2DA 1I6JA 4U7UD 2AP6A 2YPYA 3VVUA 3BQ1A 4OQJA 2IRYA 2K06A 3GIKA 3NNAA 3V5RA 4DR7F 2FD2A 2QRRA 4GMKA 4QPXA 1KDNA 2JVRA 3L9ZA 1WOSA 4ED0A 1HD1A 2ZC3A 2YPZA 2DGQA 1UPPA 2BBEA 3FCVA 2CNOB 1U26A 2GVDA 1YHQS 4DR3F 1S12A 2OPSB 2F5GA 2QTWA 4EWTA 5GADI 4A47A 4BHQA 3QZ7A 2JC1A 1HWKA 3A3PB 3R9LA 2YWGA 2GJIA 4DV2J 2HVIA 3V6JA 4ANEA 2HFSA 1OO0B 2N4DA 2F63A 4DPUA 4RUCA 3GV7B 3LP0A 2A18A 3K5PA 3MAQA 5J1NA 3H59A 3M8PB 4DFMA 3EXCX 1Q8KA 1OSDA 4ID8A 3NGDA 1KD1T 5DJBA 4RJVA 2DR7A 1Q79A 1A9NB 3VV2B 3ILOA 4HI1A 4B17A 3AJ2A 4XTTA 1M1HA 5LXYA 1GFWB 2R7OA 1TKXA 2GNKA 3UCGA 3FZ2A 4UQTA 1VI7A 3GJSB 4ED1A 1QVFR 4KPYA 4I67A 5EHHA 3T41A 2KFZA 2DYAA 9ATCB 3WX8A 4TQSA 4LF6F 4G1QB 4WFXA 3FFIA 3SSRA 3TVKA 1VRUB 1ZH5A 4FYDA 4NASA 5KT6A 2GVZA 4KV8A 1XMOF 3P96A 1DZ5A 2DCUB 5DZ7A 2MLXA 2MEWA 5AXLA 2E9TA 3CJQA 4NYOA 4TNOA 2FUG9 2XI3A 3CC7S 1FO1A 1RWVB 2EBGA 2HRUA 3C19A 3MCSA 4JI7J 3N6NA 2I9SA 3M8WA 4RW7A 1KONA 1S1VB 1RJJA 1RT6A 5KFVA 1FE4A 2H1YA 1EETB 3TUZC 1YJNS 3CMES 1F3VA 3NCRA 3J7AN 4ZDNA 3ZFVA 1H74A 4ER8A 5LSLA 3BDPA 4NRTA 5DDPC 4DWIA 4R0EA 4KIAA 3OT9A 3EPIA 1VIXA 1Y0HA 3VAHA 3DRSB 4I0WA 4GVBB 5K14B 2VPXB 3ZNUA 1IWAA 4B3TJ 1VMBA 2O66A 5KG5A 4UQGA 4U7UK 3M9NB 2F1FA 2PA3A 2J8AA 1YKWA 4HDHA 3RB6A 3WC2A 3C46A 4CQ1A 2XB2D 2FIUA 2C3MA 3QT6A 5DG8A 1KSPA 2ZM6F 2NPFA 1Y3JA 4ES1A 2D3UA 4QWDA 1T7PA 3PM9A 1REGX 2MZSA 2GGPA 3PW4A 2VBYA 5D4LA 4X66J 2BE2B 2CG8A 3N01A 4LFBF 4MK8A 1VYAA 2CQIA 2PO4A 5LSRA 1BWVA 1H72C 3G82B 1PC4A 2KYXA 1S79A 4KFBA 3CXCR 1H3DA 2OPRB 3IRXB 3BGRB 2ROGA 3Q89A 3G6YA 2RRAA 3VWSA 5KAKA 3LGHA 3NY0A 2LXUA 1Y10A 2EK1A 2IDEA 5CCMA 2FVSA 3ZZ0A 1C2PA 4KE5A 5D4NA 1ZETA 2HHHF 3K5OA 1KFDA 1HFEL 3PIOQ 3TZWA 4CLPA 1H2UX 4TU8A 1Q7LB 1RAOA 2MZJA 2YX1A 3MI7X 3MMAB 1V3RA 1RWNB 4KHMA 2EFVA 2QLJB 3D1OA 5J2NB 4XPEA 1QSYA 2FJVA 1HBNA 3PXGa 1KWMA 5KG3A 1B7FA 2Z56B 3AD7C 3MMCB 3CJ5A 5IT9U 3MM9B 3GJQB 3KXDA 4NA1A 3FEZA 4DG1A 3GB0A 4CO3A 5IZHA 3G96A 1D9AA 5F8IA 4ED5A 5CH7B 3NBPA 4USUA 3NOCA 3GILA 4C8MA 2R4FA 5IXUA 1HW8A 3FKBA 2PFDA 1L5UA 4I6AA 1VLYA 1DURA 5F3TA 5HLFB 1GTHA 1Q82T 1X31C 4UOCA 4IRKA 2QGFB 2RDDA 2YQ3A 3Q8YA 4PG4A 3UNYA 5E7OB 3TQ1A 1FRXA 1HNIA 1EKRA 1HWUA 1C0TB 1QTNB 1NHVA 2R7QA 2XY7A 3M6UA 3OR2B 1O8BA 1ZPVA 5E41A 4E2FB 4ZCKA 2CZ9A 3BGLA 3HI9A 4DMZA 1S5ZA 3C16B 5C25A 3POTA 2Z2ZA 2C2EA 4FF2A 2OD6A 1WSRA 1RB0A 3DCAA 1R6YA 3W8PA 2E5LF 3NP5A 1U24A 4EBEA 2B56A 2RHSB 2DNLA 3EWGA 2ZH5A 2MHEA 4WFZA 2BKNA 1KVJA 1RU1A 2G2ZA 2B9XA 4IG3B 5T14A 2AKWB 1RT7B 1QY7A 1FDAA 1LWFA 4DV1J 2HFUA 3CW2C 3PEJA 3RYLA 5I3UB 1X8DA 3EE3A 4K0KF 3FSXA 1RT3A 4ZN1A 2HHSA 3HX9A 3JXOA 1NKBA 4C8ZA 4LR8A 3ZZTA 3EJMA 5EN1A 4JBCA 5IWAF 1FRLA 4L75A 4J9UE 4UZCA 3AXMA 3HSJA 4U96A 2V9WA 3MD3A 1IM4A 2LDIA 4RW8B 2NLWA 3QT8A 5C24B 2WVFA 4IH5A 2L9NA 1IKVB 2DNNA 1Q8IA 1ZZNA 4J5OA 1CLFA 2C28A 2J76E 1RADB 1XNQF 2M7SA 5DGBA 3BSOA 1S49A 4ZVQB 2ZZMA 2CADA 4GO7X 2RHQB 4LF2A 5KG4A 4CDIA 2ZD1B 1RTIB 5KFFA 3TI0A 2YKNA 2IRUA 2JH3A 2PC6A 3FQKA 2MKSA 2GVDB 3LALA 4NYZA 1R0AB 3AODA 2VG6B 1V3ZA 2OPSA 3J7A1 1FJ7A 1T11A 2GJFA 4X4OA 1N6QB 4QYRA 5IV3A 3PRVA 3S7RA 3M8SA 3GFXA 3HULA 2CQ4A 4FXWA 4NI2B 5LOQA 1Q86T 1CPZA 4FS2A 2DNYA 1ACMB 1PYTA 4I4BA 4E0DA 3OXGA 4NMLA 4LBHA 3NL0A 1FWKA 1B0TA 1RWWB 1LXNA 2DGVA 2JFKA 2GO9A 2YKPA 2IM0A 1FRMA 1RHQB 3I56S 1DQ9A 1FNMA 2IJFA 3P5TL 3IWLA 4J9MA 1FWLA 1FDNA 1RHJB 3TYTA 3IWXA 1U2RA 1V5IB 1U1NA 3E8OA 3KDNA 3FEYB 4H4OB 4ZPBA 3JYTB 2W9CA 1WJ9A 2KYZA 4ICLA 1E6VB 1XTZA 2JVOA 4N7TA 1EP4B 4ZP7A 1NSKL 4URSA 2ASYA 2LECA 4OI0A 3D6HB 4OYZA 4V1Ak 2MKKA 1S48A 2I5JA 1C1BA 2QMXA 2X1BA 3MR7A 3PYDA 3TZZA 4YB7A 1U2FA 4P52A 2CPYA 5DQHA 3LW5C 1PKUA 2ZHOA 3CCWA 4KV8B 1D9FA 2QLWA 1N5QA 2DCLA 1XWLA 3LWMA 1YITS 2OLWA 5IQQA 1NK7A 2W2MP 3BM7A 3ILLA 4PABA 1RACB 3EM1A 5J1EA 2N7YA 1S0OA 2YNFA 1FX4A 2VA3A 1WTFA 4Q0BA 2EC0A 2K7KA 4NXNJ 1IUJA 3PTWA 5KFIA 1TKZA 4QWCA 4DF8A 3HHEA 3GYNA 1URRA 4IOBA 3P8BB 1ZYQA 5D8HB 2AEJA 2V50A 2ZOFA 3SSSA 1F2GA 1IKWA 3MCNA 1FNXH 3TEGA 1S4FA 1SUQA 4MTPA 1NSAA 1ZM4A 1F9EB 2I38A 3BH6B 5JMNA 2PA8D 7FD1A 2BQUA 4ZHRA 2CJKA 1CC8A 2H3EB 1IBKJ 1VRQC 2HQIA 1U0HB 3PW7A 1UWAA 3Q8SB 2DPIA 2AJ4A 2Z2MA 2BE7D 5EDWA 3UO0A 3R8YA 3U02A 5H1SV 3LP1A 1J5OB 3MEEB 1HI0P 4F3OA 4RW9B 4J37A 3NAHA 4DX6A 5F9NA 2LU2A 4WU3A 5KFEA 5A76A 2CVIA 1SV5B 4NLRA 4DSEA 4LJMA 4B3OB 3Q83A 1NEEA 3I5BA 2JX2A 1WC3A 1HNXJ 2GMLA 4AXJA 3O1LA 1FFWB 3DLEB 3QWPA 5KG0A 4XIUA 4K2XA 2CPEA 2FLNA 3NWGA 1L3KA 2AX1A 2Q6CA 4XDCA 4NXMF 5D6GA 4ZLNA 1SL1A 3HVTB 4ERDA 2RUSA 2ZH4A 1B3TA 4ZLLA 4DR1F 1OS5A 3ZZOA 4C8LA 3SI8A 4FYVB 1AZSB 5ETRA 1R8BA 2UV8A 2KT2A 3HJFA 3IRWP 3FBCA 1Q0NA 2JFDA 2OSRA 2MJUA 3BN4A 4QW8A 4CCHA 2UXDF 1SC4B 1IKXB 3G8SA 1NLKL 4I56A 3GP9A 1UJ4A 3MPDA 5BYRA 4DR4F 4ES2A 1VJWA 2CPIA 4CLSA 4A8FA 3C6TA 2GCFA 4NZ7A 5FLXU 1U6BA 3OTBA 1TV6A 3S6EA 4OMFG 1VDHA 3OBIA 3I31A 1P27B 4PG6A 2XYPB 1LKZA 4DR1J 2NQPA 2HFOA 5L39A 2B6AB 3EVOA 4FS1A 1RI7A 1UWBB 1V6HA 2DR6A 3SFGA 5DQGA 4K4WA 2O01C 2FGOA 3T5LA 2FZKB 2F8MA 1Q4RA 1RSCA 2RH3A 3K5MA 3RB3A 1GXUA 2QSWA 4OYMA 3TUPA 1T0TV 3H8YA 5F0WA 1X4DA 1NZ8A 1RYSA 3KNAA 3J7YI 1RT4B 2A10A 2Q43A 3IG1A 4H4MA 3BYRA 3BV8A 1WEYA 4DJBA 4ES3A 3SZ2A 3RBDA 1JXLA 1DFDA 1IR1A 4DDFA 3M9MB 4JYAJ 3CDWA 3M05A 5A0YB 3TZYA 3KK3B 1HHTP 4X4VA 2KJWA 1K1SA 4LSLA 4QJVA 2QEXS 2IRXA 2G1HA 4NX9A 1U8SA 3UWTA 4KY3A 3KJVA 3O3LA 2IA6A 3UQSA 1RDRA 4KPCA 3B4MA 5F8GA 4YOEA 2ZBIA 3R5BA 3HFKA 1KEKA 4NEYA 1ITPA 3I4PA 2WW4A 1MROA 3KFWX 3LA0A 2DHSA 5KFHA 4OL8A 3DYAB 1GAOA 3ZZYA 4IDKB 2W7PA 2AX0A 4FXVA 1RKJA 1PJ5A 2WCXA 3MPYA 5IM0A 1JLCA 4DL3A 4R25A 3CJKA 1PIEA 2GIRA 2IHR1 4AQYJ 2DEIA 3QWUA 1VBXA 1EHWA 1EZZB 3EDQB 4RX6A 2DEJA 3ILJA 3QIPA 4JP8A 4USVA 5GAGU 2G2OA 3DRRA 4DCJB 3I0SA 3WC0A 4LF8F 2ADBA 1H2VZ 4ZPAA 4X4SA 2R8HA 4I2QB 4NPOA 1V3SA 4B9UA 2XI2A 2V9KA 4DXLA 4USHA 2HNDA 1F60B 1NSPA 4P73A 2DXEA 2IMOA 2RT3A 2VC0A 5CYQB 2YWWA 5G0RA 2C2DA 3AH6A 3W9IA 3CCRS 2CQ3A 1JLGA 2J0XA 2B0GA 1DTTB 1WC5A 4C48A 4R8UB 4KGVB 2GX8A 4X4PA 1CEZA 2CNLB 4ID5B 1FE0A 3ET6B 4ED6A 3T5JA 3HO1A 1KVKA 2O3DA 4QOTA 3OR1A 4Y0FA 1DLOA 1RAHB 2M3DA 3BPDA 4L3KA 3QJPA 2IBOA 2KZMA 1UEKA 1JMTA 3KLVA 2UVUA 1G6BA 4P7VA 5HSPA 3EZ5A 4ZVPB 2G0IA 3MM8B 4ANCA 4CLLA 1N5VA 3DLBA 2Z4PA 3BKTA 2Q3PA 4G65A 4DL0C 4ECQA 2KTQA 1GX5A 1FRIA 5FIIA 2C2RA 5A8WA 1VQ9S 4WE1A 4RL1A 3PEHA 1N56A 4KTQA 3RUBL 4WKRA 1VQSA 1JLAB 2M70A 2H9ZA 2FPHX 2MY8A 1LFWA 1RGVA 2QO3A 3EZUA 3SDEB 4EMDA 4ENOA 4NLUA 4M5KA 3T5HA 1HKAA 1RTJA 1ZPWX 2VKZG 3HP6A 1N5SA 1WHVA 2DY9A 2BRLA 4GKJF 1JQGA 2VF3A 4YR0A 1VQNS 1YRXA 4TN2A 3GIJA 3QJJA 4PG5A 5D4OA 5DDRC 3J80U 4DF4A 4QBUA 3OHAA 4L73A 2MQPA 2HS4A 1RHKB 2WZ1A 2N3OA 4USJC 1KQFB 1VGYA 4F4XA 1Q8BA 1VBZA 3QRPA 1IKWB 2XYGB 2ZUGA 3DHXA 5B08A 3CC2S 4F4KA 1CS4B 5BXIA 4L6V3 3RAMA 1Y00A 4JB8B 2KH9A 2R2SA 2HHHJ 2C3OA 2RKIA 3IFEA 3CTRA 2LFVA 3MGJA 4NE9C 3K8WA 4Y2KA 2KXFA 1FDBA 3EZOA 3H0PA 1NNDA 3NNCA 1A7GE 5LM7E 2VOPA 4RUHA 3CJ3A 1U1QA 3S01A 4ITSA 3DOLB 2RQ4A 4KGKA 3LP1B 2MLZA 2ZNYA 2NXJA 4K7QA 3FJ2A 4Y28C 5E3AA 4CH0S 3MEGB 4DQPA 3TA1A 2HGNA 2KJVA 1NJZA 4G1PA 5GAEI 1V9OA 3DLHA 2VB6A 3KOAA 4EBCA 3MAAA 2QA1A 4RBVA 5IWAJ 1RA6A 4ZOSA 4DPOA 5J2QA 1JIHA 3HT0A 4MK9A 1SPBP 2J7UA 4NLOA 4XO0A 2MSTA 4DPXA 3DDKA 2E5LJ 2HHUA 2Y0BB 3A12A 1FJCA 3BSCA 3UPFA 1HBUA 2QL7B 5FD1A 3V81A 3W2WA 3FMBA 5E3RA 1UZHA 1P6TA 2IFXA 5HMZA 4HHJA 4C11B 1KQSR 3NGRA 1NB7A 2L08A 4QZVB 3A4TA 5CYMB 3MEDA 1UFKA 1ZAWA 2EKYA 3MAHA 3KK2A 4NCAA 1K0TA 4X62F 1T9WA 5MLCV 2W8KA 3IAM9 1HIYA 3IN5A 5IOLA 2XQCA 3DLKB 3PZPA 3A8KA 1GH8A 4ZKAA 3Q24A 3RR8A 3R27A 5FJ4A 3D5MA 1HBMA 2ZBPA 5J2NA 3AD8C 3W5ZA 4DOZA 2JC0A 1TV6B 2GZOA 2PGCA 2VG5A 3M2UB 3PHEA 3KLHB 5CD4A 2OSQA 2H5IB 1Q1KA 1VK8A 1UP1A 3PVXA 1XMQJ 2CQ0A 4KO0B 2R7RA 2ILYA 4B9VA 3OLBA 3JAMU 3L95X 4OLOA 1YRTA 2PT0A 2VDHA 3D9BA 3M2VB 4O3QA 3OVSA 1KP6A 4LF9F 2ZH2A 3MD1A 2GC8A 5DLGA 2MKHA 3MM5A 1WI8A 4A48A 4ZLJA 4QWEA 3DI6A 2M5YA 2HQ3A 1RKIA 4DFPA 1VBYA 2E5HA 1OJ4A 3HHLD 5K14A 2AYEA 2FQQB 1RT4A 2ZZTA 4F0HA 2ZEJA 1MU2B 5IT4A 2H65B 3D1QA 5A8RB 2ZM6J 4ECZA 4Q8EA 4IQMA 4G3IA 2LEAA 4LT6A 1SC1B 1QD1A 4QIWD 3UD4P 2UVVA 4EU0A 5D3GA 3C16A 3DLLQ 4WTYA 5KFBA 2XNRA 5KFTA 3D28A 4ECSA 5T41A 2ZJRQ 1KFSA 3AJ1A 2NZ4A 1MWYA 3QPIA 2DGUA 2ZH7A 3OTOF 3T1YJ 2VBZA 4YB1P 4DU8A 4YS2A 2W2QP 2FHKA 1IQTA 4EO6A 3LPEA 2OPRA 4FKYA 1VQ6S 2XHWA 3CCLS 2G9OA 4A8KA 2VBXA 4PQUA 1S1XB 2V69A 3C15B 1RLCL 2DISA 2DB1A 3Q0AA 3MHYA 2OTLS 2FHMA 1YGYA 3BREA 3W2VB 4DQQA 4DR5J 1NXIA 1JKHA 3BB5A 1O0PA 2HGMA 2BW7A 1I51B 2CQPA 4LIRA 5CHCB 2GAGC 1JNZB 5AE2A 4DR5F 3OTDA 4NCGB 1S1UA 5K8NA 1IKVA 2BX6A 2HFVA 2HBQB 3KMSA 1NHKL 4EYIB 1Y11A 3CB4A 1OYDA 1QSLA 4ZVUB 2VASA 3K2YA 4P2MA 3UNGC 5D78A 4YFUA 2FZGB 2HNDB 2BVZA 3CDBA 5CYQA 1U1PA 2NSBA 1LQ9A 5GMKa 3F56A 4YQWA 3CMAS 3R1LA 1KBRA 3TQEA 2ZVSA 2Y3YA 1DTTA 3CSKA 1WOPA 5D4PA 1R43A 3DGPA 3C66A 1NJIT 1MMNA 4KHRA 4CH1A 3J7Z5 4CWBA 5HQMA 3QMQA 4AL7A 2GMJA 4ATNA 4JI6J 1T9XA 3C6UA 2V5HG 3NGSA 1UCNA 3DLJA 4A4JA 2IJRA 4OV6A 3O6QA 1XR6A 2B4PA 3R2CJ 2DK2A 2AJFE 2M2BA 2W25A 1TZ0A 3CD0A 5BR8J 2R9LA 1GMVA 2OI2A 2HBYB 4AXIA 2GJ2A 2CPXA 3I9ZA 3V4IB 4KJIA 2CPZA 4B9MA 2WBRA 2LEBA 1XC9A 2MZTA 4LQ3A 4DUZJ 4DR2J 4MKVA 2LDYA 5L9NA 2RUGA 3VQSA 4OYPA 3BSNA 3RRGA 1JLAA 3CJSA 3SBMA 1QAXA 1S59A 2Y9HA 2DRAA 3LO3A 1E6VA 2C3YA 2UVRA 1Y5IB 5K8OA 1FK9A 1T9VA 3ZTOA 2QMUB 1WEXA 2AT1B 1UA1A 4HH0A 1I94F 2DR9A 1IKYB 1XNRF 4L3NA 3SV3A 1NDLA 2WOMB 2VFUA 1FKPB 3TO8A 1JLQB 2KT3A 1WWHA 1P1LA 4PXDA 1K9MT 2QZ8A 5EUHA 2DITA 3WHIA 2B4UA 2MQ8A 1TELA 4X66F 1FDDA 2POKA 4GKKF 4WZMA 2GA7A 2WVEA 1NUEA 4M5IA 1NB2A 1C4AA 1AB8A 2MJNA 1GNKA 3F0NA 3FNNA 3PJ9A 2R8GA 1F3FA 1HR0F 3NRBA 2AZ3A 3E3XA 3NAIA 5KT4A 2YY3A 2BYCA 1TKZB 2WVBA 4OI2A 3VZIA 4Y65A 3TUIC 2ZD1A 3V4MA 3BGFA 2A2CA 3IBFB 3MURP 3H25A 5IQ6A 2LP4A 2WRMA 3ENAA 4DCOB 3GQCA 2FB0A 1Q7YT 3B82A 3TA0A 5EWEA 1HPZB 2GS8A 1TL3B 2W4CA 4FPRA 2UU9J 1HL6A 2H4WB 1FWPA 3AJDA 1QM9A 3CE8A 3DC2A 4DFKA 1K73T 4LFCJ 2XY6A 2BKPA 1N5TA 2M52A 3SQOP 3M32B 4R5PA 2IM3A 4WFAQ 4DSFA 2OUGA 1AT1B 1YG0A 5KT3A 1FF2A 4N41A 1YJUA 2ZFHA 5B0EA 2MXYA 3BJYA 2YNHA 4X64J 2XMKA 3N79A 3PR5B 1OQ6A 3KLFB 2PEBA 1Z2ZA 3H5UA 1VQKS 2QE5A 4GVBA 2X3GA 1S4EA 1WHXA 1SJ1A 4PXEA 4ICLB 1MLAA 3SQGB 1RAFB 4NLWA 4OHVA 2NXCA 2N3LA 4YB5A 1R8PA 2DHHA 1RE1B 4DV7J 1N0VC 3FK4A 5DM7Q 4EUVA 2E1CA 4V19X 4P74A 5C25B 3N5FA 4QR0A 4I69A 1MNEA 3T9NA 4MYUA 5SUHA 3I0RB 5M2UA 5HATA 5GAEU 2BANA 5THWA 4UZBA 3V6DB 1YJWS 1TKDA 3CC4S 3N6LA 1QAYA 2XMTA 1FKAF 1Y5LB 4RW6B 4UT4A 3A3NB 3K17A 2J6SA 1JLFA 1OQ3A 1FRKA 1QJHA 2E29A 3HZEA 2RRNA 3PACA 1RWMB 2Y1LB 2XO7A 2AGQA 1TL4A 4Z7YA 2BM1A 3D6TB 4WXWA 4WKYA 5J1EB 3FFIB 4AT1B 2VQFF 2FJWA 2LYVA 2HRTA 2D7SA 5KOXA 1JXVA 1LWCA 2X3DA 4KKOA 3VQTA 3MM5B 5LJ3Y 1J2VA 4CLFA 4P9SA 3R5JB 1ZS6A 2FHJA 2GIFA 4IH7A 2Q1LA 4RPFA 4CYUB 5ADZA 4C2MA 1VQ5S 1KKHA 5DO2A 4RNFA 4CM2A 1H7WA 2EKNA 3VAMA 1YI2S 2J0WA 2DBBA 2V8PA 2ZJQQ 2IDLA 1SQEA 2KRRA 3G87A 4PR6A 1KQKA 1X7VA 2JHEA 2MTLA 3MM9A 3TW0A 1WORA 2WB4A 4DV0J 2A6OA 4DR4J 3CIMA 1NH8A 3ELHA 4JI3J 5DS7A 4DN0A 2B7BB 2RAQA 2VUGA 3QFHA 4ZPTR 2PIIA 1S0NA 2FYXA 4JI0F 1SI9A 4Z7CA 1U02A 3VAGA 3EDRB 2DIUA 1TK8A 3GYXB 4LFAF 2XMVA 4B08A 1S97A 3N6MA 5F9LA 4LF1A 2ZH3A 1WC6A 2QLXA 3ISND 1HQUA 3DKDA 2DY1A 3KK3A 4N8NA 3QAUA 3W2VA 1M1GA 3JTOA 4RO0A 1F1BB 4WTOB 3J7ZT 2P2CB 3GIMA 3EGWB 3MR5A 1E6YA 5K5MA 1AFIA 3Q8UA 1Z4UA 2EFQA 2AV5A 1R8AA 3CMQA 2P6SA 5U47A 3DRPA 1N34J 2GO8A 2IYIA 1KLMB 2KDOA 1EP4A 3IAS9 4TXSA 3O44A 2R7XA 1WI6A 1VHFA 3M8PA 2HFZA 4K4YA 2ZZNA 2N82B 1HNZJ 1RAEB 2LA6A 2QYGA 3AD9C 3UVJB 3QT5A 4CLWA 3RJMB 4DCPB 4L74A 1T9YA 4DX5A 1Q53A 2MGZB 3OSPA 1M5VC 2FVRA 2C22A 4F4YA 4N76A 1NH7A 4BLGA 2L41A 2HK2A 4E8UA 1QLNA 3W8GA 2VQEF 5D0RA 4ALZA 3RAXA 2YX4A 4A8MP 1HYSB 1RCOB 2DGSA 1UETA 4JYAF 1HBNB 5AXKA 3ENVA 4G1QA 1PYSB 5D77A 2R7UA 2OMOA 5IS2A 3UR0A 4DG1B 2QLFB 4DSIA 5HMYA 4DUTA 2MYFA 3D2WA 5DRKA 3QGIA 4KH1B 5ETLA 4JI6F 3PJXA 4PXCA 5B09A 4RNMA 2RU3A 1WOOA 1BXNA 1TL1A 4ID5A 4OZ0A 4IH6A 2KM8C 4X2BA 1RU2A 4HACB 2H5JB 1JXEA 1DY3A 1QE1B 1UEUA 2DKOB 1CJTB 2LA4A 2OD4A 4LREA 5KFYA 2EG1A 2RILA 1QUPA 3IA0A 3ILIA 3GR0A 4QPTA 4UOFA 1IKYA 1IBKF 5HBMA 4HKQA 2RDJA 1XMBA 2DNZA 3LAMA 2AD9A 4YDXA 5A0YA 2D3OR 1RAGB 1X5PA 2U1AA 4WE1B 4WP8A 2L48A 1NSQA 1U7LA 3M7VA 4UY85 3DRSA 2YVSA 1SIWB 1J5OA 4AE5A 2VDIA 4O4RA 1VC0A 1AW0A 4M5JA 1SKSA 1SV5A 1TUGB 1S6OA 2H5EA 4OIXA 1ZTTA 4PWDA 3HZGA 1MWZA 4USTA 2LQJA 2KU7A 2AW0A 3NEKA 2CPDA 4KSEB 3AOCA 3G86A 2BE2A 4ZK7M 4OX9J 2P5VA 2R8IA 1UVIA 3CULA 3A8JA 3FEXB 3CD7A 5CABA 3T19A 5HQLA 1AXQA 1NO8A 1S9GB 3B6BA 3GCXP 1X0FA 1JX4A 3KTQA 2F4VF 2NR0A 1Z1ZA 2B4OA 1X5OA 1I1GA 1FVQA 4I2QA 1YDLA 3SCKE 4QYZJ 5GAHI 4R5PB 2HHWA 5KFOA 1RHMB 4H4KC 2YNFB 4LVOP 3EGZA 2CNKB 2JJ4D 1SH2A 3UR3C 1X4BA 5DZ6A 3T1YF 1R0AA 1K8AT 5KFUA 1QSSA 3W3SA 4DQRA 4X4UA 1NBEB 4GKKJ 1H38A 4CH7A 4R8UA 3ZC4A 1FFSB 2GMHA 4HLBA 1REVA 2WSFC 1Y3KA 2I1RA 1HW9A 2VJVA 1FHTA 4UTGA 2OJ3A 3NLCA 3MMCA 1EX8A 3MFHA 1YX2A 1T03B 3N0VA 2Y1IA 3HSDA 5JXSA 4B9NA 4PG7A 4K2JA 2MQLA 3CJ0A 4JI5F 1LWXA 3W1YC 3F41A 4CO5A 3W63A 2XTJP 1ZOTA 3GV8B 4PAAA 1GT8A 3DMJB 1U0HA 2HGLA 2IPOB 1S1WA 2O5DA 3HSGA 4C0OC 5AXNA 4F2SA 4ZPCA 4F36A 4ZN3A 5IC4B 1T3OA 4LFBJ 3THVA 4K50A 1C0TA 3FSIA 3SDEA 2UUBJ 4FF1A 2GW8A 3OR2A 4K5RA 4URGA 3TR5A 3HLUA 2FJXA 4LF5J 2DNHA 3MEDB 4OI6A 3SSQA 2DNPA 2B9WA 1IN0A 2ATLA 3T6BA 4JI7F 2YQ1A 4JV0A 2HEKA 2R2RA 3CDUA 2GGPB 5HMWA 2ACMA 3CD5A 2HK3A 3JSMB 2DO4A 2P6TA 3IM9A 4OYXA 3ENWA 4MMOA 2KXNB 3H40A 2LQ8A 5F8JA 2CQDA 5C2GA 1HNVA 2XMUA 1FKOA 1RHRB 2Z57B 2L3MA 2GIQA 3CJTA 4P7TA 2ABYA 3IBWA 2VA2A 4PRFA 1MSWD 2MZQA 3CCMS 2DHXA 1JLBA 5A8KB 2BR0A 1FJGJ 4B3RJ 2HSEB 5DDOC 1XN9A 3TWZA 1WUUA 2CVEA 3CT9A 4ZIVA 3H5YA 3K5LA 1IJFB 3MF5A 3MUVP 1S10A 3H98A 2XZWA 1UVLA 1N0UA 4N8OA 4WK3A 2JZ5A 1JK9B 4LMZA 1T02A 4M5MA 3MMAA 3CD6S 1P8GA 1WHYA 3PO5A 1C0UB 3D7SB 4KR0B 4PXBA 2BE9B 3E2EA 2W8LA 1DQAA 3BDEA 2BM0A 2KI2A 4L72B 1HQ2A 2M9KA 2X51A 5T7LA 2BACA 3TAMB 1JJ2R 3Q22A 2V0NA 2AEFA 2HS3A 2ERRA 4RUBA 4QQBA 3CCSS 2XGQA 4UW2A 1UKUA 4F4AA 5I3PA 2APOA 1H2TZ 4O3PA 1VQ4S 1SH3A 2LQ9A 3OFGA 3W2WB 1W26A 2XHCA 2ZBCA 4RWWA 2W9BA 1OY8A 3HK2A 3MM8A 4NZ0A 1I5OB 3Q2TC 4B3OA 4NA2A 1PAEX 3UVJA 3AAWB 3PY8A 5K20B 2HMIB 3POTB 2GQCA 2HZAA 4NL5A 3S8SA 2V8DA 2W9AA 1FXDA 1VISA 4YHHJ 7FDRA 2CPJA 2Y0SD 1JJCB 4IFVA 4DL5A 3HHKA 1N36J 1ZZFA 4ZJQA 5KFPA 4GVLA 1SCJB 1SJ4P 2VG7A 2ZUAA 2VL1A 2XGPA 5DG7A 1NK5A 1ZM9A 1OPIA 1S76D 3K0JA 2UXBF 1T8EA 1U47A 4M95A 4RBUA 1U49A 5C42A 2HHVA 4CT8A 4ED8A 1IBMF 4B3SF 1BQMA 1HNWJ 2FJDB 3K8VA 5KFZA 4CO0A 2MMYA 1B7YB 3T6JA 2W2OP 3OJSA 3NKYA 2CAJA 3RRKA 1FERA 3AB2B 1D3WA 3PHTA 2EG2A 4RW8A 2X1AA 3NS6A 5CZXA 2XY5A 1NKCA 4DV5F 4RUAA 1S57A 1MU2A 2BJ9A 5A8RA 4ZCIA 5KT5A 2PEHA 3UDLA 5KFQA 5HBMB 4A8XA 4O23A 1VS3A 4F50A 2WW8A 4Q0BB 3X3UA 4DPTA 3QBCA 2EFPA 3FMWA 4ELTA 4NLTA 4KGMA 3G8TA 2HNZA 5EX3A 1UZDA 4WBFA 2HYIB 1IJEB 3WIUA 4PUOA 5AJ3F 3JQKA 3DXSX 4M5NA 1XMOJ 1FK9B 2V94A 2Z2YB 2DNKA 1ZAVA 2XYHB 5KFDA 1TVRA 3DGVA 3I82A 2BJDA 2VH7A 4PWDB 4DL4A 4PQUB 1JLQA 1X60A 2E1RA 2HQFA 1S1XA 1TKTB 3C15A 5E33A 2HZCA 3KYLA 2JEJA 5BJRA 3DHWC 5ETSA 4RWXA 1JKHB 2FVCA 4KC5A 4LUBA 2HRYA 3TNVA 2JLFA 3D0GE 2W01A 4H4OA 3MPUB 5KG6A 2W9CB 3M9OB 3JYTA 3H4DA 2CFXA 1OMSA 4DUYF 4DV4J 4CLUA 4GC7A 3BSAA 4NMXA 2DT9A 3ZZPA 4DV2F 4DV3F 3PX4A 1S7IA 4C3LA 2RQMA 3KK2B 1EQ0A 1VQMS 2ASDA 2XSJA 3AFGA 1Q81T 1F5BA 1XIQA 3CGIA 5DLFA 2XMMA 1LV5A 3Q8PB 2KXHA 2EI5A 2CPFA 3HVAA 3QJLA 3KUGA 3HVTA 3HKZD 3TA2A 4QWAA 4ZJOA 2YX7A 1UA0A 3DRRB 2HVDA 5L1LA 1M5OC 1BUXA 4M94A 3MWBA 1UMJA 1FD2A 1W7WA 3S1TA 2B51A 3VAIA 3C2PA 4H54A 3JSBA 4KO0A 4UOHA 2BQRA 2UUCJ 1B0PA 1CVJA 4MKYA 2WBMA 1XMQF 2CJ9A 3THTA 2G0CA 4UUXA 2VIHA 2ZKTA 4HYKA 4HL9A 4WP3A 3SEOA 3V6KA 1IBMJ 1YQHA 4OHYA 4HVZA 2QC3A 2MQOA 3W5YA 1SB6A 2BOPA 1EB0A 2G13A 1RWUA 2E7XA 1N33F 4FYXB 2J6TA 2AJQA 3KWMA 4YMEA 2LQBA 5I42A 1N5YA 1PILA 1VRTB 3AOAA 2NZCA 3MOJB 1CJKA 3GU0A 5JVHQ 1CJVB 4P2XA 4C0BA 5LT5A 2ALZA 4OX7A 2B8QA 4IFYB 1VOMA 1BWEA 1HBUB 4CLZA 4H4MB 2KVIA 4LQ9A 3MEEA 5KFLA 4FBUA 4RW9A 2M88A 2RMLA 2WVDA 1DAXA 5E0OA 3QO9B 4MFBB 2QX0A 2HBZB 1H6KX 1SQGA 3JS9A 3CJRA 4JI3F 1PAUB 3JTNA 5E3CA 1CG2A 1HWJA 1ZA2B 2RQCA 5CYMA 1YRUA 1X9MA 2NXUA 3W9HA 1TAUA 1SIZA 1G3OA 5LSOA 3VZHA 2DHAA 1M5SA 1R7IA 1X4EA 3VTIA 4JI1F 2ZKUA 3TX0A 2PMZD 2MKCA 3R5AA 2K1RB 4PWWA 4OZJA 1S1TA 4WK1A 1IBLF 4AD6A 1U25A 1KQGB 5CA5A 4DL7A 3ITHA 4EFAC 4JI5J 3KHGA 2VONA 1EJ7L 5B0BA 4K5SA 3HMJG 3GSDA 4DX8H 4CT9A 2NUHA 4WXOA 2AF6A 1IKXA 3DGPB 4Y00A 3M2VA 2VQEJ 2RJZA 2XO6A 1IBLJ 1Q95G 3KLFA 4BBYA 3DI6B 1WF1A 4P75A 1ZM2A 1S6PB 1YJ9S 2BXJA 3M6XA 4U8VA 5L1IA 2W9BB 2LLZA 3QLHA 4L76A 5ETTA 1PC5A 3HVWA 2YKMA 1HQUB 2KKHA 3BO2A 2HAIA 3U7JA 3OFHA 5H9EK 2LXIA 5E5NA 2HLUA 3MZIA 1TUVA 4ELUA 1X9WA 3TJ9A 2XS7A 2OPQB 5D0GA 3H42A 1YJ7A 5FLXY 1XERA 4GRSA 5D0EA 4ECUA 2RS2A 1D09B 4QIFA 1HQEB 5EWGA 2BUNA 1KLMA 2DPJA 4RW6A 4IKAA 3D68A 1Y9OA 3KHLA 4C11A 4EGLA 2MZ1A 2VPWB 1SXLA 2ZJPQ 3GJRB 1APSA 4BS2A 4Q43A 3JSRA 3MPWA 4U7CA 4V19J 1L3UA 4K4SA 1F5AA 5A8WB 3M6VA 4LSLB 4MKBA 5HVFA 2OGUA 1WTBA 4J9NA 5HVGA 2A1BA 5B0GA 3M8RA 2B8PA 4OJ3A 2WTFA 3V6DA 1JLEB 3GONA 5FDLA 3FVYA 3BQ0A 3ETOA 3FUYA 3TANA 2D3O1 2IYGA 4IG0B 5K8MA 1WNEA 2WHOA 1EKSA 4NCGA 1MN9A 3MR2A 2RRBA 4WF9Q 4IQXA 2GQ2A 3K7RA 3KLIA 3R7BB 2FJAB 2LKZA 3DU6A 4N56A 3BGUA 1KLNA 2XS2A 1T05B 3SYZA 2OEMA 4M5DB 2E5GA 1UFWA 5KFSA 1RWKB 3CO9A 1K1QA 5D0HA 2GQQA 4RR5A 4PCQA 1U1RA 1FEHA 2EVZA 4HACA 3WX4A 3IR6B 2CQBA 1ZM3A 2XNQA 3AT1B 3UN3A 4XAKA 4LF7J 1M5KC 1HLWA 4NLDA 2BJ7A 2VU5A 1TVRB 4C8NA 1LK7A 2OIHA 1VLOA 5J2MB 2D1CA 2RKIB 3QSYB 1UEVA 4DPWA 3RW6A 4F4ZA 1TKTA 2DNRA 5H9FJ 1XBWA 4DZ6A 3P6YC 4ECWA 4JI1J 2NPIA 3QGHA 4F0KA 3MUMP 2LVWA 3HDSA 2ZITA 3PRDA 4CO4A 3U1NA 4ZS6A 3CCUS 3RGIA 3OVAA 1R0CB 1CULA 4B3RF 4O44A 4TVAB 4U95A 4F7VA 2D74B 4PWUA 5ETKA 2GHVC 2BQ3A 2E66A 3NCQA 2XSJB 4EYHB 1S9FA 1D9DA 2WOMA 2GV1A 2BA9A 4N5SA 2R8JA 2UXDJ 1YSJA 3QRQA 1YBUA 2KO1A 4U9RA 3AOBA 5A6WA 3IXQA 1IR0A 3P49B 2F7VA 2BJEA 1SJRA 2YKAA 3H7HB 3JTPA 4C8OA 2QA2A 1UW9A 4PPDA 5HAOA 3PW0A 3LGMA 4A46A 2EBEA 3BPSP 2D9OA 4K59A 2XMWA 1A6LA 3MMBB 1WG5A 2NXEA 4C6AA 2XCPA 5F0UA 3EPGA 4CLKA 2VBWA 4IRDA 3R7SB 2AMCB 2HNYB 1OIAA 2OP5A 3HHLA 4JV1A 1URNA 1FRHA 1RHUB 4C3MA 1CJUB 2W7OA 3MECB 2JLGA 3V6HA 3ISNC 3LP2A 5HP1A 3M2RA 4DR6J 1OWXA 3W66A 3C6UB 4RW4B 1WACA 2UUCF 1X4CA 2LXFA 1TL3A 3T1HJ 1N52B 1CS4A 2E1PA 2AIRB 3MR6A 2B3TB 1VJQA 3C8YA 2KVQE 4R0JA 2XBPA 5F3ZA 1VRTA 2JOQA 3JB9k 5I3QA 3V4IA 3OUYA 1UVKA 3I5CA 3Q86A 1HR0J 5AXMA 4IFYA 2KG1A 2RF2A 2ZWOA 4ECYA 1CC7A 3VGVA 4OI1A 1T3NA 5KFWA 2MSSA 3OHBA 1KHVA 4RKUC 4QWBA 2XLIA 3SXLA 2VC1A 3PYEA 3I32A 4USIA 4WZQA 1R27B 1FT8A 1GMWA 4B02A 3H5XA 3MCMA 1R31A 3ONQA 4J91A 1RCXB 2BRKA 1TK0A 5HMXA 1TMMA 2CZVC 2B43A 2EC2A 3EGVA 2B9YA 3PV8A 2G2YA 4LBPA 3TOQA 1JJHA 1FRJA 1NDCA 3C14B 3MCOA 2K1RA 1JWWA 3D54A 1S1TB 3W7BA 1T9UA 3NMRA 3I9V9 2JDJA 3AA9A 1TMJA 4M5LA 5HI7A 5A8KA 2RIJA 3H90A 3A8IA 4LF4F 4QU6A 1YLXA 3GG0A 3HD1A 3MPVA 4LRDA 4JI4F 3PYGA 1MW7A 4U8YA 2XSFA 5DQIA 4E98A 2HQCA 3RU0A 4ECXA 2JSXA 3K57A 2NS1B 3EICA 1OY6A 4ZVFA 4ZHRB 3G6ES 2YQ0A 1NK4A 1NK6A 2BEFA 2YNGA 4ILRA 3FC9A 4CIOA 3RZAA 3DLGA 4WJBA 4J9OA 1U8WA 2IVYA 5H9FK 1GQEA 4DL6A 3TAQA 2DGWA 2E9RX 4USMA 1HI1A 2DIVA 4DS4A 3US5A 2V8VA 3D66A 4EI2A 5J1PA 5JUMA 5GAHU 1EARA 2Z30B 2KHCA 2XULA 5HANA 2YWEA 2IY5B 4YN3B 3ZZRA 4DX7A 1TR0A 3PFOA 3O5TB 4M63A 1MWQA 2F8HA 3T1AA 5CCLA 4K4XA 1VQOS 1FXRA 3OD2A 2HAFA 2QYCA 2XWYA 1HQEA 4OJGA 2NXNA 3CCQS 4FBTA 1YK9A 1AFJA 4X64F 2YTCA 5ETMA 5AE1A 3OL8A 2QSFA 3R6LB 3E01B 5DDQC 2OFHX 4XDDA 1RTDA 5HROA 2FZCB 2ZBQA 3HCXA 2BJ3A 2Q66A 1D0EA 5KOWA 1ELOA 4LSNA 2DJWA 1NCLA 1BY9A 2V34A 1QUVA 4J90A 4IO1A 3KJNB 5LJ5Y 2FVPA 2C3PA 2RQKA 3DOMA 3MM7A 4HI2A 4I2PB 3OPKA 3PFEA 4LSZB 2ZVIA 1XR5A 3QYYA 4QR2A 4IG0A 5KFKA 4OJ1A 5KFAA 5H9EJ 3CPWR 2NREA 1X0PA 1FX2A 2ROEA 4FVCA 4Y2CA 4J9VA 3BQ2A 1YJVA 4JI2J 3IM8A 5LL6d 2FLLA 2HIYA 2OEKA 4OZNA 3IS9A 5C42B 2B7CB 5IT9Y 1CQNA 4U67Q 3MR3A 2CQHA 2EFGA 1CQMA 2LMIA 2A0FB 4IR1A 4M5GA 3ZZZA 4OJHA 1MMLA 3N5BA 1B99A 3BO4A 4FNHA 2ACYA 4Q2MA 3ENQA 2BJ1A 3MMJA 7AT1B 1RT2B 2QL5B 1O6XA 2QJ3A 3N28A 3U1LA 1FI4A 3UDCA 3GFZA 3OLAA 2ZH8A 4DUZF 5ETQA 1MN7A 1RT5B 3B4DA 4CNZA 3OW2R 1RT1A 3J81j 5J2MA 3LGNA 2PD1A 5KT2A 1U2CA 1C1CB 1TQLA 4TY9A 2C2ZB 3VF0B 4DV5J 4A8YA 2XZTB 3UN2A 4QIEA 5HVHA 1I94J 2X1FA 5KFGA 3TRGA 4CM0A 1NKEA 5L46A 2YH1A 1KNZA 1XJWB 1G7CB 5T7LB 4B3TF 1HPZA 3VALA 4ECTA 3PX6A 4LRBA 1REVB 1XEZA 4FP9A 2ADCA 1Y5NB 2PI4A 2HKEA 3P4UB 4DR2F 3PRBA 2FY1A 3HKWA 2MQNA 4Q2LA 2NSCA 4O44B 4A8WA 1CJTA 1I3OB 3CIZA 2V2KA 2VFVA 1HHQA 3WBZA 4XK8C 2PDAA 4X65F 2MKJA 2YNHB 4CO2A 4B9LA 1UFLA 2VOOA 2Q6BA 3B54A 3G2XA 3GSIA 4K4TA 3OL9A 1BLUA 4KT0C 4PQAA 1N32J 2QA4G 2LU1A 4I7FB 4NLPA 2DVIA 1Z2LA 2UV8G 3OFFA 4LRCA 4YB6A 5EWFA 1YTYA 1RAJA 1RAIB 2V8GA 6AT1B 2BZ2A 4FZVA 5L38A 2AQ4A 2PI5A 2P9GA 2VHGA 3F73A 1KRPA 3OV7A 2PSZA 3MTJA 3ZTSA 2AGPA 2CJQA 1U45A 2BANB 3KMQA 1FJGF 1GXLA 3CCTA 2CDQA 4NOHA 4ZVGA 4NLVA 1R89A 1WC1A 3KUHA 3FCWA 2BJ8A 3FBFA 5F8HA 1SKWA 3KK1A 1FKOB 1S9GA 4NEZA 2YBVA 3R5CA 4KAIA 2HZVA 2M8HA 2QLBB 3D3BJ 5DM6Q 2V4JA 4ZVRB 2N7CA 4P6QA 3Q8VA 4CTAA 4F0MA 1HBOA 3I87A 4WFBQ 2R2TA 1MG7A 2R7WA 3HHNB 2O1PA 3MEKA 4EO8A 5K8PA 3ETMA 2C1EB 2ROPA 4JUZA 4F04B 3J80Y 3HF5A 2C42A 5C2CA 4Q44A 3LWLA 1S0MA 4H4KA 1LFPA 2W2PP 3JAMY 3K59A 2EFOA 3R5DA 2D41A 1T03A 4JV5F 3LP0B 3D6MB 2FLPA 4OYOA 3M32A 2I0XA 5KFRA 4MT1A 2CPHA 4OZ5A 4N77A 3CF5Q 1BMQB 1RK8A 4G1IA 5LMNF 3ZTQA 1HNXF 2PFFB 5B0DA 1FNOA 2SXLA 5J2PA 3DMJA 4RNHA 4UF4A 1TKXB 2M4MA 4DSLA 3TAPA 1RISA 3EYZA 2YNIB 4Q45A 4NZ6A 1UW4A 2DTJA 1DARA 2KFYA 3UCUP 3AY0A 2HFNA 4CZCA 3R1HA 4WFYA 3CCES 1LW2B 1XQIA 1HMVB 2B5JA 1CSJA 3KLGB 4QR1A 2OAUA 4IYQA 1X4AA 1RBLA 4HTIA 4A8OA 2KL8A 1GMUA 5KTQA 3SIPB 1ULRA 1RZMA 4WU2A 3WIVA 4RU9A 2XZDB 1S6UA 3JSMA 3DRPB 1PSDA 1B4SA 3TP2A 1OYEA 2MQQA 4OHXA 4LF4J 2J8SA 3ITHB 1JLFB 3OL6A 1JJ4A 3IBCB 3IC1A 3ZZUA 2QIFA 1PJ7A 1KN6A 3D1HA 2ZNZA 3EUNA 4I6WA 5G4DA 5HQ8A 1RTHA 4YY3F 1RT6B 2MQMA 2WONA 1LNQA 2HWIA 3FBBA 3NGTA 4PKDB 2DNOA 3N4WA 4QW9A 1UL3A 4CRJA 1HWIA 2VKRA 3M30B 5B0FA 3AB4B 2V8HA 2ZOMA 2EXUA 3RTVA 3H2UB 1DTQA 3LOUA 3R97A 2HQGA 4OYBA 4C9DA 5DGAA 2C2KB 2H54B 2EK6A 1RXOB 3NOGA 1T95A 3BN7A 3QLHB 1WD6A 2OELA 4KH0B 4O4GB 2W4DA 2CWKA 4BWMA 4ZCMA 3MUTP 1SVDA 1C0UA 2J9CA 1IXKA 2XCAA 5ETVA 3SV4A 3HHLC 2DO0A 4RNOA 1CJKB 8ATCB 1QAIA 4EZ9A 4C4WA 1D8YA 1CJVA 4HEA9 1NU4A 1S1WB 1JB0C 1VIOA 3NCPA 4OYAA 2DH7A 2GFFA 4Y6IA 3PR4A 4KGZB 2JLEA 4ZPDA 1VC6A 4ECRA 3D4JA 1LWFB 3BH7B 5JJBA 4X4TA 3G4SS 4WPAA 2ZDOA 3KKFA 5CYJA 2QV6A 5KFXA 1RUSA 4X4QA 2DXDA 4I68A 1UVMA 3KG4A 1TL7A 1NJWA 2W4PA 4DZDA 4NLYA 2DXFA 5AE3A 3VGTA 4DU7A 2Y1RI 5LXRA 2R2UA 4ZITA 3VAJA 4A8SA 4QYZK 2PE8A 2OPPA 2IBKA 3GWCA 1RBOB 3CNQP 1BQNA 4JOUA 4LF7F 3DM2B 4NWBA 4CO1A 4OLPA 1W2BR 2KRBA 2WK4A 3BR8A 1HNVB 2V63A 3SCLE 4MIAA 4IUFA 1EIYB 1RWOB 4ILMA 4YP3A 2Q79A 5LMUJ 1RT1B 1JLBB 3TVYA 1J5EJ 4LFAJ 2D3ZA 4LRFA 2PMWA 1RTZA 2VG7B 1GK8A 4M8LA 4M5DA 1T05A 1W2IA 4NXNF 3LH2S 3WDOA 3W60A 2MGZA 1LK5A 3M6WA 3L3CA 2MB0B 5DETA 5CXTA 2E9ZA 1R3NA 4QCLA 2FJEB 2VG6A 3FQLA 1X9SA 2VPZB 3UD5A 1UJ6A 2JEFA 4AL5A 4KB7A 4M5HA 4ZP8A 2E1AA 5L9XA 3KJFB 5KFMA 4OX9F 3HVRA 1NJXA 1WF2A 4ETZA 3CCJS 2CG4A 3LUYA 3OJUA 2CIMA 3SCJE 3W64A 4DSJA 1BE4A 2AEMA 3BS9A 2NYIA 3DRYA 2BV3A 2J9EA 1Q78A 2QFIA 2DR8A 4X84A 1ZTWA 1WDDA 4RLEA 4QIGA 6FD1A 1SKUB 1TL1B 2HVEA 3IR7B 2CJXB 3LF0A 3P3DA 3QATA 2I6WA 5F8LA 1NK8A 4X4NA 1UJ5A 2FLOA 4PUOB 3CO0P 1UVNA 3CUNA 1KHWA 1QE1A 2K3KA 3MFIA 2HW3A 1S6QB 4MJKA 4ZA1A 4UUWA 2R3VA 1S77D 2XG8A 1BC6A 3BEGB 2IIHA 3W9JA 4J9SA 5D15A 2CJAA 2AYMA 1N5YB 1ZA1B 2OHDA 1UVJA 2HHTA 4OI4A 4LF5F 4P72A 5F8MA 5KG1A 2Z2LA 1W25A 2OFGX 4KYZA 4WYLA 4XPCA 4F2RA 1A0OB 3GJTB 3OFEA 4A8QA 2FHJD 3U27A 2X1GA 2V68A 4Q5VA 3RB0A 3KG0A 4KQZA 1N88A 2M8DB 2MLYA 5B0AA 1TP7A 1OSCA 2DGTA 2F4FA 5C24A 4IFVB 8AT1B 2IC3B 2WVCA 4P2FA 1F0XA 3GZ7A 4OZ3A 2VV5A 2XMAA 2V4JB 5M2RA 3I4HX 3Q23A 2BOAA 3QAEA 3AA8A 2G0JA 4F25A 3UW1A 2IAJA 1BQMB 2DGOA 2WB1D 1SJFA 1FJEB 1EQMA 1R8CA 4ZVSB 2CXEA 2FDNA 3JQMA 2M0GB 1NMEB 1H7XA 4ZP6A 3ZXWA 5EX0A 4YY3J
chains in the Genus database with same CATH topology
3DN9A 2COLA 2CKWA 1U6FA 3NG8A 4GO5X 1WG1A 2DRBA 2MY7A 4CNYA 3KLEA 4DR6F 3IWNC 3Q2SC 4DHVA 5BYQA 5F8NA 1SC6A 3LANA 2ZH1A 3IGVA 5B0CA 2ZDPA 4Z2XA 2XS5A 2MZRA 2KG0A 2OTJS 3KLGA 2J7KA 4ELVA 4MAKA 2DH9A 5I42B 3HXMA 1J5EF 3B78A 3NMAA 3TAMA 1SJ3P 3I55S 3UE2A 1C4CA 3MDFA 4F3MA 2UUWA 1UAWA 4ED7A 4PG8A 4F8RA 3P6YC 4DN9A 1Y7PA 3IRXA 4BC7A 3G8QA 3OVBA 2VZ9A 2KFNA 4IG3A 2U2FA 2YKOA 5HO4A 1NJYA 4C8KA 3LPYA 4EZ6A 1FTRA 4K4UA 3AHPA 4IOCQ 4O3RA 3TX8A 2IMWP 3QZ8A 4Y2IA 3PKMA 1VRUA 3CJ4A 4I1TA 2V4QA 2HMIA 4BC9A 2DHGA 4WFNQ 2RU9A 3E51A 2E44A 4ZHRA 2HHPA 1FCAA 3L7PA 3CDAA 1PO6A 4ZPWR 4M1KA 1VC5A 1L3SA 2AU0A 3G9CA 1QVGR 2WAQD 4O4GA 2AYGA 3EGNA 2B6AA 1S99A 3NBPB 1EETA 1RTIA 2RDIA 2RVJA 1T94A 5A6PA 5HLFA 4PPZA 4NLSA 2P9CA 5E3PA 5CD4H 1NK9A 3GIIA 4YR3A 2PN6A 1S9EA 1FEEA 2CQ1A 3PIPQ 4B9SA 2CZ4A 5SZTA 3CJ2A 2QA4S 3GFHA 4URQU 4OX8A 3THPA 1WG4A 1U4BA 4LSNB 4O0IA 4OZLA 4TLRA 6FDRA 4TU9A 2ZHAA 2NUUG 1BQNB 1N34F 2OPQA 1K0VA 1FESA 4UY8T 3TARA 2JEGA 3G71S 1GXTA 3BGRA 2VFRA 1MROB 2MKIA 1N33F 3D0IE 1LW0A 2FC9A 1O5JA 2UUTA 3SXLA 2LQ5A 2QT7A 4NRUA 1NAQA 2UVWA 3DOKB 4F26A 1U6ZA 2KHDA 2W24A 1LXJA 3QGPA 1NZAA 4YDDB 2AYBA 3RR7A 2UXCF 3F44A 2PMHA 3CWJA 4Y3CA 4FXDA 3I5AA 3FRYA 5F41A 3CVKA 1YJTA 1JLEA 5FDLB 3EX7B 1H0HB 1N54B 3VR1A 2VD3A 3KLIB 1C1CA 2J6UA 1WF0A 5KFJA 1SH0A 1M1KT 1YJRA 3LQVA 5K9FA 1KTQA 3MM6A 2RE1A 2IVMA 1U1OA 3U1MA 3ULHA 3UCZP 3RBEA 5HP1B 3BF4A 3PW5A 2VPYB 5IT0A 1M90T 4FNIA 2JEIA 2BW2A 3O8WA 1HNIB 3D0HE 4LVNP 1AUDA 3IG1B 4RW7B 2E5IA 4C8YA 1S1VA 1Q16B 2FJBB 2O67A 4O3NA 4DV4F 4DFJA 3BZQA 4RBTA 1N8RT 1RP5A 2F9DA 3OUYB 3FRZA 3C3LA 5L1JA 2EWHA 1GX6A 4BCAA 1B64A 5IFMA 2HNZB 4C0HA 3RB4A 2YWHA 3MM7B 1OPZA 2DGXA 1F5CA 2CQCA 3NGKA 4KRWA 2KB2A 3N9UC 1B0VA 4TY8B 5BR8F 2BDPA 1KR4A 2OO4A 1RT3B 4WIIA 3HT3A 3NNHA 4OFZA 1HA1A 4HH1A 2ZH9A 3J7YU 1NK0A 1FVSA 5DG9A 2XEXA 4ZCLA 5CQGA 3QIPB 1D1UA 4ZPVR 2WSCC 4NLQA 2J5AA 4Q8FA 2V4RA 1N36F 2WSEC 4MH8A 5GVQA 4AL6A 2KZZA 3LAKA 1KOHA 3QIDA 5JVGQ 4K4VA 2CJBA 4C7QA 3OQ2A 5C5JA 3Q8RB 3CEDA 3T5KA 3GG1A 2HLTA 4HTJA 1ZAXA