3HVAA

Crystal structure of fimx ggdef domain from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
VSSQDPVTGLYNRSHFLDLMDAAVQQAVTARKPSTLAYIHLNGYPSLQADHGLSGIDLLLGQLAGLMREQFGEEADLARFGDSIFAALFKGKTPEQAQAALQRLLKKVENHLFELNGRSAQATLSIGVAGLDEKTAKAQDVMNRAHRCADDAARKGGSQIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein FimX
publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
source organism Pseudomonas aeruginosa pao1
molecule tags Transferase
total genus 53
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvaA00
2RF2B 5KFXA 3RB4A 3V4IA 3E01A 4O44B 1HPZB 2HNDA 2YNIB 3DOKA 3PVXA 3UQSA 5HROB 1S9EB 1TV6A 2ILYA 3JYTA 5C25A 4PWDA 4WYLA 1RT3A 5DG8A 4TXSA 1TL3B 3FFIB 4K4YA 1QAIA 1KLMB 1U09A 2HNZB 1IKVA 4IG3B 3MTKA 2IAJB 3LAMA 2BANA 3QIDA 2BRLA 2GIRA 3QO9B 3H5SA 4DEZA 4I7FA 4YP3A 3NBPB 1HNVB 2YKNA 3BSCA 1RTHA 4G1QA 3KLEB 1HQEB 3SI8A 2OPQB 2J6UA 5CYQA 4MFBB 2XI2A 4JV1A 3BGRB 1CSJA 3GILA 4LSLB 2O5DA 2C2DA 4O4RA 4R8UB 3BQ0A 4RNFA 5L1IA 5KFIA 3DOLB 2ALZA 3NAHA 2VG7A 2C28A 5HLFB 2R8JA 4KB7A 1GX6A 1XR6A 3M8PB 2W8KA 5KT4A 2J6SA 4ZPCA 1S48A 3KK3B 2W9BA 4ECVA 1S1XB 3LP1B 5C24B 2VA3A 4O3NA 5DGBA 3MEGB 3DRPB 2R8IA 4FBTA 1HQUB 5KFHA 4K4WA 1C0UB 2FLLA 1MMLA 2D3UA 2GIQA 3T5KA 1C1BB 1SH3A 1EP4A 4K4ZA 1T05A 4Q0BB 1NHUA 3CO9A 4RW4B 3SFUA 4K4UA 4HKQA 3DLEB 4R5PA 1TKTA 2HAIA 2IM2A 4YR3A 5C5JA 2V4QA 2OPSB 3MR5A 4KAIA 5J2NB 3C6UB 5JUMA 3GV8B 3I5CA 4EO6A 5HP1B 1TL1B 2IC3A 2WOMA 2FVCA 5KFBA 2WONA 3IGVA 3KHHA 3PW5A 1QUVA 3HHKA 4TN2A 1RTDA 4K4TA 4Q8EA 3NMAA 1HNIB 4TQSA 4F4YA 2OPPA 4RW7B 3QIPA 5KFLA 3DYAB 4ED8A 1N6QA 2HNYA 2XGPA 1S1VA 1RAJA 2R2RA 2IM3A 3FSIA 1DTQB 1ZTTA 1LWEA 4I2QA 1DLOA 4IH7A 3MR3A 1TKXA 5DQHA 2ATLA 2OH2A 4TY9A 2B5JB 2YKMA 3DLGB 4O4GA 1JX4A 4ZPDA 3I0SA 2FVSA 4J9SA 3TAMA 4KHRA 4KKOB 2IM1A 1BQMB 1S9FA 2OPRB 5F8JA 1REVB 3N6MA 1YVFA 1RTJA 3NGDA 1S9GA 2XCPA 4ZHRB 3ISNC 2ASJA 3H4BA 4PWDB 4EO8A 1RT3B 5KG4A 4H4MA 4GC6A 4J9PA 4IG0B 3OLBA 3QGGA 4EBDA 1T3NA 4NLWA 2IM0A 2D41A 3OSPA 1JLQA 3C6TB 1JXLA 2CJQA 5DLGA 5K14B 1S49A 1FK9B 5KT3A 1VRTB 1N5YA 1SH2A 5J1EA 3H5XA 3OSNA 4ED6A 3HVTB 1LW0A 2D3ZA 4IFVA 4DG1A 4O3SA 3FQLA 4LQ3A 3MEEA 1S10A 2VG5B 2ASDA 3DRSA 3QLHA 4KSEB 4Q8FA 3V81A 5KFTA 1VRUB 2V0NA 5F8MA 3D5MA 2F8EX 4EEYA 2DPJA 3V6JA 2ASLA 2FLPA 2JLEA 4RW6B 4FS1A 1HARA 1HMVA 3DMJB 4WXOA 3MECA 2XGQA 4IRKA 4M94A 4RZRA 2XI3A 3LP0A 1RTIA 5CYMA 5KFNA 3CIZA 4DL6A 3KNAA 3PJWA 3GIMA 3BSOA 4ECSA 1BQNA 3IGNA 2EC0A 4IOBA 4RNHA 3QYYA 3OL9A 4YR2A 1J5OA 1HYSB 4YMEA 5F8NA 1IKXA 4ID5B 4F4WA 5DGAA 1XR5A 2VG6A 2YNGA 1SH0A 3M8QA 3PHEA 3EPIA 4IR1A 5EWFA 4I2PA 2IJNA 1S4FA 4KE5A 1T03B 4IFYA 4U6PA 4TQRA 1RT6B 3IRXB 3KLHB 2V4RA 3G6XA 4K4XA 1ZTWA 5KFYA 3KK2A 4ECWA 4QWAA 1IKYB 2YNHB 4ZVGA 1JLFB 1UWBB 3UR0A 2AX1A 2BE2A 1JLGA 2AGOA 1QAJA 5D3GA 3KHRA 4TLRA 1MU2A 4NLVA 2B6AA 3DI6A 2ZD1B 4J9QA 5L1KA 4TY8A 3PR5B 1FKPA 5FDLA 3JSMB 2UUWA 4WFXA 1RT7A 4IRDA 4HYKA 4QWCA 3RBEA 2UUTA 2CKWA 4URGA 2ZE2A 3UDLA 1IKWA 1TKXB 4ECUA 5HBMA 1S6QB 2W9CA 4RW9B 2I5JA 4Y2AA 4ZP8A 2FJWA 4NLPA 2C2RA 2JC0A 4ECXA 5J2PA 3E51A 4RNMA 4IDKA 3QZ8A 3BSNA 5KFRA 1S6PA 2AGPA 1C1CB 4WYWA 2VA2A 5KFZA 2C22A 4WFZA 2RKIA 3ISND 4Q43A 3OHBA 2W7OA 3CDEA 2JEIA 4ZMMA 5DLFA 1TKZA 4DL7A 1JLCA 1RT4A 2AWZA 3HVWA 4URSA 4J9LA 1DTTA 3BJYA 2YNFA 1C2PA 5I3UB 1JLEB 4FBUA 4J9OA 4NZ0A 3Q8PB 3LP2A 1RT2A 1TP7A 5J2QA 2HMIB 4B3OB 3KMQA 1RYSA 2JC1A 3DRRB 4ZVHA 1S1TA 1RA6A 3LANA 4F50A 3MEDA 3QLHB 4MK9A 5KFFA 3KLFA 1JLAA 4PQUB 4H4OB 3V81B 4ED7A 2JEJA 3DM2B 4LSNB 1QE1B 2C2EA 4WE1A 5KFDA 3PZPA 5KFJA 4PUOA 4RNOA 4WZQA 3H4DA 3MECB 2FJVA 5CYMB 4H54A 4MIBA 1C0TB 3KK1B 3VQSA 2UVUA 4KV8A 4NLOA 4ICLA 1RT5A 1LWFB 3QGIA 3Q8QB 2FVQA 1LW2A 4ECQA 3EPGA 3M8QB 1S1WB 3CDWA 3MR2A 3IS9B 5KFQA 4KFBA 4J9KA 4IFYB 5T14A 3V6DA 3DLKA 3BQ2A 5J2MB 1N56A 4DL2A 3I0RB 4QPXA 1JKHA 5KT2A 5EDWA 2RF2A 3KLGB 5KG6A 5F8GA 2XWYA 1HPZA 3ITHB 2YNIA 3KLIA 5HROA 1S9EA 3G6VA 3E01B 3V4IB 1KHVA 2HNDB 4TYAA 2AGQA 1S1UA 2B43A 3DOKB 5KFVA 2E9RX 4TYBA 1TV6B 5EUHA 3JYTB 3BQ1A 1TL3A 3FFIA 5C25B 2W7PA 1KLMA 2HNZA 3DI6B 3H59A 5EWEA 3QO9A 4RNNA 2XC9A 4TY8B 1FKPB 1IKVB 4R0EA 1HNVA 3KHGA 4MK8A 3CJ4A 2BANB 2AX0A 4O3PA 4MIAA 4ZP6A 3Q8SB 4IH6A 4I7FB 2YKNB 2OPQA 1RTHB 4G1QB 4IKAA 4ZPBA 3BR9A 2WCXA 5EWGA 4MFBA 2J6TA 4Q45A 2E9TA 3BGRA 5CYQB 3T19A 4LSLA 4RUAA 3H2LA 1RYRA 5F9LA 4R8UA 5KG0A 4J9RA 2JEFA 1K1QA 3DOLA 2W8LA 3NL0A 3M9MB 5HLFA 3T5HA 5DG9A 3DDKA 2VG7B 1SUQA 3LAKA 5I42A 4ECYA 5KFUA 4ED2A 2BQ3A 5KG1A 4KO0A 2JEGA 3N6LA 3IG1A 1ZETA 4ECRA 3V6HA 4JV0A 3KK3A 2V9WA 3LP1A 5C24A 2W9BB 3MEGA 3DRPA 4K4SA 1HQUA 4O3QA 3I5BA 3LALA 2XCAA 4IR9A 1C0UA 3OLAA 5F9NA 1C1BA 5J2QB 4Q0BA 1LWCA 2BR0A 4RW4A 2W9AA 4NRUA 3BREA 1EP4B 4WXWA 1SV5A 2WK4A 3DLEA 3MEDB 3G6YA 1R0AA 4NYZA 5KFPA 1T05B 2FVPA 4U7CA 2OPSA 3MFHA 4R5PB 1TKTB 5J2NA 3C6UA 4NLSA 5HP1A 1TVRA 4ED3A 5KG7A 3KLVA 1TL1A 3CDUA 4G3IA 4RW8A 1EETA 5DQIA 5KFWA 2IC3B 2WOMB 4NLTA 1HNIA 2WONB 1RTDB 4RW7A 3DYAA 5DQGA 2OPPB 3QIPB 3RBDA 4K4VA 4NLRA 4QW8A 4F4XA 2HNYB 1N6QB 3GIKA 1S1VB 4ICLB 5KG5A 1DTQA 5KG2A 4Q44A 1KHWA 1TQLA 4ZVFA 2QE5A 4J9NA 3RB3A 1LWEB 4I2QB 1DLOB 2BQRA 3CVKA 4DL5A 3V6KA 1T94A 2B5JA 4JV2A 4OL8A 3H98A 3T5JA 2YKMB 5F8LA 2ZKUA 4KKOA 4O4GB 1BQMA 3I0SB 4ZVEA 3IN5A 2OPRA 1JKHB 5KG3A 3TAMB 4NLQA 3OHAA 4ZHRA 4ED0A 3KLIB 1RTJB 1S9GB 4NCGA 3PW2A 1S1UB 3SFGA 4IG0A 4YR0A 3NKYA 2R2TA 4H4MB 4EYIB 3RB0A 3D28A 3OL6A 2R2UA 4Y2CA 3C6TA 4O3OA 3PW0A 5K14A 3PJXA 4MKAA 1FK9A 1JLQB 1VRTA 1S97A 3KHLA 1NNDA 1XR7A 5KFEA 1N5YB 3HVTA 3G86A 5F8HA 2FJXA 5J1EB 3FQKA 3NAIA 1RDRA 1LW0B 4IFVB 4DG1B 2VG5A 1W25A 3MEEB 1D1UA 1RT1A 4KHMA 3CJ5A 3DRSB 1VRUA 1N4LA 4IQXA 4IRCA 4RW6A 4ECTA 1SUQB 3DMJA 5I42B 3TQ1A 4Y34A 3GIJA 3GQCA 2BRKA 4KO0B 1HMVB 5KFSA 4URQU 1IM4A 3IG1B 4MK7A 4EBCA 3RAXA 3LP0B 1RTIB 5KT6A 4EYHB 3I5AA 3ICLA 5C42A 2R8HA 4QWDA 3OL7A 1BQNB 2RDIA 4MH8A 1HYSA 5L1LA 5KFAA 4J9MA 2I1RA 4ID5A 3Q8RB 1FKOA 1JLBA 4NLYA 1J5OB 4NRTA 1IKXB 3MR6A 3CJ0A 4NLDA 2VG6B 2YNGB 4XO0A 1LWCB 2RDJA 3KJVA 5L1JA 1T03A 4I2PB 1RT6A 3IRXA 3KLHA 1R0AB 1SV5B 2R8KA 3PW4A 2IBKA 3RAQA 2R2SA 4WFYA 3HVAA 3KK1A 1IKYA 2YNHA 1JLFA 1UWBA 1TVRB 3KK2B 4O44A 5KFMA 2R8GA 2UVWA 2HWHA 4GC7A 3M9NB 4RW8B 2BE2B 4EBEA 1EETB 1JLGB 5D3GB 5KFKA 2IJFA 1MU2B 2ZD1A 2B6AB 4IG3A 3JSMA 2IAJA 2HWIA 2FLNA 5KFGA 2IMWP 3NBPA 5FDLB 3KLEA 1RT7B 1HQEA 4QW9A 2AQ4A 4KBIA 3RB6A 2ZE2B 1S6QA 1IKWB 5KFCA 5KT7A 4F4ZA 4RW9A 4FS2A 3OL8A 2AU0A 3FDSA 5HBMB 3KOAA 2W9CB 4MKBA 1N48A 4RU9A 1S0OA 3N6NA 2I5JB 1S0NA 1K1SA 1C1CA 2WRMA 5J2PB 4IDKB 1S6PB 4O3RA 2GC8A 2FVRA 3H5UA 4NCGB 4NLGA 2RKIB 3H40A 3M8PA 4QWEA 3MFIA 3TVKA 1D0EA 2E9ZA 5L9XA 4LQ9A 1TKZB 3T1AA 1JLCB 3KMSA 1RT4B 3GV7B 5I3UA 1JLEA 4YQWA 1DTTB 4ZP9A 1S1XA 2YNFB 1WNEA 1GX5A 4M95A 1I6JA 4ZP7A 4QWBA 3HKWA 4IH5A 3GYNA 2HMIA 4B3OA 5F8IA 5KFOA 3M9OB 3LP2B 1RT2B 3DRRA 2ILZA 2UVRA 1Z4UA 2DPIA 3BSAA 2IA6A 1NHVA 1S1TB 3EZUA 4PQUA 4H4OA 2UVVA 1RT1B 2WB4A 3DM2A 4LSNA 4X2BA 3CJ3A 3KLFB 4NLUA 1JLAB 1QE1A 3UPFA 4DL4A 4RUCA 3T5LA 4ECZA 4WE1B 3H5YA 1OS5A 3MF5A 3QZ7A 4PUOB 1C0TA 3PR4A 3GIIA 3GV5B 3QGHA 1JIHA 4JUZA 5JXSA 4DL3A 5C42B 4KV8B 1LWFA 5KT5A 5DG7A 2D7SA 1RT5B 2WTFA 4XPEA 1FKOB 1JLBB 1RA7A 4K50A 2WHOA 4WZMA 1S1WA 3PW7A 2BQUA 1LW2B 3IS9A 4NLXA 4Y3CA 3DLGA 3KJVB 4ED1A 3CJ2A 5J2MA 4KFBB 3CWJA 3I0RA 3V6DB 3DLKB 3KLGA 4XPCA 4ZPAA 1S0MA 1REVA 3ITHA 2QV6A 3FRZA
chains in the Genus database with same CATH superfamily
2NPIA 3E01A 3AD7C 5HROB 1FFWB 2Z56B 1GMWD 2HZVA 4LSZB 4J90A 1QAIA 1ICEB 2DEJA 1WHXA 1TUVA 4YY3F 3QIDA 3H5SA 3BSCA 3HK2A 2OPQB 1S5ZA 1BLUA 4QR1A 4MFBB 4OFZA 4O4RA 4R8UB 3W2VA 1PIEA 4CI0B 2B8PA 2Q6BA 2J6SA 3KK3B 2VA3A 2C3MA 4NEZA 3CSKA 4K4WA 2D3UA 4DFMA 4Q0BB 6FD1A 1YBUA 2JL9A 4EK2A 4A8OA 2MEWA 2VASA 4LRAA 5HP1B 2M88A 3I5CA 2HGLA 2IPOB 1QUVA 1VQ9S 4F4YA 2KKHA 1VYAA 1DTQB 4IH7A 3PACA 3P8BB 3NWRA 4NYOA 2P8IA 2OEMA 3FBFA 4KHRA 1BUXA 2V8VA 4P52A 4F3MA 1JWWA 4DF8A 4RPFA 4IG0B 3OLBA 1UEUA 2ZBQA 4OYIA 3OSPA 4ZS6A 1RU2A 2FHJD 1U47A 3RGIA 3WC0A 1T95A 2HQIA 3D1HA 3QAUA 4KSEB 4CLFA 1CPZA 1KQSR 3Q8VA 2HQGA 4ES1A 5CCLA 2ZBRA 3QYYA 2FHOB 2P6TA 2G0CA 2ZM6F 3MWBA 5THWA 2YNGA 2NCKL 3D68A 4QR0A 1WC5A 3NGKA 3CMAS 1QAJA 3VCDA 4F8RA 1F9EB 4WFXA 3SDEA 3NCRA 2ZE2A 2VJVA 5A2QU 2AJ4A 1RISA 2I5JA 4ZP8A 1HBNA 2QYCA 2UXBF 4I6YA 2RKIA 1U7LA 2QMUB 5I3UB 1AXQA 4ZJLA 2JC1A 5DDPC 2MB0B 3LQVA 4L75A 1AFIA 2GHPA 2DVIA 2UVUA 3WX4A 3A8JA 3BYRA 3B8HA 1RHQB 3S7RA 3IS9B 2YWKA 3SYZA 4CM2A 1H7WA 1FI4A 5B09A 1DQ9A 1MNEA 3MR7A 4LR9A 2ACYA 3H59A 3PDNA 2R42A 1KRPA 1IKVB 3DXBA 1T7PA 3HM9A 4IH6A 3FEZA 2EBEA 2VONA 1CJVA 2IVMA 1QTMA 1IBLJ 4OHZA 3TNVA 3HF5A 1SJ3P 1VR6A 2VHGA 3B54A 2D1CA 2OMOA 4LJMA 4RLEA 4A8MP 2ZH3A 4XDDA 4OHWA 4B3MF 4LF9F 2B7BB 3LWLA 4CTAA 4Y6IA 4U7CA 2OPSA 4KY3A 3D0HE 2EG2A 1YDLA 3DFEA 1EETA 1UP1A 4QW8A 1S76D 3CCUS 3OVSA 2H65B 5T7LA 3NGUA 4ZN1A 1NK7A 4M5IA 5F0WA 2V4JB 1WF1A 2BACA 1NSQA 2D3OR 2FJXA 1U8SA 2FHMA 1CULB 1W25A 3EZOA 4DR3F 6FDRA 1XMOJ 2WAQD 3ICLA 4BS2A 1L3TA 5ETRA 4QYZJ 4K2XA 4BLGA 2I1RA 1JLBA 2BKOA 2ZH7A 4HR2A 2OUGA 2LQ5A 3SMZA 1V3ZA 3M9NB 2DT9A 3PRDA 4P2XA 5CCMA 2VZ9A 4B9NA 3SBMA 4LRDA 1RABB 5KT7A 3FDSA 1K0TA 1KFSA 2VPYB 3I96A 1KTVA 1BXNA 2Z4PA 4M95A 1I6JA 4QIEA 4IH5A 3TUJC 2UVRA 4CH7A 4NCBA 3M2RA 4F02A 2A6OA 1LOUA 4WE1B 2KHCA 3P45B 1SC6A 4ZPVR 2RB7A 1LW2B 1KOOA 4Y3CA 2FDNA 4L3NA 4FVMA 1Y5NB 1EZZB 3TARA 4WYLA 4K4YA 2V67A 4I7FA 1GFWB 4G1QA 1U1QA 1CSJA 4A8SA 2C2DA 3QT7A 3BQ0A 5ETVA 2YPZA 3Q24A 2G0IA 4F2SA 5E33A 5DGBA 1C0UB 4G6VB 3CE8A 3CO9A 3NS5A 1Q7LB 3M6UA 3EM1A 5KFBA 2CXEA 4ED8A 1S1VA 5KAKA 1D9DA 1JJHA 3A8KA 4JI4J 3D7SB 3EGVA 1TKXA 2G2ZA 6AT1B 2P5VA 2VPZB 1RTJA 2EEYA 4DPYA 3AD9C 4LF7F 3TEHB 1MMNA 1ZM4A 4ANCA 1QM9A 1F6TA 3C14B 2VG5B 3I4HX 2ASDA 1NK0A 2DISA 3IBCB 5DS7A 1U1PA 3DMJB 3DNCA 3MECA 2UU9J 3A8EA 1RCXB 2B9WA 2ZH1A 1BQNA 1FNXH 2OIHA 3TA1A 2K8GA 2UUBJ 4WP9A 2MZSA 2MSSA 3KLHB 1VISA 1ZTWA 2XULA 1MSWD 2OD4A 3M6XA 3JSMB 1AYEA 3Q23A 2I2YA 1KVKA 4CO2A 2W9CA 4WU2A 4RW9B 4Y2AA 3T3FA 3R1HA 4NLPA 4USKA 2XLKA 2CYYA 2PE8A 3M6WA 3GJSB 4WK1A 4DV0F 3H2VE 2IRXA 2VQEF 5A0YA 4JI0J 3OXFA 3LP2A 2CQ3A 1TFYA 4JI8J 2JEJA 4CH0S 2ZDOA 1ELOA 2VKRA 2RD5C 1RP5A 1RKJA 1PYSB 3QGIA 2R7OA 1TELA 3CCJS 2CWXA 3JQJA 2P9CA 2RF2A 3KLGB 2MQQA 3P96A 2HNDB 3DGPA 3FFIA 2HNZA 2WW4A 1RWKB 4DR5J 2XC9A 4ILMA 3ZNUA 3Q8SB 3QWPA 1R0BG 1MMDA 4LSLA 4J9RA 5K20B 2KB2A 5HLFA 3TYTA 2B4VA 3M32B 1SVDA 5LMNF 4LRBA 1N0UA 3FNNA 2DR7A 3G6YA 3WC2A 1SJ4P 1T0TV 1X4BA 3CDAA 3MMCB 4IOAQ 2K7JA 3FMWA 5CZXA 5GAHI 3J7Z5 4RWWA 2ZKUA 3IN5A 3ENWA 4KGMA 4J9UE 2K2PA 2YWEA 4IO9Q 4NL5A 2I9SA 5HMXA 1BWVA 4X62J 2R2TA 4UOCA 2BXJA 2DNNA 2PA3A 4MKAA 2HG4A 2DGQA 3GJQB 3M2VA 3MPUB 2VJUA 3W2WB 2XYPB 2WB1D 1IQTA 3MM6B 1UETA 3PM9A 3AJ1A 1HMVB 5KFSA 4DN0A 3KJNB 2Y1LB 1U48A 3Q8RB 3K17A 3KUGA 2E5HA 5I4MA 3KJVA 1LFWA 2VFSA 1DY3A 4WP8A 1HNZF 3HVAA 3NXZA 3BKTA 1RQ0A 1EHWA 4LBIA 3FC9A 3SIPB 3ET6B 1OO0B 5KFGA 1FTRA 4U67Q 2XO6A 2IRYA 1IKWB 2XMAA 2VV5A 4RU9A 4DZ6A 1S0NA 1YQHA 3VAFA 2FVRA 2PT0A 5IWAF 4NLGA 4B9UA 4DV1F 1D0EA 3T1AA 4I6WA 4KPCA 1RT2B 3DRRA 3IC1A 2IIHA 4C0HA 3EZUA 1FWLA 4DV6J 1A0OB 1HWLA 3THPA 4PUOB 1FE0A 1JIHA 3K5NA 1K0VA 4ZCLA 4CLUA 2QLWA 2I8EA 1FKOB 4NX9A 3GONA 4JBCA 3CJ2A 3DLKB 3FRZA 4IO1A 3JQMA 1TV6A 3JYTA 4HHHA 2G1DA 2KZMA 1U09A 2BJ7A 4UF4A 1PC4A 2KO1A 2DKOB 3SI8A 4DR4J 3P3DA 1WOOA 3M7VA 4N8OA 4QIVA 3DRYA 2E44A 1ZZFA 2PMHA 4P74A 4BWJA 3HHDA 3OTDA 1OYDA 5ADZA 1RBLA 4GKKF 1X4AA 2XS2A 3EGNA 1T3OA 4LRFA 1WJ9A 1AUDA 1IQZA 3C6UB 2LXIA 4EO6A 2E1PA 2IC3A 2VPXB 2MHEA 4NI2A 2DGVA 4M5JA 4RW7B 3QIPA 2DH9A 2HNYA 8AT1B 1HQ2A 2HQ3A 3TJ9A 2V69A 2MJNA 2VBXA 3CEDA 4ZLPA 1S9GA 4ZHRB 1ZM3A 1KBRA 1SKRA 2DY1A 1CJUA 4OQJA 1WSRA 2ZFHA 4TNOA 1U1OA 5DLGA 1FK9B 1B99A 2DIUA 4ED6A 5J1NA 3MEEA 4I1TA 4M5HA 1C4CA 3BH7B 3MPYA 1KSPA 4I68A 2F8EX 3OTOJ 1HARA 1UEVA 2XI3A 3LA0A 5KFNA 5HN0A 2PC6A 4YMEA 3PHEA 3IP0A 2J8AA 2B7CB 1SC3B 2QEXS 1VJWA 4DPUA 4TLRA 2B6AA 2HURA 1SL1A 4IQMA 2OFGX 1RSCA 2RE1A 1A6LA 5AXNA 1S99A 4EGLA 3T1YJ 3LGHA 3CC2S 2MKHA 2J7WA 3R8YA 1YJVA 3MDFA 1ZA1B 1F9FA 1SJRA 1S7IA 1VI7A 1UWAA 1RA6A 2AT1B 2DK2A 3VVTA 2CADA 2HQFA 4USIA 5KFJA 2KG0A 2LDYA 4FYVB 5HMZA 2X3GA 3ILIA 1HL6A 1Q8LA 2MDAA 4ZLNA 4J37A 3MM5B 5J2MB 1Y00A 5IC6B 5K8NA 4BDPA 3ITHB 4EZ9A 2KN4A 1S9EA 4PXDA 1W7WA 4YHHJ 5IT9Y 1TTHB 1NO8A 3MZIA 3KHGA 1HNVA 4MK8A 5U47A 2DH8A 4ZPBA 4X66F 2NQPA 2M2BA 3MAAB 1RAHB 3R27A 3UWTA 2EKNA 3M9MB 3T5HA 3MCMA 4TU8A 1NDKA 1ZETA 2E1RA 4PG8A 5MAOA 2BZ2A 3MCSA 3C8YA 1Q16B 5CHCB 5F41A 4KPYA 1TVRA 2BE7D 4ED3A 2ROPA 2N4DA 1D9FA 3BO3A 2XZTB 5DDOC 1VS3A 4OYBA 3G9CA 2ADCA 1WTFA 3N0VA 3DU5A 2V2KA 5HMYA 4PXEA 1F0XA 4D3HA 1F1BB 2MKSA 2K1RA 4NCGA 3SFGA 1R27B 3KYLA 5ETSA 1T9WA 2FJBB 2AJQA 3POTB 2V6AA 1CJVB 1X60A 2LQ9A 3DRSB 1PBAA 1P8GA 1YK9A 4URQU 1DHMA 2ZVIA 1U0HB 4DV4J 1YRXA 2YKPA 4CTAB 1U45A 4OX9J 4DR7F 1IKYA 1UTAA 3KK2B 1N32J 3TZWA 3T1HF 3R1LA 2BE2B 1WHYA 1EETB 4Z37A 3VAGA 2LCWA 4ETXA 5F3TA 1S6QA 4QZVB 2VFTA 1PAEX 5T7LB 2V8PA 3N6NA 3VWSA 2XMVA 7FD1A 2LDIA 2MZQA 4UUXA 2KU7A 2UXCJ 3HT3A 5A76A 3KKFA 3OW2R 5BR8J 3HKWA 2AMCB 3OQ2A 3GLJA 3BSAA 2WB4A 4NLUA 5FIIA 4CZCA 4JYAJ 4ECZA 1WEYA 4LF8F 4B9LA 4B3TF 4LUBA 3VHQA 4OZNA 1LWFA 2RMLA 4CLZA 4XPEA 1JLBB 4WZMA 1DQ8A 1XMOF 3V6DB 4ES2A 4XPCA 3J81j 4CT9A 2AYEA 3SEOA 2GS8A 1K8AT 3PO4A 2CPIA 1GTEA 1RTHA 1Q0NA 5CYJA 2MQLA 2CNLB 1WI6A 3SCLE 1KVIA 2FJAB 3C3LA 2W8KA 4JI2F 2XZWA 4BHQA 5IV4A 2F7VA 2D69A 1DQAA 3C15B 3L9ZA 5SUHA 1RWMB 2VDIA 4R5PA 3KG4A 4KAIA 2M70A 1TL1B 3HFZB 5B0CA 2VQFF 3QT5A 2RJZA 3SSSA 4I2QA 1BD6A 3GJRB 1R8CA 2B0GA 1VGYA 4LF4J 2YKMA 1L3VA 3ISNC 3H2UB 7AT1B 3TP2A 3QGGA 2XWXA 2E5IA 2EC2A 2CPHA 2CJQA 2VODA 5J1EA 1GNKA 1X5PA 1ZZNA 4LQ3A 2D3O1 3V81A 4A4JA 3F44A 1MG7A 1WELA 3PFOA 2IDLA 1SI9A 3BSOA 4HI1A 4U9RA 2CPDA 1HYSB 1P6TA 4F4WA 2VG6A 3M8QA 4I2PA 2GX8A 8RUCA 4N41A 4ECWA 4QWAA 1FDBA 3KDOA 1JLGA 5D3GA 2GJIA 3EXYA 3M8ZA 3QT6A 2CPZA 4AL7A 4J9QA 3OV7A 1TKXB 3CGIA 2W24A 1RCOB 5B0DA 5KFZA 3E2EA 2VUGA 2JEIA 4X4OA 2MLYA 4KJIA 1JLCA 4J9LA 1FCAA 2YKQA 4WP3A 2CQGA 4JI1J 3RBZA 5LSRA 4ZVHA 3TUIC 3UCGA 4H4OB 4ED7A 1QE1B 3MECB 4Y65A 1KONA 3NGSA 3T9NA 1WG4A 2LQJA 3JTNA 1NPRA 2M0GB 5GMEA 4QPXA 1UJ5A 2F40A 4O3PA 1VQ5S 4USMA 4DUZF 1UFWA 4IKAA 3VTIA 2XSJB 5CYQB 3I56S 2RNEA 5KG0A 1OY9A 4KGVB 3DOLA 2JEFA 1F9HA 3I9ZA 4USVA 1VQLS 4ED2A 4EZ6A 2CQIA 5HQLA 2LU2A 3MCOA 2GHWA 2XY6A 1ZAXA 4Y2KA 4RW4A 3BREA 3B4DA 5KFPA 1IBMJ 2QA4S 2ZUGA 1FNOA 4RW8A 4QBUA 4LIWA 2CNOB 5D15A 2OPPB 3RBDA 4F4XA 4M1KA 4C8OA 3A12A 3WX8A 3OFFA 1KHWA 2QSWA 4J9NA 2KJVA 3W9HA 9RUBA 4M5LA 5IT9U 5HQ8A 1X5TA 5A6PA 4ZVEA 2OPRA 2EG1A 4P73A 1NKEA 1X4DA 1NEEA 4ZVUB 2J0QD 4MJKA 1ROFA 2ZNYA 1UPPA 4WF9Q 4C4WA 4DPOA 1R6YA 3HHLA 3KJFB 1XR7A 4JP8A 3NS7B 4EMDA 2E7VA 3BO2A 4DR5F 5D4NA 1X0FA 4F0KA 1ITPA 4J9MA 2DNYA 3LGMA 3MR6A 4UW2A 2Z2MA 2Z58B 2DY9A 2BKNA 3L7UA 1VQMS 3AA8A 1S72S 1NK5A 1IBKF 1TL5A 1HBMB 2HWIA 2BW7A 2A10A 4DU7A 3HSZA 2AQ4A 4FS2A 3W8GA 1R89A 4MKBA 4OMFG 3C2PA 1WKLA 1V9OA 2GC8A 2LA6A 3QRQA 1S1XA 3HHEA 2Y1JA 4OX6A 1UCNA 2JNJA 4A46A 2W25A 3DCAA 2V50A 3TR5A 3PFEA 2OJ3A 2ADBA 1BMQB 4Q2LA 1EAYC 3THVA 1MN9A 3OVBA 4N56A 5KT5A 1GMUA 3DC2A 3GSDA 4FP9A 3DLGA 3KJVB 3GCWP 4G1PA 3AD8C 1XMQJ 4HT5A 3PVXA 4ZKAA 1RT3A 1HLWA 2BANA 4DEZA 3ZZRA 3WIUA 3GTYX 3K8WA 1U1KA 3QFHA 3MEKA 2Q79A 2JFDA 1JNZB 2YTCA 5C24B 2XNRA 3CW2C 4HLBA 2MKKA 4PCQA 4A8YA 5GVQA 2ZH9A 1CQNA 2CJ9A 2OSQA 1TKTA 1HBUA 3N9UC 1D9AA 1RTDA 4TN2A 1HD0A 4FXDA 2W2MP 3R2CJ 4DV6F 3SXLA 2A2DA 3MR3A 4X64F 3IWNC 4ZPDA 2OLWA 3UNGC 2HKEA 4KKOB 3HP6A 3H4BA 2B8QA 1EQ0A 2IM0A 4KYZA 3LWMA 1S49A 4K7QA 1ZH5A 4UY8T 1IR2A 5F0UA 3MTJA 1WC6A 2NYIA 4LF5F 1HNWJ 2HQDA 1Q8KA 2HVHA 2H3EB 1TMMA 1XR5A 4K4SA 3EPIA 5HSPA 3LW5C 3AB4B 4WKRA 1NJWA 2NUHA 4ZVRB 2DJWA 4KT0C 5FDLA 1URNA 3QMQA 4ZVOB 4A8WA 7FDRA 4ERDA 2GQ2A 1S6PA 3I6PA 4UQGA 4I6AA 3HJVA 3SCKE 2QFIA 3R3TA 4C11A 1I94J 2AWZA 1JLEB 1GMVA 2MZTA 2GMJA 3RR7A 5J2QA 1A7GE 1FDDA 3LGNA 1H2VZ 4F50A 1GT8A 1W26A 1FJCA 1HR0J 4DJBA 4NOHA 2RH3A 3CCWA 3ZTRA 4DZDA 1HHQA 2GVDA 4DBQA 3CDWA 4YY3J 2WBMA 5AE2A 3DDIA 2NLWA 5ITHA 4ZCIA 2E5LJ 2QG9B 3KLIA 5EGYA 2CRLA 5HROA 3JTPA 3BQ1A 4UOHA 3U1NA 3F73A 2WVDA 2EC0A 3CJ4A 3D6FB 1NK6A 2OPQA 4YB7A 4YEAA 4MFBA 2J6TA 3IM8A 4H4KA 4R8UA 3R5JB 4ETZA 3HX9A 3NL0A 3G87A 3DDKA 2Y8YA 1SUQA 5HVHA 3DRXA 3V6HA 2HIYA 3KK3A 3PIOQ 5F9NA 2XM3A 3J7A1 4Q0BA 1G1XA 1R3NA 1PCAA 1ZAWA 4DUTA 4NLSA 5HP1A 3F56A 4L6V3 5DQIA 3D1QA 4B9SA 1SKWA 5CZVA 1DTQA 5KG2A 1SC4B 3TA0A 1U8WA 4FXWA 4X65F 1FJEB 4F04B 1FX4A 4LF2A 2DYAA 1U6FA 2DBBA 1VQYA 4IG0A 3DLBA 4NA1A 1S6UA 3D4JA 3NMRA 3VAMA 4YHHF 1LW0B 2RUGA 1N4LA 1Q95G 5B0EA 3TQ1A 2JLGA 3PEHA 4L72B 4DSFA 2NXUA 4TLQA 5L1LA 5EX0A 3TI0A 2Q3PA 4F0MA 3NNCA 4I64A 2XMKA 2RDJA 3IWLA 3QFWA 2I6WA 4CDIA 1TVRB 2UVWA 5FD1A 2PIIA 2CDRB 4GC7A 2BUNA 5K5MA 1VCTA 2XY5A 2AZ1A 3ENQA 3NGTA 4CYUA 5HBMB 1WORA 1ZS6A 1K1SA 5E0OA 2AKWB 4NCGB 4PKDB 5I3UA 4FF2A 4N5SA 1U1RA 5F8IA 2EPIA 3M9OB 2RSQA 1KS2A 5DRKA 1JLAB 3HSGA 5H1SV 1URRA 4P7TA 2HBZB 4AXJA 3J81Y 4Q5VA 1QUPA 3IS9A 1KNZA 4F3QA 4FPRA 3WQPA 1GXLA 3GFYA 5LJ3Y 1S57A 4L73A 2Z2ZA 3P5BP 2M8HA 2C3UA 1IKVA 1WC4A 1EB0A 4OX9F 2CZ9A 2WBRA 3SV4A 1N32F 4OZJA 1H7XA 3KXDA 4AFFA 4C0OC 4B3MJ 3B6BA 2PO4A 3OTEA 1HQUB 4DR6F 2FLLA 3DLHA 4N8NA 1C1BB 2MGZB 2C1EB 1VQ8S 4K4ZA 2PI5A 3SFUA 2ZH8A 2XB2D 2UXCF 1T8EA 2PEHA 5LSOA 3K89A 5JUMA 2AGOA 3IGVA 2W01A 3NMAA 3FBEA 5KFLA 2O66A 2ERRA 3ZC4A 3K0JA 3QBCA 1HW8A 1SQEA 4K0KF 4BBYA 1N33J 3EZ5A 4TY9A 2B5JB 4MKVA 1Q5VA 1Z1ZA 1WHWA 1S9FA 3EX7B 4WTYA 2V4JA 2ASJA 3TZZA 2Z2LA 2ZZMA 4GVLA 2QTWA 4YB5A 4GKJJ 2FIUA 1NZ8A 1VRTB 1VBZA 1FEEA 2E1AA 1CULA 1BQXA 2GHVC 3QJJA 4U7UD 2BYCA 1AROP 2PI4A 3V6JA 4KGZB 4RW6B 2MQOA 1UVKA 4M94A 2XLJA 2ZZNA 4B9VA 3MM8B 5B0GA 1WC3A 3CJQA 5DGAA 3GR0A 1TU0B 3W9JA 1RT6B 3IRXB 2GMLA 1CBKA 1EARA 5GAHU 3NOGA 4DQQA 1IUJA 4CQ1A 4Q2MA 2C3OA 1WUUA 2IMOA 2FB0A 5D0EA 3CC4S 2RS8A 1YJ9S 2VFVA 2MMYA 4PWWA 5LM7E 2YVSA 3DXSX 3CCSS 1SIWB 3J7YI 4ZMMA 1VBXA 4URSA 4LF4F 1QAXA 2GGPA 1IJFB 2W2QP 2I38A 3KUEA 1TP7A 3HFKA 2WSCC 1JJ2R 2YWGA 4DPXA 5KFFA 1X9SA 3V81B 4WE1A 3MAHA 2YWWA 2YKOA 3CO0P 2K3KA 1LW2A 3M8QB 2HS4A 3K5PA 3W5YA 3I0RB 5C7PA 5KG6A 4HTIA 5M2PA 2B43A 4HHJA 3BN7A 5C25B 4ZITA 1VQKS 1VLYA 2YKNB 4GRSA 4OYZA 2W8LA 3L95X 1OIAA 1C0UA 3OLAA 1LWCA 2C2NA 2H5JB 1T05B 3TZXA 2JLFA 4CNZA 3KLVA 1QLNA 2BMBA 5J1PA 5DQGA 3D2WA 2V2QA 1RAOA 5L39A 1VJQA 4E98A 2B51A 4LF7J 2DRDA 1NK4A 2LLZA 1MROB 3TAMB 1VC6A 1UFLA 2MSTA 2A18A 3HFVA 4ED0A 2ZOFA 3SSQA 1NPKA 2J0WA 1WDTA 3PJXA 2Z57B 1NZAA 1X5OA 3FRYA 1NNDA 5KFEA 3MM9B 1Q79A 3SQGB 4ITSA 1M5KC 2VG5A 1CJTB 1NXIA 5JJBA 3A13A 3ZXWA 3DMJA 1SL0A 1IXKA 3NNAA 3A8IA 4EBCA 3UO0A 5IXUA 3MUTP 5AE1A 2FQQB 1NU4A 1R8BA 2HW3A 4ANEA 2DNMA 4C97A 1RWPB 3KLHA 3OFHA 4OJ3A 4CO5A 2EK1A 2D9PA 4OJGA 4RW8B 5DM6Q 3KUHA 3JSMA 2O67A 4JV5F 1BY9A 1MWZA 1IBMF 2VQEJ 4RW9A 5HVFA 1F5BA 4R0JA 4MTPA 1FRKA 3HJFA 3PKYA 2HK2A 3QPIA 3TZYA 3M8PA 2X1FA 2E5GA 3TVKA 4ZOSA 3G82B 1FFGB 4AD6A 1DTTB 3PY8A 4DS5A 4WJBA 1HW9A 5DDQC 2KJWA 2RU9A 5L8RC 2A1BA 3GR1A 1YTYA 3MF5A 2CDQA 3FEYB 2Q43A 4WWSA 1RAEB 4GO5X 3DHXA 1RHKB 4AT1B 1D3WA 3KLGA 3W7BA 1JKHB 4CO0A 1U25A 2HNDA 2YNIB 2FHJA 3AQOA 1TKDA 3UD5A 2DO4A 1TL3B 3PYFA 4DUYF 1FRXA 4N77A 4DV7J 3RBXA 1FDAA 4P2FA 1KC8T 4QIWD 2E7WA 5RUBA 2O5DA 5LMNJ 2QJ3A 2C28A 2IRUA 5I3QA 2KXHA 2FY8A 5D77A 1G6BA 3KNGA 1V6HA 5DZ7A 3HXMA 4AL5A 5H9FK 4ECVA 1M5HA 4KR0B 1S1XB 2VOPA 3M32A 5E5NA 3VGSA 2FZCB 1FHTA 1SH3A 3J81U 3DLEB 3MMCA 2V4QA 1J5EF 4P7VA 1KLNA 4X4TA 2DXDA 4EU0A 4OZLA 1REGX 2IM3A 1IVZA 1H2UX 3A3OB 3DLGB 1F3FA 1U1LA 4LF1A 3VZIA 2C2KB 2KDOA 3PXGa 2VF3A 1RT3B 5KG4A 3IBWA 5E7OB 3TRGA 2MYFA 3ZZPA 5K14B 3W2WA 3DLLQ 2XBPA 1EQMA 2ZHBA 3FUYA 3MM6A 3QLHA 4EEYA 3I82A 1HMVA 5B0BA 4RZRA 3JB9k 1HNZJ 4DLGA 4ECSA 1SH0A 5EWFA 1S4FA 4PEOA 4OZ0A 2W2PP 2E7XA 1TL4A 5K8PA 2YNHB 2F65A 2OI2A 3ET6A 1VDHA 4K5RA 1FDNA 2J7UA 3FBCA 1HWUA 4DV1J 2HLUA 1IKWA 1I1GA 2M7SA 5AT1B 2QA4G 1APSA 3R6GB 2C2RA 4NA3A 5GMDA 1M1HA 4C48A 5L46A 1DURA 4DHVA 1XERA 2BJ8A 5FJ4A 3PIPQ 3FJ2A 1RT2A 3CDBA 2DGTA 3CB4A 4QCLA 4I69A 2UUAF 1T9UA 4C8KA 2AF6A 3UE2A 2FPHX 2D74B 5FLXY 4MT1A 1Q8BA 5KFDA 3T6BA 4PUOA 4DI6A 2BJ1A 2HQCA 1NDLA 3Q8QB 1QSYA 5HQMA 3OBIA 4DLEA 1GK8A 5KFQA 3DLKA 2BM0A 4X4RA 1HNWF 2NXEA 2PFDA 1RGVA 2AGQA 2LU1A 2VDHA 1TL7A 4CRJA 1H38A 3BR9A 5IC4B 4TU9A 1YI2S 3M30B 3H2LA 4GKKJ 1YG0A 2YX1A 5I42A 4ECYA 4C11B 3N6LA 3RG6A 2A6MA 4DDFA 1PSDA 3D3BJ 5J2QB 1PJ7A 4Y0FA 4WFAQ 1I94F 1SV5A 2WK4A 3C6UA 2HVEA 4UTGA 3VF0B 4RW7A 5GADI 4NXMF 1B0PA 5KG5A 1TQLA 1DZ5A 4O0NA 2ZC4A 2BQRA 1NSAA 4ZCKA 3R6LB 4PG5A 4UQTA 4ZHRA 3KLIB 2CPEA 3CC7S 3MMJA 3NKYA 1Q78A 4H4MB 4EYIB 3UN3A 1FK9A 2E5LF 2ZJRQ 1N5YB 2HFOA 3NGRA 4OI2A 3AAWB 1RT1A 1RJJA 3R5GA 2KH9A 3LPYA 1SUQB 3G8QA 3O6QA 1NDCA 4DCOB 1H2TZ 1E6YA 4OJ1A 4DR1J 1J5OB 1IKXB 1EKSA 2APOA 2L48A 3MPVA 2V8HA 2IHR1 3M8RA 5KFMA 2XMTA 4C8YA 4KHPF 1AW0A 3CMES 2GAHC 3TANA 4IG3A 1RUSA 4QW9A 1RZMA 1S79A 1S59A 4JI7J 3BGOP 4CLTA 4UY85 3EWGA 5HJYA 3OR1B 2GV1A 2BA9A 1X9WA 3CCTA 4HH0A 1CJKB 4LR8A 3ZZYA 3BO4A 4USWA 4ZLJA 1J2VA 1PBUA 4JI5F 3JAMY 1FRHA 3T5LA 3PX0A 3GIIA 2CQ1A 1WEZA 3OTBA 5IS2A 4DL3A 3D0GE 1UVMA 3QSYB 3FSXA 2MY8A 1NKBA 3EGWB 1OJ4A 1D8ZA 4NLXA 1HI1A 3MM5A 5J2MA 4KFBB 3CWJA 2QL7B 1IJEB 4CO1A 1FJGF 3ITHA 4X66J 5M2UA 4N7TA 3ZZ0A 3U7JA 2QMXA 4LFCF 3UQSA 1KLMB 2ZEJA 4OLPA 2V34A 1X0PA 4DXLA 3MAAA 4ZVSB 4WBFA 2XI2A 4CYUB 2HK3A 4RNFA 3C16B 3NAHA 2HHSA 4NZ6A 3CF5Q 1SPBP 3W65A 3IR6B 1S48A 2ZITA 3O8WA 3DGVA 1KR4A 3T5KA 3B82A 2YQ0A 4YR3A 3WBZA 1YRTA 3GV8B 2PMWA 3HHKA 1HNIB 3VV2B 4KQZA 4GMKA 3UVJB 1M5PC 2JVRA 3D67A 1KN6A 3K58A 3V5RA 3IXQA 4K59A 2FTRA 1YVFA 1VQ6S 2M8DB 2POKA 2J9EA 2MKJA 4ZDNA 3BB5A 8ATCB 3A3NB 3POTA 4F3OA 1OWXA 5DDRC 2HHWA 1Y3JA 2JHEA 2P2CB 3FQLA 2ZKTA 3DRSA 3HHLD 2HGNA 4P75A 4LFAJ 3TJ8A 3MD3A 1ZA2B 4DR7J 2CVEA 1U1NA 1U0HA 3T1HJ 2CNKB 3FCHA 1SKUB 1UW4A 2XLIA 2BJEA 5GAEI 2BVZA 1XJWB 2IJNA 2NXJA 4DFJA 1NK8A 3KK2A 2OFHX 2BE2A 5C2GA 4Y2MA 3KHRA 4P2SA 3TUZC 4XIUA 3PHTA 4QWCA 3HD2A 3EICA 2A2CA 2AEJA 1V5VA 3E51A 2RU3A 4WFZA 2JH3A 3O1LA 4Q43A 5CABA 1N33F 5JVHQ 2Q66A 3H90A 4PWUA 2KTQA 4U8YA 4J9OA 3ENAA 2WW8A 4LF8J 2DR9A 1L5UA 4B3TJ 3QT8A 4UUWA 1OMSA 4FKXA 1QVFR 3MEDA 3BPDA 3DM2B 1RK8A 2YKAA 4F36A 3ZTPA 4GKJF 3PZPA 2L41A 2V2VA 1G7CB 1UVLA 1V5IB 5ETQA 4PG7A 2HFNA 3V6DA 2YPYA 1M90T 2PD1A 5KT2A 5BYRA 3CIMA 4NA2A 4MIWA 4ZIVA 4ILLA 4TYAA 2LEAA 3QSIA 2KI2A 5EWEA 1RACB 4OYOA 1Q8IA 4R0EA 2C42A 1PG5B 3D66A 2E66A 2R3VA 4JI2J 4DSKA 3T19A 3RR8A 1N5SA 1K1QA 1RB0A 5DG9A 2COLA 2VG7B 3LOUA 3WHIA 3TX0A 4ECRA 4HTJA 1R8HA 3EVWA 5FLXU 2GGPB 3PX4A 3ZZUA 3O3LA 1H98A 2MHNA 2VQFJ 2WVFA 3C15A 4ZA1A 1MW7A 1P9QC 4PYDA 1EP4B 1FRIA 4XTTA 4F26A 1NAQA 2XS7A 2O1PA 1MLAA 4DSLA 1TL1A 3CDUA 2HS3A 4MMOA 2WONB 4GVBA 3R5AA 5D4PA 3RB3A 1LWEB 1T94A 4HKQA 5F8LA 3AT1B 3Q8UA 4O4GB 4NLQA 2YY3A 2A3JA 2HBYB 2W2NP 4LFBF 1UA1A 4P72A 2R2UA 4Y2CA 4F25A 1JLQB 4KIAA 3PEJA 2WVCA 3TA2A 3UNYA 2DCLA 1RKIA 4M5KA 1WTBA 1NH7A 2KHDA 2UXDJ 2DGOA 2H54B 2A0FB 1RTIB 3R7SB 1B0TA 2R8HA 3D9BA 2RDIA 1HYSA 2PGCA 5KFAA 1LWCB 4QOTA 3IFEA 1Q1KA 3RRGA 2MZJA 2M9KA 1MN7A 1SJFA 4WCEQ 4KBIA 3HZGA 3LO3A 3FMBA 3NP5A 3KOAA 2CZ4A 1WHVA 1N48A 2AYBA 1S0OA 1FFSB 3P49B 3HT0A 5J2PB 4O0IA 1IN0A 2ROGA 5L9XA 1M5SA 3DDNA 3ZFVA 3OFEA 4ZP9A 2LVWA 1GX5A 2L3MA 2CUYA 2ILZA 1E6VB 1SKSA 4H4OA 2UVVA 1QE1A 2DIVA 4DL4A 4RUCA 1FEHA 1HI8A 1Y3KA 1G2EA 2AP6A 1VOMA 2R7RA 4DX6A 3R97A 4J7CA 2ZJPQ 2D7SA 1RA7A 4K50A 1XBWA 3KG0A 2XMUA 4DUZJ 1X4EA 1HPZB 1WF0A 4BC7A 4W90B 3UN2A 4F2RA 3PO5A 1HWKA 2XSJA 5CYQA 3BGRB 2CQ0A 2ALZA 4RWXA 4ZN3A 3M8PB 1ZM9A 4ZPCA 1AA1B 1UVJA 2DNOA 3CJRA 3JAMU 1MWYA 4B02A 4PQAA 2ZH4A 2QL9B 3K5MA 2OPPA 3DYAB 1RXOB 2Z2YB 3BDPA 2AEMA 3Q8YA 5IZHA 5CQGA 3UDEA 1S0VA 2DNGA 4PR6A 3D1OA 3GYGA 2KT3A 2KT5A 1N8RT 4JI3F 2EVZA 2RVJA 4LVNP 1SH2A 2G2OA 4V19X 2W4PA 1QDUB 2YX7A 5F8MA 5JMNA 4DV7F 1FVQA 3SCIE 5IV3A 3CIZA 3BN4A 1IBKJ 1LEOA 3PCOB 4ID5B 2N82B 1YJNS 3FSYA 2IJRA 2DHAA 2YH0A 2ZZTA 4ZVGA 1JLFB 1UWBB 1GQEA 4NLVA 3FGVA 1HBMA 1X4FA 4TY8A 3DOMB 4M5DB 3RBEA 2UUTA 1OY6A 2F3JA 2FJWA 1NK9A 3QZ8A 5DLFA 2MZ1A 4CT8A 3EGZA 3HI9A 1TUWA 2HMIB 4B3OB 1YSJA 3LANA 2QRRA 3L3CA 3QLHB 3OXLA 4LSNB 2WVEA 2HHUA 2RILA 3NCPA 4KH0B 1FXDA 1RAFB 3J80Y 2QA1A 3Q83A 5LMUF 3CD6S 4DL2A 1RHMB 2XO7A 4P9SA 1VHIA 3PNIA 1S1UA 2E9RX 3CJKB 3MUMP 2G13A 3U1LA 5EWGA 2E9TA 4F0HA 1CS4B 2DHGA 2QN6B 1YKWA 1UFKA 4NWBA 5KG1A 4LRCA 2CPJA 3ZZTA 5C24A 4ANDA 2MXYA 3D6MB 5D4LA 3MXHP 4DQPA 2UUCF 2FLNA 2FVPA 4X64J 2X1BA 4Z2XA 2WOMB 1W2BR 4NLTA 3GE9A 3E8OA 2LYVA 1RE1B 4K4VA 3BBBA 2ASYA 1DRZA 3H98A 1LK7A 4KKOA 4LREA 3UR3C 2VB6A 1VC5A 5L38A 1UPMB 1TL7B 1PKUA 1XIQA 4L3KA 1B7YB 3KHLA 3HO1A 1YJRA 3PYDA 4U8VA 4LF5J 4B3SF 4IRCA 4AUKA 5I42B 2QZ8A 3GQCA 3EUNA 4AYBD 1BHNA 1YWXA 3LP0B 4OI4A 1XN9A 2D9OA 5C42A 1VBYA 4CLPA 1WG5A 2K06A 2K3IA 3WDOA 1N0VC 4YOEA 2V9KA 2ZWPA 4K5SA 4YDDB 1SV5B 4C9DA 2R2SA 4DR2J 2AEFA 2IBOA 3IAS9 5HK4A 4OYWA 2MTLA 4FN5A 1EIYB 2W2OP 1VQSA 1HQEA 2H4YB 1FRMA 5KFCA 3OL8A 3OR2A 2E1CA 3H20A 2AZ3A 3TW0A 2DGXA 4IDKB 1QTNB 3Q86A 1RWWB 1V3SA 4PXBA 1JLEA 4ZJOA 3L7PA 4FVCA 1ULRA 3G71S 1O8BA 5KFOA 1VIXA 1RT1B 4X2BA 2OEKA 3G4SS 5EHHA 3K7RA 1WOPA 4OHYA 3QGHA 2B4PA 1E6YB 4KV8B 1RT5B 2LXFA 1LQ9A 2JDJA 3PW7A 2HWTA 2BQUA 3AB2B 2HRUA 4FYWB 2ZNZA 4ZPAA 4ZVPB 4DR1F 3EMTA 3M8YA 4IG3B 3QO9B 2OAUA 4YP3A 3J7YU 4V1Ak 4X84A 1W2IA 1N5VA 3TAPA 3TAQA 2ALYB 3IBFB 4OYXA 1SB6A 2J9CA 5KFIA 4X4SA 3K2YA 2HHXA 1XR6A 4L76A 1KFDA 4JI7F 2JJ4D 3MEGB 3DRPB 2R8IA 2EI5A 5KFHA 5KOXA 2Y0SD 1HI0P 1UA0A 4XK8C 2CJAA 4NMXA 3GFZA 4X65J 5J2NB 2P9EA 3HZEA 3PW5A 1H0HB 5HI7A 4HVZA 3W3SA 2CA9A 2V2ZA 2FC8A 2R2RA 3PX6A 4MKYA 1FRLA 4HI2A 4J9SA 3N4WA 3N6MA 1C4AA 1F60B 3ELHA 3HDSA 2CPXA 1FA0A 1HIYA 2AYGA 4OLOA 3Q22A 4GC6A 2BOPA 4TU7A 4UZCA 3EYZA 1OSCA 3OVAA 1B64A 3OSNA 1LW0A 3P5TL 2XY7A 1JXEA 3RAMA 2HFVA 3W5XA 1VRUB 2DPJA 2LFVA 3RRKA 1XTZA 4CLSA 3IGNA 1P27B 2NYHA 4FPIA 5F8NA 4NXNJ 4WTOB 3MMBB 4IFYA 1VIOA 4K8RA 2IVYA 3FEXB 3W8PA 2ZD1B 1H74A 4DU8A 4NMLA 3PR5B 2UUWA 1PJ5A 2C3PA 3VGTA 4P2MA 5CH7B 2PFFB 3JSBA 3D54A 1TK5A 5HBMA 1UVIA 4DF4A 4LBPA 4WKYA 4E0DA 3LF0A 3UD3P 2DNQA 4PYAA 1U4BA 1M5VC 1B3TA 2B4OA 2HRYA 1TUGB 2CPYA 5HJXA 3Q0AA 1JLAA 3AOAA 5BYQA 4ZJQA 3GSIA 1YRUA 4LIRA 2V8DA 4M63A 2NPFA 4ICLA 2HIQA 4LFAF 4ELUA 4LBHA 3BQ2A 4DX7A 1U26A 5A8KB 1G3OA 3V4IB 2CNNB 3EJMA 2YX4A 4TYBA 4OJHA 2W7PA 4LVOP 2G4BA 2HLTA 2DNPA 1I51B 3OXGA 2XQCA 5HATA 2EXUA 5F9LA 1NKCA 4DR6J 2IYGA 4FZVA 3PV8A 4DQIA 4O23A 3NS6A 2W9BB 1HQUA 3G2XA 3NWGA 1YJWS 2CIMA 3M05A 4LR7A 1C1BA 1JJ4A 2MGZA 5CD4H 4DPTA 4NRUA 3J80U 3MEDB 2KVIA 4DV2J 4K0KJ 4ZPWR 3EVMA 1CG2A 1N54B 3BV8A 4OZ3A 4DFKA 2PA8D 1TAQA 4JV2A 3CVKA 4DL5A 2B5JA 3ETMA 1RHUB 3I0SB 1UZDA 3R5CA 1YJ7A 2M3DA 2ZHAA 4JI6J 2KYXA 3BZQA 1HNXF 3PW0A 2ZVSA 3BM7A 3EVOA 1VRTA 2FLOA 2DNZA 3S01A 3JSRA 3R5BA 3NAIA 4IFVB 2ZJQQ 3MM7B 4DG1B 3AQPA 2X1AA 4RW6A 4ECTA 3GIJA 5KT6A 1K47A 3MM8A 3US5A 2CZVC 3EDQB 3QAEA 2B9EA 4FXVA 1RT6A 3IRXA 5DJBA 3VQTA 2IBKA 2R7QA 4B9TA 4BC9A 4RR5A 5B08A 2W1BA 2IJFA 3GPAA 4GVBB 2IAJA 2OTJS 4OI0A 4A8KA 3DN9A 3GU0A 4R25A 4OI6A 1GAOA 1FD8A 3ZZOA 3MFIA 2AIRB 2LP4A 4KRWA 1TKZB 2RIJA 3PKMA 1RT4B 1H73A 4YQWA 3U27A 2UV8G 3K5LA 1K73T 2X1GA 2CQBA 1S1TB 4YN3B 3CJ3A 3KLFB 3PYGA 1SQGA 3UPFA 1Q4RA 1AB8A 1IBCB 3TVYA 1OS5A 5SZTA 5JXSA 3MPWA 1YGYA 2WHOA 2UXDF 2F5GA 3TOQA 2C2ZB 3R9LA 4C3KA 3I0RA 2AJFE 4IOCQ 3PRVA 3PW4A 4I0WA 2JWNA 1FRJA 5C25A 2FGCA 2VKZG 5H9EK 2YKNA 2DH7A 4USTA 1N52B 1UL3A 2R8JA 4KB7A 1Q81T 1H3DA 2KZZA 4OYAA 1SQFA 5KT4A 2CQ2A 4ELVA 3LP1B 1SCJB 4RKUC 2QGFB 3TUPA 1R8AA 3BBFA 2IVFB 3M4XA 4NCAA 3JTOA 1T05A 3TEGA 2VU5A 2F4VJ 2HAIA 2IM2A 1HHTP 1AZSB 4AE5A 2J7KA 2CJYB 2XGPA 1RHJB 5HMWA 2KRBA 3DKDA 1RI7A 1ZTTA 2ZBPA 2VOOA 2BOAA 3N01A 1MROA 2XYGB 3TAMA 1CEZA 2IM1A 4FYXB 5ETTA 4DPWA 3MD1A 2W7AA 1OQ6A 2ZUAA 3C6TB 1QD1A 3MM9A 3SQGA 2CG4A 3H5XA 3HVTB 4O3SA 1CJTA 2R7TA 1FKAF 1JMTA 3KJQB 5KFTA 4HACB 2XGQA 2GVZB 2KL8A 5CYMA 4IOBA 2V63A 4YR2A 1Q7YT 1U6ZA 5GADU 1FTCA 4AL6A 4JV5J 4U6PA 2NXNA 4OZ1A 3RW6A 2RUSA 3G96A 4XAKA 1NJXA 2EK6A 3IMQJ 3ZTOA 1D09B 3JS9A 3W66A 4ECUA 4U7UK 4RNMA 2BBEA 1SL2A 2AGPA 1C1CB 1R6VA 2F8MA 3NLCA 4QYRA 3AOCA 3G82A 1DTTA 3GG1A 1LFPA 3GYXB 2DHHA 2JFKA 3KMQA 3M1VB 3MI7X 4PQUB 4A48A 3CCES 1RAIB 2Z8QA 4WZQA 5MLCV 1C0TB 2QL5B 1B7FA 2HHHJ 2G1HA 2FVQA 1S1WB 4DUYJ 3MR2A 2HAFA 1N56A 1WD6A 1JKHA 3KFWX 5F8GA 1X8DA 2XWYA 3G8TA 2YNIA 4ZLLA 3DOKB 1HBOB 1EKRA 5EUHA 1TL3A 4RNNA 4TY8B 5BXIA 4MIAA 2X3DA 4B9MA 3NCQA 1RYRA 3OUYB 4HL9A 3I9V9 2E1MC 1HFEL 3QATA 2FZKB 4YS2A 2JEGA 1J5EJ 1NLKL 3BYPA 2RHQB 3LALA 3CCZA 2PSZA 3UCUP 3DLEA 4ED5A 2CVIA 2MKCA 2B9XA 1LKZA 3B4MA 4U95A 1CC7A 1N6QB 5IOLA 3GIKA 2OD6A 4B08A 2QE5A 4OV6A 3MOZA 1DLOB 4OL8A 4YB6A 3VAIA 2DB1A 3OHAA 3MOJB 1B0VA 3ULHA 1S1UB 4Y28C 3VGUA 3CCRS 3CULA 2AD9A 5K14A 3HULA 3OT9A 4DOZA 1XEZA 3WIVA 5E3CA 4HHUA 2AJ1A 2HFUA 1HHSA 4PZVA 2Y3YA 2B56A 2V8GA 5HO4A 4A47A 4NRTA 3NG8A 4NLDA 2V68A 5G0RB 4N47A 5LOQA 4FF3A 3RAQA 2YNHA 3CJTA 4O44A 4NYPA 2QT7A 1MU2B 1R31A 4Y00A 2LECA 2KG1A 2OO4A 1KTQA 2IMWP 3NBPA 3ISZA 1RT7B 3KLEA 4J5OA 2XHCA 1H6KX 3ETOA 2J9DE 1PILA 2WRMA 2UUAJ 3H5UA 3JXOA 2H4WB 2IA0A 3GV7B 2WSFC 4QIFA 4X4VA 2YNFB 4B17A 4IYQA 4QWBA 2FUG9 2JX2A 3UI3A 3QJLA 2CAJA 2WVBA 2RQKA 1PGZA 1R0CB 5GAEU 3GMGA 2Y0BB 3UW1A 1JJCB 4JUZA 1F2GA 1LXJA 5C42B 1GXTA 3VZHA 2KM8C 2GAGC 1SC1B 1NPPA 3RW7A 2RAQA 1NSPA 3HKZD 2KFYA 2EFOA 1X7VA 5D8HB 4WFNQ 3ZNJ1 4TXSA 3UCZP 2GIRA 2MLXA 2G9OA 4DR2F 1HQEB 4ZK7M 3C19A 3M30A 3OR2B 3HHLC 2G2YA 4DV5J 5ETOA 2VL1A 1PAUB 2ZDPA 1F2HA 5DO2A 1TFWA 1WC0A 2YWHA 3CT9A 4G1IA 2GIQA 4NXMJ 1FXLA 2ZH2A 3M2UB 1M0SA 1U6BA 1LWXA 2DO0A 2VBYA 1KWMA 2GJ2A 4Q8EA 3NOCA 4TQSA 4CLLA 4K2JA 2DRBA 3I55S 2OH2A 2ATLA 4DV3F 5AJ3J 1JX4A 1BQMB 3RRHA 4C98A 4CLYA 3VAKA 2CQHA 2BDPA 3SQOP 3W9IA 3MURP 1NCLA 2DTJA 4H4MA 2LEPA 1ACMB 4WIQA 3ZO7A 3ZZZA 1N5YA 1N34F 2XG8A 1VQNS 2DGWA 5K9FA 2DD8S 2J5AA 4S0MA 3LTOA 1UEKA 3D5MA 4DX8H 1TAUA 2ZWOA 1I5OB 4J9VA 3RU0A 4KHPJ 1J5OA 1IKXA 2CQPA 1R7IA 2YQ3A 4IR1A 1T03B 2OTLS 2R7XA 3G6XA 2RRNA 2AX1A 2VD3A 2PMZD 1BWEA 4PG4A 2EFPA 2NUUG 1TMJA 1NMEB 2CQDA 2PDAA 3MMAA 2G0JA 2QO3A 5D4OA 1U02A 4YB1P 4FYYB 1D8YA 2C22A 2J76E 1KQFB 3OHBA 3CDEA 3OR1A 1L3KA 1JXVA 2GMHA 4JI5J 4C6AA 3O44A 1P9YA 1CJKA 4QJVA 4OZ5A 1U1MA 4NZ0A 4B3RF 2NZ4A 1N36F 1OSDA 4RU2A 2DCUB 3CCMS 2W4CA 1QVGR 4H54A 5D0RA 1FJGJ 4LFCJ 1WOSA 3OPKA 5T41A 4KFBA 4JB8B 4IFYB 5D6GA 1HD1A 3QWUA 3A1YG 5EDWA 3E01B 1KHVA 2RRAA 5KFVA 1KLMA 4NXNF 2RS2A 3VGVA 1S7HA 5E3AA 4Q45A 1T9VA 2QLBB 2BKPA 3C16A 2MPUA 5KFUA 2CJXB 1X31C 3W2VB 1RWVB 1M1GA 4O3QA 3I5BA 2WSEC 5IQQA 4AQYJ 2VC1A 1GEHA 4WU3A 1KOHA 1R0AA 1Y5LB 3M6VA 3AODA 2LQ8A 5KFWA 1XWLA 1HNIA 1Z2LA 2OGUA 3HD1A 4NLRA 1YBAA 1LK5A 4ICLB 4OI1A 4ZVFA 3UVJA 1WC1A 2NSCA 4BCAA 3O5TB 3MUVP 3D3CJ 4DCJB 1RWUA 2BJ9A 3GFXA 5DETA 2EFGA 4P71A 5AXKA 2B9YA 2UZAA 3UFCX 2ROEA 4FNHA 4KHMA 3FZ2A 1UZHA 1CC8A 1OPZA 2BRKA 2FZGB 3THTA 2NR0A 3R7BB 3S1TA 3K59A 2WZ1A 4QWDA 2CQCA 2Y1IA 4NLYA 2L9DA 3QRPA 3CJ0A 2YNGB 1M5OC 1KQKA 4XDCA 4DX5A 1Y11A 2R8GA 3S8SA 2HWHA 4CIOA 2BW2A 2M52A 4DV2F 1L3SA 3SDEB 4KTQA 2ZE2B 3CCVS 3H7HB 2I5JB 1HBNB 4PAAA 5HL7Q 2BEFA 2GIFA 2RKIB 3H40A 3DU6A 2E9ZA 5E3PA 4H4KC 4CO4A 3UD4P 3KMSA 2B4UA 4USHA 3W61A 2ZOGA 1S4EA 1WWHA 1YJUA 4KC5A 5ETKA 3X3UA 1Z4UA 4D3GA 2HZAA 4JI6F 1O51A 3DM2A 3HVRA 5LXRA 2VBWA 2F8HA 4DFPA 3AXMA 4OHXA 2OHDA 4Y2IA 4MAKA 2L9WA 3GP9A 3CMQA 5CA5A 4DS4A 4LF6J 1K44A 4OX8A 1PO6A 1REVA 1UMJA 4PWDA 4ENOA 1K9MT 2EKYA 2F9DA 2IAJB 2BRLA 3MCNA 4A8XA 2QIFA 2XEXA 4OX7A 2ACMA 2OEJA 2J6UA 2HHQA 4DSEA 4JV1A 2NREA 5L1IA 2UP1A 4UT4A 3J7AN 2VG7A 4PRFA 3R7NB 1KP6A 5HVGA 1KEKA 4DMZA 1U24A 3KDNA 2KRRA 3BEGB 5GMKa 2AJ2A 1IBLF 1FXRA 1MMLA 1EP4A 4C7QA 5B0AA 4CP5A 3FVYA 5C5JA 1NJYA 2OPSB 2E29A 2R9LA 1SBRA 2WONA 5IM0A 4K4TA 3CNQP 4PXCA 3IO1A 3VAHA 4A8QA 1LWEA 4LFBJ 5AE3A 1X4HA 4I67A 2NS1B 4C3LA 4PABA 4N76A 4O4GA 5F8JA 3KTQA 1IR1A 2DGUA 4JOUA 4I56A 2GFFA 1QY7A 2MQ8A 4HT7A 2RDDA 4J9PA 2QC3A 4EBDA 1T3NA 2M4MA 1JLQA 2QMWA 4USUA 2CJBA 4M5GA 1T11A 3E3XA 2ATCB 1UAWA 2D3ZA 4RX6A 2U2FA 3VR1A 3CTRA 1Z2ZA 1RTIA 4DL6A 2PN6A 5D0HA 2Y9HA 4RNHA 1GXUA 3PYEA 2OELA 3MAQA 5KTQA 2H9ZA 3GB0A 2VBZA 1P1LA 3M8WA 3TQEA 3BKFA 2DHXA 2QX0A 9ATCB 3DI6A 4X4UA 1FKPA 1DJ0A 4IRDA 2F4VF 1MWQA 3TX8A 3UDLA 1XQIA 4J91A 4C8LA 4DCPB 1T9YA 3OFGA 4ATNA 3CCLS 5J2PA 5KFRA 1L3UA 2JVOA 4FNIA 2AJ0A 4ZIWA 1C2PA 2F9JA 1T9XA 4BWMA 3Q8PB 2N7YA 3H8YA 1E6VA 4V19J 3AA9A 4W98A 3R2DJ 3U02A 2GQQA 3M2RB 3GJTB 3GIRA 2X7IA 4ILRA 5CYMB 1P1TA 3T9ZA 1U2RA 3VALA 2LEBA 1VMBA 1GMWA 2RQCA 1X5SA 3ILJA 5T14A 2I0XA 3L09A 4NE9C 4ZPTR 3U1MA 2GO8A 1VC0A 1YHQS 1HPZA 4NEYA 3NEKA 2V5HG 1R43A 2XHWA 4I7FB 3BPSP 4G1QB 4DQRA 3BGRA 3A3PB 3IAM9 3LAKA 1XK8A 2HFSA 2XSFA 4FF4A 3IG1A 3T6JA 2R7SA 3VAJA 2ZH5A 5ETPA 3MHYA 2N7CA 2W9AA 4WK3A 3SSRA 1O0PA 2W4DA 3Q2SC 4F4KA 1KDNA 4OYMA 4OIXA 3EE3A 3DYAA 3SZ2A 1S1VB 2DNLA 3RZAA 3QRRA 3V6KA 5ETLA 1U2FA 3UN5A 4JI3J 3GZ7A 3H25A 4QQBA 1RTJB 2HHHF 4JI4F 5K8OA 4DWIA 4USJC 1TZ0A 4O3OA 3CJ8A 1IWGA 1ZM2A 1RDRA 1SJ1A 1QSLA 2FC9A 3CJ5A 4IQXA 1G4CA 4CCHA 2N4CA 4MK7A 1XNRJ 1Y5IB 1BQNB 3NY0A 1UJ6A 4FYDA 4ID5A 4ID8A 2R7UA 2HHVA 1WKKA 4HEA9 2R8KA 2HHTA 2UU9F 2MJUA 3KK1A 1JLFA 1UWBA 1RLDA 2LMIA 1FWKA 3AH6A 3DOMA 4M5DA 2UUBF 2N3OA 2VPWB 2IDEA 2X51A 1RADB 1WG1A 2AU0A 2W9CB 5GAGU 1ZOTA 5H9EJ 1FX2A 4QWEA 2XZDB 4LQ9A 1CLFA 3SCJE 5A0YB 3CUNA 4TKTA 2HMIA 4B3OA 4RJVA 3LP2B 1UVNA 2IA6A 1NHVA 4LSNA 4TVAB 5LMUJ 3FCWA 3HMJG 4JI0F 1VHFA 1S6OA 3BDEA 2WTFA 4JI8F 3RJMB 2XYHB 2YH1A 1N88A 4FBUA 2RF2B 4O44B 2XTJP 5IQ6A 3CJKA 3DGPB 3FFIB 2HNZB 2H48B 3I4PA 3NBPB 3KLEB 3AHPA 2VC0A 1CS4A 4LSLB 1WSVA 5HLFB 1YITS 4ZVQB 4CWBA 1GX6A 2VIHA 2UUCJ 1M1KT 4O3NA 4FBTA 1TK0A 2MKIA 5E3QA 3MR5A 2WOMA 2FVCA 3KHHA 2LA4A 4W92B 4CLKA 2FYXA 3CCQS 1OY8A 2CPFA 3BKUA 1UKUA 2R7VA 3AOBA 1FESA 4OI3A 3NGDA 3CD0A 2DRAA 4B3SJ 5BYSA 4FDFA 4NLWA 2GA7A 2D41A 3FCVA 4C2MA 3M2VB 3FK4A 2GW8A 1S10A 4X62F 1NRKA 2ASLA 2JLEA 3LP0A 3RTVA 4KGKA 2F4FA 3N5BA 5JVGQ 1R8PA 4DV5F 3FZBA 1F5CA 4M5MA 3TJAA 2ZBIA 5A8RA 2MKYA 1Y10A 2YQ1A 2XMJA 2V4RA 1X4GA 2Q1LA 3IM9A 3WZ0A 3UR0A 5K8MA 2H5IB 1VK3A 1NB7A 5L1KA 4C8ZA 2OMLA 3K57A 4URGA 1RAGB 5KOWA 4ELTA 3AXKA 2CG8A 4RBUA 2YWFA 1RWNB 2JC0A 1RHRB 3W60A 1RBOB 4IDKA 3BSNA 2JRSA 2W7OA 4FKYA 3MGJA 1FWPA 2L08A 1Y4ZB 1VQ4S 2EWHA 5AJ3F 4HDGA 5EN1A 1NUEA 1GTHA 4OHVA 3DRRB 3HHNB 2EFNA 4PG6A 1U0SA 4MK9A 1NB2A 3QJPA 2C2EA 5CXTA 2HVDA 2KT2A 4KV8A 2HEKA 1RT5A 3EPGA 2ZBCA 2OKQA 4J9KA 4IUFA 4QU6A 4DSIA 3P4UB 3G6VA 3GWCA 1TV6B 3JYTB 3TO8A 2Z30B 3QO9A 5G4DA 1AFJA 3OTCA 3MMAB 5A8WA 1JQGA 5CD4A 4C0BA 1XNQJ 2BQ3A 1RU1A 4KO0A 3BBCA 3I87A 4DR4F 2IFXA 1RTZA 2CFXA 3MEGA 3DRPA 1VQOS 2XCAA 2B3TB 4RBVA 2DHSA 1FVSA 2O3DA 3BGFA 1FNMA 5J2NA 5IT0A 4G3IA 3W5ZA 2IC3B 2H5EA 4NI2B 3N5FA 1NHKL 3QIPB 3OJUA 2HNYB 1ZPVA 4L74A 1KVJA 2DEIA 2RQMA 2P9GA 4CNYA 3CD7A 1S9GB 3CXCR 3PW2A 5ETNA 1CJUB 1QJHA 1S97A 3G86A 3FQKA 1F3VA 2MQMA 1AT1B 3IWXA 1DFDA 3MEEB 3DLJA 4WPAA 1VRUA 1SIZA 4M8LA 2R7WA 1Y9OA 3H0PA 4EYHB 1A9NB 3OL7A 1WI8A 3BH6B 1VQ7S 3CD5A 2DR5A 3EDRB 1I3OB 3MMBA 1XMBA 5L1JA 3OTOF 1OYEA 4X4PA 1R0AB 2IY5B 4AQYF 4EBEA 2ZD1A 2B6AB 2NSBA 4G65A 2BE9B 4CH1A 3I31A 4EFAC 1V3RA 3BR8A 5CAAA 1WNEA 3K5OA 3TVZA 2P6SA 4MYUA 3T1YF 3GYNA 2GNKA 2DPIA 4M5NA 3IR5B 4P6QA 3O2IA 4QYZK 2XS5A 2DR6A 3QZ7A 1LXNA 2EFVA 4QU7A 3PJ9A 2FHKA 3GV5B 2KFZA 3ILOA 1VK8A 3F0NA 1XC9A 1HKAA 5AXMA 2HVZA 5LT5A 2BV3A 3OD2A 3KWMA 4RL1A 4F7VA 1S0MA 5A8KA 3RB4A 3V4IA 1S9EB 1TR0A 2ILYA 2XNQA 1UJ4A 4ED4A 1HNVB 2K7KA 2OSRA 3LUYA 2NZCA 2DNRA 3GILA 2LQBA 3C66A 2ZM6J 4X4QA 4DN9A 3TWZA 1FO1A 4F4AA 3A4TA 3D0IE 3L7OA 5LXYA 1HA1A 4YFUA 1FJ7A 2W9BA 4DL0C 4DSJA 4ZCMA 1PJ6A 5IFMA 1NHUA 4MYTA 3UDCA 4IR9A 4A8FA 2GQCA 2HHPA 2UXBJ 2LKZA 3FSIA 3SV3A 3OJSA 4EWTA 3AY0A 1HNXJ 3KG1A 3I0SA 2FVSA 1REVB 2HBRB 2K1RB 2XCPA 4PWDB 4LF6F 4WIIA 1IWAA 1JXLA 4YDXA 3HPOA 2AV5A 2BX6A 4IFVA 1Q5YA 3MM7A 4DG1A 3Q2TC 2BJ3A 2RRBA 3V2UC 4Q8FA 2FJDB 2FLPA 4Q7AA 3KNAA 3PJWA 3GIMA 4YUDA 3ADAC 1FD2A 2MQPA 2BM1A 3CJSA 4TQRA 3W63A 4K4XA 1IKYB 5IM0B 3HLUA 4DV4F 4DQSA 4HYKA 2CKWA 2ABYA 2EBGA 1QSSA 1Q86T 1S6QB 2UV8A 1PYOB 2HRTA 3PTWA 2QFJA 3S6EA 2ZH6A 2KXNB 1VRQC 1BE4A 1TKZA 4LF9J 1RT4A 3HVWA 1RLCL 3BJYA 2LXUA 4QPTA 5LSLA 2Z0GA 1WKJA 2QLXA 2QLJB 2PEBA 1IM6A 1S1TA 3HCXA 3KLFA 1NM2A 1IR0A 3NRBA 2KVQE 2QLFB 4RNOA 3H4DA 5BR8F 3IA0A 1PC5A 4MIBA 1S77D 3VQSA 2YXLA 5HANA 1LWFB 1O5JA 1LV5A 1NJZA 1JNRB 4JYAF 5ETMA 2J0SD 1FT8A 1J27A 4RO0A 1EJ7L 1SJQA 1DAXA 3JQKA 4DR3J 3DI6B 4ER8A 1FKPB 2AX0A 4ZP6A 1N5TA 1RTHB 2J0XA 4PPZA 2WCXA 4RUAA 2ZHOA 3I32A 5D0GA 4UOFA 2CJKA 1YBTA 2JSXA 4JV0A 2V9WA 3LP1A 4C3MA 4NASA 5LJ5Y 5D78A 3W1YC 2HFZA 2EFQA 1WEXA 3FBBA 4WXWA 2N3LA 4R5PB 1AZSA 5KG7A 1VBKA 4U96A 1FF2A 2L9NA 4Q44A 1OQ3A 4OZ2A 4I2QB 3T5JA 2YKMB 3ZTSA 1X9MA 5KG3A 2DGSA 1DARA 1T9TA 4YR0A 3RB0A 1RWXB 2XMMA 3D28A 3C6TA 2VH7A 4OYPA 3HVTA 5J1EB 2KYZA 1VQPS 1VLOA 4HACA 2DXEA 4UZBA 2GVZA 3IG1B 2ZOMA 2DITA 4XO0A 2VG6B 2U1AA 4I2PB 1B4SA 4WFYA 3K8VA 1JLGB 4RBTA 5D3GB 5E3RA 3MPDA 4I4BA 3AFGA 5B7WA 2BABA 4F67A 1BGXT 4F4ZA 1AUSL 3L4BC 4UOGA 3BGUA 1C1CA 4O3RA 3G6ES 1JLCB 1YJTA 4KH1B 4ZP7A 3M1VA 3UDVA 2CWKA 4OV1A 4PQUA 3Q89A 2R4FA 5HAOA 3H5YA 4JI1F 1C0TA 3GG0A 3W62A 3PR4A 1F5AA 1BC6A 3M8SA 5E2QA 1S1WA 1HWIA 1XNRF 3ONQA 3KK1B 5KFXA 1YZ7A 5IT4A 3DOKA 3C46A 1HBOA 2VFUA 5DG8A 2RHSB 2JZ5A 2DNKA 3MTKA 3LAMA 3J7ZT 3GCXP 4EI2A 1N5QA 4RUHA 4CM0A 1YLXA 1PYTA 1UW9A 2FGOA 3OUYA 3X1LB 3C14A 2HVIA 1H72C 4IRKA 3DOLB 2RQ4A 1QAYA 3QQCD 5I3PA 2YBVA 1NSKL 1NJIT 1FERA 4LMZA 3IR7B 3LH2S 5LL6d 3F41A 3B78A 4Z7YA 3BS9A 4RW4B 4K4UA 2DXFA 1ZYQA 2SXLA 1TK8A 2KM8B 1ZAVA 2O01C 1N6QA 1RAJA 4NZ7A 1DLOA 5DQHA 4DV0J 2HZCA 1U2CA 3N79A 4GO7X 2OPRB 1CQMA 4EO8A 5A2QY 1NH8A 1CVJA 2C2OB 1NDPA 3N28A 1X4CA 5KT3A 3HHLB 1U49A 2F63A 2BJDA 2AYMA 2VFRA 1OPIA 1SXLA 4ES3A 1S12A 2EW9A 4NPOA 2V0NA 1FE4A 4FS1A 2DNHA 4WXOA 3BF4A 1YIJS 3OL9A 1RAAB 1O6XA 2H51B 5G0RA 3AJ2A 1KQGB 4KE5A 1JK9B 4EUVA 2HBQB 4Z7CA 5KFYA 1LNQA 2HS0A 1MU2A 1RT7A 4HH1A 2VICA 3P6YC 4E8UA 2MQNA 1VFJA 2JOQA 4ECXA 1NBEB 2Q6CA 2VA2A 4WYWA 2IYIA 2MLZA 3ISND 1EX8A 4DL7A 2QYGA 2YNFA 4C8MA 3W64A 1HWJA 2FY1A 1Q53A 3FKBA 2CQ4A 1GH8A 1RYSA 5M2RA 2KXFA 2FJVA 1ZPWX 2GJFA 3JSYA 4NLOA 4P10A 2AW0A 4ECQA 3CPWR 3LPEA 5A8RB 1Y7PA 1YZ6A 4X4NA 3D6HB 5C2CA 3IRWP 2BANB 3AJDA 2H1YA 3G8SA 3ZTQA 3QGPA 1XMQF 1B70B 2F1FA 2V94A 4KGXB 5A6WA 1JB0C 4AXIA 4QR2A 2BR0A 3M2UA 1YX2A 5H9FJ 5E41A 2GCFA 3ILLA 4LT6A 4NYZA 3MFHA 1TKTB 2FJEB 1HBUB 1T02A 4DV3J 2KFNA 1RBAA 2J8SA 3D6TB 1RTDB 2C2MB 3PG9A 2J9DA 2ZC3A 4C8NA 5IWAJ 2FD2A 4ALZA 5B0FA 3VVUA 5DM7Q 1ZBTA 1BQMA 4W4MA 2DR8A 1N34J 4CLWA 1DBDA 3QNWB 5EX3A 2Y8WA 4FF1A 3GFHA 3HSJA 2HYIB 3OL6A 4HDHA 1RWOB 5F8HA 5A8WB 1D1UA 3HSDA 3RUBL 3EXCX 4Y34A 2GO9A 2MY7A 4KO0B 3R5DA 1IM4A 3RAXA 1WACA 3I5AA 2C3YA 4MH8A 4PPDA 1Y0HA 1FKOA 1WF2A 5L9NA 1XNQF 1T03A 2QSFA 3T41A 2HSEB 2OP5A 5KFKA 5AXLA 5FDLB 2QA2A 3PRBA 1Q82T 3RB6A 2NXCA 3H42A 4B3RJ 1WDDA 4QIGA 4WFBQ 1N36J 1S6PB 3DHWC 2RT3A 3RYLA 4CO3A 2XMWA 4E2FB 5GAGI 5F3ZA 1KD1T 3BGLA 5DZ6A 5BJRA 2HGMA 2Y1RI 4ZVTB 2MZRA 3ENVA 2AHOB 4RUBA 5DG7A 2E5JA 2M5YA 2GZOA 2GVDB 2HPUA 1KKHA 1HR0F 4ED1A 3V4MA 3NNHA 2QV6A
chains in the Genus database with same CATH topology
1UMJA 2NPIA 3E01A 1HPZB 4HT5A 3PVXA 1WF0A 5HROB 4ZKAA 4PWDA 4BC7A 1RT3A 1K9MT 1QAIA 2EKYA 4W90B 2F9DA 1WHXA 1TUVA 2BANA 2IAJB 2BRLA 3QIDA 4DEZA 3H5SA 4YY3F 4F2RA 3BSCA 3ZZRA 3PO5A 4A8XA 3HK2A 1HWKA 2QIFA 2XEXA 3K8WA 2OPQB 4OX7A 1U1KA 2XSJA 1BLUA 5CYQA 4QR1A 4MFBB 2J6UA 2HHQA 4DSEA 4JV1A 3BGRB 4OFZA 3MEKA 4O4RA 4R8UB 2CQ0A 2Q79A 5L1IA 2ALZA 2NREA 2UP1A 2VG7A 2JFDA 4PRFA 4RWXA 1JNZB 2YTCA 3W2VA 3M8PB 4CI0B 1KEKA 4DMZA 1ZM9A 2Q6BA 2J6SA 1U24A 4ZPCA 3KK3B 1UVJA 2DNOA 2VA3A 5C24B 2C3MA 2XNRA 2KRRA 1MWYA 3CSKA 3BEGB 4K4WA 4HLBA 4B02A 5GMKa 2MKKA 4PCQA 4A8YA 1FXRA 1MMLA 2D3UA 1IBLF 4DFMA 5GVQA 2ZH9A 1CQNA 1EP4A 4C7QA 4Q0BB 2CJ9A 5B0AA 4PQAA 6FD1A 2ZH4A 2OSQA 1TKTA 1NJYA 3FVYA 5C5JA 1HBUA 2JL9A 2OPSB 4A8OA 2E29A 2VASA 3N9UC 2R9LA 1D9AA 5HP1B 2M88A 3I5CA 1SBRA 2WONA 2HGLA 1QUVA 4TN2A 1HD0A 5IM0A 1RTDA 4FXDA 4K4TA 1VQ9S 4PXCA 4F4YA 3K5MA 2OPPA 3DYAB 2KKHA 3IO1A 3VAHA 4DV6F 3BDPA 4A8QA 1DTQB 1LWEA 3PACA 4IH7A 3SXLA 2A2DA 5AE3A 3MR3A 1X4HA 4X64F 4I67A 4NYOA 2NS1B 4C3LA 4N76A 5IZHA 3IWNC 4O4GA 4ZPDA 2OLWA 3UNGC 4KHRA 4KKOB 5F8JA 3KTQA 2V8VA 5CQGA 4F3MA 2DGUA 4JOUA 3HP6A 1JWWA 1S0VA 2DNGA 4PR6A 3H4BA 4I56A 4DF8A 2GFFA 1QY7A 3D1OA 4HT7A 4J9PA 4IG0B 3OLBA 4EBDA 1T3NA 1UEUA 2IM0A 2KT3A 2M4MA 2KT5A 1JLQA 3OSPA 1N8RT 2QMWA 3LWMA 4ZS6A 1S49A 2CJBA 2FHJD 1U47A 4JI3F 3WC0A 2EVZA 2RVJA 1T95A 4LVNP 1SH2A 1ZH5A 3E3XA 1UAWA 2HQIA 4UY8T 2D3ZA 3D1HA 4RX6A 4V19X 5F0UA 2U2FA 2W4PA 3QAUA 4KSEB 3VR1A 1CPZA 2YX7A 3CTRA 5F8MA 4DV7F 1KQSR 3MTJA 1Z2ZA 1FVQA 1RTIA 3SCIE 4DL6A 3CIZA 4ES1A 5CCLA 2NYIA 4LF5F 2PN6A 3BN4A 4RNHA 3QYYA 2FHOB 2P6TA 1GXUA 2G0CA 2ZM6F 2HVHA 3MWBA 4ID5B 1XR5A 5THWA 2YNGA 2N82B 3EPIA 4K4SA 4QR0A 1YJNS 3FSYA 3LW5C 3AB4B 4WKRA 1NJWA 3MAQA 5KTQA 2H9ZA 2DHAA 2YH0A 3NGKA 3GB0A 2NUHA 4ZVGA 1JLFB 1UWBB 1GQEA 2VBZA 3CMAS 1QAJA 3VCDA 1P1LA 4NLVA 3FGVA 2DJWA 2DHXA 4F8RA 1HBMA 3DI6A 4X4UA 4KT0C 1X4FA 4TY8A 1FKPA 5FDLA 4WFXA 1DJ0A 3QMQA 4M5DB 3SDEA 4IRDA 3RBEA 1URNA 2F4VF 2UUTA 3TX8A 4A8WA 3NCRA 2ZE2A 3UDLA 2AJ4A 7FDRA 4ERDA 4C8LA 1RISA