3HVAA

Crystal structure of fimx ggdef domain from pseudomonas aeruginosa
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
162
structure length
162
Chain Sequence
VSSQDPVTGLYNRSHFLDLMDAAVQQAVTARKPSTLAYIHLNGYPSLQADHGLSGIDLLLGQLAGLMREQFGEEADLARFGDSIFAALFKGKTPEQAQAALQRLLKKVENHLFELNGRSAQATLSIGVAGLDEKTAKAQDVMNRAHRCADDAARKGGSQIKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX.
pubmed doi rcsb
molecule keywords Protein FimX
molecule tags Transferase
source organism Pseudomonas aeruginosa pao1
total genus 53
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature ec 2.7.7.65: Diguanylate cyclase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00990 GGDEF Diguanylate cyclase, GGDEF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3hvaA00
3JSMB 4J9PA 4IR1A 2YNFB 4MKAA 4ECUA 1HQUB 4ZP7A 1HNIB 1S1TA 1SV5B 4NCGB 3MF5A 3KLGA 1TL3A 1RA7A 4YR2A 1LW0A 1BQNA 1DTQA 4RW7A 2W7OA 3DOKB 4DL6A 4QW8A 1JKHB 4QWEA 1JLBB 2JEIA 4TN2A 5KFCA 1S9GB 4Y3CA 2HNDB 1Z4UA 4K4YA 3Q8RB 4IG0B 4QWCA 2XCAA 3KJVA 4FS1A 3MFHA 2B5JB 4KFBA 3V6KA 5KFMA 1S1WA 4IH7A 1W25A 2QE5A 4QPXA 2WONA 4Q45A 4K50A 4J9QA 1IKXB 2BQRA 3QIDA 4DEZA 3M8QB 3MEEA 5I3UB 3BSAA 3UQSA 4YR0A 4WYWA 2E9TA 2V4RA 4U6PA 3HVTA 5HROA 3M9MB 5J2MB 4KBIA 2W9CA 2J6SA 3T5JA 4H4MA 4NRUA 3UR0A 5K14B 1BQMA 2I5JB 3GV8B 3RBDA 3MEGA 3GIMA 1TKZB 1FK9B 3H5XA 2R2RA 4RUAA 2OPRA 3H5YA 3PW2A 4TLRA 4O44B 4RNNA 2IMWP 4NLWA 2IM0A 4Q43A 4NLXA 4ZP6A 3N6LA 3BSOA 2IJNA 2QV6A 4KKOA 2IC3B 2D41A 4I2PA 3V6DA 3GIIA 2IAJB 2CKWA 3OLAA 5CYQB 4EYIB 3PW0A 4WE1B 4RUCA 2B6AA 3CJ4A 5L1LA 1DLOA 5J2NA 3FFIB 2C22A 4K4SA 2UUWA 4MK9A 2YNIA 3CJ5A 4J9SA 5HLFB 4IRCA 2V9WA 1N5YB 1C0TB 5J2QA 4Y34A 3DOLA 5KFHA 1MMLA 2HNYA 5JUMA 4F4XA 2YNHB 4ECYA 5C24B 5D3GB 1ZETA 2DPJA 1MU2A 2BANB 5KT7A 5L1JA 4ED0A 4IR9A 4JV2A 4JV1A 4F50A 4ZVFA 5F8MA 4J9NA 1REVA 1RT7B 1JLCA 3LAMA 3JSMA 2YNFA 3DLKA 1HQUA 1HNIA 1SV5A 3RB4A 2AGPA 4NCGA 4LSNB 3DOKA 4MFBB 1RTIB 4IQXA 1JKHA 1JLBA 1S9GA 2HWHA 3QYYA 2RDJA 2HNDA 4ECWA 4IG0A 1I6JA 3CJ3A 2JLEA 3KLIB 3T5KA 1HMVA 2D7SA 4ZPAA 4IRDA 5F8JA 1ZTWA 4MH8A 2B5JA 2JEJA 4WYLA 3BSCA 2RKIB 1K1QA 4NLTA 4RW4B 4F4YA 3LAKA 3H5SA 5C5JA 2WTFA 1IKXA 4RU9A 3OSPA 2IBKA 3M8QA 4R0EA 5KG3A 5KFQA 5I3UA 3DLEB 4O4GB 1J5OB 2ASDA 2UVWA 2R8GA 2ZD1B 4K4TA 4FBTA 5J2MA 1VRTB 4DL4A 2BQ3A 1S10A 2XC9A 5K14A 2ILYA 3CDUA 5FDLB 3Q8QB 3LALA 1FK9A 1TQLA 2JEGA 4K4UA 1HNVB 4XPEA 2WK4A 3TAMB 4O44A 2VA3A 4RW6B 3NKYA 2W7PA 2C2RA 2IC3A 2HAIA 5F9LA 3C6UA 3PR5B 3QLHB 3KLVA 2IAJA 5KT2A 3QGHA 5CYQA 2B43A 5DG9A 1JXLA 4WE1A 2ZKUA 2XCPA 3FFIA 2AX1A 3HKWA 4HKQA 3HVWA 5HLFA 2JC1A 3DRPB 3NBPB 3QZ8A 2VA2A 1N5YA 3I5CA 1C0TA 2I1RA 3IN5A 3ISNC 4WFYA 1T03B 1RTDB 3V81B 2R8JA 4TY9A 4ZHRA 1QE1B 2YNHA 5D3GA 1LW2B 5C24A 2UVUA 4ED6A 2BANA 2XI3A 2YNGB 3T19A 3KLEB 5J2PB 4ECXA 3OSNA 3RBEA 2FVSA 5KFKA 1R0AB 1T05B 3BSNA 1RT7A 3DRSB 5KT4A 2RF2B 4NLOA 3H98A 1C2PA 3NGDA 5KFSA 3TVKA 4LSNA 1S49A 4JV0A 2R8IA 4J9RA 5F8GA 4MFBA 1RTIA 2BRKA 4KO0B 5JXSA 3KMQA 3QO9B 4ECRA 2IJFA 2GC8A 2R8HA 1TKXB 1SH3A 4YR3A 2OPSB 3I5AA 1S1UB 2HNZB 3CO9A 3KLIA 1N6QA 4ZVGA 4GC6A 3GYNA 4MIAA 4URQU 3RB6A 4RW4A 4O3NA 4NLQA 4DG1B 2GIRA 3LP2B 5KG5A 3IGNA 4QWBA 3GIJA 5EWGA 3DLEA 4H54A 4O4GA 1J5OA 4OL8A 3DMJB 4MKBA 3SFUA 2ZD1A 1VRTA 2C2DA 3EPIA 3CJ0A 5FDLA 4O3SA 4ZP9A 1RT4B 4ECVA 5T14A 2DPIA 3PJWA 2JEFA 2UVVA 2FVRA 1HNVA 5EDWA 4PWDB 2XGPA 5DG7A 4R8UB 2BE2B 3TAMA 4G3IA 1IKYB 3JYTB 1JLQB 4RW6A 4TY8A 1RT3B 2AGOA 4TQRA 3IG1B 4DL7A 3FQKA 3MECB 3GQCA 1CSJA 2JC0A 1YVFA 3H40A 1RYSA 3QLHA 3DYAB 3LP1B 1NHUA 4YQWA 2W9BB 5DLFA 4X2BA 4RNHA 2J6TA 5J1EB 1RT6B 1JX4A 5KFFA 1U09A 3DRPA 3NBPA 1JLAB 3C6TA 5L1IA 3IRXB 1XR5A 4XO0A 1T03A 4G1QA 2AQ4A 1RTDA 3V81A 2WB4A 1QE1A 4IG3A 4IRKA 1LW2A 3ISND 2YNGA 3KLEA 1HQEA 5J2PA 4WZMA 4KV8B 5HP1B 1JLGB 1R0AA 1T05A 1D1UA 1S0NA 3DRSA 5F8IA 2RF2A 3MFIA 3DLGB 4NLYA 1EP4B 3KLFA 3KNAA 1NHVA 4NZ0A 3FQLA 4O3OA 5DLGA 4I7FB 4KO0A 3QO9A 3M9NB 4KSEB 1C0UB 1HYSB 1TKXA 4RNMA 2OPSA 3OL9A 1S1UA 2HNZA 1FKOB 1QAIA 2R8KA 3D5MA 4F4WA 1OS5A 2OPQB 2V0NA 4LSLB 2WOMB 5KT3A 1DTTB 4QW9A 1WNEA 4TYAA 5KG6A 4XPCA 3PW7A 4DG1A 2ALZA 2R2SA 3LP2A 5L1KA 4RNFA 3I0RB 3V6HA 4I2QB 3GV7B 1S6PB 5C25B 3DMJA 3CVKA 4ECSA 4LQ3A 3PHEA 3G6XA 4ZPDA 3KMSA 3KK2B 1RT4A 3LANA 4NLUA 5F8LA 4QWAA 4ED3A 4TQSA 3QIPB 3FSIA 4PWDA 4KHRA 2WRMA 2I5JA 4R8UA 4EBDA 1S1XB 1IKYA 3JYTA 1TL1B 1TKZA 3BGRB 1JLQA 4RW9B 4O3RA 1RT3A 4Q44A 3KLHB 3IG1A 3MR5A 1LW0B 4RW7B 4Q8FA 4MK8A 4NLRA 3N6MA 3DYAA 3HHKA 2W9BA 5KFZA 3E01B 5J1EA 2HWIA 1RT6A 4WFXA 2IM1A 3Q8SB 1LWCB 2EC0A 1KHWA 3ITHB 4URGA 1LWFB 2CJQA 3IRXA 1RT1B 1C1CB 1RAJA 1C1BB 2ZE2B 1IKVB 3QZ7A 4DL2A 1JIHA 4IH6A 3FRZA 4Y2CA 4F4ZA 3G6VA 4DL5A 2ASLA 4EO6A 4PQUB 3HVTB 4HYKA 1T94A 4KV8A 2W9CB 5I42B 4O3PA 3KHHA 1JLGA 3KHGA 5HP1A 3EZUA 1FKPB 1RTHB 1NNDA 3MEGB 4MIBA 4NLVA 5DG8A 1S9EB 4J9KA 2C2EA 3DLGA 3RB3A 3V4IB 2FVPA 1S6QB 1EP4A 3LP0B 2D3ZA 3H59A 2FLPA 1XR6A 2V4QA 1QUVA 5KFIA 3QGGA 2XGQA 4I7FA 4ECQA 1VRUB 4IFVB 3OL7A 2IM3A 2HMIB 4ED7A 1C0UA 4B3OB 3NL0A 1HYSA 4DL3A 4RW8B 3I0SB 3OHBA 1GX5A 4NLGA 3MR2A 4NYZA 1SH2A 5J2NB 5DQGA 5KG4A 2OPQA 5F8HA 1IM4A 4LSLA 1HARA 2WOMA 1GX6A 1DTTA 3M8PB 4EBCA 5DQIA 5KFDA 3DM2B 2GIQA 3EPGA 2IA6A 1RT2B 3QGIA 2WHOA 2IM2A 2OPPB 3DOLB 3I0RA 5KFBA 4I2QA 2R2TA 1S0OA 2RKIA 4ZP8A 5C25A 5DGAA 5KFXA 3KHLA 4LQ9A 3NAHA 5DQHA 5KFYA 3VQSA 4ZVHA 1S4FA 1TKTB 1IKWB 3KK2A 4ZPBA 2E9RX 4ZMMA 3KOAA 5KFEA 4Q0BB 3MR6A 2FJVA 3QIPA 5F9NA 3DLKB 1S1XA 1N56A 1TL1A 3BGRA 1TVRB 3MEDB 4RW9A 3BQ0A 3OLBA 3KLHA 1RT5B 2YKNB 2VG7B 3PW4A 4KAIA 2VG5B 2W8KA 1JLEB 3KLFB 4RZRA 4YP3A 4ICLB 3E01A 3UPFA 5KFVA 1LWCA 3BREA 4Q8EA 3ITHA 1HMVB 1LWFA 3CDEA 3DDKA 5KFOA 3MR3A 1RT1A 1C1CA 5KFJA 2W8LA 3NMAA 1SUQB 4K4VA 3PJXA 2C28A 1C1BA 3KK3B 2ZE2A 1IKVA 3V6JA 1S1VB 3TQ1A 3MTKA 3CDWA 5F8NA 1LWEB 3ICLA 4PUOB 4EEYA 1TV6B 4H4OB 5KFPA 5EWEA 4ED8A 3OHAA 2BR0A 4PQUA 4IOBA 3H4DA 5C42B 5I42A 3RAQA 4QWDA 3N6NA 2YKMB 1FKPA 1RTHA 4WXOA 4IDKB 1S9EA 4IFYB 3PZPA 4FBUA 4URSA 2RDIA 2XWYA 1S6QA 3KK1B 4K4WA 3V4IA 3IS9B 3LP0A 4M95A 3T5LA 1EETB 4NLPA 4R5PB 3GIKA 4ID5B 4K4XA 3CWJA 1VRUA 4IFVA 3C6UB 3FDSA 1HPZB 2HMIA 4B3OA 2W9AA 4RW8A 3I0SA 4TXSA 4NLDA 3UDLA 2FVCA 1RYRA 1KLMB 4KB7A 2VG6B 3M8PA 4ECZA 4K4ZA 1RDRA 5KFGA 3DRRB 3DM2A 3BJYA 1RT2A 4EYHB 4ED2A 5HBMB 3E51A 3SI8A 4O3QA 3NAIA 2OPPA 2AGQA 1RTJB 4Y2AA 4ZHRB 5KFRA 4NLSA 1SH0A 2R2UA 1RA6A 1QAJA 3DI6B 3G6YA 4JUZA 3BR9A 3CIZA 4ED1A 2FJXA 1UWBB 3PR4A 4WXWA 1TKTA 1IKWA 5CYMB 5KT5A 2F8EX 4Q0BA 2E9ZA 5KFNA 2J6UA 5KT6A 4ZPCA 4GC7A 3MEDA 1TVRA 4KHMA 1JLFB 3H2LA 1XR7A 1RT5A 2YKNA 3Q8PB 4J9LA 2VG7A 1S97A 1S0MA 5KFTA 4J9MA 2BE2A 2VG5A 1KHVA 1JLEA 2XI2A 5KFAA 1S1TB 3RAXA 1ZTTA 3M9OB 4ICLA 3T1AA 1TL3B 3KLGB 3MECA 1BQNB 1DTQB 2BQUA 1N4LA 4EBEA 3LP1A 1N6QB 3CJ2A 1SUQA 4IKAA 3HVAA 3PW5A 5KG7A 4WFZA 3KK3A 4M94A 5KG0A 1S1VA 1JLAA 1LWEA 3G86A 1K1SA 3KJVB 1TV6A 4H4OA 4KFBB 2FLNA 4O4RA 4PUOA 4WZQA 3D28A 1S1WB 4MK7A 2WONB 2ASJA 5C42A 2AX0A 3PVXA 3RB0A 2UVRA 2YKMA 3MEEB 5KFLA 4IDKA 5KG1A 3T5HA 3SFGA 4IFYA 5HROB 3KK1A 2AU0A 4H4MB 3OL6A 3IS9A 1BQMB 1N48A 3I5BA 3IGVA 1TP7A 1EETA 2WCXA 4TY8B 3H5UA 4KE5A 4R5PA 2BRLA 4IH5A 2OPRB 4ID5A 1S48A 2FVQA 1HPZA 2FJWA 2UUTA 4EO8A 3KHRA 4FS2A 4KKOB 4ZVEA 1KLMA 4I2PB 5DGBA 2VG6A 3GILA 3BQ2A 3V6DB 2D3UA 3DRRA 2O5DA 3BQ1A 3C6TB 1D0EA 1FKOA 2B6AB 5HBMA 5L9XA 1DLOB 5KG2A 1S9FA 4G1QB 2AWZA 1T3NA 1RTJA 2OH2A 2YNIB 4IG3B 5KFUA 3DI6A 5J2QB 4J9OA 4RNOA 1UWBA 2ATLA 1HQEB 1S6PA 4ECTA 2HNYB 5CYMA 4YMEA 3OL8A 1MU2B 5KFWA 3GV5B 4U7CA 4NRTA 1JLFA 5EUHA 5EWFA 1REVB 3H4BA 2FLLA 4TYBA 1JLCB 2ILZA
chains in the Genus database with same CATH superfamily
3IAS9 1LV5A 1U6ZA 2JVOA 1XN9A 3FZ2A 2N3LA 1RK8A 2JEIA 1UEKA 3K5NA 3EZOA 4AQYF 3PX0A 3WC2A 3D9BA 1RBLA 2PA8D 2QSWA 2CNKB 3BSAA 2G2ZA 1PC5A 1KP6A 2JLFA 1FWKA 1SJQA 2GVDA 2HS3A 1GFWB 3ET6B 4OX9F 4WE1B 3UWTA 2RAQA 5KFHA 4OZJA 2DPJA 4FF4A 4ZVTB 3KUGA 5F8MA 3K17A 4BC9A 1JLCA 3M30A 4C7QA 5GAHU 3EYZA 1NJYA 3IWXA 3PYGA 2V69A 3M8QA 2ZFHA 1R0CB 4OHWA 4V1Ak 1H72C 3JAMY 3RYLA 2VH7A 5DZ7A 2ZNZA 2KYXA 3C6UA 5ADZA 5KT2A 5CYQA 4PEOA 4F8RA 5IFMA 3TRGA 1C0TA 1T03B 3IN5A 5J2PB 3CE8A 1MWZA 3W2VB 2QLWA 4NLOA 1T9XA 5LSLA 3BH6B 3W61A 4WU2A 2NYIA 1FWPA 1MNEA 2P6TA 5D8HB 1RWPB 3GIJA 2W4DA 1S7IA 2Y9HA 3M2RA 1VRTA 2HHTA 2B7CB 1H73A 2U1AA 3JYTB 1N32J 1EQ0A 2JX2A 2HQIA 4U95A 2VODA 4DR5F 3G6ES 2KFNA 1NHKL 3D68A 4USKA 2F4VJ 4G1QA 2QIFA 1SJ4P 4IG3A 3DGVA 1T05A 4PRFA 3DRSA 4C0BA 4WP9A 2YWKA 3GJRB 4IYQA 4F3MA 1UTAA 1XWLA 2ABYA 2HK3A 3LF0A 3QO9A 1FKOB 3MPYA 3MI7X 4M5LA 3LP2A 4N7TA 1NDPA 4NI2A 4ECSA 4PPZA 4LRAA 3KJFB 2R7WA 3LANA 5A6WA 2EFOA 1U1NA 2CQ4A 4PWDA 1JLQA 5IT9Y 3OJUA 3QAUA 4OZ1A 3OTDA 5J1EA 2CQDA 3ITHB 1U2CA 3RUBL 1WF2A 1C1CB 3LA0A 3QZ7A 1D3WA 1UP1A 4QIFA 1MN9A 2NZCA 1T8EA 2W9CB 4X4SA 2UXCF 5F0UA 1CJVB 3GG1A 2QL9B 2LQ5A 1VYAA 2CJAA 5LOQA 4G6VB 2HFUA 2YVSA 4RW8B 3W2WA 2ACYA 2BEFA 4F26A 3I0RA 5A0YB 4FVMA 5D4OA 3UN5A 2E5HA 1FDBA 1PIEA 3MHYA 4ANEA 1S1XA 3KLHA 1O6XA 2UV8G 5ETOA 2E44A 3LTOA 2CPFA 1B64A 1NPKA 3POTA 1HMVB 4ILRA 3TWZA 4A8FA 4YB5A 1NRKA 1X9MA 2AYBA 1RTHA 3V4IA 2YQ0A 2ZH2A 4F67A 3GIKA 2V63A 3CCTA 4C98A 4K4XA 4C8LA 2KT3A 1SPBP 3UDLA 3I32A 2MEWA 4HDGA 2D3OR 5M2RA 1U1QA 2ZZTA 3QJPA 2B51A 2DCLA 1UPMB 3MEDA 4ENOA 4J9LA 1N54B 3OFGA 1QAXA 1XMOJ 1WG1A 4V19X 3OXGA 2VQEJ 3I9V9 1SUQA 1HBOB 1N5SA 1K1SA 3EMTA 3QFWA 3GR0A 3C8YA 2WSEC 3OUYA 3HO1A 3RB0A 3BM7A 3ZZTA 4XDCA 3SFGA 4KJIA 3CSKA 5HROB 5ITHA 3EGWB 4LIRA 4FF1A 3I5BA 2QA4G 1AFJA 2XZWA 2AEFA 4W98A 4UUWA 4YUDA 4J91A 3DRRA 3M8YA 1D0EA 2G2OA 5KFUA 5J2QB 1H38A 2BABA 4X66J 4N47A 1GTEA 1Q1KA 4WKYA 4J9PA 4ECUA 4DR2F 2MDAA 2DXFA 1RA7A 2R7RA 1F2GA 1KN6A 2HNDB 2ZBCA 2SXLA 3AY0A 1W25A 4K50A 4DSLA 2XQCA 3LPEA 3DOMB 1LOUA 3M9MB 1CLFA 4KH0B 5K14B 4NASA 2QV6A 1GXUA 1T02A 1F9FA 2LP4A 5IM0B 4DI6A 4USMA 3OTOF 2DNZA 3DOLA 1MMLA 3L9ZA 4K5RA 1RWXB 3B4DA 5LMNJ 1BHNA 3OD2A 2Q6CA 3DU5A 5GAEU 1X4CA 5HQMA 2K1RB 1WF1A 1NAQA 1AB8A 2MTLA 4UQTA 3OFFA 3P8BB 1I6JA 5HANA 2B0GA 3UCGA 4I4BA 1FRMA 2ZBIA 1OPIA 2YWHA 3MCNA 2IBKA 5T41A 2KHCA 1JJ2R 3IWLA 2RH3A 1HA1A 3T1YJ 2MGZB 1YBUA 2WSCC 3M8ZA 4HKQA 2JWNA 1HBMB 2F4VF 4ILMA 4D3HA 6FDRA 3W7BA 5AXNA 3AODA 5C24A 3M6WA 2IRUA 1HHTP 2XYGB 1MROA 3PEJA 1RTIA 3EVMA 4KO0B 3KMQA 2GC8A 4MYUA 4KGKA 2EBEA 2DGQA 2KJVA 4URQU 3D3BJ 4O3NA 5KG5A 4PCQA 4OHYA 1H98A 4WPAA 3CD6S 3CCJS 3KTQA 3SIPB 5L46A 2BE2B 2OLWA 1RT3B 3GQCA 3QPIA 2QL5B 1Q7LB 2FGOA 4K0KF 1RT6B 2V2QA 5RUBA 2RILA 2UUBJ 1Y5NB 4M5DB 1VQOS 3ISND 3DCAA 3KLEA 4KV8B 2YKQA 2Z8QA 1V5VA 3QMQA 2HVDA 3MMJA 2IVFB 1QSLA 1S1UA 4HH0A 3CMES 5CQGA 3HKZD 2FB0A 1B0PA 3QSYB 3G6XA 4WTYA 2MJNA 1TMJA 5F8LA 1GH8A 5K20B 2XLIA 2WRMA 4DV7J 1SKSA 1X4FA 3DLJA 4AD6A 3FMBA 2ZEJA 1LWFB 4Z2XA 4MAKA 3TVYA 5IS2A 4QBUA 4DL2A 4PQUB 1WF0A 3QFHA 3OFEA 2FJDB 3BGOP 3PV8A 2OAUA 1EKSA 3KNGA 4ED7A 2HYIB 3CNQP 3UDEA 3SDEA 3ZTRA 1WEXA 5J2NB 1WOSA 1S6OA 2OPPB 2HBZB 1HNWJ 2RKIA 3KHLA 2W01A 2R7SA 3KK2A 5CYJA 4M5JA 2C2ZB 5EN1A 2B9WA 4I64A 5I4MA 1XMOF 1OYDA 1SL0A 2Z56B 2KT2A 2M8DB 4YP3A 4KTQA 2VQEF 3PYDA 2E29A 3V6JA 2Z2MA 4C8ZA 3O2IA 4IOBA 1MG7A 1VQPS 3GFXA 3J7YI 2QYCA 4DFPA 1Y5IB 3C19A 2FTRA 2RDDA 2FZGB 2G0CA 4K4ZA 1X0FA 3B4MA 4U8VA 5KTQA 4ED2A 3DI6B 4PG7A 4LT6A 2MSSA 4X66F 4B3SJ 2AYEA 2RUGA 4RBUA 5KFTA 3IRWP 3T1AA 3KLGB 3MECA 5BR8J 5AT1B 5B7WA 4PG8A 1NZ8A 3KK3A 1YRTA 1JLAA 2FLNA 2DEJA 4O4RA 3PVXA 3A3OB 3HCXA 4NXMJ 1WG4A 2HLTA 1VC5A 2LYVA 4UZCA 2UUTA 3BN4A 2J5AA 2V5HG 4UOHA 1RADB 3K7RA 4CNZA 3R2DJ 5HMXA 1VR6A 5CCMA 4C48A 2HVHA 1L3UA 2ILZA 1WTBA 1OQ6A 1HQUB 3MOZA 4JI1J 2ROEA 1T11A 4Y3CA 2XSJB 1PG5B 2B5JB 4MT1A 3HT3A 4YR0A 3JSRA 4M94A 3UR0A 3NS6A 2BKOA 3MEGA 3T9ZA 3GIMA 3H5XA 3T1YF 1RCOB 1IBCB 4Q43A 3V6DA 3GIIA 3NXZA 3PW0A 1DLOA 3K8VA 3CJ8A 3L09A 3CJ5A 4J9SA 4ZJOA 3W5XA 4W92B 1YBAA 2FGCA 4M5HA 3G82B 1HWIA 4N8NA 1HBUA 1ZETA 5KOWA 3LAMA 4WWSA 2LDIA 3CXCR 1A0OB 1PJ6A 1RWKB 1YJTA 3IXQA 1HNXJ 1U1LA 1S9GA 3QYYA 4ECWA 4IG0A 2JLEA 2D7SA 1Q8LA 2JEJA 1Q16B 3NNHA 2HK2A 3SEOA 5C5JA 4RU9A 2Y0SD 3BGLA 2ASDA 1VBKA 1FVSA 5T7LA 1S10A 4QR0A 2HHWA 3AH6A 4FXDA 1FK9A 1NEEA 1R8PA 2MKCA 1HNVB 4XPEA 3SBMA 2Z4PA 4HLBA 2H5EA 4YB1P 3KLVA 3SQOP 2CQ0A 3FFIA 3MM7B 2MQOA 1E6VB 3I5CA 2EG1A 4WFYA 3ZFVA 2UUBF 1QE1B 3QRRA 3RBEA 2FVSA 3NMRA 3BGUA 5MLCV 1T95A 2AEMA 4L72B 2R8HA 4NMXA 4RW4A 3P49B 2HVIA 5E3RA 3DLEA 4O4GA 5H9EK 1FE0A 2C2DA 1U7LA 2DGVA 2UVVA 2FVRA 4AE5A 3TUIC 2CNNB 3FQKA 2LXIA 1NHUA 4DWIA 2E5IA 3I31A 3NG8A 3VAIA 2GIFA 2MMYA 2XYHB 3C15B 3TARA 1D9FA 1S0NA 4W4MA 4LF8J 1EP4B 1ZM9A 2APOA 2WVEA 2B9EA 2HZCA 3GR1A 3RAMA 2D9OA 2UXDF 3B82A 2V0NA 4NWBA 5KG6A 3GV7B 1HNWF 4OX6A 3DMJA 3HHLA 2B4VA 3G8SA 2NSBA 5HK4A 1RT4A 4TQSA 3CC4S 5B0EA 3HHLD 1WD6A 2LQJA 3VR1A 2G2YA 2W9BA 5H9EJ 3Q23A 1O5JA 3Q8SB 1KHWA 2BKPA 3JAMU 2JH3A 3GP9A 2V8GA 1RI7A 3KHHA 3AAWB 2I38A 4PR6A 1IBMF 5BYSA 4A8YA 1B70B 1KQKA 2O66A 1FJEB 1N8RT 4EUVA 1UCNA 5K5MA 1CJUB 4CT9A 2XMMA 7AT1B 1GX6A 1RT2B 1X4HA 5HSPA 4NE9C 2FJBB 3EM1A 2HKEA 4QYRA 2GQCA 4ZDNA 4Q0BB 4B3SF 2GJIA 2DNOA 2CQIA 1JXEA 1TL1A 3HZGA 2YKNB 1MWQA 3UD5A 5DM6Q 2MQQA 3EVOA 4RZRA 4P74A 3MGJA 1RAGB 4NA3A 1XIQA 4K4VA 2R7TA 1FKPA 2P9CA 3PZPA 2CPEA 1S6QA 4OZLA 4NXMF 1X5TA 4R5PB 4AL7A 3K5PA 2WBMA 3ILLA 1U24A 1T9TA 4NLDA 4B9VA 1R43A 3GFYA 1FDNA 1J5EJ 1JJHA 1ZA2B 4DV6J 3S1TA 4Y2AA 5KFRA 2A2CA 5K8MA 2J76E 2E1CA 5KFNA 5IC6B 1X0PA 1TVRA 4KHMA 2W2NP 3E8OA 2OJ3A 4C11B 1F5BA 2AV5A 1N34J 1YSJA 1TKDA 4JI1F 1Q78A 3LP1A 1N6QB 2HVZA 3NNCA 3PW5A 2ZKTA 1MLAA 3KDNA 2RQKA 3DRXA 2V34A 3MD1A 1D9AA 2DR8A 3IGVA 3MCMA 3MDFA 2R7OA 3VALA 3LWMA 3TZXA 1QM9A 2F3JA 1Y7PA 4I2PB 3I56S 1N36J 1FTRA 2E7XA 1SBRA 3BO4A 1V3ZA 1G6BA 3R6GB 1G7CB 3PNIA 1QVGR 1ULRA 4NRTA 2FLLA 1SJ3P 3JSMB 3OFHA 2HHQA 4XDDA 4A8XA 1D8YA 3ZC4A 4K4YA 1Z4UA 3Q8RB 3WX8A 4DSJA 3W64A 2M70A 1S1WA 2QE5A 2WVDA 2IVMA 3R5DA 5I3UB 5D6GA 2FJEB 3GV8B 1BQMA 3DKDA 4XTTA 3K57A 4TNOA 2OPRA 1FJGJ 2C3YA 2IMWP 2F1FA 2AHOB 5B0CA 1KOHA 1N5VA 3R7NB 2V9WA 5IXUA 1RHKB 4ECYA 1LEOA 5D3GB 1RJJA 1DZ5A 2QLBB 3C14A 1YJRA 3GZ7A 4OYZA 3T1HJ 4K8RA 3M7VA 1F5AA 5IQQA 4NZ7A 2MHEA 1TL7B 5F8JA 4DV1J 1JNRB 4MH8A 3NP5A 3A8EA 2WBRA 3F41A 4FBTA 4OI0A 2HEKA 2ILYA 2QLFB 1TQLA 2ZHBA 2F9JA 3ET6A 2QA2A 4CLFA 4WE1A 4IOAQ 3BH7B 4OHXA 1V5IB 4TY9A 5A8RB 2ZC4A 1QSSA 2Q43A 2Z2YB 3DDIA 4LF8F 4H4KC 2AT1B 1RB0A 2EC2A 4ANCA 3HM9A 3CJRA 3BO3A 3MPWA 4LF4J 5B08A 4GC6A 2OI2A 3JS9A 3CD5A 3UW1A 5IZHA 2C3MA 2ZBPA 3PJWA 2DR7A 2E1MC 3EZ5A 3OVAA 1H6KX 1YZ6A 2M5YA 1U6FA 1T03A 3PRVA 3E3XA 4L3KA 2KRBA 5J2PA 3W2VA 1YJ7A 4KGMA 1CG2A 3KLFA 1TUVA 4OZ0A 1U6BA 1URNA 1U1OA 3CJQA 4BDPA 1OS5A 1UVJA 3L7UA 1GMUA 4LFAJ 3MZIA 4MKYA 2X1BA 5C25B 3PX4A 1TU0B 3IO1A 1IJFB 4PAAA 1F2HA 4CLZA 3ZZZA 4KHRA 3JYTA 2BJEA 3SSRA 4M63A 2D74B 1JWWA 3EX7B 2YWEA 2VUGA 2ZE2B 2ADCA 4F4AA 2DNGA 2RSQA 4JI7F 3R9LA 2EBGA 5DJBA 2QSFA 2GVDB 3OL7A 5ETVA 2J9DA 3ILJA 1HARA 2KH9A 5DQIA 4JP8A 1I3OB 2E5GA 2ROGA 2Z0GA 3MR6A 4J5OA 1KEKA 2VG7B 1MN7A 1N34F 3MMBA 4Q8EA 3ITHA 1C1CA 4U7UD 3U1MA 3TQ1A 1LWEB 1UW9A 2WVBA 2M2BA 3L95X 2BR0A 1LKZA 2YKMB 1I94J 3OVSA 1CJVA 4FBUA 3QBCA 1WORA 4B9UA 2YWFA 3UN2A 3QWPA 3C6UB 3THVA 4RW8A 1S0VA 3DGPA 2LA4A 5A0YA 1M5PC 1N36F 2C3PA 3BR9A 5B0GA 2ACMA 3SQGB 3SXLA 2VDIA 4Y2MA 3ZNJ1 2ZH1A 3HULA 2XI2A 4LF1A 3CJ2A 3VV2B 4WZQA 3IP0A 2UVRA 2DVIA 4DSIA 1NSKL 3ZTOA 2N4DA 4UOCA 1UWAA 1NB7A 4L75A 1FJGF 4OYPA 2GGPB 2FY1A 1RWVB 1ZH5A 1VBYA 2F63A 2D3UA 3H2UB 4G1QB 4JOUA 4IG3B 1TMMA 2HNYB 4YMEA 1Y11A 3A3PB 5HQ8A 2A18A 3A3NB 4MKAA 2K3KA 4JYAJ 1SV5B 1QAYA 3T1HF 3BO2A 5IWAF 5DM7Q 4Q7AA 1HBOA 1HI1A 2C3UA 4DV1F 2DGWA 4EK2A 1LK7A 2YQ3A 2EKNA 3GTYX 5DDRC 3UCZP 1RWWB 5HROA 5J2MB 4KBIA 4K2XA 3RBDA 1SI9A 2V4JB 1RAFB 2R2RA 3H5YA 4QIGA 2C2KB 1FESA 2FY8A 3T6JA 3TW0A 3EE3A 3W63A 4K4SA 4MK9A 5J2QA 1RHJB 3RW6A 1WWHA 4DPOA 2DR6A 1FFSB 1U1MA 2GMJA 1SB6A 2OHDA 3GONA 2OMOA 3GG0A 1VIXA 2QLJB 2HHVA 4F0MA 2JJ4D 2ZHOA 2HS4A 2HNDA 4LF4F 3R2CJ 1VJQA 4QU6A 1X9SA 4UT4A 1OY8A 3DOMA 2ZD1B 3Q89A 5K14A 4DZDA 3CDUA 3Q8QB 2OEKA 2GVZB 3BPDA 2ZDOA 1IR0A 2N82B 3OXLA 3US5A 3PR5B 1NDCA 1WG5A 1F9HA 3POTB 3QGHA 2B43A 2ZKUA 5IM0A 5JVHQ 3A12A 2ZC3A 4XAKA 3CMQA 2YWWA 1BE4A 2RUSA 3O3LA 1G1XA 3ETOA 1JQGA 4U9RA 1NCLA 1X4DA 4OYIA 2K1RA 1PO6A 1W26A 3TEHB 1TKXB 1Y0HA 3CO0P 2HNZB 3GYNA 4LFAF 1KD1T 4DG1B 4OHVA 2NR0A 4FNHA 4ECVA 1CJKB 1XMBA 2BW2A 2HFNA 2XGPA 4KGZB 2EFGA 3MPDA 2MGZA 4DUTA 1CSJA 1FERA 2G1HA 2J6TA 2WAQD 2MZQA 3IFEA 1HBMA 4BWJA 2ZH4A 3HHNB 2LECA 2OD6A 2AZ3A 4IRKA 1V9OA 2VBWA 1U2FA 1RU2A 4OYBA 3MM9B 4DSFA 2LXFA 4KO0A 2KXHA 3ZTSA 2L48A 1X5SA 4P71A 4LSLB 2DK2A 2GMLA 5CA5A 1T9WA 1FDDA 2ALZA 2ZJPQ 1PBUA 3ZTQA 2V8DA 4LR7A 4RL1A 4OZNA 1TKZA 1RT3A 2XLJA 5DETA 3E01B 1RT6A 2CJQA 1RT1B 2Q79A 4ZLPA 1C1BB 4M5DA 3FRZA 5GAGI 4DL5A 2ASLA 2W25A 4HYKA 4KV8A 1GMVA 1I94F 2YXLA 3EZUA 3V5RA 3LP0B 1RABB 3QGGA 2HFSA 2HQFA 2XGQA 3JB9k 3S7RA 2CG8A 3MPVA 4DL3A 2AZ1A 1KVIA 4LMZA 5F8HA 3M8PB 3ILOA 5BJRA 1SKWA 3DOLB 3THPA 4DV2J 4ZP8A 5KFYA 1S4FA 5CABA 5GMDA 2CPIA 2ATCB 2ASYA 3SCIE 2RD5C 3A8KA 2LQ9A 3QT6A 1JLEB 4ICLB 4OLOA 4FPIA 1LWFA 1QTMA 5CCLA 2EKYA 3DLHA 4PQUA 3N6NA 1NK7A 1VQSA 1DARA 3W62A 1QTNB 3KK1B 5CH7B 2DRAA 4O0IA 1AZSB 3FDSA 1PILA 4TXSA 2VQFJ 2FVCA 1FJ7A 4W90B 3VQTA 1RU1A 2OPPA 3G8TA 1KNZA 2DHGA 3W60A 1SH0A 1QAJA 4JUZA 4DV0J 2BOPA 3HMJG 1FCAA 2E9ZA 2W2OP 4LFBJ 4YY3J 3D54A 3MOJB 4JYAF 1AUSL 3WIUA 2HW3A 3BKFA 3ELHA 4YEAA 4GVBB 4QZVB 1P1TA 3M05A 4P7TA 3BGFA 2JLGA 3KJVB 2Y1JA 2L9NA 1U49A 4YHHJ 2ASJA 4IO1A 4X4QA 7FDRA 3K2YA 2BRLA 2ZITA 4PKDB 2MQPA 4OYAA 2RS8A 1YTYA 4G1PA 1RAOA 3M8RA 3J81j 3DI6A 2VFSA 4J9OA 2KXNB 2HGNA 7FD1A 4C3LA 1R27B 1N88A 1U26A 2Z58B 3KLGA 3RU0A 2DCUB 2V6AA 2B4OA 2XMAA 5D77A 2AF6A 3NNAA 4QWCA 4ZN3A 3MFHA 4LUBA 2FC9A 4Q45A 4DEZA 4CWBA 3OTCA 4WYWA 4U6PA 3ZZUA 3MPUB 1S77D 1RWMB 3Q24A 3FNNA 1FX4A 2ZUGA 4USTA 1O51A 4CH0S 3IR7B 2IAJB 2XHCA 4EYIB 5FJ4A 4KT0C 2KO1A 2WZ1A 1VBXA 2UUWA 3AOAA 2YNHB 3F44A 4ZVUB 2BANB 2BM1A 1KFSA 1KSPA 4J9NA 1RT7B 2H54B 4FYDA 1DJ0A 1HQUA 4AT1B 4TU7A 3DNCA 2XSJA 1WACA 4IRDA 4LF5J 4U7UK 2B5JA 3BSCA 2RKIB 2DJWA 1O0PA 4F02A 4B9TA 4C6AA 1YJVA 3ZZRA 2JEGA 3TP2A 1HD1A 2HRTA 1FRXA 3QLHB 4OV6A 3MUVP 2JRSA 3IA0A 4LVNP 5E2QA 3G82A 4DPWA 3TOQA 3NWGA 2YNGB 3KG1A 2ADBA 2ZH5A 3J7A1 2ZZNA 2QZ8A 3NGDA 3D2WA 3M32B 5JXSA 1H3DA 3C3LA 1FDAA 4YR3A 5GMEA 4DR7J 1HBNB 3L4BC 3PX6A 3SV4A 3D6HB 5EWGA 4N41A 2E1PA 4LFCF 1T7PA 1WOPA 4NMLA 3CJ0A 4CH1A 4B02A 1M5VC 1HNVA 1IKYB 1HL6A 3MECB 3G2XA 2Z2ZA 2HWTA 2QMWA 2PN6A 3MM7A 1E6VA 1JLAB 1XR5A 3D66A 1QE1A 2BE7D 1K9MT 1HQEA 5E41A 2CADA 4ZIWA 2BJ9A 2H1YA 4B9LA 4ZA1A 2HAFA 3GIRA 5AE3A 3SMZA 1NMEB 1VFJA 2VBYA 2RVJA 4KSEB 1HYSB 4DL0C 1ICEB 2WOMB 1VLYA 5L1KA 3R5AA 4EZ9A 3AT1B 2ZUAA 4MYTA 2CJKA 2VIHA 4QR2A 1WC6A 3R27A 3HHKA 2W7AA 2NCKL 2H48B 4AXIA 3MCOA 4PG6A 1NH8A 2DNNA 4LF7J 2KN4A 4UUXA 3C15A 1VQ5S 4K7QA 3MEGB 4J9KA 2A2DA 1EP4A 3G8QA 2L08A 5MAOA 1SKRA 3PRDA 2A6MA 1WKJA 1GX5A 1F60B 5HATA 3CPWR 1IM4A 2J7WA 2B4UA 2GIQA 3QGIA 4C8NA 4DV0F 4QYZK 2K7JA 1FFWB 2CWKA 5F9NA 2ROPA 4I6WA 4YY3F 1UA0A 5K9FA 1UEUA 2ZWPA 2CQ3A 5KFJA 5I3QA 2J0SD 1FEEA 2HURA 4YHHF 4KIAA 5T7LB 1CS4B 3MMAB 8AT1B 3IS9B 4DX7A 1IR1A 3ENWA 1EETB 3I4HX 4LF9J 3LGNA 1CJUA 1HPZB 2MKJA 1LNQA 1F3VA 1SQFA 1RT2A 4LBHA 4EYHB 2BMBA 2AGQA 5AXKA 2HBYB 2UXBJ 2LKZA 2YQ1A 4WXWA 2VPWB 3OT9A 5HMWA 4Q0BA 3EVWA 2G4BA 5LMUF 3WIVA 2YKNA 1IVZA 2QX0A 4DXLA 3BYRA 2OELA 2JDJA 3VZIA 3CULA 2GJ2A 1M0SA 4CCHA 4QYZJ 4RUHA 4DUZJ 1WI8A 4RBTA 1Q5YA 5CAAA 1X5OA 2EFPA 3G86A 2MZSA 4MK7A 4MMOA 3SCLE 5C2GA 3WX4A 1OIAA 1KQGB 1YBTA 3HZEA 4R5PA 4FF3A 3VCDA 4DN0A 3KHRA 2UZAA 3IC1A 4FS2A 1ZAWA 3R6LB 4PPDA 1NSPA 2R7QA 2Q3PA 2MB0B 2FHJA 2DGSA 3SSQA 4ZP7A 1GEHA 1LWXA 2X1FA 3DOKB 3P6YC 1JKHB 4HACB 1FNXH 4LF5F 2DHHA 2QA4S 4CYUB 2DGXA 1ZM4A 2PI5A 3KDOA 2A0FB 4USVA 1NSAA 1UJ4A 4NRUA 1GK8A 3PM9A 4RUAA 1G3OA 3CCRS 1FRLA 3H8YA 2EFQA 4LR8A 4ZP6A 4BCAA 4I2PA 2D41A 3FCVA 2C22A 1HW8A 4CLKA 4F4XA 2ZHAA 3R97A 5KT7A 3TQEA 3GSDA 3JSMA 2ZVIA 3RB4A 1CULB 1TFYA 2DBBA 2EFVA 4IQXA 2DH9A 4DR7F 3R5JB 5E33A 2CZ9A 5I3UA 2UVWA 2XC9A 1RACB 2WW4A 1S59A 2QEXS 2N4CA 2KXFA 1V6HA 3CTRA 2HQ3A 1BXNA 4RW6B 2XNQA 3HJFA 2QRRA 4G65A 4UQGA 2V8VA 3P5BP 3HKWA 3HX9A 4KY3A 3T9NA 3NBPB 1M1KT 2R8JA 1ZZNA 3D7SB 5D3GA 3SCJE 3G9CA 4DMZA 6AT1B 1JB0C 1RCXB 4K59A 3M1VB 1V3SA 5KFSA 4DV3J 4KRWA 1TL7A 3FCHA 1UJ6A 3RB6A 4NLQA 1ZAXA 1RISA 2WSFC 4FXWA 2YTCA 4O3SA 2CWXA 2DO4A 1PBAA 3QATA 4TY8A 4OI3A 3LP1B 5DLFA 1BQXA 4CO0A 3NEKA 3VHQA 4XO0A 1TL4A 4IQMA 5A8RA 2D9PA 4WZMA 2L9DA 4FYWB 1WHYA 1RBAA 2BKNA 2DY1A 1Y3JA 1RHRB 1WOOA 2CNLB 4O3OA 4RKUC 3S01A 1AA1B 2R8KA 1DTTB 1WNEA 4TYAA 4OLPA 3M8WA 1HLWA 3P96A 2NUHA 3KMSA 2CJYB 3N28A 1PJ5A 1FXLA 1S79A 1VQLS 2IY5B 4LRDA 3BGRB 3O44A 4ILLA 3AQPA 2EC0A 4CRJA 3FSXA 4ZLLA 1RAJA 2BM0A 3AD7C 1M5OC 2ZH6A 1HWJA 3RB3A 4AL5A 2LU1A 1WELA 4LF9F 2UU9F 3UDVA 2Z30B 4X4VA 2C2NA 1H2UX 4NYZA 2EEYA 4QPTA 5KFDA 3PO4A 4NCBA 5C25A 4I68A 3GJSB 1TKTB 4JI4J 1KFDA 2OTLS 5F3TA 1RT5B 4E0DA 1FD2A 5KFVA 4DUZF 1PC4A 2CPZA 4DPTA 2ZE2A 2FJAB 1S12A 4I6YA 4ED8A 5AE1A 2DNRA 1L5UA 4TLQA 5AJ3J 2BE9B 4ECZA 4QIEA 3BF4A 2JFDA 1RTJB 2RE1A 2EPIA 3D4JA 5J1PA 2GNKA 3ETMA 4ZCIA 3PRBA 1Q8KA 1VDHA 5LT5A 2VG7A 4C3KA 1KHVA 3RAXA 5HMZA 4QIWD 2OP5A 1BQNB 4CP5A 5A2QY 5BYRA 5M2UA 4WFZA 3GLJA 2VASA 5ETPA 1LWEA 1AXQA 2YKMA 1B0VA 1CC8A 4NX9A 4OYXA 1RAEB 4C3MA 2DTJA 2AU0A 5E3PA 5HJYA 4U67Q 3H5UA 2DT9A 2XZDB 3R5GA 3GILA 3EDQB 2B6AB 5DDQC 2AWZA 1T3NA 2OGUA 2YNIB 3DXBA 2RQCA 1NXIA 5IT0A 3AA8A 3SQGA 1YK9A 2ZZMA 5KFWA 2KHDA 1ZS6A 3G96A 2H9ZA 3KLFB 2VD3A 2N3OA 1SQEA 1JNZB 1LW0A 4RW7A 3T41A 4X65J 2HIYA 2IRXA 3SYZA 2MY8A 2BJ3A 5HJXA 1W2BR 2VKZG 3VF0B 4J9QA 1FJCA 5A76A 1IUJA 1FD8A 4ES3A 2J6SA 5SUHA 4ES2A 2KFYA 4TLRA 4O44B 4RNNA 2GGPA 1KTQA 4MTPA 5CD4A 4ZCKA 2M0GB 3R7BB 5K8NA 4JV5J 2B9YA 3CIMA 1VQYA 1N5YB 2F5GA 2HNYA 3CCES 2XULA 1VS3A 4ED0A 1Y3KA 4YS2A 2I0XA 2XHWA 3BYPA 4B3RJ 4WBFA 1SV5A 2F8HA 1YITS 1OSCA 2B3TB 2VV5A 4DV3F 5E3AA 2Z57B 1NJWA 1HW9A 2RDJA 2CDQA 1AW0A 2F8MA 4PQAA 2FYXA 4FKXA 4WYLA 4F4YA 4PXDA 2GV1A 2WTFA 5J2MA 2V2ZA 4ZLJA 4JI0J 2V4JA 3NY0A 4DR4F 5F41A 3VZHA 2VA3A 2HGMA 4FP9A 1UVNA 4Y00A 3NGKA 3U02A 3EXCX 2YPZA 2RNEA 3MMBB 2LCWA 1Q7YT 2AX1A 3LGHA 3U1LA 2B8PA 2VA2A 3D1OA 1RTDB 3V81B 1HFEL 1QJHA 4CLTA 4ETXA 4Y28C 2J0WA 1N0VC 3AFGA 2CJXB 1VHFA 2RF2B 4ZK7M 2KU7A 2DNMA 1FA0A 1PYTA 3Q86A 2OO4A 1H74A 2L41A 1RZMA 2H5IB 3DGPB 4JI6J 1WI6A 4MIAA 3HP6A 2GQ2A 5AXLA 4QWBA 1OWXA 3TUZC 2PEBA 2ZD1A 3KG0A 2GVZA 2JFKA 2HPUA 2VKRA 1QD1A 4NOHA 3H40A 4YQWA 2CAJA 1B7YB 4A8KA 2CQBA 4I56A 3THTA 3IRXB 1VQ4S 1UJ5A 1F6TA 2FHKA 2NXUA 3TAQA 1JLGB 4LR9A 4KC5A 3DLGB 2P8IA 4NLYA 2KT5A 2HS0A 1NHVA 4I7FB 2RB7A 2W2QP 1C0UB 3IWNC 1TKXA 2DH7A 4KHPJ 2VBXA 1UVLA 2HNZA 2GZOA 1Z2LA 5LL6d 1RBOB 3DRYA 4DG1A 5ETTA 3D0GE 3UCUP 3CB4A 3M2UB 4MJKA 1CJKA 1JXVA 4JI4F 3H7HB 2CDRB 3J81Y 3MR5A 3PYFA 2V8PA 5ETRA 5B0FA 3EWGA 3I9ZA 4K5SA 2UP1A 4F4ZA 2ZBQA 1Q8IA 2ZH3A 1RKIA 1WJ9A 4MIBA 1S9EB 4J7CA 2X1GA 2D3ZA 3P3DA 3MM9A 2A10A 4ZS6A 1U1PA 1DQ8A 3NL0A 3MWBA 4NLGA 2MKIA 4LSLA 2VL1A 5D4LA 3JTOA 2VF3A 3RG6A 3OR2B 5KFEA 1PJ7A 3PIPQ 4F04B 2VG5B 4YN3B 2WVFA 3E01A 4BLGA 2ZM6J 5THWA 4EGLA 4ZVPB 5KFOA 1RT1A 3PJXA 4LRFA 1C1BA 5F8NA 3MTKA 4EEYA 1TV6B 4H4OB 4AL6A 2K2PA 4EZ6A 1KOOA 3S8SA 4K4WA 3LP0A 4GKJJ 2XMWA 1P6TA 3M8PA 2B8QA 5HBMB 2M4MA 3X1LB 2R2UA 4N5SA 4OZ3A 1UWBB 2MQMA 1Q81T 1IWAA 2DNLA 3VVTA 3H2LA 3MUTP 3LGMA 4E8UA 4OYMA 1JLEA 4CLLA 4ICLA 4X65F 4TVAB 3VGUA 3NRBA 2DITA 4HI1A 2KYZA 1ZAVA 3QNWB 5IV3A 3MEEB 3HSJA 4M5KA 3KK1A 2CQPA 2GHVC 4J9VA 4X64J 1NBEB 1N32F 4KE5A 3WDOA 1AZSA 1M5SA 3PDNA 2BJ8A 1U25A 5DGBA 1TUGB 2QA1A 2OH2A 1VCTA 4DU7A 1S6PA 3KWMA 3AOBA 5EUHA 1REVB 3W9IA 1L3KA 1BD6A 4NZ6A 1HNIB 3I55S 4Y0FA 3HHEA 3U27A 2RRBA 4GVBA 3GYXB 1IM6A 3ULHA 4ZJLA 3KJVA 1TK5A 3AXKA 2BQRA 2HHUA 3HVTA 2MZ1A 1YJUA 1TKZB 5ETLA 1XMQJ 2FHOB 2AJQA 2IM0A 2XM3A 2EXUA 2IJNA 2CKWA 4FNIA 1U45A 3C66A 1VMBA 4USHA 4DPYA 1Q53A 1VQ8S 2V94A 2IJRA 2IYGA 5BXIA 2R7XA 2ZNYA 3ZNUA 4ZVOB 4F50A 4ZVFA 3F0NA 1U0HB 1F5CA 2OD4A 4LSNB 4QU7A 3SZ2A 2CIMA 2DGUA 3W3SA 4Z7YA 2M9KA 2BZ2A 1JMTA 4DPUA 2AMCB 4DR3J 2L9WA 4DL4A 3A8JA 3LALA 3CD0A 3CCZA 3TJ9A 2IAJA 5DG9A 3GE9A 2N7CA 4RBVA 1Q79A 4DLEA 2BA9A 3HVRA 2YNHA 1GMWD 2BANA 2J9DE 2GW8A 3OSNA 2XMUA 2J8SA 1SL1A 1UMJA 1RT7A 1DURA 4N76A 3MM6A 1KONA 4P75A 2W2PP 3IR6B 2FDNA 1RAHB 5GAHI 3IGNA 1GQEA 3GB0A 2JEFA 2JZ5A 4WTOB 5DG7A 3FVYA 1C4AA 3BPSP 4TQRA 3TJ8A 2GMHA 2JC0A 3QLHA 1R7IA 4UOGA 4UTGA 4RNHA 2J7KA 2DHXA 1JX4A 3I6PA 2DIUA 2YNGA 3OR1B 2YH1A 1Y00A 4A8QA 3KNAA 3M32A 4DFJA 4RNMA 1HKAA 1HBNA 2OPQB 2OMLA 4WJBA 5KT3A 4XPCA 3V6HA 3VGVA 4A8MP 3QIPB 3MD3A 4O3RA 1IKYA 2CQHA 4RW9B 3PYEA 4Q8FA 3N6MA 5KFZA 4DV5J 1H2VZ 3Q2TC 2HWIA 1LWCB 1IBLJ 1L3SA 1H7WA 3OV7A 3QJJA 4C8OA 4O3PA 4ALZA 3KHGA 3QRQA 3J7ZT 2Y0BB 1VRUB 4IFVB 3ZZ0A 1HYSA 3N5FA 3OHBA 2C2MB 2YPYA 2DEIA 5KG4A 2WOMA 1RAAB 3EPGA 2QT7A 3TA1A 4P52A 3WQPA 3CCLS 3A13A 4NYOA 1X60A 1IKWB 3J80U 4ZMMA 1Q4RA 4DDFA 5LMNF 3I4PA 1N56A 3HHLC 2DD8S 4M8LA 2LEPA 1YJ9S 3UPFA 3NMAA 2VB6A 2CPHA 3M8SA 1B4SA 2QYGA 4J37A 3CDBA 5C42B 4CM0A 2CQGA 2HQGA 2CA9A 3HSGA 4X64F 4OJGA 3RZAA 4P2MA 3TZYA 1KLMB 2VG6B 2VPXB 4RU2A 3UE2A 4ZCLA 4I67A 4YDXA 2QTWA 2J6UA 3J7Z5 5B09A 2MQNA 5D0HA 4CO4A 5KFAA 3IR5B 1DTQB 2DB1A 1Y4ZB 4DR5J 3MURP 1ELOA 2QG9B 2RQMA 5KG0A 2KM8B 3W9JA 1EZZB 2A3JA 2WONB 3TR5A 3K8WA 2BW7A 1CS4A 2YH0A 5DS7A 2ZDPA 3MMAA 3IS9A 3FEYB 4Y6IA 1EETA 4IH5A 3PEHA 1HPZA 3W65A 4KKOB 2O5DA 4E2FB 4NL5A 4DR6J 4F7VA 4CTAB 1HQEB 4KYZA 4DF4A 4PYAA 5EWFA 1R8HA 4KGVB 4IR1A 1B7FA 2M8HA 2W7OA 4P9SA 4YB7A 3K89A 2XCAA 3FUYA 4O23A 5KFMA 2IPOB 2XMTA 5AE2A 1IKXB 1TTHB 4A8WA 4EU0A 3MAAB 2E9TA 2V4RA 3T5JA 1FKAF 4DV7F 1FXRA 4CO5A 3AD9C 3FMWA 3BSOA 3AJ2A 2P6SA 1YGYA 4HI2A 3EICA 4C9DA 1BMQB 1PSDA 4FVCA 2BV3A 5HLFB 4FPRA 1KWMA 1QDUB 1K0TA 3HXMA 2BXJA 6FD1A 4GRSA 2PMZD 3R7SB 3DOKA 5LXYA 1JKHA 3BBCA 4HACA 2XSFA 1Z1ZA 4CYUA 4X4TA 1XC9A 2BQ3A 1RE1B 3HFZB 5A2QU 1URRA 1FXDA 1PYSB 2MXYA 2B56A 2I1RA 1TL5A 4FF2A 3CJKB 1LW2B 1GT8A 2RT3A 2LFVA 1L3VA 3OVBA 1R0AB 1KR4A 3CD7A 4EFAC 1D09B 1CULA 3RR7A 2DNYA 2HHXA 1FNMA 4A46A 4DUYJ 2HFOA 1IXKA 1N5QA 5GAEI 3DU6A 2NXNA 4H54A 1NK9A 2H65B 3SFUA 2MLZA 4P7VA 3PFEA 4NPOA 2G0IA 3NGRA 5HAOA 4WIQA 4R0JA 4RW6A 3IG1B 2HVEA 5BR8F 4DV5F 4N56A 3Q0AA 4PXCA 1IBLF 3NBPA 3BZQA 3AD8C 3RRGA 3K0JA 5HP1B 3EDRB 4X4PA 2FC8A 1REGX 3UR3C 2CZ4A 4UY85 2UV8A 1S6UA 3M1VA 3L7PA 4DR2J 1ZM3A 3GFZA 1SC1B 4LF2A 3CCQS 3LH2S 1U47A 4B08A 4ZIVA 4ZCMA 1XJWB 4NEYA 4X4RA 4DQPA 3LW5C 2VOPA 2U2FA 4Q44A 3T3FA 1VGYA 3AB4B 1DBDA 4KR0B 3OBIA 2KI2A 1SKUB 4URGA 1ACMB 5ETMA 3SSSA 1IKVB 3J7YU 3OTOJ 1GXLA 4EO6A 5IT9U 5EGYA 2C2EA 2XS7A 2FVPA 2ALYB 1A7GE 2Y1RI 5KFIA 1WKLA 1TUWA 2I8EA 3MR2A 1IQZA 5H9FK 1DTTA 1FEHA 2R7VA 3TAPA 1AT1B 3NGUA 3RRHA 3HD1A 1GNKA 1KS2A 2B9XA 1RAIB 3BGRA 3W1YC 1T9YA 3PW4A 4KAIA 1HNXF 3IMQJ 2BYCA 2W8LA 1K44A 1MMNA 4TU9A 1S1VB 5LXRA 1EQMA 5KFPA 4A8SA 1YQHA 3OHAA 4QWDA 2OEMA 2VC0A 4URSA 2ZJQQ 2XWYA 4EMDA 4DFKA 3AXMA 4I0WA 4JI5J 4ID5B 1AROP 4CT8A 1XTZA 4USIA 4DR1J 5KFGA 3RBZA 3BJYA 3AHPA 4O3QA 2H4YB 1NLKL 4DR6F 1TKTA 4X4UA 5CYMB 4MKVA 2F8EX 2BDPA 3VGTA 5H9FJ 4GC7A 4UZBA 4Z37A 1RT5A 4OYWA 3Q8PB 4C8KA 4F2SA 4WKRA 3EGVA 1S1TB 2CPXA 1TL3B 2LMIA 2XYPB 2G13A 2IDLA 4K0KJ 3H42A 5KG7A 4KFBB 2VOOA 2PDAA 5KG1A 3MEKA 2RU9A 3J81U 1N48A 1HHSA 3L7OA 2H3EB 2DGTA 2DNHA 2VJVA 2VFTA 4TY8B 2E7VA 2A6OA 4P10A 4ZVEA 1BGXT 3BQ1A 4WIIA 1RTJA 3G4SS 1WHVA 2HZAA 1MU2B 2R9LA 4TYBA 4G1IA 3IM8A 4PWUA 1BWEA 4C97A 4NCGB 4IUFA 1BQNA 4NEZA 2JL9A 4M5MA 1JLBB 4LBIA 1KC8T 3JQMA 3V6KA 3R5CA 3UQSA 2Q1LA 1YRUA 5G0RB 1W7WA 2J7UA 4NLWA 2IHR1 2AYMA 1LXJA 2OEJA 1CQMA 1CVJA 2B6AA 3CJ4A 5I3PA 3JQJA 4OX7A 2YNIA 5M2PA 3QAEA 1UA1A 1FVQA 4XIUA 4AUKA 2Y8WA 4XK8C 1I1GA 4WFAQ 3VAJA 2LQ8A 4FZVA 3CW2C 4DUYF 3RRKA 2XLKA 3WHIA 5KFQA 4K4TA 3NWRA 2WK4A 4O44A 3NKYA 2W7PA 1U8SA 1X4AA 2C2RA 2HAIA 5IT4A 3MUMP 1VQKS 3VAMA 2DH8A 2B7BB 2YX7A 3HVWA 1N5YA 4AXJA 2HHHJ 2FD2A 3BEGB 3IBCB 2UVUA 1SC3B 1RHUB 3E2EA 4ATNA 4WFNQ 2Y1IA 1CC7A 1RLDA 1RTZA 1U8WA 1JJ4A 2R8IA 1BWVA 4FYVB 2ERRA 1J5EF 2DR5A 4DV6F 5HMYA 1R8BA 2PC6A 2XWXA 4JBCA 3H0PA 2GIRA 2HBRB 1N33J 3UO0A 4MKBA 4USJC 2HSEB 4V19J 3Q8YA 4NA1A 3ISZA 3FGVA 2KRRA 4L3NA 3TZZA 3N0VA 2XO7A 5L1IA 3H20A 3LUYA 1RTDA 4DQRA 3V81A 2WB4A 2DHAA 3K58A 3C2PA 2OSQA 3TA2A 3F56A 2RF2A 4A8OA 4RLEA 4NZ0A 4PWWA 1NJIT 2J8AA 1EIYB 1Q86T 4DX6A 2BBEA 4KGXB 4F4WA 5A8KB 3C16A 3WZ0A 4L74A 4A48A 3NGSA 2L3MA 3DN9A 3MM8A 1DFDA 1PAUB 3FSIA 3FJ2A 4I6AA 5F3ZA 3G71S 1KQFB 4Y65A 1LW0B 3I96A 4RW7B 2D3O1 3CC7S 4OI2A 4AYBD 4M5GA 4WFXA 3EGZA 1ZA1B 3IRXA 2QGFB 2XZTB 3RGIA 4Y2CA 5ETQA 3S6EA 1JLGA 5A6PA 1AFIA 3DLGA 5L8RC 1C4CA 2V4QA 2HRYA 4JI5F 3TJAA 4I7FA 2IM3A 1C0UA 4B3OB 3I0SB 1UFKA 3IAM9 4DR1F 1UW4A 2IA6A 4F0HA 1RSCA 3U7JA 5DGAA 3M2UA 3OJSA 2E9RX 1WDTA 2JOQA 4LJMA 1B99A 2COLA 2XMJA 3OLBA 1FTCA 4DV4J 2X3DA 4WU3A 2E66A 4C4WA 3F73A 3MR3A 1WDDA 1L3TA 2K7KA 1B3TA 2E1RA 2YWGA 3CEDA 4Q2LA 4ELTA 4IDKB 1S9EA 4CO1A 4RPFA 4M95A 4RJVA 2V9KA 1UZHA 5LM7E 4X4NA 1S99A 1BLUA 2K3IA 4KB7A 2MPUA 1GAOA 3SI8A 3NAIA 2HQDA 4NLSA 3FBFA 3CIZA 2FJXA 4CNYA 3RJMB 3PR4A 3R3TA 3A8IA 3PKMA 3OR2A 2BACA 3H90A 1NK0A 2XY7A 1JLFB 1S97A 3RBXA 4J9MA 2VG5A 1QSYA 1ZTTA 4OJHA 2O01C 1TR0A 4CLPA 3MCSA 4J9UE 2QC3A 1TV6A 4H4OA 5EHHA 3KJNB 3D28A 3GJQB 1A6LA 3VAHA 2GJFA 3BDPA 2HFVA 4H4MB 4DFMA 1H2TZ 2WCXA 1S48A 4QR1A 2E5JA 5BYQA 1M90T 1SJRA 3ZTPA 2UXDJ 5L9XA 5HBMA 5B0DA 4S0MA 5EX3A 4WK1A 1UWBA 2AD9A 3GMGA 2PD1A 2ZOMA 2C42A 3CT9A 5GADU 2P9EA 3H4BA 3TYTA 2YNFB 2V2KA 4F3QA 3AJ1A 2CFXA 3M4XA 1LK5A 4F3OA 5JJBA 2IDEA 3HDSA 1ZPWX 3NS5A 1B0TA 4CO2A 3MEEA 1X31C 5HL7Q 2NZ4A 1IBMJ 2Y8YA 4ES1A 5A8WB 2RU3A 4NLXA 2IC3B 2OFGX 2XEXA 2WB1D 2AW0A 2DRDA 3O8WA 2YX1A 1VK3A 4DS4A 2HHHF 1X4EA 2CVIA 1RQ0A 5L1JA 4IR9A 2CQ2A 1REVA 1QVFR 1NU4A 4RWWA 3DLKA 1HNIA 3UNGC 2NXEA 2VFUA 2GHPA 2R42A 2CRLA 4R25A 3VTIA 3T5KA 2PFDA 4ZPAA 5FLXY 4ZPWR 3EJMA 4WCEQ 4R0EA 1N33F 1J5OB 2R8GA 3GFHA 3X3UA 2BJ1A 1M5KC 5FDLB 1EHWA 3TAMB 3TNVA 3FEZA 5HVHA 2ZOFA 2PE8A 5FD1A 2YBVA 5CZVA 3NGTA 2KVQE 1VQNS 2Y3YA 2AEJA 4ZHRA 2HBQB 1EB0A 4OV1A 4ED6A 1FRKA 2PEHA 3HSDA 2BJ7A 1IBKJ 1U0HA 5HO4A 1HNZJ 1EX8A 4GKKJ 4LSNA 4ED5A 3CCUS 3I5AA 2AJ2A 3CO9A 3QGPA 2FZCB 1WC4A 3CDAA 3IBFB 1YG0A 3AB2B 3VVUA 2G9OA 2NUUG 2RMLA 5T14A 5EDWA 3BDEA 4R8UB 4BC7A 3FRYA 5K8OA 1YVFA 2CQCA 3H2VE 4M5IA 1SC4B 3C6TA 2XMKA 1M5HA 4GO5X 4N8OA 2D1CA 3B6BA 1W2IA 1DY3A 2LDYA 4PG5A 1G2EA 1DQ9A 3HHDA 1NB2A 3LWLA 2QMUB 5L38A 5DLGA 4DX5A 3QT8A 2CYYA 3PO5A 1BY9A 4QW9A 2CXEA 3PW7A 1MWYA 5DO2A 1S6PB 4LQ3A 2XB2D 4WP8A 2QMXA 4QWAA 2KM8C 4EBDA 2I5JA 5GMKa 4OYOA 4DV4F 2MLXA 1P9YA 2HZVA 1CEZA 5D0GA 1P9QC 4DQIA 3O6QA 4TU8A 2YX4A 4ID8A 1RHQB 3W5YA 4DCJB 4ZKAA 4IH6A 3OR1A 3HVTB 3MMCB 4AFFA 4PZVA 2Z2LA 2HRUA 3EGNA 3JQKA 1CPZA 4GVLA 2I6WA 5D0EA 1DAXA 3PHTA 2KKHA 4L73A 4HT7A 1ZYQA 1Q5VA 2OPQA 1KVJA 1IN0A 4P73A 2R2TA 4DQQA 1SC6A 5KFXA 3MM5B 3N5BA 4HDHA 4ZPBA 3QIPA 1WEZA 2IVYA 4RW9A 4CQ1A 1NKEA 3UNYA 5B0BA 4ZOSA 2HHSA 2MKSA 1VQ7S 1LWCA 4ETZA 3CDEA 2F4FA 2C28A 4HR2A 3OTBA 2OFHX 4PUOB 4WXOA 4FDFA 3ZZYA 1CBKA 1LXNA 1VRUA 4IFVA 1FHTA 1X8DA 5H1SV 1RYRA 1SQGA 5F0WA 5DDOC 1WC0A 1XNQJ 3NCRA 3DC2A 4ED1A 3MAQA 1IKWA 1R6VA 4C0HA 2HGLA 2VFVA 3DXSX 5LSRA 3MM6B 5E0OA 3KFWX 1VLOA 1V3RA 2LEBA 3TO8A 4EBEA 2PO4A 2VICA 1MMDA 4CDIA 3D0HE 5C42A 2AX0A 3FKBA 4DPXA 3O1LA 1RP5A 2M3DA 2GFFA 4BS2A 1VC0A 1TP7A 3UVJB 1FI4A 1JK9B 1KLMA 2VG6A 4LBPA 1I51B 1HHQA 1UPPA 1YDLA 4Q2MA 3B78A 1UZDA 2V68A 1BUXA 1H7XA 2W24A 3BB5A 1U2RA 1M1HA 1DTQA 2DISA 1T9VA 1D9DA 3N01A 4UF4A 2R7UA 2LVWA 2WONA 2KB2A 3KUEA 2CNOB 1T9UA 1FFGB 2DO0A 1NPRA 2RHSB 5D15A 4LIWA 4JI7J 1RKJA 3Q8VA 4KKOA 3BS9A 2YY3A 2CG4A 3NCQA 3W8GA 4RUCA 5L1LA 1A9NB 4PXBA 4BWMA 4OI4A 4OJ3A 4DCPB 4CTAA 2KG1A 4JV2A 1FNOA 1IBKF 1VIOA 2V67A 2JHEA 1HNZF 4GKKF 4ED4A 4MFBB 2HWHA 3U1NA 4RO0A 3KLIB 3M2VB 1ZTWA 3GCXP 4GO7X 4DV2F 2AYGA 3OSPA 1IKXA 4LSZB 5KG3A 3MAAA 5LJ3Y 1J2VA 4UOFA 3OXFA 1JXLA 4HH1A 5HLFA 3DRPB 3QZ8A 1WC5A 1WHXA 4CI0B 5C7PA 1WTFA 1EARA 3D1HA 4GMKA 3HJVA 3N4WA 5KT4A 3GPAA 1Y9OA 3TVKA 2OTJS 1S49A 1F1BB 4J9RA 2VQFF 2BRKA 4A4JA 1TAQA 1X9WA 2AJ0A 2OPSB 4ZVGA 4DJBA 3CCMS 3UDCA 1PAEX 4FYYB 4DOZA 1U4BA 3N9UC 5IOLA 2XO6A 2I9SA 3HD2A 4DBQA 4YB6A 2VFRA 4U96A 4ZP9A 4LFBF 1I5OB 3PY8A 4P6QA 2LA6A 4B9SA 4OFZA 4X62J 1OO0B 1RYSA 3DYAB 3J7AN 4X2BA 5GAGU 2VZ9A 2CVEA 5J1NA 3CJKA 2QJ3A 3KG4A 3K59A 1LW2A 4Y2KA 1R0AA 3RTVA 1IQTA 3P5TL 2DRBA 3DHWC 3R1HA 1CJTB 2HG4A 5IWAJ 4WF9Q 5GADI 5DRKA 4RNFA 4UW2A 4I2QB 3PHEA 2V50A 2Y1LB 3ILIA 4NLUA 2VDHA 3K5OA 3ZZOA 3HK2A 3O5TB 2RJZA 2JNJA 1UKUA 3IG1A 2ZOGA 1UFLA 1TK8A 1RHMB 4F4KA 3I87A 3PXGa 4LF6J 2IM1A 2NXJA 1X7VA 4L6V3 3HLUA 4KQZA 4PG4A 2DHSA 2GAGC 4P72A 4HHJA 5I42B 5HP1A 3SV3A 2FLPA 4M5NA 1NUEA 3FZBA 3FBBA 5HVGA 4ECQA 2HMIB 3W5ZA 1WUUA 3UD3P 3ZZPA 2MKYA 4ERDA 4OQJA 3T6BA 3DM2B 4ZPVR 3Q83A 2G1DA 2IM2A 1XNQF 1IJEB 5DQHA 3VQSA 4C0OC 2KG0A 3N79A 2PMWA 5IQ6A 1NH7A 2NPFA 2W4PA 2W8KA 1E6YB 1RGVA 2H51B 3BREA 3IBWA 2F40A 1IKVA 1TELA 3RAQA 2PIIA 2X1AA 1K73T 4OZ2A 1HWLA 4IFYB 2XS2A 3KXDA 1NK5A 2VPYB 1H0HB 4DCOB 1GXTA 1RXOB 3D6TB 2G0JA 3G6YA 4CH7A 1U02A 2IYIA 5KT5A 3W8PA 2NPIA 3TANA 1XR7A 1S0MA 3M9OB 4NXNJ 1Z2ZA 3HI9A 3HVAA 2R3VA 1S1VA 2RRNA 5G4DA 3C46A 2PGCA 5HQLA 2KZMA 3GCWP 4ID5A 2H5JB 2FVQA 2YKAA 5E7OB 3PKYA 4BBYA 4HTJA 1HI0P 1FKOA 3EXYA 1S9FA 3CCWA 1ZBTA 4RNOA 4ECTA 5CYMA 4LRBA 4QJVA 1DQAA 1FRJA 3GV5B 1JLCB 2KVIA 3M30B 1S1TA 3MF5A 1T3OA 1TL3A 2V8HA 2OIHA 4KFBA 4QPXA 2CPDA 1NK4A 3QIDA 3M8QB 4RWXA 1D8ZA 3GSIA 5D4PA 2W9CA 2XY5A 3LOUA 1MSWD 1Y5LB 3HF5A 3PW2A 4YOEA 3N6LA 2JSXA 5CYQB 4CZCA 3HT0A 4LF7F 1C0TB 3JTPA 3R5BA 3ZO7A 4WP3A 4H4KA 3HSZA 1KDNA 1MU2A 1ZM2A 1F9EB 1TAUA 4JV1A 1VQ9S 2AJFE 3PACA 1IR2A 2V2VA 4NCGA 4HL9A 3DHXA 2H4WB 1JLBA 4P2XA 2DXEA 2X3GA 3CJ3A 1HMVA 4KH1B 4F25A 1K1QA 3QSIA 3M2RB 4FN5A 1VRTB 5G0RA 1S4EA 2KZZA 1FRIA 4J90A 4K4UA 3V4MA 4X62F 2HLUA 2BOAA 5CHCB 4DZ6A 2XCPA 2GAHC 1VC6A 1UAWA 2UUAJ 1PGZA 1R0BG 3DLBA 1SCJB 2M88A 3G87A 4ECXA 1VI7A 4KPYA 5KFKA 1T05B 2CJ9A 2ZJRQ 2W4CA 3DRSB 4HHHA 3I82A 2VJUA 2BX6A 1OY9A 2XMVA 4JV0A 2GHWA 4E98A 3QWUA 3QO9B 3DFEA 4FYXB 2PFFB 1TFWA 3BN7A 2UXBF 9RUBA 3LP2B 3UFCX 1S76D 1PCAA 4DX8H 4NI2B 1NDLA 3EPIA 1UL3A 2LQBA 3BV8A 2WW8A 4PWDB 1XNRJ 4DS5A 4G3IA 1JLQB 2E1AA 2AGOA 3FBEA 3L3CA 1G4CA 1OPZA 2LLZA 3KYLA 4OHZA 2QN6B 2RHQB 5J1EB 1KQSR 4LF6F 5KFFA 3PJ9A 1R8AA 4ITSA 1PKUA 5LJ5Y 4P2FA 1WEYA 2MZJA 4WFBQ 1D1UA 1EAYC 3SCKE 4QIVA 5FIIA 4CLWA 3VAGA 2N7YA 3CCSS 3TI0A 1JJCB 3OL9A 1QAIA 1CQNA 3VGSA 4D3GA 3W2WB 4ZN1A 8RUCA 3D6MB 3I0RB 2P9GA 1GTHA 4ZPDA 4ED3A 1HIYA 4B3MJ 2XBPA 1S1XB 5HI7A 3CCVS 2POKA 3KLHB 5HVFA 2IFXA 3HPOA 5FLXU 2MKKA 1NDKA 1SXLA 3M6VA 2RIJA 3VWSA 1RTHB 1NNDA 4NLVA 1S57A 3V4IB 1X4GA 1XR6A 1QUVA 2VC1A 1XBWA 5L9NA 3TA0A 5JUMA 5DQGA 5A8KA 4JI3J 4LQ9A 2AKWB 2EFNA 3BR8A 5SZTA 4RX6A 3R1LA 2HQCA 2B4PA 3MEDB 1DHMA 2DNPA 4DHVA 4FKYA 3NOCA 4NXNF 2M52A 1S5ZA 3JTNA 1SUQB 5IV4A 4I1TA 3KJQB 3ENAA 4X84A 5EWEA 3OUYB 4ZPTR 1RWOB 4HVZA 1NJZA 2CZVC 2QLXA 2MQLA 4DLGA 1OMSA 4OX8A 4B3OA 3I0SA 4RUBA 3DRRB 1OJ4A 2Q6BA 2QL7B 3E51A 1RA6A 4ELUA 1UETA 4LFCJ 2E7WA 2BE2A 2QO3A 1LQ9A 2AIRB 3PTWA 1N4LA 2BQUA 3FK4A 4C8MA 4IKAA 3CMAS 1UEVA 5CZXA 2RQ4A 4RR5A 1J27A 5KFLA 4IDKA 4C8YA 5CXTA 4K2JA 4B9MA 3OW2R 4EO8A 3BQ2A 1OYEA 5KG2A 2BVZA 1PYOB 1OQ3A 1FWLA 1R3NA 4YDDB 3OL8A 2KTQA 3QRPA 2JVRA 1JLFA 4OZ5A 5E3QA 1YRXA 1Q82T 4N77A 2MZTA 1XQIA 1NM2A 4I69A 1Q0NA 1SJFA 2PA3A 3QT7A 4CLYA 4DL6A 2K06A 3GWCA 4QWEA 4TN2A 3HFKA 3C16B 1KKHA 1EKRA 4FS1A 1Y10A 3CUNA 1KLNA 4NYPA 3TUPA 3MM8B 4H4MA 3MR7A 3WC0A 2AJ4A 1P1LA 5DDPC 5JVGQ 2MLYA 2FPHX 3OLAA 2XNRA 5J2NA 3CF5Q 1ZOTA 2MJUA 4IRCA 4DQSA 2UUAF 3DLLQ 3UN3A 1OSDA 5C24B 4CM2A 1XK8A 2EK1A 3LPYA 2YNFA 2AGPA 1VK8A 4DF8A 1MROB 3TX8A 1RTIB 3Q8UA 5L39A 3GJTB 1YJNS 3LAKA 3H5SA 4IOCQ 5EX0A 4Z7CA 1R89A 3DDNA 3H25A 5A8WA 1XNRF 4P2SA 1KRPA 2O67A 2IC3A 5F9LA 1HWUA 8ATCB 1YWXA 1KBRA 4MIWA 5K8PA 2PMHA 4WK3A 2JC1A 3ISNC 2F65A 2YKOA 1X5PA 4U8YA 2BUNA 2W1BA 2XI3A 3T19A 3KLEB 2YKPA 3BSNA 3H98A 3RR8A 5LMUJ 2RRAA 3AJDA 5F8GA 5AJ3F 2NQPA 3BKUA 2IJFA 1TZ0A 1SH3A 1S1UB 5ETKA 3D67A 2MZRA 4ZVRB 3FC9A 3PIOQ 4QOTA 1J5OA 2DIVA 4OL8A 1VHIA 1NZAA 2EWHA 5KAKA 1KVKA 5ETSA 1RLCL 1HR0J 5FDLA 2DPIA 4B3MF 5ETNA 3TAMA 2K8GA 2VONA 3TVZA 2C1EB 1FE4A 4JI8J 1U09A 1NO8A 3QJLA 1VISA 2AQ4A 2VBZA 1KTVA 3W9HA 1VRQC 5F8IA 2XG8A 4F2RA 2O3DA 5C2CA 1WKKA 3TX0A 1VQMS 3M9NB 4OMFG 3SDEB 4EI2A 3D5MA 4JI3F 1WSRA 1O8BA 3KK2B 4IO9Q 1M1GA 3M6UA 1SVDA 2VU5A 3A4TA 3PFOA 4R8UA 4CO3A 4NLRA 1AUDA 3NLCA 3OTEA 3BBFA 4NCAA 2X51A 2CUYA 1FO1A 2CPYA 1F0XA 1NSQA 3G6VA 4HTIA 3Q2SC 2EK6A 1NKBA 1UFWA 3A1YG 3H59A 3OPKA 2MQ8A 2NLWA 1QUPA 4CLUA 1VBZA 2PI4A 1SH2A 4JV5F 2WHOA 2O1PA 4JI2J 4ANDA 2NS1B 4ZVHA 3ENVA 2XY6A 4B17A 2IRYA 3KOAA 4B3RF 3DLKB 3BQ0A 2J9CA 1BC6A 1AYEA 4KPCA 3UD4P 2OKQA 4C2MA 1QLNA 3KK3B 2DYAA 2J9EA 3ICLA 4DSEA 2EG2A 2KJWA 2F7VA 3MMCA 1UVIA 1NK8A 3LO3A 4JI0F 1F3FA 1HWKA 2RDIA 3GYGA 3OQ2A 1WC3A 4OJ1A 2W9AA 2E5LJ 2CPJA 3P4UB 1RDRA 4ZHRB 3MM5A 4HEA9 1RWNB 4A47A 1MW7A 2NXCA 2GCFA 1SJ1A 2CJBA 2MHNA 2MSTA 9ATCB 1HI8A 3PG9A 4JI6F 1HD0A 4F0KA 2A1BA 4ER8A 1FX2A 4PUOA 2WVCA 2C2OB 1FT8A 4QCLA 3FEXB 4HT5A 1K47A 2FJWA 3ONQA 1GMWA 3V6DB 1S72S 2I2YA 3C6TB 1DLOB 1FF2A 4X4OA 1Q8BA 4TKTA 3JSBA 2VHGA 3D6FB 5JMNA 2AP6A 2ATLA 1XEZA 1HBUB 4U7CA 4L76A 5CD4H 3VAKA 3CJTA 4YR2A 5IC4B 1N52B 4KHPF 4QW8A 5KFCA 1S9GB 2UUCJ 4YFUA 3K5LA 4IG0B 2HIQA 5D0RA 2AJ1A 2XS5A 4IH7A 1S7HA 4PABA 2EI5A 2FZKB 3Q22A 1APSA 1SIZA 2NSCA 2IBOA 1K0VA 2I5JB 4PYDA 4ZVSB 3HFVA 1FK9B 5AXMA 3UVJA 1YKWA 4B3TJ 1FRHA 2UU9J 1P27B 1ITPA 2ZBRA 4OIXA 3FFIB 5D4NA 1UVKA 1U1RA 3QQCD 4Y34A 2OSRA 1ZZFA 2VPZB 2FIUA 1RUSA 1EJ7L 3TEGA 3WBZA 2GO9A 3NOGA 1R31A 1U0SA 3B54A 3M6XA 4AQYJ 3CC2S 1HQ2A 4NLTA 4RW4B 2QFIA 5LSOA 3DLEB 4O4GB 1U1KA 3D1QA 1HR0F 2DXDA 2KFZA 2EVZA 2ZM6F 4OX9J 1N0UA 3IM9A 2ZVSA 4JI8F 3LQVA 1T0TV 3AA9A 3K5MA 2RS2A 1VJWA 2GO8A 2ZH8A 1C2PA 3GU0A 4GKJF 5E3CA 4QQBA 3ADAC 2ZWOA 1R6YA 3PCOB 4MFBA 4C11A 4ECRA 3QT5A 1LFPA 2FHJD 1N6QA 3KLIA 2IMOA 3M2VA 5KOXA 4FXVA 2F9DA 3D0IE 3DMJB 3MTJA 3HHLB 4O0NA 2KL8A 2GA7A 1RT4B 3AOCA 4DU8A 1U48A 4B9NA 2ZH9A 4DL7A 1WSVA 1VOMA 2J0QD 2W9BB 4BHQA 3ENQA 2KDOA 2DKOB 3DRPA 3MXHP 3BKTA 1YIJS 1YI2S 4M1KA 2DY9A 2DNQA 3MFIA 3FQLA 4OI6A 2ZH7A 2CQ1A 2P2CB 2OPSA 2NYHA 2IA0A 2GS8A 1YHQS 4DN9A 2R2SA 4CIOA 4ZLNA 3CVKA 4JI2F 2EW9A 3MAHA 3D3CJ 3RW7A 2P5VA 1OY6A 1TL1B 4ZVQB 4PXEA 4OI1A 4MK8A 3DYAA 2W2MP 1ROFA 1JIHA 2LU2A 2MYFA 1XERA 4LRCA 2FQQB 1T94A 3CJSA 1FKPB 5DG8A 4ELVA 1XMQF 2MY7A 3UI3A 4ZITA 1S6QB 3B8HA 3TUJC 2DGOA 1NPPA 3J80Y 2C3OA 1CJTA 4USUA 5E5NA 2E5LF 1R8CA 1VQ6S 4EBCA 4F36A 2M7SA 5KFBA 4I2QA 1S0OA 1IWGA 3NAHA 2QFJA 1ZPVA 3KUHA 3EUNA 2MKHA 2FJVA 3CGIA 4CLSA 2PSZA 1LFWA 1TVRB 2OUGA 1Q95G 4DR4J 1WHWA 2HHPA 1TK0A 1NK6A 3DDKA 3NS7B 3JSYA 3BBBA 3CDWA 4EWTA 3FSYA 4DR3F 2NREA 3H4DA 5I42A 2UXCJ 3V2UC 1DRZA 2DR9A 4JB8B 5D78A 2XTJP 2X7IA 3T5LA 4NLPA 1YZ7A 3CWJA 5B0AA 2HMIA 2BJDA 1P8GA 1YLXA 5GVQA 3DM2A 4ZJQA 3VAFA 2LEAA 3NCPA 3ZXWA 1YJWS 5KT6A 4ZPCA 1NJXA 1K8AT 2Q66A 2GX8A 1RWUA 2GQQA 1E6YA 1UVMA 1YX2A 2IIHA 1X4BA 2PT0A 2UUCF 1QY7A 1SL2A 5U47A 3FCWA 4USWA 2R4FA 2J0XA 1S1WB 1SIWB 2HFZA 3W66A 2FUG9 3T5HA 4IFYA 4UY8T 4HHUA 3KKFA 3OL6A 3FBCA 1BQMB 5HN0A 4Q5VA 3R8YA 2OPRB 4B3TF 3P45B 2FLOA 4NA2A 1WC1A 4LREA 3AQOA 1NKCA 2DNKA 5DZ6A 3TZWA 4Y2IA 4LVOP 3JXOA 1N5TA 4DSKA 2LXUA 2D69A 2FHMA 3C14B
chains in the Genus database with same CATH topology
1L3KA 3BB5A 4MKAA 1BD6A 2K3KA 3IAS9 1U6ZA 4NZ6A 1LV5A 2JVOA 1HNIB 1SV5B 3I55S 1QAYA 3T1HF 1U2RA 4Y0FA 1XN9A 3HHEA 3U27A 3BO2A 1DTQA 3FZ2A 2DISA 2N3LA 2RRBA 1RK8A 5IWAF 2JEIA 1D9DA 5DM7Q 3N01A 3GYXB 4Q7AA 1HBOA 3K5NA 1HI1A 3ULHA 2C3UA 4AQYF 3KJVA 4DV1F 2R7UA 2DGWA 3PX0A 2LVWA 1TK5A 1LK7A 2YQ3A 3WC2A 2WONA 2PA8D 2BQRA 2QSWA 2KB2A 3BSAA 2HHUA 1PC5A 5DDRC 3HVTA 3UCZP 5HROA 5J2MB 4KBIA 2MZ1A 4K2XA 2DO0A 1YJUA 2JLFA 3RBDA 1TKZB 1SI9A 2V4JB 2R2RA 3H5YA 2FHOB 4LIWA 4QIGA 2AJQA 1RKJA 1FESA 1SJQA 2IM0A 2HS3A 2IJNA 4KKOA 4OX9F 3BS9A 2CKWA 3T6JA 2YY3A 2CG4A 3TW0A 3NCQA 4WE1B 4RUCA 4FNIA 5L1LA 3C66A 1VMBA 1U45A 1A9NB 4PXBA 4K4SA 4USHA 4MK9A 4BWMA 3UWTA 4OI4A 4OJ3A 5J2QA 1Q53A 1VQ8S 2V94A 4CTAA 3RW6A 5KFHA 1WWHA 2IYGA 4DPOA 2R7XA 4OZJA 2ZNYA 2KG1A 2DPJA 4FF4A 4JV2A 1FNOA 1U1MA 2GMJA 1SB6A 4F50A 1VIOA 4ZVFA 5F8MA 1IBKF 2JHEA 1F5CA 2OMOA 1JLCA 4BC9A 3GG0A 1VIXA 3M30A 2HHVA 2OD4A 1HNZF 2JJ4D 4C7QA 2ZHOA 5GAHU 4GKKF 4LSNB 4QU7A 3EYZA 4MFBB 3SZ2A 2CIMA 2DGUA 2HS4A 3W3SA 2HWHA 3U1NA 2HNDA 1NJYA 4LF4F 3IWXA 2M9KA 3KLIB 2BZ2A 4QU6A 1JMTA 3M2VB 1ZTWA 4GO7X 4DV2F 2AYGA 3OSPA 1X9SA 1IKXA 3M8QA 2ZFHA 5KG3A 4OHWA 3JAMY 2L9WA 5LJ3Y 3DOMA 2ZD1B 3RYLA 4DL4A 5K14A 3CDUA 3Q8QB 3LALA 2VH7A 3CD0A 2ZNZA 3CCZA 2ZDOA 1IR0A 2KYXA 2N82B 3OXLA 3US5A 1J2VA 3C6UA 5ADZA 3PR5B 1WG5A 2IAJA 5KT2A 3POTB 3QGHA 2B43A 3OXFA 5CYQA 5DG9A 1JXLA 2ZKUA 3GE9A 2N7CA 5IM0A 4HH1A 4F8RA 5IFMA 4RBVA 1Q79A 3TRGA 5HLFA 4DLEA 3DRPB 3QZ8A 2ZC3A 5JVHQ 1WHXA 1C0TA 4XAKA 4CI0B 3IN5A 1T03B 2BA9A 1WTFA 3HVRA 3O3LA 1G1XA 2YNHA 3D1HA 4GMKA 2BANA 2J9DE 2GW8A 5J2PB 3OSNA 2XMUA 3ETOA 3CE8A 1MWZA 4U9RA 3W2VB 1SL1A 1UMJA 1RT7A 1DURA 3N4WA 5KT4A 1X4DA 2QLWA 4NLOA 4N76A 3MM6A 5LSLA 1KONA 1Y9OA 3TVKA 2OTJS 1S49A 2K1RA 4WU2A 4J9RA 2NYIA 2VQFF 2BRKA 4A4JA 1PO6A 1TAQA 1X9WA 2AJ0A 1TKXB 1Y0HA 3IR6B 1MNEA 2OPSB 2P6TA 2HNZB 2FDNA 4ZVGA 3GYNA 4DJBA 3CCMS 3UDCA 4LFAF 5D8HB 1KD1T 5GAHI 4DOZA 1U4BA 4DG1B 3N9UC 3IGNA 3GIJA 4OHVA 1GQEA 2W4DA 2I9SA 3M2RA 4DBQA 1VRTA 4YB6A 2VFRA 3GB0A 4ZP9A 2NR0A 4FNHA<