3HVCA

Crystal structure of human p38alpha map kinase
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
348
structure length
327
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title p38alpha MAP kinase C-terminal domain binding pocket characterized by crystallographic and computational analyses.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 327
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hvcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hvcA01
2WMTA 3IDBA 3E3PA 1GIIA 2VGOA 3HZTA 3O50A 5FWKK 2BUJA 2PVYA 2YM8A 4CV8A 4UMRA 3VO3A 1Y8YA 3BYVA 4MHAA 4GUEA 4ZS4A 3TEIA 3QWKA 1JKLA 3DBFA 3KGAA 4EK3A 3JUHA 3FMDA 4EQUA 5CF5A 3AD5A 4X2GA 2C5XA 2VRXA 4B4LA 1JWHA 4FEUA 3ZFYA 2V7AA 2C5YA 2IVTA 2IWIA 2GQSA 3AGLA 3V8TA 1DAWA 2PVHA 2W4OA 4TZRA 4N6YA 3KXNA 3FYJX 4EHZA 3MW1A 4EZ7A 5FXSA 2QODA 5I9UA 1ZLTA 5CVHA 2UZNA 3UZPA 1O6YA 2SRCA 4PDSA 1OECA 2VX0A 5C26A 5T6KA 4O7NA 4BWPA 4RC2A 3ROCA 4CFNA 3ZSIA 3FMLA 3U87A 1L8TA 3I0QA 2H96A 3KN6A 5DN3A 4ASDA 4QQJA 2JIUA 2QG5A 3O0GA 4BCOA 3F5GA 4IIRA 4R8QA 4Z9LA 2OF4A 2IW9A 4CMOA 4EK8A 3UE4A 4ZTLA 4DF3A 4C34A 2XCKA 1PKGA 3VBVA 1UNGA 1XH9A 4BGGA 5J5SA 4NKAA 4O0YA 2CGWA 4JIKA 2FSTX 2B9JA 3Q96A 2RL5A 5EI6A 3EH9A 4S31A 3I4BA 3R9OA 4DH3A 5JSMA 5H9BA 4FA2A 4DBXA 1UWHA 3KQ7A 4KIKB 4FTMA 2Q83A 2PMNX 2PVFA 3FHIA 3QXPA 3DAKA 1CTPE 3EHAA 3V8SA 1RJBA 4WUNA 1PYXA 4O7RA 1WZYA 2IZTA 4G31A 4L6QA 3G9LX 4CYIA 3KK8A 3U55A 4S32A 4RVTA 3AC4A 4CQEA 4FIIA 2GNLA 1UWJA 2UZDA 5CSXA 1J91A 4PMTA 3KA0A 4JIAA 3UP7A 5KMKA 2WQBA 3QZGA 4WBBB 5M55A 2PVJA 4QTDA 4CD0A 3V5WA 2G9XA 3ZXTA 2VTIA 4JAJA 5FXRA 2BZIB 3HMMA 2GTMA 3AD6A 3PYYA 5HX8A 1KE8A 2XNBA 3VC4A 5C8KA 2WEVA 1MRVA 2JEDA 3ET7A 1YKRA 2X8EA 3GNIB 4FSZA 4P5QA 2RGPA 4ASEA 3HKOA 1SVEA 3FI8A 3UYSA 2JITA 5JQ5A 4OTWA 3R9DA 1B6CB 3DKFA 3MH2A 4YO6A 3TKHA 4ZP5A 1Q8UA 5CY3A 4DFUA 2Z7SA 4NTTA 4U8ZA 1OI9A 5FP5A 4CRLA 5I0BA 3OT3A 3TIYA 4ANOA 4JQEA 3KU2A 4FIJA 5FTGA 2F49A 5K4IA 5HTIA 3HECA 2BRMA 4K9YA 4BZNA 4A9RA 4XP3A 1ZOGA 3KCKA 3AT3A 4G6LA 1OIUA 4PPBA 2RKUA 2WMAA 5E8ZA 4UWBA 4CMUA 2ERZE 1VJYA 4AGWA 3FMMA 2W17A 4G1WA 2B9FA 1REKA 5AM7A 3TV4A 2OIBA 5CXHA 3DAEA 3FY0A 4XLIA 4YZMA 4XRLA 4FIGA 4MXCA 4O83A 1JKSA 5A4LA 1OB3A 3RHXA 3LQ8A 3LKMA 1W83A 4GRBA 4D9TA 4KS7A 4WG4A 5HTBA 2XKFA 3BKBA 4FTAA 4CFMA 4R5YA 2ZOQA 4A4OA 4Q5HA 2I0YA 3IS5A 2G15A 4O0VA 2HENA 3T3VA 1J1CA 3ZONA 5AEPA 5AIKA 2QOIA 4G5JA 5LJJA 1PXLA 3MBLA 4IZ7A 1EH4A 5AAFA 4L3PA 3PDTA 3SA0A 4FSWA 2QOKA 3ZLWA 2HELA 5HIBA 4MBLA 5CEQA 4FR4A 4CG8A 3VNTA 4PL3A 3OD6X 4YC3A 4FT9A 5L4QA 3SC1A 4DCAA 4EBWA 1GY3A 4YURA 5LVLA 3LCKA 2QR7A 2QHNA 2XB7A 3BLHA 3HEGA 4LMNA 3LFQA 1JSUA 4P4CA 1NT2A 1KE9A 1YHVA 2PY3A 2WD1A 4FUXA 4LOQA 3R7VA 3S1HA 4OBPA 3EJ1A 4FTIA 1CMKE 1URCA 5AP7A 3CCNA 3H30A 2I7QA 3Q52A 4XS2A 1XH6A 1IASA 3WF6A 1ZYCA 4BDHA 3SQQA 3HV6A 4R78A 3SV0A 4CEGA 2R3JA 2YCQA 1H4LA 3PG3A 1V0BA 4KWPA 4ANNA 5J9LA 4WRSA 2R9SA 4Q9ZA 4DLJA 4JI9A 4G3GA 4RMZA 2QHMA 5KZ0A 5BYLA 1R0PA 2XBJA 2ZM3A 3PJCA 1BYGA 3HVCA 4FYNA 3RK5A 3NUAA 3VUIA 2HW7A 3DXQA 2BFXA 4TW9A 2ITWA 3MY5A 4JQ8A 3QQHA 4EKLA 3DFAA 5CAOA 1GZKA 4L01A 4M7IA 5I3OA 2JKQA 4YHJA 4NIFB 3KF4A 1Q24A 4D2RA 1A06A 3QBNA 4ZSEA 3ZSHA 4BDAA 4XG4A 3UYTA 3WZKA 3OP5A 2BPMA 4RLKA 3NW7A 4FG7A 3I7CA 4O21A 2R2PA 4YZCA 2GNIA 4EOLA 4LGDA 5HOAA 2Z02A 1XHAA 3MS9A 2W1CA 3MTLA 3VS4A 4YJRA 4NJ3A 5CF8A 3D5VA 3R02A 1WBSA 1YI3A 3E93A 1WBPA 2XIYA 3UQFA 3ZM9A 3TI1A 2I0VA 4YSJA 3O71A 5IA2A 3KRJA 3MGYA 3TZ8A 3D83A 4IX3A 3A61A 2GCDA 4RT7A 3HAMA 4MX9A 2XEZA 4FV4A 4LL0A 1PYEA 4ACHA 5DA3A 4USFA 4WT6A 3AC1A 2VWBA 3E8DA 5F20A 4KIOA 5IUIA 2R7BA 3Q4ZA 1M2QA 3PXQA 3WILA 5CSPA 3HP5A 3P4KA 5I5ZA 2A2AA 5CXZA 3QD0A 4W8DA 2UW9A 2WMXA 4MCVA 2Y7JA 2B54A 2BHHA 1H01A 3QKKA 4F6UA 3OCBA 4YO4A 3MPTA 3NIZA 5JH6A 1ZMWA 4TN6A 4AN3A 4L42A 4MXXA 4EUTA 5AAGA 3JVRA 3DB6A 4MNFA 3K5UA 3N9XA 1BI8A 4A9SA 3PSCA 2J2IB 4FVPA 3SOAA 4IX5A 4ITHA 4C57A 3E8EA 4CLJA 4FE2A 4L3LA 3RPYA 5M57A 4FEWA 4IB1A 1W98A 3W2OA 4ALUA 4MBIA 1AGWA 5DNRA 4QTEA 4YTCA 2R5TA 2HOGA 2OGVA 5DPVA 5FD2A 1H07A 2BILB 4Z7HA 4XCUA 2GQRA 4GKHA 3GU5A 5CYIA 5L2QA 4FSTA 4QP9A 5IQGA 5AMNA 4KBKA 3IDPA 5I9WA 4MNEA 4KRDA 3MJ2A 4E4XA 5TT7A 3G6HA 4U97A 5D12A 3FZ1A 3VUHA 5EHOA 2PZPA 3HGKA 2OBJA 3AMAA 3QUDA 4FT7A 3KXHA 4RJ5A 1Z9XA 4JG7A 2OFUA 4FKOA 3E8NA 5CSWA 5E4HA 2YM5A 4KUJA 5CEIA 5EH0A 4YJNA 4HVSA 3EN6A 1Q3DA 1YI4A 4KD1A 2YITA 4C02A 5AX3A 3V6SA 4NUSA 3CKWA 5CU6A 4A9TA 5DEYA 4AW1A 4FTNA 1UKIA 2QOCA 2WB8A 5LVNA 4K77A 2YIQA 3NCGA 4RJ8A 4E1ZA 3ELJA 3PXKA 4I5PA 4DAWA 3VS1A 5EKNA 3NYXA 1BI7A 4NCTC 2OW3A 5DBXA 4A9UA 1MQBA 4FOCA 2GSFA 2YIXA 3DK3A 5EQYA 5EYCA 3LQ5A 4H1MA 3UP2A 4FZ6A 2ONLC 3E87A 1O6LA 4HCTA 3WI6A 1U59A 3G0EA 4ZZOA 3H10A 1ZRZA 5KZIA 5JGAA 2PULA 3W18A 2YAAA 2CLQA 2VWYA 4OBOA 4NM7A 1YDTE 1F3MC 3CXWA 3MIYA 4J8MA 4KSQA 4Y73A 5BVKA 4QPAA 4E26A 4EH4A 5AV1A 3FZRA 3L8XA 4O0TA 4YUQA 2W05A 4EEVA 2Y4IB 3TUBA 1VEBA 1H8FA 4HJOA 4FTJA 1NY3A 3P9JA 4PY1A 3F3TA 3QHRA 4QMVA 3RZBA 4TYHA 2NO3A 4DEBA 1K2PA 5CNOA 2ZYBA 3EZRA 3QTRA 4ZTRA 5HE0A 5IQDA 1JQHA 1Q41A 1REJA 4NW6A 4RSSA 5JGBA 3Q9WA 2P2IA 3DZOA 5LQFA 1Y6BA 4G3EA 4U41A 4IDTA 1DS5A 4NM5A 4FBXA 4HGLA 3CIKA 4D1ZA 4F9YA 1ZXEA 3DXPA 2JDVA 3E62A 3FHRA 4WA9A 4Y5QA 4YJVA 4IFCA 5AP5A 3P86A 1CDKA 4QYGA 3GC7A 3NYNA 3ZUTA 5JZJA 5IMXA 2WTDA 4EWQA 1L3RE 3E63A 2R3FA 1U54B 3BHUA 3D7TB 4LMUA 2HAKA 3OCGA 3FLZA 4IM3A 3EN4A 5A3XA 1PMEA 2ITTA 1S9JA 3WOWA 3UOKA 4QMNA 4ANMA 2ETMA 2WEIA 4CMTA 4LG4A 3CTQA 4JG6A 3OG7A 4D5KA 3RCJA 4FYOA 4WIHA 3O23A 5KMMA 1H25A 3B8RA 1KE6A 4I20A 3R63A 3QLGA 4RIXB 3BQRA 3EQGA 3LPBA 3DLSA 3Q53A 5H3QA 3MI9A 2BRNA 3HV7A 3T3UA 4CZUA 4EYJA 3NW6A 5HTCA 3BGZA 4AW0A 4OT6A 4OAVB 3KN5A 3PA5A 5GJGA 2WMQA 2YZAA 4RQKA 3UOJA 4GYIA 3C9WA 5ETIA 3SW4A 2QURA 2WTCA 5D7VA 5A4CA 2XRWA 3DJ7A 3EQFA 3FMKA 4BZDA 3POOA 1STCE 3OWKA 3NNUA 3LJ2A 3COHA 5FGKA 2O5KA 4EH2A 2J4ZA 3H3CA 5FXQA 3QQFA 2PUIA 3OWJA 1OPLA 2CHLA 4JDIA 2BZJA 1U5RA 3O8UA 2CKEA 4Z3VA 3EQDA 2F2CB 1MRYA 4OW8A 4AOIA 2VTJA 4BVUA 4C38A 5HG7A 5M4UA 2PVLA 5DLSA 4O6EA 4BHNA 5AV2A 1DAYA 3QQGA 3R7OA 3QRTA 2RF9A 3UG2A 4X2FA 5A4QA 2PMOX 3HMPA 4Y72A 1DI9A 4DEGA 1B38A 4MKCA 3GCSA 4ALWA 2PHKA 5TO8A 1BMKA 2W5BA 3GVUA 3CQUA 1H00A 3I6WA 1AD5A 3CD3A 3QKMA 2B9HA 3KXZA 5CAPA 5L2SA 2FSLX 3BBTB 4FKLA 3UG1A 2I1MA 4NFMA 4UX9A 2R3GA 4RVKA 4YGAA 3NEWA 3II5A 1GZNA 2Q0NA 4JLCA 5FEQA 2J0JA 4FTUA 2R3LA 4DEIA 4MYGA 4B9DA 3P5KA 1OITA 2J5FA 2Y6MA 3NSZA 2PSQA 1XKKA 1TVOA 2PVKA 2QO9A 3ENHA 1GNGA 3M11A 4WNOA 4RA4A 5JT2A 3QA0A 4B6LA 4RZWA 5ANEA 4CLIA 3I0OA 5FBNC 5GZ8A 3QGWA 3ZBXA 3F3UA 4Y85A 4D5HA 3NLBA 4GU9A 4X3FB 3ZUVA 3W55A 1WBNA 3QUPA 4FV5A 2YCRA 4FG9A 3VRZA 4RIWB 5EOLA 4NKSA 4AZFA 4G3FA 3NMUF 3NRMA 2CNUA 2VWZA 1FOTA 3E5AA 2CMWA 2YDIA 1E1VA 5AIRA 4U9AA 4F4PA 1H1PA 3W2SA 1YHSA 4TRLA 3Q2MA 5CU4A 3DA6A 3ID6C 4XRJA 4I93A 4ZY5A 5TOZA 4EOQA 5BUJA 4IZ5A 4EH5A 3FJQE 4F64A 2BCJA 2JGZA 3OXTA 2C6MA 3FV8A 3POZA 3DXNA 3QX2A 4YJOA 2Z7RA 3PVGA 5EFQA 5IEVA 3TNQB 3RAKA 4APPA 3BEGA 1KOAA 2VGPA 4IANA 3LFDA 2C0OA 3L9LA 4ENYA 5LOHA 2WGJA 4IXPA 1QL6A 2J0LA 2YABA 1PF8A 5L6PA 2O0UA 3F2NA 4YNOA 2P4IA 4M69B 4QP1A 4W9XA 3TNIA 5A6OA 1PW2A 5EYMA 2ZMDA 5E8UA 2PVNA 1OIYA 2OXXA 3B2TA 3R1NA 4LI5A 3V5TA 3LMGA 4D2WA 3MTFA 1FVTA 2QLQA 4L53A 4WSQA 3ZDIA 3F5PA 3S00A 4FNZA 4CGAA 2YERA 3TT0A 2PZIA 3R2BA 3NS9A 1Q8TA 2ZM4A 1PXIA 4HOKA 3LXLA 5K9IA 1I09A 3V3VA 5FBOA 1WVWA 2YLEA 3D5UA 3DBQA 3IW8A 4XHKB 5C27A 2JDOA 4PDOA 1IR3A 5ANOA 1OBGA 1G8SA 4EOJA 1J7UA 2CGUA 3SXFA 4QP7A 2ITOA 4EC9A 3MSSA 5M56A 5AUUA 4DEDA 3LMIA 3VBXA 3NYOA 2VTPA 2CLXA 1DI8A 4YHFA 4PDYA 2Y4PA 2Z60A 5KKRC 4HPTE 2P33A 3AMYA 1PMUA 1WBWA 2C6KA 2XNGA 4O1OA 3UNZA 4WHZA 2ZV7A 4I0TA 1SVHA 4AT5A 2C3IB 2YDKA 3RJCA 4FL3A 1UU9A 4WBOA 5CU2A 3R30A 4DINA 3GT8A 3MY0A 5IH6A 1Y6AA 2OZAB 3SX9A 3TNHA 3UMWA 2VO6A 3UO4A 4IX6A 1YQJA 3FLWA 4NM0A 3UPZA 3W8LA 5HGIA 2ZB1A 3UC4A 3QQLA 2PK9A 3ZBFA 1P14A 4EK6A 2IPXA 5G6VA 2B53A 4IAKA 5B0XA 5IDPA 4BGQA 3OOMA 4QTAA 3KMWA 5AR4A 3BYSA 5LMBA 2EB3A 1YOLA 4RWIA 1R78A 3UVPA 2Y8OA 2W7XA 4AZEA 3QZFA 4P7EA 3BGQA 3ZH8A 4DTAA 3VBTA 2IZRA 3E8CA 4FK6A 2WTKC 4TPTA 2WMRA 3UQCA 3DDPA 2OSCA 3GEQA 3OEFX 4L67A 3FQHA 3L9PA 1Q61A 4R1VA 5CSVA 1UU3A 3EN9A 3NX8A 5IQIA 1VYWA 1XQZA 3KEXA 2X0GA 4OGRA 5CT0A 5LCKA 4BC6A 5IQAA 2QKRA 3DQXA 2E9VA 4G6NA 4OTPA 4RIOA 3PLSA 2ZAZA 2YACA 4O0XA 2PZ5A 2RIOA 4DTKA 2AUHA 4QO9A 3ZLXA 1NVQA 5H8GA 4ZSAA 3MB6A 3F61A 3VWAA 4BIDA 1TQIA 4AWIA 1JNKA 2WMUA 2WQNA 3WYXA 4O0RA 3U9NA 4YTHA 5AP4A 4ZK5A 4D4RA 1E1XA 4XUFA 3PZEA 3G5DA 5IZFA 5EQPA 2QD9A 3DJ5A 3QRUA 3EQIA 5L2IA 3LCOA 1YOJA 4RZVA 4UBAA 5BMMA 1PXJA 3BU6A 1VZOA 3BBWA 4DITA 5EM8A 5H8EA 1SVGA 3ZEWA 3JS2A 5LWMA 2JBOA 4P90A 3SW7A 4C35A 4BZOA 4YLLA 4FKPA 4MQ2A 4LV8A 2ITQA 3FI2A 4KKHA 1IAHA 4Q2AA 3RNYA 4UN0C 4G3CA 3QYWA 5HD7A 4DG2E 5LXMA 5E91A 2GS7A 1W8CA 4GW8A 4DFYA 3C5IA 4FGRA 2O63A 2CSNA 2VUWA 1S9IA 4UWCA 4IVBA 5HX6A 2HWPA 2J0MB 4EWHA 2BTRA 2VAGA 4CT1A 3VBWA 4O0SA 4C33A 1H08A 3OVVA 1Q8ZA 5E8WA 2UW6A 3GQIA 3UIBA 4HPUE 3OF0A 3Q9ZA 1IEPA 5CZIA 3VF8A 2JKMA 4BI2A 1H0VA 3IONA 4QMWA 3UIXA 4X7QA 1Y57A 3H0ZA 3VBQA 3LLTA 4E20A 4QMUA 2C4GA 1J3HA 1APME 4IAFA 4OLIA 4CFVA 2NNWB 2J0KA 4BTKA 3KFAA 4BB4A 2C6TA 4OTIA 4KIPA 5CS6A 2ITVA 4UEUA 4O2ZA 1OL1A 3LAUA 2P55A 3KK9A 4W4YA 2F7XE 4UYNA 5JRSA 3IOPA 5LVOA 1SYKA 3IGGA 4FL1A 1KSWA 1U4DA 3NUYA 2C0TA 4PRJA 3QD4A 3JXWA 4GFOA 5BYZA 3W2PA 4CCBA 3OBJA 4FEXA 3DQWA 5M51A 3ETAA 4LQMA 1ZY4A 4EHEA 4XOZA 4ZJVA 4YJSA 5FEDA 4BDIA 2PUUA 4BHZA 4UXQA 4MD7E 3VHKA 2AYPA 4Z55A 3FEGA 2ZJWA 1OIQA 1QPDA 2BZKB 3EFWA 1U5QA 3TNPC 3M1SA 4XG6A 3UC3A 3V01A 4MVFA 1JPAA 4L3JA 4YLKA 5GNKA 4DGNA 5AA8A 4A4XA 1K3AA 3JR1A 4U45A 1YW2A 2HZIA 2R0UA 3WF7A 3QD2B 1OZ1A 5HVKA 4V0GA 2R3QA 4O7SA 3EIDA 1YXSA 2W99B 4K11A 2G1TA 2UUEA 3MESA 3NUSA 4OUCA 4BBMA 4KABA 3Q5IA 1LEWA 3H9RA 4E3CA 4JX7A 3DT1A 3A7GA 3F82A 4NT4A 4E6DA 5BVFA 3PE1A 5JMSA 1FMOE 3R83A 3BV2A 1OMWA 4KAOA 4WD5A 4DA5A 1LP4A 4WKQA 3R22A 3MDYA 4DGMA 1ZWSA 4FV2A 2CCIA 4DFXE 4IB3A 4BCJA 4XOYA 2VN9A 4H58A 4U43A 4I0SA 3LQ3A 5EM7A 4YU2A 4FTKA 4I4FA 4F09A 1OIRA 4JBQA 2XEYA 2XVDA 3LOKA 4IDVA 4WNKA 4U81A 4RX5A 4HYSA 3TACA 2CNVA 3FLQA 4BYIA 5I4NA 4UMQA 1ZARA 3B8QA 4AT4A 1IG1A 1E9HA 3LFFA 2B52A 3KVXA 4H3BA 1U46A 1PXOA 3EKNA 4PF4A 5FRIA 1FVRA 4PV0A 2CPKE 1P4FA 5AJQA 2X81A 4F0FA 4IFGA 4CCUA 3R8MA 5M44A 2I0HA 2VZ6A 2BRGA 3EQCA 2IW6A 4U79A 3ZLSA 1YI6A 4IAIA 4YR8A 3ZEPA 2YIWA 2R7IA 2J51A 2WKMA 4OTRA 5C8MA 5C4KA 3CTHA 4BCHA 4MF1A 2CKQA 4R3CA 3BEAA 3T9IA 5HG9A 3HRBA 5DI1A 2VWVA 3GI3A 4FKSA 4M84A 4APCA 2YWVA 4RC4A 5HNBA 3ZFXA 5TF9A 4J52A 2RG6A 5EW8A 3QGYA 4AS0A 3P7BA 5HORA 2VTTA 5IH4A 3I6UA 2XK8A 4FX3A 2IVSA 3COKA 5M4IA 3C7QA 4F1MA 5L3AA 3D5XA 3A2CA 3DAJA 3PE2A 4FL2A 4TTHB 3ZRKA 4PX6A 3ZCLA 3RTPA 4QYEA 1FPUA 3RK7A 2X8IA 4XG2A 1TKIA 2FGIA 2YCSA 5EYKA 4F63A 2R3HA 4LRJA 3ANQA 3QUEA 3ROYA 1GJOA 4I6HA 4YP8A 5A4TA 5IA0A 3EZVA 4MXAA 1WMKA 5IQFA 3NPCA 5E92A 3K3JA 3P23A 3IG7A 5BNJA 3LFEA 3KY2A 4GK4A 1YXTA 2YFXA 4AG8A 4EH6A 4RFYA 3L9NA 3I81A 4IB5A 4KIKA 4BBFA 5ETFA 4D2PA 3LFCA 4E5WA 3PVWA 4U40A 2CKPA 2OXDA 1VR2A 2W06A 4BCNA 5J1WA 3QRKA 5M4FA 1KUTA 4YZ9A 4DEAA 1WFCA 3CR0A 3D94A 2JD5A 5LARA 3Q4UA 5CTPA 3ORIA 3UIMA 1W84A 3D0EA 3TKUA 5FDXA 4BWXA 4E5AX 3Q4CA 2ZDUA 4JDKA 4L46A 5KMLA 4J99A 2R3PA 3R7UA 3WZJA 3LFBA 3QQUA 4FKTA 4DGOA 1H0WA 3VVHA 3S2PA 5EDPA 2C68A 3F5UA 2W1DA 2YIRA 2VWWA 3QRJA 3GENA 4PMPA 4F6WA 2CJMA 1XBCA 5A4EA 3MFSA 3GFWA 4XBUA 1M14A 3D5WA 3KVWA 4GCJA 2RFDA 3ALOA 4I5MA 3IK3A 3RM7A 2GFSA 4IE9A 3IECA 2QNJA 3SG9A 4QMOA 2PVMA 2XK4A 3COMA 3HL7A 3C4XA 4CXAA 5E9EA 1IA9A 3C1XA 3V5QA 1UV5A 4EYMA 5AV4A 3R7EA 4EOSA 5DR2A 4EC8A 1XR1A 4N6ZA 2GTNA 5IEYA 4F7SA 3SD0A 4O7ZA 1Q62A 4H1JA 3PJ2A 3K2LA 1NVRA 5KCVA 1GZOA 1H26A 2XIKA 3E88A 4FTCA 2X8DA 4FIHA 4IVDA 2GNHA 4O84A 2ZVAA 5IH5A 2LGCA 4LGGA 4BCMA 2R0IA 4DT9A 4RIYB 2WOTA 1FVVA 1MQ4A 3NR9A 4CT2A 5BMSA 5KHWA 3F2RA 4DTBA 3TUCA 3CC6A 5J7HA 4PPAA 4RQVA 1XO2B 3G15A 5E8XA 4BKJA 3VW8A 3TUDA 4FV6A 4FV9A 4BKYA 3VS5A 4EOOA 3P0MA 2W1HA 1TQMA 3QFVA 2O65A 5DH3A 5IQHA 3BI6A 1PMNA 2PE2A 5ITAA 3OS3A 2YZLA 3UOLA 2EU9A 3OFMA 5D10A 3ATSA 5CVGA 3PPZA 5DE2A 4EZ3A 4ZLOA 2XUUA 2XK9A 5BX0A 2WZJA 3GP0A 3A7HA 3R0TA 4NH1A 4B7TA 3IW6A 3S95A 2WMSA 4G3DA 1ZZ2A 5HG5A 3VJNA 4DYMA 4CFUA 5GZ9A 3PA3A 4YSMA 5IQCA 4U3YA 3PG1A 1YVJA 4RC3A 2QG7A 3OW4A 3UQGA 4YZDA 4HVDA 3QC4A 3F69A 3RAWA 1UNHA 4HCUA 2GS2A 5AP2A 3R8VA 4ZSLA 4F7LA 5CEKA 5KMIA 1R3CA 3FQSA 4PPCA 4E7WA 4L7FA 4C37A 5KMNA 2RFEA 3UGCA 2G2IA 4QMMA 5HICA 2R3IA 5M07A 2V55A 4AN9A 4RA5A 2XCHA 4U3ZA 4ZOGA 1M7QA 4FOBA 2W0JA 4IWDA 3NVKI 4BIBA 4FICA 3R7IA 3RINA 3FZTA 3COIA 3FZPA 5L2WA 4TYIA 2UZLA 4CZTA 2WTIA 4W8EA 4YBKA 2CGVA 4JDJA 5CEOA 5FM3A 3R73A 3VUMA 2IZSA 3PA4A 4YTFA 3NNWA 2BAQA 5L8KA 3DNEA 5CU0A 4LL5A 4I21A 3VW6A 3ZHPC 4AZTA 4UV0A 1PJKA 4JX3A 4C3PA 3Q2JA 3MH3A 2ZV9A 1OL2A 2XJ0A 4W4VA 4NIFA 3ZDUA 2WQEA 4ZXTA 3SOCA 3GU8A 3MFRA 1OKWA 4JRNA 3F7ZA 2YAKA 4BCQA 4C0TA 3BHYA 4ACCA 1NVSA 5ANDA 4GVJA 1OUYA 4XNEA 2VX1A 2RFNA 4GU6A 4RVMA 3KL8A 2VV9A 4NZWB 4XG3A 3RI1A 2HYYA 2IN6A 5JRQA 4JQ7A 3CTJA 4EUUA 1RQQA 3HA8A 4U44A 3WZDA 3P78A 3PPKA 3CQWA 4FKRA 4L68A 3VF9A 1NXKA 4C3RA 4XV3A 5DT0A 4K1BA 4C4EA 3A7IA 1P5EA 4R77A 3AD4A 2B1PA 2IVVA 3EYHA 2J7TA 3LCDA 4FKVA 4JVGA 3UOHA 2E9PA 1WAKA 5J8IA 3VS6A 2IW8A 2QVSE 3C4EA 5T68A 3SRVB 4F1TA 2PPQA 5CLPA 3D15A 5E1EA 3N4TA 5DRBA 3DKGA 2VWUA 2QC6A 4LRKA 4RJ6A 3P08A 4RLLA 2WNTA 2YM4A 4WRGA 2BIKB 3QZHA 2QOFA 3N51A 5EW9A 3RBWA 5HO7A 2H34A 4R7HA 1KV2A 4LUDA 4IACA 5K0KA 1X8BA 3TTIA 4W9WA 4RFMA 4ERKA 4M0YA 3QWJA 4NFNA 4NSTA 5JK3A 4C4HA 3BGPA 4JOAA 4BCGA 4AOTA 2XK3A 1WVYA 4HGEA 5CU3A 2ITYA 2RFSA 1QPEA 1LPUA 3U8WA 4D2VA 5FTOA 2XIZA 4E4NA 4A07A 3V04A 4EORA 3A4PA 3ODYX 3QTXA 4QOXA 4I24A 4QMLA 3OHTA 1JKKA 2GQGA 4I6BA 4RJ7A 4GT4A 4IWPA 4U0IA 4YLJA 3V8WA 4L45A 5CVFA 4D0WA 4F65A 4BTMA 3G51A 4QQ5A 3ORXA 2XNPA 2YM3A 4QQCA 2C1BA 2WXVA 2OZOA 4FT3A 2GU8A 3KRWA 4GH2A 4DH5A 2YJSA 2PL0A 4C59A 2JKOA 3FI4A 2PMIA 3ULZA 3TJDA 4ZLYA 1Y8GA 5JFWA 5HG8A 2Z2WA 5AFVA 5BUIA 2C3KA 3KRXA 5LVMA 4HGSA 1YRPA 4DC2A 4GG5A 4ENXA 1FMKA 2UW8A 2XRUA 2X39A 3ZYAA 5IPJA 4R6VA 5DEWA 3OUNB 4D2SA 5IMEA 4I3ZA 5AUXA 4O7WA 4LGHA 2BKZA 2C3JA 3EYGA 4FZAB 4Y5HA 3UVQA 3GU7A 2PTKA 3DJ6A 4DFLA 4UXLA 5HBJA 4MEDA 4I41A 4QMTA 4AFJA 5F95A 3FL4A 2YEXA 2JFMA 3O7LB 4KA3A 4EOPA 1QPCA 3NUXA 4ZTHA 5I3RA 4UB7A 5DYJA 2BRHA 2IVUA 3KXGA 2V7OA 1URWA 2CGXA 4X21A 4C7TA 5EOBA 2XNEA 3H9FA 5E7RA 2X2MA 1QPJA 3IGOA 4QNYA 2PZYA 3PRFA 2ERKA 3QL8A 3KC3A 4F0IA 3HV5A 4Q9SA 4KNBA 3E64A 4YJTA 1YWNA 3VAPA 3IDCA 4RX7A 4F7JA 2F7EE 3R8PA 5EI2A 2QOBA 1YXUA 2IZUA 2QOHA 3U9CA 4AGDA 5A46A 2X7GA 3SDJA 4XV1A 5AUVA 4A9YA 3DKCA 3FI3A 3TZ9A 5GIOE 1ZYDA 4J98A 4C2VA 2UW5A 1BLXA 1M2PA 4ACDA 1HCLA 3AXWA 4CFWA 3RPOA 3H4JA 5HQ0A 4DEEA 1F5QA 2JAMA 4M3QA 3RAIA 3AT2A 3CPBA 2GNGA 3DOGA 3GCQA 2UZEA 4GK3A 4KIQA 5IA5A 5AUWA 3VHEA 3ZRMA 5LWNA 3ATTA 3IW4A 1Z5MA 4RVLA 5JFVA 3NNVA 4G5PA 4M66A 4GUBA 3R1SA 3DBDA 3OMVA 4X6QC 1PY5A 3BE2A 2GPHA 3PXZA 4C58A 3NYVA 3ZZEA 1DM2A 1BX6A 3EFLA 3QTZA 2NRYA 5C8NA 2A1AB 4MAOA 2BTSA 3H9OA 4WG5A 4AA5A 3TTJA 2QONA 4CG9A 3FDNA 3P1AA 3PWDA 3FMNA 4JR3A 4PMSA 1YWVA 3VS2A 1OL6A 3BHVA 4U42A 4X2JA 3OC1A 5C03A 4KS8A 3MVHA 3W1FA 1U54A 2WFYA 4FNWA 3D7TA 3MJ1A 3DZQA 4TYEA 5EYDA 3DU8A 3RPSA 2FUMA 4ZZNA 2Z7LA 3DS6A 4HGTA 4ASXA 4C62A 4HYUA 4JAIA 4F7NA 1SNXA 5CAQA 2PWLA 2XJ1A 3BELA 3EQRA 3F88A 4AW5A 3O51A 2YWPA 4IX4A 4M14A 3MVLA 3FPQA 4FV3A 4WOVA 2WTVA 4G16A 5JKGA 4FSYA 4RIXA 3WIGA 3TDVA 2A27A 3DBCA 4HVGA 2V62A 3QA8A 4J7BA 3Q4TA 4KKEA 4CSVA 1JSTA 4D58A 3V51A 4GV1A 3HDNA 3SAYA 4BI0A 2A4LA 3ZO3A 4EK4A 2C6OA 4C4FA 3RP9A 4G6OA 3FY2A 2QOQA 2WPAA 3A62A 3WF8A 4L8MA 4X2KA 4U6RA 4UZDA 5E1SA 4FSUA 5D7AA 5FEEA 4EJ7A 3RALA 3VBYA 3WZEA 4XBRA 4O38A 3TG1A 1P2AA 3BYMA 4ANQA 3FYKX 3LXNA 4MXOA 4OBQA 2UW4A 5BVDA 5JFSA 4O7LA 2BIYA 3BHTA 4BY9E 4EQMA 3GOPA 5J9ZA 5KX8A 1Q4LA 2JBPA 2IG7A 3QYZA 3C51A 1PXNA 2VWIA 5GINE 4D4SA 3U4UA 1NW1A 4TYGA 2O64A 3EN7A 2AC3A 1PXMA 4YPSA 4AGUA 4QTCA 4C4GA 3G2FA 3AG9A 3Q32A 5CQWA 5HBEA 2ZV2A 4YZBA 5HNGA 3GFEA 3OY3A 4LYNA 2QU6A 4NL0A 4N4SA 2B7AA 4GJ3A 4I6FA 3KB7A 5DR6A 4OAUC 4OTDA 5FG8A 4TY1A 3NAXA 3OT8A 4UY9A 3PVBA 4EHGA 3S3IA 4K6ZA 3FXWA 3KULB 2X7FA 4FODA 2RSVA 1I44A 2OJJA 2YHVA 4GIIA 2B4SB 3DLZA 5L8JA 2HZNA 5B7VA 2X9EA 3EMGA 4O22A 4U80A 2JIIA 3QQJA 3LCTA 5F4NA 5L6WL 3ZFMA 4CTCA 3KF7A 3E3BX 1SMHA 4E73A 4A4LA 4DFNA 3FMJA 3IW5A 3M2WA 2PZRA 1QCFA 2BALA 3EQPA 3OOGA 4QP4A 3GCUA 4YJPA 5LMAA 4UALA 3D2IA 4D0XA 4X3FA 4O7YA 3VS7A 3WF9A 2ACXA 4ZEGA 4YTIA 5CAUA 4DLIA 4RIWA 3OCSA 4ANSA 5IISA 3PY1A 4O96A 4XMOA 4BWKA 3SVVA 2C0IA 4HYIA 5AAEA 4FEQA 3QTQA 3QX4A 3HUBA 4Q5EA 2UVYA 3ORLA 4AA4A 4QD6A 2BDFA 2XKDA 4S30A 4R5SA 2IJMA 4HCVA 5I9VA 4IJPA 3KXMA 3W2RA 3KXXA 4FZ7A 5EM6A 2C3LA 4FZDB 1KE5A 3CD8A 4I94A 4BFMA 2R64A 4QYFA 3ZC6A 3UBDA 4ARKA 2OICA 2JIVA 2JDRA 4YMJA 5J1VA 2PMLX 2Z7QA 4GEOA 4EJNA 4M15A 2OI4X 5HE3A 3UDBA 3AC8A 4NK9A 3TDWA 1OL5A 3R9RA 1XWSA 3Q9YA 4UWYA 3R8UA 4RWKA 3CPCA 5KHXA 5EDRA 1CKPA 2NPQA 3MA6A 3MA3A 3CEKA 4S34A 4F9CA 3LFNA 1J7LA 2QI8A 2FYSA 4BCIA 3UVRA 1SZMA 4M69A 4MWHA 4MBJA 1R1WA 3ANRA 3C4CA 1BL6A 3EB0A 3PXRA 1XH5A 4WSYA 5FP6A 3NAYA 3ZC5A 4QT1A 2F7ZE 5JZNA 5CANA 4F1OA 4F0GA 4HNIA 4BF2A 4DGLC 3QC9A 2F2UA 3O96A 3W10A 4EOIA 1PMVA 2UV2A 1CM8A 4TKSA 1M17A 2OH0E 2BAKA 3VQUA 4ZY6A 3W16A 4NEUA 3SLSA 3G0FA 2V22A 4QMXA 4UYAA 3BYOA 4IAYA 5K0XA 5TR6A 4TWOA 2WHBA 2XBAA 2BKKA 2PYWA 3PTGA 2WMBA 4FTTA 5FTQA 1Q3WA 3FZSA 3PSBA 3L8PA 4GSBA 1CSNA 2XNOA 2EB2A 5LVPA 3CSVA 5CI6A 1OPJA 5EI8A 4ZTMA 3PVUA 4M68A 5KO1A 3FLYA 1OBDA 3R8ZA 1UA2A 5A9UA 1GAGA 5IU2A 4CKJA 1YDRE 2XS0A 4E5BA 3FSFA 5H2UA 2OZAA 2E9UA 4XG9A 5DGZA 5CASA 2B0QA 3BWFA 4D9UA 4OT5A 3SGCA 2G2HA 2HY0A 2ITUA 5HBHA 4NW5A 4TWCA 2ZV8A 5A14A 3Q3BA 3Q9XA 3LW0A 4HZSA 1ZY5A 2ZDTA 5C01A 4A7CA 5J5TA 2GNFA 4PP7A 3NIEA 2VU3A 3ULIA 3BX5A 4JR7A 3RKBA 2XYNA 3GU6A 4J71A 3VRYA 1XBBA 2RG5A 3EQBA 3IPHA 3QCXA 2WU7A 3BPRA 3BWJA 4ZAUA 3OROA 1HOWA 2C1AA 4EK5A 4OTFA 2J5EA 3HUCA 3TM0A 4IW0A 1M52A 4O27B 5CT7A 3RAHA 4ZSJA 3LM5A 3E7OA 4QP6A 2C6IA 2BHEA 2W9FB 2YN8A 4ZJJA 4JT3A 3I5NA 2C5OA 5ACBC 2O2UA 4C36A 3VS0A 3QAME 5IQEA 2XNNA 4PQNA 3THBA 1WVXA 2XF0A 5GJFA 2YJRA 4GG7A 4ERWA 5KKRB 3F3VA 4M12A 2ETKA 1MRUA 4UMUA 3RHKA 1ZZLA 2W1GA 2GDOA 2J50A 3OZ6A 3PPJA 4JBOA 3FQEA 4FEVA 4UZHA 4C3FA 3ZLYA 4JDHA 4ZLZA 1OUKA 5K5XA 3OXZA 2ITXA 2QU5A 4NWMA 4RFZA 2G01A 3HA6A 3BYUA 1UKHA 3QALE 4FSMA 4GT5A 3UNKA 3MB7A 4IJ9A 4H05A 2WIPA 2FB8A 4CV9A 3FKOA 4IMYA 3HX4A 4YNEA 3HMIA 2REIA 4XX9A 5HLWA 3C4ZA 2HXQA 1J7IA 4AGCA 5DWRA 4KBAA 1UU8A 3L1SA 1W7HA 2ETRA 4ACMA 5BVEA 2OIQA 5BVWA 3ACJA 1ZYLA 2KULA 2FA2A 2OLCA 5DMZA 1PXKA 3K3IA 3AT4A 3EQHA 4MK0A 2PUPA 2VWXA 3BLRA 4M13A 3B2WA 3LM0A 5M53A 1XBAA 4O7VA 4QNAA 2XJ2A 4MQ1A 4QPMA 3DKOA 1RDQE 1PKDA 3ENMA 3QRIA 3RPRA 4IZYA 3VS3A 1FGKA 2R3NA 2WTKB 3MYGA 3C4FA 2ITNA 2KTYA 5AP0A 4IVAA 5EHLA 1R0EA 2FO0A 3BU5A 3PRIA 2OIDA 4M97A 5H8BA 1WBTA 4AT3A 2VNYA 2VD5A 3QHWA 2X7OA 3WE8A 4TT7A 3HP2A 3T9TA 3KKVA 1YOMA 2OJIA 2WQOA 2EWAA 3ZS5A 1ZYSA 1A48A 3TV7A 2W1FA 1G5SA 4FMQA 2HXLA 2NRUA 4EH3A 5JQ8A 3V5JA 3QF9A 3I79A 4D28A 4FGBA 2Y0AA 2J6MA 4UMPA 2W96B 4UMTA 4O6LA 3WZUA 3CP9A 5LMKC 4ZMFA 3CE3A 5M06A 4MD9E 3JPVA 4EI4A 4OTGA 4B8MA 5L8LA 4AUAA 1G3NA 2GS6A 4XP0A 3R2YA 3ITZA 1FQ1B 5EG3A 2BAJA 2HZ0A 4FVQA 1QMZA 2JKKA 1HCKA 4R7IA 4Y83A 3ZUUA 2QO7A 3NWWA 4RRVA 5E8VA 5GHVA 3RK9A 2OG8A 4ASZA 4AU8A 5HVJA 4GVAA 3EOCA 5E8SA 5FM2A 3ODZX 3FSKA 5BPYA 1Z57A 5GIPE 4AOJA 2Q0BA 3U4WA 4EKKA 2GHGA 1IA8A 3LJ0A 2QOLA 4IM0A 3UODA 2Y6OA 5AV0A 4V05A 1FINA 3RWPA 4QMQA 3P79A 2P2HA 3R7GA 1W0XC 2YISA 1JLUE 2UVZA 3RPVA 4I5HA 1A9UA 2XK6A 3D4QA 4OTHA 5M4CA 3DPKA 4ZTQA 5BVNA 2B9IA 5HLPA 3W2QA 5IA4A 1OVEA 2P0CA 5DIAA 1V0PA 4ANLA 5IDNA 4AQCA 4FC0A 5IG1A 2WOUA 4FIEA 3OBGA 5AA9A 2X9FA 4JJRA 1PHKA 5ANIA 5DRDA 3ZMMA 3MVMA 4YC6A 4DEHA 1F0QA 3HV3A 2B55A 3DTWA 2FVDA 4QMSA 1OKYA 3ZM4A 3C0IA 4IQ6A 4Z16A 1O9UA 2G2FA 3IW7A 5A6NA 5KBRA 3HV4A 1AQ1A 3I1AA 3NW5A 3O2MA 4I4EA 4AX8A 4GT3A 5CEPA 1ATPE 2OJ9A 4DFZE 4OTQA 3E92A 5HE1A 4ZZMA 2UZWE 2JLDA 3LXPA 3QTWA 4X2NA 4YJUA 1WBOA 2I40A 3ORMA 3N4UA 3VUTA 4L7SA 2PVRA 4ZTNA 4FV8A 4L43A 3AOXA 4C4JA 2OJFE 3CJGA 3G9NA 3GU4A 4ALVA 4BIEA 4F08A 3F3ZA 5AR5A 1YHWA 3REPA 2WMWA 5FQDC 1RW8A 3BZ3A 5K5NA 3JYAA 3PP0A 4FG8A 3O8TA 3C0HA 1LR4A 3KMUA 3HRFA 1GOLA 3QCYA 1JOWB 2WQMA 3FC2A 4ACGA 4O0WA 2H6DA 3D14A 3DGKA 2C47A 3HNGA 3R9NA 4CZYB 2O3PA 3C50A 1ZOHA 3GCVA 2FH9A 4ZJIA 1T45A 2C30A 2EXCX 3UZRA 3L9MA 2PU8A 3LMHA 3TZ7A 1VYZA 5L2TA 3S0OA 4JRVA 2R3KA 5K4JA 2X6EA 2J0IA 1SM2A 3FC1X 4DH7A 4NM3A 4AF3A 4IWOA 4N70A 4GIHA 3C4WA 5HCZA 4Y95A 2R4BA 3QXOA 5TKDA 3BE9A 4AXAA 4J96A 5IUGA 5HVYA 2CNQA 4MNEB 4FNYA 5AUTA 1OPKA 1BL7A 4IEBA 3OUKA 3LZBA 4WUAA 4XP2A 5C4LA 4KINA 4L00A 2Y4IC 3PXFA 3GOKA 3ZTXA 4EOMA 3TN8A 2CN8A 3W33A 2J9MA 4FTRA 4PNKA 4GK2A 3EN5A 3O17A 5BYYA 2WTJA 1UNLA 3BRBA 1OKVA 3QTIA 3LJ1A 3BLQA 2WELA 2FSMX 2EUFB 1NA7A 3F66A 4MH7A 2JAVA 2VTLA 3QD3A 4R1YA 2XA4A 5AV3A 5AR8A 3V6RA 1FGIA 4M8TA 4FSRA 4D1SA 4CKIA 3HMOA 4KB8A 3NNXA 1JKTA 3PSDA 2XIRA 4O7TA 5M09A 4XJ0A 2BDJA 2V0DA 2HWOA 4TNDA 3UO5A 4OR5A 2UZBA 2VTAA 4CQGA 2GFCA 3K5VA 4BDGA 3FLSA 4JS8A 4AZVA 4BDFA 4ORKA 4QMZA 2XNMA 4QMYA 3E7VA 4RWJA 4CTBA 5HNIX 4O82A 1GZ8A 5I9XA 2EVAA 3D7ZA 3JY0A 4NTSA 4E4MA 3C0GA 2UZTA 5HZNA 4QYHA 1B39A 2OH4A 4MD8E 3FZOA 4BDCA 2ZM1A 4QYYA 4TYJA 3GXLA 2E2BA 3JVSA 4IAZA 5DG5A 4WG3A 2IO6A 3R04A 5HD4A 2VTOA 4O86A 3SXRA 5K3YA 2W4JA 4PWNA 2CDZA 2YIYA 3BU3A 4JXFA 4RX8A 3QU0A 5M08A 3A7JA 5D11A 3DK7A 3AC5A 4ID7A 4W4XA 3CY3A 5HCYA 4BDBA 4TYHB 5ACKA 4RBLA 4MXYA 3ZO1A 5DOSA 2BROA 2VTSA 2X2KA 2XP2A 4QPSA 4CYJA 5IA3A 5CWZA 4B0GA 2XYUA 3QZIA 1R39A 1V1KA 3TZMA 5DT3A 4IB0A 1H1QA 1UU7A 3AQVA 4G34A 4FI1A 4LM5A 4YPDA 5EK7A 4FKWA 3FXZA 3TV6A 5LMKA 1ND4A 4LUEA 5E8YA 4DT8A 1ZOEA 4RJ3A 3BHHA 4XV2A 5HEZA 4PTEA 3LLAA 2Y9QA 3L8SA 1Q99A 4XG8A 4XLVA 4I92A 5J95A 2XZSA 3HDMA 3IQ7A 3FKNA 3ORNA 3VUKA 4L52A 4DBNA 1XH7A 5BUEA 3LFSA 1GIHA 1Q5KA 2DS1A 4RIYA 2R3RA 3HMNA 3RM6A 5HU9A 1SNUA 5ICPA 3DFCB 2OO8X 5AWMA 3VJOA 4AE6A 3BV3A 2VO7A 4FT0A 4FVRA 2OJGA 3ZSGA 1ERKA 5GJDA 5JFXA 5E8TA 4QP2A 4GKIA 2CKOA 4FIFA 4DH8A 3DNDA 3NUUA 4V01A 4BDJA 3FLNC 4E8AA 2W4KA 4FTOA 2CCHA 4FKJA 4W4WA 5D1JA 3UPXA 1K9AA 2NP8A 4C8BA 4CFFA 3NZ0A 3DBEA 5AUZA 5T3QA 3ORKA 2OXYA 4H39A 3UTOA 5IF1A 4BBEA 5J87A 4RJ4A 5HHWA 4CRSA 4G17A 4HW7A 2P3GX 3PUPA 4U5JA 3G33A 5EDQA 3UNJA 2W9ZB 4PNIA 3WE4A 3M42A 2ZMCA 4ITJA 4R3RA 5C9CA 3R1QA 4BDEA 4AZWA 1YXVA 1H1SA 3I7BA 4HNFA 5CQUA 2WTWA 4LOPA 4KBCA 5B2MA 4FF8A 4WO5A 5JGDA 2F57A 3U6HA 2YDJA 1OM1A 3FMEA 3OTVA 1GIJA 3MVJA 3GUBA 3DDQA 1JVPP 4X3FC 4LRMA 4G9RA 3EL7A 4C2WA 5IUHA 5KBQA 1BUHA 2F4JA 2W5HA 4X0MA 3AC2A 3DTCA 4KRCA 3RNIA 1WBVA 4IZAA 4USEA 5HIEA 1KV1A 4BGHA 4BTFA 2C5NA 2YLFA 1OL7A 2BFYA 2F9GA 5AR2A 4GL9A 3WYYA 4P2KA 5CAVA 1XH8A 3RMFA 2JC6A 3F2AA 1Q8YA 4KKGA 4FZFB 1T46A 4I22A 3ALNA 3F5XA 4CFXA 3DB8A 3K54A 5KUPA 4HVIA 2QLUA 5AM6A 3QKLA 2W5AA 3PY3A 2UW0A 3OCTA 3PJ1A 5F9EA 3CGOA 1JBPE 2X4FA 2W1EA 3QCSA 4EH7A 4K2RA 3LXKA 3TCPA 5F94A 4ANBA 2BR1A 4WNPA 4E6AA 4CKRA 4FSQA 3FXXA 3W8QA 4O1PA 5ANJA 4DG3E 2GHLA 3V5LA 2XK7A 3GB2A 2R3MA 4GMYA 4BKZA 2OU7A 5I9ZA 3WIKA 4F9AA 1P4OA 2PE0A 3VQHA 4QTBA 4BDKA 4DHFA 5D41A 5IKWA 3TWJA 4BICA 2VO3A 4C61A 5AP1A 4D4VA 4O2PA 4ZMEA 3MPAA 2VTQA 3A8XA 2QO2A 3MPMA 1YDSE 4XG7A 3D2KA 5HKMA 4USDA 5HCXA 5JN2A 1ZAOA 3IKAA 3SHEA 2HZ4A 3NCZA 5CX9A 3TNWA 4YBJA 5EW3A 3SRVA 4MTAA 1KOBA 3C5UA 4EH9A 4NJDA 1KE7A 4K18A 4ONAA 3A8WA 5HE2A 2VX3A 2X2LA 3LVPA 4EOKA 4Z7GA 2X1NA 2VNWA 4DN5A 3HAVA 1Q8WA 4EBVA 1Q97A 5EQEA 2UW7A 3TL8A 3U51A 3GQLA 5AP6A 2BMCA 1H27A 5D9HA 3ZO4A 3EL8A 3ZXZA 4BDDA 3JY9A 4P5ZA 3UZTA 4FKQA 4F9BA 3KRRA 3ORZA 2JFLA 5IEXA 2VTRA 5CSHA 3HLLA 3KMMA 4M0ZA 3QLFA 4FT5A 2AC5A 1LUFA 3HYHA 5J7BA 2JDTA 3RVGA 3OXIA 4N57A 2ITZA 4FKGA 5DT4A 4FV1A 4PTCA 5BQ0A 5JEBA 3FL5A 4B8LA 3IOKA 3QQKA 3NDMA 4F99A 2OFVA 4BTJA 2DYLA 3RCDA 4F9WA 3ZZWA 3MWUA 4IM2A 4JNWA 4IAAA 5FDPA 3PIXA 1W82A 4ZY4A 3R7YA 2YCFA 4QMPA 2HIWA 3TIZA 4E93A 3W2CA 2V5QA 3BCEA 5HIDA 2VTHA 1H28A 2O8YA 3FMHA 3TXOA 3ZU7A 5CZHA 3CLYA 3LIJA 4O91A 4IADA 3CGFA 3R01A 2YM7A 4HVHA 2BVAA 1XH4A 4H36A 4N0SA 4FNXA 4O0UA 4LFIA 4ZS0A 2R3OA 3NVMB 2BDWA 4K33A 3SG8A 2XKEA 2ZB0A 4YZNA 1WCCA 3R00A 1PXPA 4EQCA 5CALA 2JDSA 4Y46A 4RX9A 2UZOA 4BCKA 1TQPA 4X6RA 3CY2A 3O7LD 4D55A 5HI2A 4J95A 1ZYJA 3VUGA 4PMMA 5DVRA 5KMOA 2XKCA 1J1BA 3AC3A 5I9YA 2X4ZA 4KSPA 2WMVA 1XJDA 3U6IA 4YJQA 4G2FA 2XH5A 3CBLA 4FSNA 4FKIA 3RWQA 2J90A 4GJ2A 4JG8A 4TWNA 4FTLA 3IO7A 3UIUA 4O81A 3GC0A 4NYEA 4J53A 4BR3A 4XH6A 4AFEA 2UZUE 2HK5A 3QTSA 3DV3A 2X6DA 4QP8A 4A06A 5HLNA 5KNJA 2FSOX 5B2LA 3U54A 4PL5A 4J8NA 3NUPA 3TJCA 4JBPA 2WAJA 4DCEA 2CN5A 5A54A 3G6GA 3KRLA 4EONA 3FKLA 4DFBA 2LAVA 4LOOA 4IH8A 3CJFA 4EH8A 2HCKA 4J1RA 4CVAA 3F7WA 2OKRA 3ORTA 3CS9A 4HYHA 3BQCA 4PDPA 5EM5A 2QCSA 4E4LA 1UVRA 4RWLA 3P7CA 5G1XA 3FBVA 2BZHB 4XEYA 1M7NA 3MFUA 2QQ7A 4FV0A 4TWPA 2DQ7X 3PFQA 2HY81 3L8VA 2A0CX 3Q5ZA 3LCSA 2VTMA 4TL0A 3EWHA 5TE0A 5J9YA 4J97A 4BCPA 3KREA 4AW2A 5J79A 4NU1A 1CKIA 4H3QA 4I0RA 1H1RA 2WU6A 3R6XA 5IQBA 1JAMA 3V5PA 4D2TA 3FWQA 2E9NA 2W1ZA 5DFPA 3TKIA 2VO0A 4NCTA 3SXSA 3PZHA 2OWBA 4WNMA 4PUZA 3EFKA 3GCPA 3GC8A 1O6KA 2H9VA 2QOOA 3R1YA 3GBZA 4BRXA 2Z8CA 2C6LA 4D4YA 4EZ5A 3MFTA 3ORPA 4U7ZA 1YXXA 5HO6A 4I6QA 2ONLA 4X3JA 3S4QA 4DE4A 5ANKA 1YWRA 5C1QB 3EFJA 4EL9A 3GGFA 5HESA 5CF6A 2VTNA 5AR3A 3R8LA 3RZFA 4K8AA 4Y8DA 3AMBA 1OKZA 1LEZA 4I1ZA 3F6XA 4S2ZA 1IRKA 1M2RA 1MP8A 3OWLA 3MIAA 5CENA 1MUOA 1ZMVA 3VIDA 4BYJA 3RGFA 1V0OA 3PXYA 3R71A 3ACKA 4R3PA 4B99A 4YHTA 4DG0E 4DH1A 4QP3A 3C13A 3Q6WA 4S33A 5AUYA 4FV7A 4I5CA 4PL4A 4AN2A 3FPMA 4F70A 2W1IA 4TNBA 3UO6A 3Q04A 4LV5A 3QTUA 4M67A 4E6QA 3W32A 3ZOSA 4H3PA 4QQTA 5KE0A 3DY7A 5B2KA 4DGGA 5FUTA 3I5ZA 4ITIA 2PUNA 3U6JA 2QR8A 4PTGA 1PRYA 3CQEA 4AACA 2YM6A 4ZIMA 4PP9A 2ESMA 4C4IA 4G9CA 2BRBA 3FUPA 4HZRA 5CF4A 2ITPA 3MN3A 3LFAA 3PY0A 4IWQA 4RGJA 5CI7A 3O8PA 3OWPA 2XM9A 2C6EA 4IC7A 1RE8A 3NUNA 1H24A 1BKXA 4FUYA 4R7BA 4K0YA 3R28A 4IVCA 2GMXA 5EHYA 3MH0A 4AZSA 1CKJA 4RPVA 3LHJA 3PIYA 2A19B 2H8HA 4D1XA 2GNJA 4JBVA 4GFMA 5CEMA 3MH1A 3KULA 3UJGA 5FLFA 4AA0A 5DR9A 4AP7A 4CNHA 4MXZA 3GC9A 2YA9A 3OEZA 4FTQA 1IAJA 3PP1A 3LE6A 3BIZA 4BI1A 3R9HA 3Q60A 3SKCA 4L44A 5HU3A 1JSVA 5LCJA 3G90X 2C69A 4II5A 2QKWB 3H0YA 4XYFA 4FKUA 3FAAA 4MF0A 4EHVA 3QCQA 4YC8A 5AP3A 3R21A 2OF2A 2DUVA 4XV9A 4QRCA 2WIHA 3KCFA 4F6SA 3PJ3A 4BN1A 3I60A 3VN9A 3PIZA 4V0GB 3VULA 2EXEA 3WARA 3CKXA 5L6OA 4V04A 4IC8A 5ANGA 3F9NA 5AX9A 3WBLA 3A4OX 4GS6A 5ETAA 3ZO2A 5CNNA 5IA1A 3UMXA 3VUDA 5F1ZA 4GYGA 4ZTSA 2DWBA 2XMYA 3D9VA 3OY1A 3OTUA 4ZSGA 2E9OA 4E6CA 1KWPA 1Y91A 4TXCA 5AADA 2UVXA 2PE1A 3MV5A 3A60A 3ERKA 1H1WA 4FK3A 5AR7A 5BVOA 3DK6A 1FBNA 5ETCA 1G8AA 3PLAE 4JL9A 3Q6UA 3EKKA 5E90A 2C5VA 2C6DA 3NGAA 5EKOA 3FE3A 4BCFA 3HRCA 2UZVA 3P7AA 3WF5A 4BL1A 4AE9A 3T8OA 4MWIA 1ZMUA 2I6LA 2OK1A 2XIXA 2XM8A 3AGMA 3OW3A 4RG0A 2EXMA 2HW6A 3ZRLA 5KMJA 3PWYA 4GFGA 2GHMA 3A7FA 3F3WA 5HO8A 3PJ8A 4AAAA 5GZAA 4IHPA 4I23A 2UW3A 3N4VA 5DHJA 3DCVA 1OGUA 2WO6A 4L9IA 3MY1A 2I0EA 3A99A 4IBMA
chains in the Genus database with same CATH superfamily
2WMTA 3IDBA 3E3PA 1GIIA 2VGOA 3HZTA 3O50A 5FWKK 2BUJA 2PVYA 2YM8A 4CV8A 4UMRA 4I6LA 3VO3A 1Y8YA 3BYVA 4AAYA 4MHAA 4GUEA 4ZS4A 3TEIA 3QWKA 1JKLA 3DBFA 3KGAA 4EK3A 3JUHA 3FMDA 4EQUA 5CF5A 3AD5A 4X2GA 2C5XA 2VRXA 4B4LA 1JWHA 4FEUA 3ZFYA 2V7AA 3NFGB 2C5YA 2IVTA 2IWIA 2GQSA 3AGLA 3V8TA 1DAWA 2PVHA 2W4OA 4TZRA 4N6YA 3KXNA 3FYJX 4EHZA 3MW1A 4EZ7A 5FXSA 3W0QA 2QODA 5I9UA 1ZLTA 4F78A 5CVHA 2UZNA 3UZPA 1O6YA 2SRCA 4PDSA 1OECA 2VX0A 5C26A 5T6KA 4O7NA 4BWPA 4RC2A 3ROCA 4CFNA 3ZSIA 3FMLA 3U87A 1L8TA 3I0QA 2H96A 3KN6A 5DN3A 4ASDA 2XANA 4QQJA 2JIUA 2QG5A 3O0GA 4BCOA 3F5GA 4IIRA 4R8QA 4Z9LA 2OF4A 2IW9A 4CMOA 4EK8A 3UE4A 4ZTLA 4DF3A 4C34A 2XCKA 1PKGA 3VBVA 1UNGA 1XH9A 4BGGA 5J5SA 4NKAA 4O0YA 2CGWA 4JIKA 2FSTX 2B9JA 3Q96A 2RL5A 5EI6A 3EH9A 4S31A 3I4BA 3R9OA 4DH3A 5JSMA 5H9BA 4FA2A 4DBXA 1UWHA 3KQ7A 4KIKB 4FTMA 2Q83A 2PMNX 2PVFA 3FHIA 3QXPA 3DAKA 1CTPE 3EHAA 3V8SA 1RJBA 4WUNA 1PYXA 4O7RA 1WZYA 2IZTA 4G31A 4L6QA 3G9LX 4CYIA 3KK8A 3U55A 4S32A 4RVTA 3AC4A 4CQEA 4FIIA 2GNLA 1UWJA 2UZDA 5CSXA 1J91A 4PMTA 3KA0A 4JIAA 3UP7A 5KMKA 2WQBA 3QZGA 4WBBB 5M55A 2PVJA 4QTDA 4CD0A 3V5WA 2G9XA 3ZXTA 2VTIA 4JAJA 5FXRA 2BZIB 3HMMA 2GTMA 3AD6A 3PYYA 5HX8A 1KE8A 2XNBA 3VC4A 5C8KA 2WEVA 1MRVA 4O4CA 2JEDA 3ET7A 1YKRA 2X8EA 3GNIB 4FSZA 4P5QA 2RGPA 4ASEA 3HKOA 1SVEA 3FI8A 3UYSA 2JITA 5JQ5A 4OTWA 3R9DA 1B6CB 3DKFA 3MH2A 4YO6A 3TKHA 4ZP5A 1Q8UA 5CY3A 4DFUA 2Z7SA 4NTTA 4U8ZA 1OI9A 5FP5A 4CRLA 5I0BA 3OT3A 3TIYA 4ANOA 4JQEA 3KU2A 4FIJA 5FTGA 2F49A 5K4IA 5HTIA 3HECA 2BRMA 4K9YA 4BZNA 4A9RA 4XP3A 1ZOGA 3KCKA 3AT3A 4G6LA 1OIUA 4PPBA 2RKUA 2WMAA 5E8ZA 4UWBA 4CMUA 2ERZE 1VJYA 4AGWA 3FMMA 2W17A 4G1WA 2B9FA 1REKA 5AM7A 3TV4A 2OIBA 5CXHA 3DAEA 3FY0A 4XLIA 4YZMA 4XRLA 4FIGA 4MXCA 4O83A 1JKSA 5A4LA 1OB3A 3RHXA 3LQ8A 3LKMA 1W83A 4GRBA 4D9TA 4KS7A 4WG4A 5HTBA 2XKFA 3BKBA 4FTAA 4CFMA 4R5YA 2ZOQA 4A4OA 4Q5HA 2I0YA 3IS5A 2G15A 4O0VA 2HENA 3T3VA 1J1CA 3ZONA 5AEPA 5AIKA 2QOIA 4G5JA 5LJJA 1PXLA 3MBLA 4IZ7A 1EH4A 5AAFA 4L3PA 3PDTA 3SA0A 4FSWA 2QOKA 3ZLWA 2HELA 5HIBA 4MBLA 5CEQA 4FR4A 4CG8A 3VNTA 4PL3A 3OD6X 4YC3A 4FT9A 5L4QA 3SC1A 4DCAA 4EBWA 1GY3A 4YURA 5LVLA 3LCKA 2QR7A 2QHNA 2XB7A 3BLHA 3HEGA 4LMNA 3LFQA 1JSUA 4P4CA 1NT2A 1KE9A 1YHVA 2PY3A 2WD1A 4FUXA 4LOQA 3R7VA 3S1HA 4OBPA 3EJ1A 4FTIA 1CMKE 1URCA 5AP7A 3CCNA 3H30A 2I7QA 3Q52A 4XS2A 1XH6A 1IASA 3WF6A 1ZYCA 4BDHA 3SQQA 3HV6A 4R78A 3SV0A 4CEGA 2R3JA 2YCQA 1H4LA 3PG3A 1V0BA 4KWPA 4ANNA 5J9LA 4WRSA 2R9SA 4Q9ZA 4DLJA 4JI9A 4G3GA 4RMZA 2QHMA 5KZ0A 5BYLA 1R0PA 2XBJA 2ZM3A 3PJCA 1BYGA 3HVCA 4FYNA 3RK5A 3NUAA 3VUIA 2HW7A 3DXQA 2BFXA 4TW9A 2ITWA 3MY5A 4JQ8A 3QQHA 4EKLA 3DFAA 5CAOA 1GZKA 4L01A 4M7IA 5I3OA 2JKQA 4YHJA 4NIFB 3KF4A 1Q24A 4D2RA 1A06A 3QBNA 4ZSEA 3ZSHA 4BDAA 4XG4A 3UYTA 3WZKA 3OP5A 2BPMA 4RLKA 3NW7A 4FG7A 4O4DA 3I7CA 4O21A 2R2PA 4YZCA 2GNIA 4EOLA 4LGDA 5HOAA 2Z02A 3BL7A 1XHAA 3MS9A 2W1CA 3MTLA 3VS4A 4YJRA 4NJ3A 5CF8A 3D5VA 3R02A 1WBSA 1YI3A 3E93A 1WBPA 2XIYA 3UQFA 3ZM9A 3TI1A 2I0VA 4YSJA 3O71A 5IA2A 3KRJA 3MGYA 3TZ8A 3D83A 4IX3A 3A61A 2GCDA 4RT7A 3HAMA 4MX9A 2XEZA 4FV4A 4LL0A 1PYEA 4ACHA 5DA3A 4USFA 4WT6A 3AC1A 2VWBA 3E8DA 5F20A 4KIOA 5IUIA 2R7BA 3Q4ZA 1M2QA 3PXQA 3WILA 5CSPA 3HP5A 3P4KA 5I5ZA 2A2AA 5CXZA 3QD0A 4W8DA 2UW9A 2WMXA 4MCVA 2Y7JA 2B54A 2BHHA 1H01A 3QKKA 4F6UA 3OCBA 4YO4A 3MPTA 3NIZA 5JH6A 1ZMWA 4TN6A 4AN3A 4L42A 4MXXA 4EUTA 5AAGA 3JVRA 3DB6A 4MNFA 3K5UA 3N9XA 1BI8A 4A9SA 3PSCA 2J2IB 4FVPA 3SOAA 4IX5A 4ITHA 4C57A 3E8EA 4CLJA 4FE2A 4L3LA 3RPYA 5M57A 4FEWA 4IB1A 1W98A 3W2OA 4ALUA 4MBIA 1AGWA 5DNRA 4QTEA 4YTCA 2R5TA 2HOGA 2OGVA 5DPVA 5FD2A 1H07A 2BILB 4Z7HA 4XCUA 2GQRA 4GKHA 3GU5A 5CYIA 5L2QA 4FSTA 4QP9A 5IQGA 5AMNA 4KBKA 3IDPA 5I9WA 4MNEA 4KRDA 3MJ2A 4E4XA 5TT7A 3G6HA 4U97A 5D12A 3FZ1A 3VUHA 5EHOA 2PZPA 3HGKA 2OBJA 3AMAA 3QUDA 4FT7A 3KXHA 4RJ5A 1Z9XA 4JG7A 2OFUA 4FKOA 3E8NA 5CSWA 5E4HA 2YM5A 4KUJA 5CEIA 5EH0A 4YJNA 4HVSA 3EN6A 1Q3DA 1YI4A 4KD1A 2YITA 4C02A 5AX3A 3V6SA 4NUSA 3CKWA 5CU6A 4A9TA 5DEYA 4AW1A 4FTNA 1UKIA 2QOCA 2WB8A 5LVNA 4K77A 2YIQA 3NCGA 4RJ8A 4E1ZA 3ELJA 3PXKA 4I5PA 4DAWA 3VS1A 5EKNA 3NYXA 1BI7A 4NCTC 2OW3A 5DBXA 4A9UA 1MQBA 4FOCA 2GSFA 2YIXA 3DK3A 5EQYA 5EYCA 3LQ5A 3KIOC 4H1MA 3UP2A 4FZ6A 2ONLC 3E87A 1O6LA 4HCTA 3WI6A 1U59A 3G0EA 4ZZOA 3H10A 1ZRZA 5KZIA 5JGAA 2PULA 3W18A 2YAAA 2CLQA 2VWYA 4OBOA 4NM7A 1YDTE 1F3MC 3CXWA 3MIYA 4J8MA 4KSQA 4Y73A 5BVKA 4QPAA 4E26A 4EH4A 5AV1A 3FZRA 3L8XA 4O0TA 4YUQA 2W05A 4EEVA 2Y4IB 3TUBA 1VEBA 1H8FA 4HJOA 4FTJA 1NY3A 3P9JA 4PY1A 3F3TA 3QHRA 4QMVA 3RZBA 4TYHA 2NO3A 4DEBA 1K2PA 5CNOA 2ZYBA 3EZRA 3QTRA 4ZTRA 5HE0A 5IQDA 1JQHA 1Q41A 1REJA 4NW6A 4RSSA 5JGBA 3Q9WA 2P2IA 3DZOA 5LQFA 1Y6BA 4G3EA 4U41A 4IDTA 2NYAA 1DS5A 4NM5A 4FBXA 4HGLA 3CIKA 4D1ZA 4F9YA 1ZXEA 3DXPA 2JDVA 3E62A 3FHRA 4WA9A 4Y5QA 4YJVA 4IFCA 5AP5A 3W0NA 3P86A 1CDKA 4QYGA 3GC7A 3NYNA 3ZUTA 5JZJA 5IMXA 2WTDA 4EWQA 1L3RE 3E63A 2R3FA 1U54B 3BHUA 3D7TB 4LMUA 2HAKA 3OCGA 3FLZA 4IM3A 3EN4A 5A3XA 1PMEA 2ITTA 1S9JA 3WOWA 3UOKA 4QMNA 4ANMA 2ETMA 2WEIA 4CMTA 4LG4A 3CTQA 4JG6A 3OG7A 4D5KA 3RCJA 4FYOA 4WIHA 3O23A 5KMMA 1H25A 3B8RA 1KE6A 4I20A 3R63A 3QLGA 4RIXB 3BQRA 3EQGA 3LPBA 3DLSA 3Q53A 5H3QA 3MI9A 2BRNA 3HV7A 3T3UA 4CZUA 4EYJA 3NW6A 5HTCA 3BGZA 4AW0A 4OT6A 4OAVB 3KN5A 3PA5A 5GJGA 2WMQA 2YZAA 4RQKA 3UOJA 4GYIA 3C9WA 5ETIA 3SW4A 2QURA 2WTCA 5D7VA 5A4CA 2XRWA 3DJ7A 3EQFA 3FMKA 1W2CA 3POOA 4BZDA 1STCE 3OWKA 3NNUA 3LJ2A 3COHA 5FGKA 2O5KA 4EH2A 2J4ZA 3H3CA 5FXQA 3QQFA 2PUIA 3OWJA 1OPLA 2CHLA 4JDIA 2BZJA 1U5RA 3O8UA 2CKEA 4Z3VA 3EQDA 2F2CB 1MRYA 4DHJA 4OW8A 4AOIA 2VTJA 4BVUA 4C38A 5HG7A 5M4UA 2PVLA 5DLSA 4O6EA 4BHNA 5AV2A 1DAYA 3QQGA 3R7OA 3QRTA 2RF9A 3UG2A 4X2FA 5A4QA 2PMOX 3HMPA 4Y72A 1DI9A 4DEGA 1B38A 4MKCA 3GCSA 4ALWA 2PHKA 5TO8A 1BMKA 2W5BA 3GVUA 3CQUA 1H00A 3I6WA 1AD5A 3CD3A 3QKMA 2B9HA 3KXZA 5CAPA 5L2SA 2FSLX 3BBTB 4FKLA 3UG1A 2I1MA 4NFMA 4UX9A 2R3GA 4RVKA 4YGAA 3NEWA 3II5A 1GZNA 2Q0NA 4JLCA 5FEQA 2J0JA 4FTUA 2R3LA 4DEIA 4MYGA 4B9DA 3P5KA 1OITA 2J5FA 2Y6MA 3NSZA 2PSQA 1XKKA 1TVOA 2PVKA 2QO9A 3ENHA 1GNGA 3M11A 4WNOA 4RA4A 5JT2A 3QA0A 4B6LA 4RZWA 5ANEA 4CLIA 3I0OA 5FBNC 5GZ8A 3QGWA 3ZBXA 3F3UA 4Y85A 4D5HA 3NLBA 4GU9A 4X3FB 3ZUVA 3W55A 1WBNA 3QUPA 4FV5A 2YCRA 4FG9A 3VRZA 4RIWB 5EOLA 4NKSA 4AZFA 4G3FA 3NMUF 3NRMA 2CNUA 2VWZA 1FOTA 3E5AA 2CMWA 2YDIA 1E1VA 2A98A 5AIRA 3VONA 4U9AA 4F4PA 1H1PA 3W2SA 1YHSA 4TRLA 3Q2MA 5CU4A 3DA6A 3ID6C 4XRJA 4I93A 4ZY5A 5TOZA 4EOQA 5BUJA 4IZ5A 4EH5A 3FJQE 4F64A 2BCJA 2JGZA 3OXTA 2C6MA 3FV8A 3POZA 3DXNA 3QX2A 4YJOA 2Z7RA 3PVGA 5EFQA 5IEVA 3TNQB 3RAKA 4APPA 3BEGA 1KOAA 2VGPA 4IANA 3LFDA 2C0OA 3L9LA 4ENYA 5LOHA 2WGJA 4IXPA 1QL6A 2J0LA 2YABA 1PF8A 5L6PA 2O0UA 3F2NA 4YNOA 2P4IA 4M69B 4QP1A 4W9XA 3TNIA 5A6OA 1PW2A 5EYMA 2ZMDA 5E8UA 2PVNA 1OIYA 2OXXA 3B2TA 3R1NA 4LI5A 3V5TA 3LMGA 4D2WA 3MTFA 1FVTA 2QLQA 4L53A 4WSQA 3ZDIA 3F5PA 3S00A 4FNZA 4CGAA 2YERA 3TT0A 2PZIA 3R2BA 3NS9A 1Q8TA 2ZM4A 1PXIA 4HOKA 3LXLA 5K9IA 1I09A 3V3VA 5FBOA 1WVWA 2YLEA 3D5UA 3DBQA 3IW8A 4XHKB 5C27A 2JDOA 4PDOA 1IR3A 5ANOA 1OBGA 1G8SA 4EOJA 1J7UA 2CGUA 3SXFA 4QP7A 2ITOA 4EC9A 3MSSA 5M56A 2XALA 5AUUA 4DEDA 3LMIA 3VBXA 3NYOA 2VTPA 2CLXA 1DI8A 4YHFA 4PDYA 2Y4PA 2Z60A 5KKRC 4HPTE 2P33A 3AMYA 1PMUA 1WBWA 2C6KA 2XNGA 4O1OA 3UNZA 4WHZA 2ZV7A 4I0TA 1SVHA 4AT5A 2C3IB 2YDKA 3RJCA 4FL3A 1UU9A 4WBOA 5CU2A 3R30A 4DINA 3GT8A 3MY0A 5IH6A 1Y6AA 2OZAB 3SX9A 3TNHA 3UMWA 2VO6A 3UO4A 4IX6A 1YQJA 3FLWA 4NM0A 3UPZA 3W8LA 5HGIA 2ZB1A 3UC4A 3BLAA 3QQLA 2PK9A 3ZBFA 1P14A 4EK6A 2IPXA 5G6VA 3O5AA 2B53A 4IAKA 5B0XA 5IDPA 4BGQA 3OOMA 4QTAA 3KMWA 5AR4A 3BYSA 5LMBA 2EB3A 1YOLA 4RWIA 1R78A 3UVPA 2Y8OA 2W7XA 4AZEA 3QZFA 4P7EA 3BGQA 3ZH8A 4DTAA 3VBTA 2IZRA 4QEBA 3E8CA 4FK6A 2WTKC 4TPTA 2WMRA 3UQCA 2XAOA 3DDPA 2OSCA 3GEQA 3OEFX 4L67A 3FQHA 3L9PA 1Q61A 4R1VA 5CSVA 1UU3A 3EN9A 3NX8A 5IQIA 1VYWA 1XQZA 3KEXA 2X0GA 4OGRA 5CT0A 5LCKA 4BC6A 5IQAA 2QKRA 3DQXA 2E9VA 4G6NA 4OTPA 4RIOA 3PLSA 2ZAZA 2YACA 4O0XA 2PZ5A 2RIOA 4DTKA 2AUHA 4QO9A 4AXCA 4FRFA 3ZLXA 1NVQA 2X0OA 5H8GA 4ZSAA 3MB6A 3F61A 3VWAA 4BIDA 1TQIA 4AWIA 1ST0A 1JNKA 2WMUA 2WQNA 3WYXA 4O0RA 3U9NA 4YTHA 5AP4A 4ZK5A 4D4RA 1E1XA 4XUFA 3PZEA 3G5DA 5IZFA 5EQPA 2QD9A 3DJ5A 3QRUA 3EQIA 5L2IA 3LCOA 1YOJA 4RZVA 4UBAA 5BMMA 1PXJA 1TZDA 1VZOA 3BU6A 3BBWA 4DITA 5EM8A 5H8EA 1SVGA 3ZEWA 3JS2A 5LWMA 2JBOA 4P90A 3SW7A 4C35A 4BZOA 4YLLA 1XMLA 4FKPA 4MQ2A 4LV8A 2ITQA 3FI2A 4KKHA 1IAHA 4Q2AA 3RNYA 4UN0C 4G3CA 3QYWA 3W0MA 5HD7A 4DG2E 5LXMA 5E91A 2GS7A 1W8CA 4GW8A 4DFYA 3C5IA 4FGRA 2O63A 2CSNA 2VUWA 1S9IA 4UWCA 4IVBA 5HX6A 2HWPA 2J0MB 4EWHA 2BTRA 2VAGA 4CT1A 3VBWA 4O0SA 4C33A 1H08A 3OVVA 1Q8ZA 4BJJB 5E8WA 2UW6A 3GQIA 3UIBA 4HPUE 3OF0A 3Q9ZA 1IEPA 5CZIA 3VF8A 2JKMA 4BI2A 1H0VA 3IONA 4QMWA 3UIXA 4X7QA 1Y57A 3H0ZA 3VBQA 3LLTA 4E20A 4QMUA 2C4GA 1J3HA 1APME 4IAFA 4OLIA 4CFVA 2NNWB 2J0KA 4BTKA 3KFAA 4BB4A 2C6TA 4OTIA 4KIPA 5CS6A 2ITVA 4UEUA 4O2ZA 1OL1A 3LAUA 2P55A 3KK9A 4W4YA 2F7XE 4UYNA 5JRSA 3IOPA 5LVOA 1SYKA 3IGGA 4FL1A 1KSWA 1U4DA 3NUYA 2C0TA 4PRJA 3QD4A 3JXWA 4GFOA 5BYZA 3W2PA 4CCBA 3OBJA 4FEXA 3UDZA 3DQWA 5M51A 3ETAA 4LQMA 1ZY4A 4EHEA 4XOZA 4ZJVA 4YJSA 5FEDA 4BDIA 2PUUA 4BHZA 4UXQA 4MD7E 3VHKA 2AYPA 4Z55A 3FEGA 2ZJWA 1OIQA 1QPDA 2BZKB 3EFWA 1U5QA 3TNPC 3M1SA 4XG6A 3UC3A 3V01A 4MVFA 1JPAA 4L3JA 4YLKA 5GNKA 4DGNA 5AA8A 4A4XA 1K3AA 3JR1A 4U45A 1YW2A 2HZIA 2R0UA 3WF7A 3QD2B 1OZ1A 5HVKA 4V0GA 2R3QA 4O7SA 3EIDA 1YXSA 2W99B 4K11A 2G1TA 2UUEA 3MESA 3P5JC 3NUSA 4OUCA 4BBMA 4KABA 3Q5IA 1LEWA 3H9RA 4E3CA 4JX7A 3DT1A 3A7GA 3F82A 4NT4A 4E6DA 5BVFA 3PE1A 5JMSA 1FMOE 3R83A 3BV2A 1OMWA 4KAOA 4WD5A 4DA5A 1LP4A 4WKQA 3R22A 3MDYA 4DGMA 1ZWSA 4FV2A 2CCIA 4DFXE 4IB3A 4BCJA 4XOYA 2VN9A 4H58A 4U43A 4I0SA 3LQ3A 5EM7A 4YU2A 4FTKA 4I4FA 4F09A 1OIRA 4JBQA 2XEYA 2XVDA 3LOKA 4IDVA 4WNKA 4U81A 4RX5A 4HYSA 3TACA 2CNVA 3FLQA 4BYIA 5I4NA 4UMQA 1ZARA 3B8QA 4AT4A 1IG1A 1E9HA 3LFFA 2B52A 3KVXA 4H3BA 1U46A 1PXOA 3EKNA 4PF4A 5FRIA 1FVRA 4PV0A 2CPKE 1P4FA 5AJQA 2X81A 4F0FA 4IFGA 4CCUA 3R8MA 5M44A 2I0HA 2VZ6A 2BRGA 3EQCA 2IW6A 4U79A 3ZLSA 1YI6A 4IAIA 4YR8A 3ZEPA 2YIWA 2R7IA 2J51A 2WKMA 4OTRA 5C8MA 5C4KA 3CTHA 4BCHA 4MF1A 2CKQA 4R3CA 3BEAA 3T9IA 5HG9A 3HRBA 5DI1A 2VWVA 3GI3A 4FKSA 4M84A 4APCA 2YWVA 4RC4A 5HNBA 3ZFXA 5TF9A 4J52A 2RG6A 5EW8A 3QGYA 4AS0A 3P7BA 5HORA 2VTTA 4DDGA 4DHIB 5IH4A 3I6UA 2XK8A 4FX3A 2IVSA 3COKA 5M4IA 2XAMA 3C7QA 4F1MA 3NFFB 5L3AA 3D5XA 3A2CA 3DAJA 3PE2A 4FL2A 4TTHB 3ZRKA 4PX6A 3ZCLA 3RTPA 4QYEA 1FPUA 3RK7A 2X8IA 4XG2A 1TKIA 2FGIA 2YCSA 5EYKA 4F63A 2R3HA 4LRJA 3ANQA 3QUEA 3ROYA 1GJOA 4I6HA 4YP8A 5A4TA 5IA0A 3EZVA 4MXAA 1WMKA 5IQFA 3NPCA 5E92A 3K3JA 3P23A 3IG7A 5BNJA 3LFEA 3KY2A 4GK4A 1YXTA 2YFXA 4AG8A 4EH6A 3ML1A 4RFYA 3L9NA 3I81A 4IB5A 4KIKA 4BBFA 5ETFA 4D2PA 3LFCA 4E5WA 3PVWA 4U40A 2CKPA 2OXDA 1VR2A 2W06A 4BCNA 5J1WA 3QRKA 5M4FA 1KUTA 4YZ9A 4AXFA 4DEAA 1WFCA 3CR0A 3D94A 2JD5A 5LARA 3Q4UA 5CTPA 3ORIA 3UIMA 1W84A 3D0EA 3TKUA 5FDXA 4BWXA 4E5AX 3Q4CA 2ZDUA 1OGYA 4JDKA 4L46A 5KMLA 4J99A 2R3PA 3R7UA 3WZJA 3LFBA 3QQUA 4FKTA 4DGOA 1H0WA 3VVHA 3S2PA 5EDPA 2C68A 3F5UA 2W1DA 2YIRA 2VWWA 3QRJA 3GENA 4PMPA 4F6WA 2CJMA 1XBCA 5A4EA 3MFSA 3GFWA 4XBUA 1M14A 3D5WA 3KVWA 4AXDA 4GCJA 2RFDA 3ALOA 4I5MA 3IK3A 3RM7A 2GFSA 4IE9A 3IECA 2QNJA 3SG9A 4QMOA 2PVMA 2XK4A 3COMA 3HL7A 3C4XA 4CXAA 5E9EA 1IA9A 3C1XA 3V5QA 1UV5A 4EYMA 5AV4A 3R7EA 4EOSA 5DR2A 4EC8A 1XR1A 4N6ZA 2GTNA 5IEYA 4F7SA 3SD0A 4O7ZA 1Q62A 4H1JA 3PJ2A 3K2LA 1NVRA 5KCVA 1GZOA 1H26A 2XIKA 3E88A 4FTCA 2X8DA 4FIHA 4IVDA 2GNHA 4O84A 2ZVAA 5IH5A 2LGCA 4LGGA 4BCMA 2R0IA 1G8KA 4RIYB 4DT9A 2WOTA 1FVVA 1MQ4A 3NR9A 4CT2A 5BMSA 5KHWA 3F2RA 4DTBA 3TUCA 3CC6A 5J7HA 4PPAA 4RQVA 1XO2B 3G15A 5E8XA 4BKJA 3VW8A 3TUDA 4FV6A 4FV9A 4BKYA 3VS5A 4EOOA 3P0MA 2W1HA 1TQMA 3QFVA 2O65A 5DH3A 5IQHA 3BI6A 1PMNA 2PE2A 5ITAA 3OS3A 2YZLA 3UOLA 2EU9A 3OFMA 5D10A 3ATSA 5CVGA 3PPZA 5DE2A 4EZ3A 4ZLOA 2XUUA 2XK9A 5BX0A 2WZJA 3GP0A 3A7HA 3R0TA 4NH1A 4B7TA 3IW6A 3S95A 2WMSA 4G3DA 1ZZ2A 5HG5A 3VJNA 4DYMA 4CFUA 5GZ9A 3PA3A 4YSMA 5IQCA 4U3YA 3PG1A 1YVJA 4RC3A 2QG7A 3OW4A 3UQGA 4YZDA 4HVDA 3QC4A 3F69A 3RAWA 1UNHA 1W2FA 4HCUA 2GS2A 5AP2A 3R8VA 4ZSLA 4F7LA 5CEKA 5KMIA 1R3CA 3FQSA 4PPCA 4E7WA 4L7FA 4C37A 5KMNA 2RFEA 3UGCA 2G2IA 4QMMA 5HICA 2R3IA 5M07A 2V55A 4AN9A 4RA5A 2XCHA 4U3ZA 4ZOGA 1M7QA 4FOBA 2W0JA 2X0PA 4IWDA 3NVKI 4BIBA 4FICA 3R7IA 3RINA 3FZTA 3COIA 3FZPA 3UDTA 5L2WA 4TYIA 2UZLA 4CZTA 2WTIA 4W8EA 4YBKA 2CGVA 4JDJA 5CEOA 5FM3A 3R73A 3VUMA 2IZSA 3PA4A 4YTFA 3NNWA 2BAQA 5L8KA 3DNEA 5CU0A 4LL5A 4I21A 3VW6A 3ZHPC 4AZTA 4UV0A 1PJKA 4JX3A 4C3PA 3Q2JA 3MH3A 2ZV9A 1OL2A 2XJ0A 4W4VA 4NIFA 3ZDUA 2WQEA 4ZXTA 3SOCA 3GU8A 3MFRA 1OKWA 4JRNA 3F7ZA 2YAKA 4BCQA 4C0TA 3BHYA 4ACCA 1NVSA 5ANDA 4GVJA 1OUYA 4XNEA 2VX1A 2RFNA 4GU6A 4RVMA 3KL8A 2VV9A 4NZWB 4XG3A 3RI1A 2HYYA 2IN6A 5JRQA 4JQ7A 3CTJA 4EUUA 1RQQA 3HA8A 4U44A 3WZDA 3P78A 3PPKA 3CQWA 4FKRA 4L68A 3VF9A 1NXKA 4C3RA 4XV3A 5DT0A 4K1BA 4C4EA 3A7IA 1P5EA 4R77A 3AD4A 2B1PA 2IVVA 3EYHA 2J7TA 3LCDA 4FKVA 4JVGA 3UOHA 2E9PA 1WAKA 5J8IA 3VS6A 2IW8A 2QVSE 3C4EA 5T68A 3SRVB 4F1TA 2PPQA 5CLPA 3D15A 5E1EA 3N4TA 5DRBA 3DKGA 2VWUA 2QC6A 4LRKA 4RJ6A 3P08A 4RLLA 4AQKA 2WNTA 2YM4A 4WRGA 2BIKB 3QZHA 2QOFA 3N51A 5EW9A 3RBWA 5HO7A 2H34A 4R7HA 1KV2A 4LUDA 4IACA 5K0KA 1X8BA 3TTIA 4W9WA 4RFMA 4ERKA 4M0YA 3QWJA 4NFNA 4NSTA 5JK3A 4C4HA 3BGPA 4JOAA 4BCGA 4AOTA 2XK3A 1WVYA 4HGEA 5CU3A 2ITYA 2RFSA 1QPEA 1LPUA 3U8WA 4D2VA 5FTOA 2XIZA 4E4NA 4A07A 3V04A 4EORA 3A4PA 3ODYX 3QTXA 4QOXA 4I24A 4QMLA 3OHTA 1JKKA 2GQGA 4I6BA 4RJ7A 4GT4A 4IWPA 4U0IA 4YLJA 3V8WA 4L45A 5CVFA 4D0WA 4F65A 4BTMA 3G51A 4QQ5A 3ORXA 2XNPA 2YM3A 4QQCA 2C1BA 2WXVA 2OZOA 4FT3A 2GU8A 3KRWA 4GH2A 4DH5A 2YJSA 2PL0A 4C59A 2JKOA 3FI4A 2PMIA 3ULZA 3TJDA 4ZLYA 1Y8GA 5JFWA 5HG8A 2Z2WA 5AFVA 5BUIA