3HVFA

X-ray crystallographic structure of ctx-m-9 s70g in complex with hydrolyzed benzylpenicillin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
263
structure length
263
Chain Sequence
QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDERFPMCGTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTMTLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDPRDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTAGDKTGSGDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CTX-M-9 extended-spectrum beta-lactamase
publication title Structural insights into substrate recognition and product expulsion in CTX-M enzymes.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 95
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3hvfA00
1L0FA 3NCKA 1S0WA 2PU4A 1S6RA 1DJBA 3MFDA 4KZ6A 3HLFA 5U47A 4RX2A 2IWCA 1DY6A 2CC1A 1HTZA 4WM9A 2ZC5B 1U60A 1SDNA 1ERQA 4QU3A 5DF7A 3UN7A 3HBRA 2ZQDA 1JWPA 5F82A 4BENA 1BULA 1JWZA 4KQQA 3C5AA 5CEDA 4ZDXA 1VM1A 1W79A 2WKEA 3UE1A 1BSGA 4L0LA 1RGYA 4N92A 4OOLA 4MBKA 2R9WA 3VOZA 5HAQA 4OLDA 3CJMA 3W4QA 5A92A 5A93A 4OPQA 4Y7PA 3IXDA 1ESIA 5GLDA 2XF3A 2DCFA 3LO7A 1Q2QA 5CGXA 3IXBA 5HW3A 4HBTA 4D2OA 3IWIA 5FI6A 4EBLA 1XX2A 4B4ZA 1EI5A 2OLVA 1PW1A 3HLGA 1BLSA 4DF6A 1K25A 1GHPA 2V20A 5F1FA 2HDRA 5GLCA 1H5XA 4CPKA 4U0XA 3MZDA 5EVLA 4E3LA 2EX8A 1PZOA 1K57A 4PPRA 3N6IA 4R23A 3VMAA 1H8YA 3G32A 4MBFA 4E3MA 2Z2LB 4GD8A 3GMWA 4OPYA 2BLSA 1PYYA 2ZQ9A 3W4PA 2WKIA 3CG5A 4LCMA 2Y2KA 5CGSA 2C6WB 3ZNTA 1EWZA 4QY6A 3G2YA 2IWBA 2V2FF 4QB8A 2Y4AA 3A3JA 1JTDA 2EXBA 1O7EA 4JKTA 2WKHA 1E4DA 4LCLA 1TVFA 2H5SA 2A49A 1JVJA 4XXRA 4GB7A 2XK1A 4CJNA 3C4PA 4RX3A 1NY0A 4PM5A 4NETA 4JXGA 1XGJA 1YLPA 3PBTA 1ESUA 1M6KA 3UPNA 5HFOA 5CRFA 4R4SA 1K57C 2WUQA 4EUZA 1FQGA 4K0WA 3I7JA 5JYPA 2H10A 2ZQ8A 2Y91A 1NZUA 3HLWA 4U3TA 5CHUA 5DVAA 2Y2JA 2HP9A 2DRWA 2ZMAA 1ZG6A 3CMZA 4N1XA 4S2NC 4IVIA 3D4FA 1NYYA 4PM7A 5FSRA 1RGZA 3O86A 4KZ7A 3VSKA 3ZVTA 4JPMA 1GHIA 3IF5A 3ITBA 3FKVA 4UAAA 4OP5A 3UE3A 2Z2MB 1PIOA 4O7DA 4GNUA 5IHVA 2Y59A 1DJCA 1YT4A 1ALQA 4JXSA 1N9BA 5EPHA 5FATA 3S1YA 5EUAA 3MXRA 1AXBA 2ZJ9A 4NK3A 5DTSA 4GD6A 4ZBEA 1ZKJA 3IF6A 2GDNA 4KZ3A 4S2LA 1H8ZA 1M40A 3C7UA 4DKIA 1MWUA 3ZGAB 3Q7ZA 1BUEA 3E2LA 4OQIA 3MKFA 2OV5A 1LHYA 4FH2A 3A3DA 3AGEA 4WYYA 3UO9A 1MWSA 3IH9A 5GHYA 2OLUA 3TG9A 3PTEA 5AQAA 2B5RA 1MWTA 1YLZA 4E6WA 5TFQA 4BD0A 3FKWA 5CGWA 3MBZA 2FFFB 1FCOA 1K56D 4C3QA 5GL9A 4X68A 3OCNA 3C7VA 1FR1A 3WS2A 4OKPA 5E2GA 3ZDJA 4HEFA 4C75A 1JTGA 4A5RA 2J9PA 1Z6FA 1W8YA 3NDEA 4R3BA 3SH8A 2PU2A 4LV0A 4P6BA 1KVMA 4R3JA 3WS5A 4R0QA 3HUMA 4R4RA 3ZG0A 1W7FA 3NBLA 2XGNA 4PM6A 1K38A 1ZC2A 2V1ZA 3MZEA 3Q7VA 3G4PA 4MLLA 3RXXA 3GTCA 3N4IA 1BLCA 1RCJA 1IELA 4DXBA 3DW0A 5FAPA 1YLYA 3W8KA 3P09A 4LV1A 3A3IA 2P9VA 4P87A 1MBLA 1WYCA 3PBOA 4S2KA 1TEMA 5EVID 2XFSA 2VGKA 3WRZA 1LLBA 3DTMA 3BLSA 4FCFA 4B88A 5FAQA 1XXMA 2PBYA 3BRMA 2EX9A 3G30A 3SOIA 3WS0A 4LENA 5HARA 1IYPA 1FCMA 1TDGA 3IQAA 1XP4A 1RP5A 4Y0TA 2JBFA 4DXCA 4ZJ1A 5EVIA 2VGJA 4PM8A 3QNCA 3IWQA 3IHAA 1KGFA 4HESA 3ZG8B 3V39A 2Y2MA 2WZZA 1L0GA 4X69A 4X56A 4EV4A 2G2WA 4KQRA 5DTTA 4UA9A 3NY4A 1L2SA 3UDXA 4DE0A 1HZOA 1IYSA 3TSGA 3PBRA 1K54C 5FQMA 2WK0A 3IH8A 3WS1A 4BQMA 3OC2A 3V3SA 5KSCA 3EQUA 4S2MA 3QNBA 3GRJA 4IBXA 2HDSA 4S2NA 5M1AA 5FAOA 3UNWA 4WMCD 2ZQ7A 4E3IA 4ZJ2A 1TDLA 3PBQA 4MNRA 5EVIC 1ZG4A 4E3JA 1PWDA 1BZAA 3LCEA 3VSLA 1GA0A 1FSYA 3OPLA 1BTLA 3M6HA 1K6RA 4GDNA 3OPPA 3S4XA 3GR2A 4FH4A 3MZFA 4FSFA 3IWOA 1FR6A 1MKIA 4GDBA 3V3RA 1W8QA 1E3UD 2A3UA 1YMSA 1K4FA 4WMCA 5D3OA 4ZJ3A 1QMFA 3E2KA 2J8YA 4BD1A 2QPNA 2Y2LA 2H0YA 3IHBA 1E25A 1KDWA 2WADA 3SH9A 2HP6A 5KZHA 3NIAA 1G6AA 2OSUA 3MXSA 4S2OA 1YLWA 1NYMA 2H0TA 1E3UA 4N1HA 1MY8A 2ZQAA 5CERA 4DRTA 1BLPA 3IF6B 5E2FA 3HLBA 5EOEA 2QMIA 1CK3A 2ZC4B 5FQIA 1GA9A 5A90A 5BOHA 1YLJA 5AQBA 5DTKA 2IWDA 4WBGA 4IBRA 2BG1A 2Y2PA 3HLEA 1IKGA 3BFGA 1KVLA 4UHUA 5M18A 4OVDA 4UA6A 5FQKA 3SS3A 4OONA 5DF8A 3RJUA 2Y55A 1NJ4A 4KZ5A 3HUOA 3N7WA 5E2EA 1LL5A 3N8SA 3ZNYA 1FCNA 4Q8IA 1W5DA 1YMXA 1FSWA 3HREA 2ZC6B 4RYEA 3N8RA 3G2ZA 2EFXA 4FD8A 3ZCZA 2J7VA 1XKZA 3NC8A 1NXYA 4KQOA 4RA7A 5EOOA 3P98A 5F1GA 3M6BA 2XQZA 4DDSA 3PBNA 4X53A 3UDFA 1WE4A 3JYIA 2ZC3B 4ID4A 2ZM8A 4HBUA 4IVKA 3ZFZA 4H8RA 4P0MA 4BL2A 4EBNA 5J8XA 3Q07A 3BFCA 4KG2A 3PAGA 4JXVA 2X02A 4KZBA 3VP2A 1CEFA 4EBPA 4KZ4A 1QMEA 3IT9A 5FQ9A 1K56A 2WAFA 2E8IA 1VQQA 1K6SA 3WRTA 1JWVA 4KZ8A 4EQIA 4E6XA 3UPOA 1L0EA 3LEZA 5FASA 1I2WA 3N8LA 4GN2A 4JF5A 4JBFA 5HX9A 2XH9A 3HL9A 4PM9A 3GVBA 4JF4A 5TR7A 1KE3A 2RL3A 2ZC7A 1KE0A 4U0TA 1MWRA 4E3KA 4OQGA 1BT5A 4LV2A 2Q9NA 4B4XA 1N4OA 2XFTA 3BFEA 1K54A 2J9OA 3G35A 4GOGA 4OH0A 3DWKA 4Z9QA 4E3NA 1C3BA 1IEMA 1YM1A 3FYZA 2Q9MA 3PBSA 4P85A 2WYXA 3OZHA 1GHMA 5E43A 5CHMA 1LI9A 4MBHA 5DF9A 4R1GA 3MKEA 5CXWA 3Q1FA 3ZVWA 4QY5A 1K55C 1ONGA 2WGIA 5E2HA 3TOIA 1MXOA 3ZG9B 2ZLYA 1PWCA 1ONHA 3VP0A 4LV3A 2G2UA 1CI9A 1MPLA 1PWGA 2HP5A 3NDGA 3GSGA 4KG5A 2WGWA 2WGVA 3CZDA 1YLTA 2R9XA 5KMWA 3UPPA 1KGEA 3O87A 4OQHA 4N9LA 4OP8A 4OOYA 5EE8A 5FI7A 2Y2OA 4YINA 1ES2A 5I94A 4S2PA 2WAEA 2HPBA 4M3KA 4X55A 3BM6A 1Q2PA 2XLNA 5FA7A 2Y2QA 5HAIA 2XR0A 2ZM0A 3VFFA 1HVBA 4BJPA 1NZOA 4DE1A 1NRFA 3W4OA 4C6YA 2JCHA 3A3FA 5CHJA 3VOYA 4JF6A 3S22A 3WS4A 4WELA 1CI8A 1OMEA 2Y2HA 2XEPA 4KZAA 5HAPA 1SHVA 4GKUA 4PMAA 3FV7A 4F94A 5EECA 5FI2A 5GLAA 1LI0A 4E3OA 3EQVA 1DJAA 5TGFA 1SCWA 1XA1A 3RXWA 4S2JA 1IYQA 4KZ9A 3UY6A 2C5WB 3G34A 1ES3A 1CEGA 3HLCA 4K0XA 3Q81A 4QJGA 1HD8A 1BLHA 3V5MA 5GHXA 1SDEA 1XGIA 2Y2IA 1PZPA 3UDIA 4WZ4A 2X71A 1GCEA 3IXGA 4GZBA 2ZD8A 5CEBA 3WWXA 3QHYA 4DE2A 4JLFA 3LY4A 3BFFA 3BEBA 1XPBA 2XD1A 5CTMA 1K4EA 1KE4A 4EWFA 5GLBA 4N9KA 1SKFA 3Q82A 5FDHA 2EXAA 3FZCA 4MEZA 4WZ5A 4Y0OA 4IEDA 3G31A 4BL3A 5GHZA 4BLMA 3HUNA 4YFMA 3VP3A 3PAEA 3BECA 2EX6A 3FWLA 2FFYA 2EFUA 3C4OA 3UE0A 1KDSA 2ZM2A 3OCLA 1O07A 3B3XA 2WZXA 3A3EA 3O88A 5CECA 1J9MA 3SH7A 5KSHA 1ES4A 3M2KA 3BYDA 4OOMA 4XUXA 5FQQA 2JE5A 4WEKA 3NI9A 5G18A 4K91A 4QD4A 2Y2NA 3O3VA 3VP1A 2ZQCA 4S2IA 4X6TA 3M2JA 1KGGA 3ZG5A 1L0DA 2I72A 5L2FA 3ZG7B 3AGDA 4WZ5C 5F83A 3V50A 2EX2A 3GQZA 3BFDA 1PI5A 4OQ0A 1XA7A 2P74A 2UWXA 1PW8A 2HDUA 4UA7A 4ZTKA 2XDMA 3Q7VB 3SS4A 2X01A 3VP4A 1K55A 3ZHHA 3ITAA 3LY3A 4RVAA 5M19A 5A91A 4Y0UA 3HVFA 1YQSA 1WYBA 3SS5A 4DDYA 5CTNA 2P9VB 5HL1A 1I5QA 1PI4A 4WEJA 5AQ9A 4JXWA 1ES5A 1ERMA 1Y54A 3HLDA 5AQ7A 3GV9A 3AGFA 4KG6A 4OPRA 3OPHA 3VFHA 1LL9A 2RCXA 5FQJA 1IYOA 3ISGA 3BLMA 2DNSA 1I2SA 4KENB 2QZ6A 5JYOA 2XD5A 3IF6C 1IKIA 5EVIB 3IXHA 2WGWB 1FOFA 2HDQA 1EROA 1G68A 2Y2GA 4OPZA 4XUZA 4ZAMA 3DWZA 3OPRA 2JC7A 4QHCA 4DE3A 4OLGA
chains in the Genus database with same CATH superfamily
1U60A 1SDNA 5DJUA 2K2NA 2GZAA 2ZQDA 1JWPA 5F82A 3C30A 4LLOB 3C5AA 3NULA 1STZA 3DAVA 1BSGA 4IUHA 5A92A 5L8MA 1ESIA 1V9ZA 5GLDA 2DCFA 3IXBA 4WUJA 4D2OA 4EBLA 2M1CA 2OLVA 1PW1A 4NXFA 4DN0A 4DF6A 1GHPA 4U0XA 4MMNA 4PAUA 4PPRA 2XA7M 3N6IA 4MBFA 1TS0A 2BLSA 1P9RA 2P08A 4XT2A 4OPYA 2ZQ9A 3S7QA 3CG5A 2Y2KA 5CGSA 2VV7A 4JKTA 2ZMVA 4LCLA 2H5SA 3IS2B 4G3WA 4GB7A 3CI6A 4CJNA 4PM5A 1YLPA 4CLCB 2OWJA 5CRFA 4HIAA 1K57C 2WUQA 1FQGA 1OTEA 2PR5A 4R38A 5JYPA 2Y91A 2UV0E 3HLWA 4U3TA 2DRWA 1TS7A 3CMZA 4IVIA 3MQ0A 4KZ7A 4JPMA 3ITBA 3UE3A 5IHVA 2Y59A 4JXSA 1N9BA 3HJKA 5EPHA 3S1YA 4NK3A 1S67L 3NHQA 3NOTC 3R7WB 3C7UA 4WYYA 3UO9A 5GHYA 1VHMA 5TFQA 4BD0A 3MSHA 4ETZA 1K56D 2L4RA 2VGLM 5E2GA 3ZDJA 4HEFA 1Z6FA 4R3BA 1BYWA 2W27A 1KVMA 1Z09A 4R0QA 1W7FA 3NBLA 1LSVA 3DBAA 3Q7VA 3GTCA 3VE3A 1IELA 4DXBA 1YLYA 1P0ZA 3W8KA 3PBOA 5EVID 4O0PA 3LFVA 2W0NA 1OJGA 1T1BA 4M4XA 3WS0A 2O9BA 4LENA 3S7PA 5EVIA 2KX6A 3TJZC 1L0GA 4EV4A 4Y17A 4UA9A 3NY4A 4DE0A 3TSGA 2D02A 4IBXA 4S2NA 3UNWA 1S1YA 3H82A 2ZQ7A 1BZAA 2V8FA 3KSFA 1BTLA 4DJ3A 3S4XA 4FSFA 3C38A 3GR2A 3MZFA 4ZRRA 3IWOA 3KX0X 1MKIA 2QHKA 1K4FA 2V9AA 4ZJ3A 3E2KA 2J8YA 4Q0HA 3IHBA 4Y3IA 2WADA 2HP6A 4JGRA 2ZQAA 5CERA 4DRTA 2Y8HA 3P01A 3HLBA 2QMIA 2V0WA 1CK3A 2L1MA 1Y28A 1GA9A 4JGQA 5BOHA 1OTDA 1PNEA 2QJ5A 1KOUA 2Z6DA 2Y2PA 4Y5FA 3HLEA 3KSIA 1KVLA 5DF8A 2Y55A 3EOIA 1NJ4A 4RYEA 4FOFA 3N8RA 4H6JA 1W63M 1YPRA 1NXYA 3NOUC 4DDSA 1LSWA 2K7SA 5EVEA 3ZFZA 4EBPA 3BQ8A 2W1TB 1QMEA 3IT9A 2WAFA 3H7WA 5HL6A 3ZYTA 3E98A 2HF6A 4KZ8A 4GN2A 3E4PA 4JF5A 3F1PA 3HL9A 3T12B 2ZC7A 2LB9A 4I5SA 4U0TA 2JKFA 1N4OA 3G35A 2CMNA 4E3NA 3FYZA 2LB5A 3OZHA 1GHMA 3CLOA 2OOLA 1LI9A 1UWPX 3DTEA 4L9FA 4QY5A 1SKOB 2M7VA 1S4RA 1PWCA 4LV3A 3LEQA 1CI9A 1MPLA 2HP5A 1W63Q 3GSGA 4MN7A 3B47A 2EWWA 4N9LA 3A0RA 4RQ9A 4OP8A 4OOYA 1X0OA 2Y2OA 1ES2A 2VEAA 4S2PA 3BM6A 1HVBA 1D06A 4C6YA 4I38A 1XJ3A 4WELA 2XEPA 5HAPA 4PMAA 3FV7A 5EECA 5GLAA 2KLIA 4E3OA 3EQVA 2PBDP 1SCWA 3BQAA 4LRZE 1P97A 4I3AA 4G3KA 1VEUA 3TE8A 4QJGA 3V5MA 1SDEA 3MFXA 3PYPA 2X71A 2W3GA 4DE2A 3BEBA 4EWFA 2EXAA 3FZCA 3T4SA 4Y0OA 3G31A 4HHDA 4BL3A 2M7UA 4BLMA 3HUNA 3PAEA 3F1NB 4P6ZM 1O07A 4DJ2A 5KSHA 2A2LA 1N9LA 1NLZA 2Y2NA 2ZQCA 4S2IA 2QWSA 3IBJA 1L0DA 2I72A 5FDSA 4ARZB 5K5BA 2EX2A 3GQZA 2L0WA 3LIAA 2UWXA 2HDUA 4UA7A 3DTIA 3VP4A 2XDMA 3SS4A 1K55A 5M19A 5A91A 4GJ4A 1PI4A 3GV9A 3AGFA 3CPTB 3OPHA 2RCXA 1IYOA 1D7EA 4EEPA 2DNSA 1TF1A 4KENB 2QZ6A 4X1LA 1DP9A 4HI4A 2WGWB 1S66L 3DWZA 2JC7A 4QHCA 4DE3A 1L0FA 3NCKA 1LSXA 1S6RA 1F98A 3MFDA 4KZ6A 5U47A 3JPUA 1ERQA 5DF7A 3UN7A 3HBRA 4BENA 1BULA 4KUKA 4KQQA 2BTFP 4WL9A 1VB6A 4ZDXA 1VM1A 1XFNA 4L0LA 1AWIA 3VOZA 1J3WA 3W4QA 3KYEA 2XF3A 3LO7A 3P7NA 1Q2QA 5HW3A 4HBTA 4NXGA 1IOUA 3UE6A 4B4ZA 4L9GA 2WKQA 1ZTUA 5F1FA 4KUOA 4QPRA 4CPKA 5EVLA 1PZOA 1K57A 3VMAA 1H8YA 4GD8A 4LCMA 2Y4AA 4GW9A 1F2KA 4HY8A 1E4DA 1NLYA 4LRYC 3H9WA 4XXRA 2XK1A 4NETA 1V9YA 3UB9A 5HWTA 3F1OB 1M6KA 1CF0A 2VA0A 5HFOA 1UGUA 1PRQA 4R4SA 4K0WA 2H10A 1OPXA 3G6OA 3RTYA 3SW1A 2Y2JA 3CHWP 3IX3A 1MZUA 3C8CA 1NYYA 3LICA 1ODVA 3IF5A 3U4LP 3T4OA 3FKVA 4OP5A 2Z2MB 1PIOA 4O7DA 1NRJA 4EBNA 5FATA 1ALQA 5EUAA 3MXRA 2ZJ9A 4ZBEA 3IF6A 1H8ZA 1BUEA 3E2LA 4OQIA 3MKFA 2OV5A 1LHYA 3TG9A 3IH9A 5AQAA 4E6WA 2FFFB 3C7VA 4B93A 1UWNX 1G28A 1K0KA 4C75A 1JTGA 2J9PA 3MXQA 4FUWA 3BW6A 1W8YA 3SH8A 2PU2A 1GSVA 3HUMA 3ZG0A 5EV0A 2XGNA 1TS8A 1K38A 1ZC2A 2V1ZA 3N4IA 3NJAA 1BLCA 4D60A 3DW0A 4LV1A 3UB6A 2P9VA 3QP8A 1N9OA 3BLSA 4FCFA 3G30A 1IYPA 1XP4A 4ZJ1A 2VGJA 3QNCA 3LIFA 4HP9A 1KGFA 3ZG8B 2ZOHA 2Y2MA 2WZZA 4X69A 3D9YA 3LR0A 4X56A 5DTTA 4BWIA 1HZOA 1YKDA 4BQMA 4Y2FA 3OC2A 5C5KA 5KSCA 4S2MA 3QNBA 5FAOA 5HDCA 4E3IA 2HV1A 1TDLA 4MNRA 4ZJ2A 1ZG4A 3LCEA 3OLOA 3BJNA 4UQIS 3VSLA 4GDNA 3OPPA 2W3HA 1FR6A 2PDRA 4GDBA 1W8QA 1E3UD 1QMFA 2Y2LA 3CUEC 2Y79A 1E25A 1KDWA 2JKRM 5F5YA 2JKRI 1E3UA 2H0TA 2H28A 4N1HA 1MY8A 5TJJA 1BLPA 4CLCD 5FQIA 5A90A 5HD5A 2IA2A 3KYZA 2IWDA 3MMHA 4UHUA 4OVDA 4CLCA 5FQKA 3OBFA 3MR0A 3IBRA 3HUOA 3N8SA 4Q8IA 1W5DA 1YMXA 1FSWA 2Z6CA 3HREA 2EFXA 2J7VA 3NC8A 3QP1A 4RA7A 5F1GA 3P98A 5FL3A 3M6BA 2XQZA 3W2ZA 3UDFA 2ZC3B 4IVKA 4HBUA 5J8XA 5F6AA 3BFCA 5AVEA 4BMWA 2X02A 3VP2A 1CEFA 4KZ4A 1K56A 3RH8B 3R7WA 1S4SA 5LBRA 3WRTA 1JWVA 3N8LA 5HX9A 2B18A 2RL3A 3LR5A 3E0YA 3PHYA 3C2WA 3BFEA 2XFTA 1K54A 3ICYA 3RFBA 1C3BA 3PBSA 3LYXA 4P85A 5E43A 5DF9A 4R1GA 3O5YA 2MJ6A 2WGIA 5E2HA 3VP0A 4LRXC 1PWGA 3CITA 3CZDA 5KMWA 1YSQA 1T1CA 1D1JA 5I94A 2WAEA 2HPBA 1Q2PA 3B33A 2XLNA 3H82B 5HAIA 3VFFA 3CAXA 4Y15A 2V1AA 3EGDC 3S22A 1FIKA 4QWOA 5EM1A 1A0KA 4KZAA 1MKMA 2B95A 2QKPA 4NXEA 4F94A 1XA1A 3RXWA 5L09A 1ES3A 3Q81A 1BLHA 4DMZA 2Y2IA 3KYQA 3UDIA 4O01A 2PD8A 3FPVA 2ZD8A 2O0YA 4R3AA 1XPBA 5F69A 5CTMA 5GLBA 4N9KA 3Q82A 2GJ3A 3T1RA 3MQOA 5DKLA 5GHZA 4YFMA 3VP3A 2EX6A 4CLCE 2FFYA 2E8JA 1KDSA 4H6JB 3B3XA 2WZXA 3O88A 4OOMA 4PKYG 2B02A 4WEKA 5AVFA 5G18A 2INWA 4X6TA 2VJWA 1VETA 3UMEA 5L2FA 3ZG7B 3AGDA 4O8GA 4WZ5C 1DP6A 5F83A 3V50A 4R6LA 1PI5A 1XA7A 3F1PB 3K3DA 3LY3A 4RVAA 4NKPA 5J4EA 5AQ9A 1ES5A 1S1ZA 1Y54A 3HLDA 4Q0JA 5AQ7A 4KG6A 4OPRA 3VFHA 1LL9A 4MCWA 3ISGA 2XA7S 3BLMA 1I2SA 2XD5A 4L9EA 3A0VA 2HDQA 1EROA 1G68A 2Y2GA 3TRCA 2P04A 1OT9A 4LPZA 2W1TA 1S0WA 3UB7A 2PU4A 1DJBA 2IWCA 4WM9A 4X1MA 1G6OA 4QU3A 4K08A 5CEDA 1JWZA 2WKEA 3UE1A 2JKGA 4PHTA 1RGYA 4OOLA 2R9WA 5HAQA 4OLDA 2KDKA 1DRMA 4OPQA 4Y7PA 3IXDA 4IUKA 3IWIA 5FI6A 4EQ1A 1XX2A 1EI5A 5TBMB 1BLSA 1K25A 2V20A 5GLCA 2P7JA 4E3LA 4YNRA 4R23A 2Z2LB 5HDSA 3GMWA 2GNXA 2HJ9C 5G4YA 1F9IA 3W4PA 2C6WB 1EWZA 3JVUA 2IWBA 2V2FF 4QB8A 1JTDA 2EXBA 1O7EA 4WLAA 3V67A 3KSHA 5DFYA 1NY0A 1XGJA 1T18A 3PBTA 1PFLA 5F68A 5HD3A 3I7JA 4EESA 1NZUA 3LUQA 5CHUA 5DVAA 2HP9A 2ZMAA 4GS9B 1ZG6A 4S2NC 2PR6A 3VSKA 3ZVTA 2J3TC 1GHIA 4UAAA 1DJCA 1YT4A 1AXBA 5KIZA 1ZKJA 1M40A 1MWUA 3ZGAB 4F3LB 4FH2A 1MWSA 2OLUA 2B5RA 3F1NA 1MWTA 1MC0A 1YLZA 1OT6A 5IS1A 3K3CA 3FKWA 5CGWA 1FCOA 1OJ5A 5GL9A 4EERA 4X68A 3LR4A 4FTXA 3S7OA 4OKPA 4EUVA 4P6BA 4R3JA 3WS5A 4ARZA 3KO6A 4HQAA 4PM6A 2W1RA 3QP2A 2G7UA 1RCJA 5FAPA 1OTBA 3P09A 4P87A 3A3IA 1MBLA 1WYCA 4S2KA 1TEMA 2OAP1 4MN5A 2VGKA 4GLQA 4WF0A 3DTMA 5DJTA 3CPTA 4B88A 1XXMA 5HARA 1TDGA 3IQAA 3T50A 3T4JA 4Y0TA 1RP5A 4DXCA 1OTIA 3LGOA 4I3JA 4PM8A 1H3QA 3IWQA 2YKFA 4AFIA 1YAXA 5FEFA 2ZOIA 3EEAA 2G2WA 4KQRA 1L2SA 2OWHA 3PBRA 2K31A 3IH8A 3WS1A 5DFXA 4EU0A 3EQUA 3GRJA 3T1XA 2VK3A 3OOVA 4WMCD 3QP5A 3IX4A 3PBQA 1H0MA 1PWDA 1GA0A 1FSYA 3OPLA 3M6HA 4NEED 1LT0A 1OTAA 4JGOA 2I9VA 3TW8A 3PXPA 3V3RA 2A3UA 4WMCA 5D3OA 2HJEA 4BD1A 2H0YA 2ZL1A 4B9OA 4G3VA 3B42A 3SH9A 5KZHA 1G6AA 2HGVA 4HP4A 4S2OA 1YLWA 1NYMA 2VKSA 1XJ4A 2PRFA 3IF6B 5E2FA 2ZC4B 4GHIB 2A24A 1YLJA 5AQBA 4WBGA 2VLGA 3F1OA 4UA6A 3RJUA 2FZ0A 4KZ5A 1LL5A 4Y13A 5HDDA 2ZC6B 3G2ZA 3ZCZA 3GECA 3PBNA 1WE4A 5L10A 4WN5A 1DP8A 4ID4A 5A8BA 3Q07A 4KG2A 3PAGA 4JXVA 4EW7A 2PYRA 1SZVA 2E8IA 3R4KA 4HJ4A 4EQIA 5FASA 4JBFA 3UB5P 2XH9A 2ZMFA 4LGWA 3GVBA 4JF4A 5TR7A 4ME4A 3BY9A 1KE0A 2YKHA 1MWRA 4E3KA 4MDZA 1BT5A 1IFQA 2Q9NA 4B4XA 2J9OA 4GOGA 3DWKA 4Z9QA 1YM1A 4I3IA 3T4QA 2WYXA 2PYPA 4R70A 1XFQA 3MKEA 1K55C 3TOIA 1MXOA 2XRNA 2FH5A 3NDGA 4KG5A 1KGEA 3O87A 4OQHA 2VX8A 5EE8A 3KSGA 4XT2B 4YINA 5HPIA 2ZBBA 3E4OA 5FA7A 2XR0A 4P6ZS 2ZM0A 1NZOA 3W4OA 2JCHA 2O99A 3A3FA 3VOYA 4YOFA 5G4ZA 4GCZA 1OMEA 3ZQ5A 5FI2A 1LI0A 2DMWA 3BY8A 2OAQ1 5TGFA 1IYQA 4KZ9A 2O9AA 3L7HA 3UY6A 3EGXC 2C5WB 1PZPA 2O9CA 4WZ4A 1GCEA 5CEBA 3QHYA 4JLFA 3LY4A 4EETB 2XD1A 1L3LA 1K4EA 1KE4A 1SKFA 5FDHA 5HZHA 4MEZA 4WZ5A 3IS2A 2EA9A 3FWLA 2NUTC 3C4OA 2EFUA 3UE0A 2ZM2A 3IX8A 3A3EA 1J9MA 1ES4A 3M2KA 3BYDA 5FQQA 2JE5A 2BASA 2XSSA 3L9KA 3O3VA 1KGGA 3T4TA 5HPFA 4BBTA 3LIBA 1Y4OA 2P74A 3Q7VB 2X01A 3ZHHA 3ITAA 4Y0UA 1WYBA 4DDYA 5CTNA 5HL1A 1I5QA 4JXWA 4ETXA 1ERMA 3CWFA 3SZTA 5FQJA 1YSPA 5JYOA 3IF6C 2PD7A 1IKIA 5EVIB 1FOFA 3GDIA 3OPRA 5DKKA 4OLGA 1ACFA 2VZWA 3HLFA 4BBUA 4RX2A 4Z1WA 1DY6A 2CC1A 1HTZA 3LR3A 2ZC5B 4HJ6A 3BWLA 1XJ2A 1W79A 1FILA 4II7A 4N92A 5HWWA 4MBKA 5A93A 2V0UA 3CJMA 3MJQA 4HNBA 2V8CA 5CGXA 3LI9A 3NOPC 4X25A 5IT5A 3HLGA 4CQHA 1CQAA 2HDRA 1H5XA 3MZDA 1NWZA 2EX8A 2J3TD 3G32A 2J80A 4E3MA 1PYYA 3D3OA 2WKIA 3ZNTA 4QY6A 3G2YA 3A3JA 2J3WA 3HJIA 2WKHA 3MF0A 1TVFA 1LL8A 2A49A 3LIEA 1JVJA 3C4PA 3JVVA 4RX3A 1G5UA 2VV6A 4JXGA 1ESUA 1XJ6A 4EUZA 2ZQ8A 4N1XA 3D4FA 4PM7A 5FSRA 1VETB 1RGZA 3O86A 4GNUA 3UPNA 5DTSA 3H7WB 4GD6A 2GDNA 4KZ3A 4S2LA 4DKIA 3Q7ZA 2NUPC 3A3DA 3AGEA 1EW0A 2XROA 3K2NA 3PTEA 1WA9A 3QP4A 3MBZA 2HZ5A 5FEGA 4HH2A 4UEYA 4C3QA 1JNUA 4YWZA 3QP6A 3OCNA 1FR1A 3T4KA 3WS2A 3VE4A 4A5RA 3HCYA 3T1QB 3NDEA 4LV0A 4CLCC 3NECA 4R4RA 2W3DA 4KQDA 5L07A 3MZEA 3G4PA 4MLLA 3RXXA 1P9WA 2XFSA 3WRZA 1LLBA 5FAQA 2PBYA 3BRMA 2EX9A 5AJGA 3SOIA 1FCMA 2JBFA 3IHAA 4HESA 3V39A 1CJFA 1SKOA 5MC7A 1VEUB 3U2AA 2WKPA 3UDXA 1IYSA 5EFWA 1K54C 5FQMA 2WK0A 4HOIA 3V3SA 1T1AA 2HDSA 5M1AA 1GSWA 2JN7A 1ZHHB 1T19A 5EVIC 4E3JA 5EM0A 1K6RA 4FH4A 2V1BA 1YMSA 2VGLS 5TBMA 2QPNA 4JGPA 3NIAA 3FPWA 3PR6A 2OSUA 3MXSA 2QJ7A 3FC7A 2W3EA 4NG2A 5HWVA 5EOEA 1N9NA 4I39A 5DTKA 4IBRA 2BG1A 1IKGA 3BFGA 3LI8A 5M18A 3SS3A 4OONA 2R78A 3N7WA 5E2EA 3ZNYA 1FCNA 3S7NA 4FD8A 4UQIM 4GS9A 1XKZA 5EOOA 4KQOA 4X53A 4EXOA 3JYIA 2ZM8A 4H8RA 4P0MA 4BL2A 4Q0IA 4KZBA 1TS6A 5FQ9A 2GX5A 1VQQA 1K6SA 2PAVP 3UPOA 4E6XA 1L0EA 3LEZA 1I2WA 4F3LA 4MN6A 4NXBA 4PM9A 1KE3A 2AVXA 3LIDA 3MS6A 4LV2A 4OQGA 2WKRA 4OH0A 1IEMA 2Q9MA 2KOIA 4PKYA 5CHMA 3DTKA 4MBHA 1HLUP 3T4LA 5CXWA 3Q1FA 3ZVWA 1ONGA 3ZG9B 2ZLYA 1ONHA 2G2UA 2WGWA 2WGVA 1YLTA 2R9XA 3UPPA 2Q0OA 3E4QA 5FI7A 4M3KA 4X55A 3CUEA 2Y2QA 4BJPA 4DE1A 1NRFA 5CHJA 3UB8A 4JF6A 4HH3A 2JKTM 3MQQA 5CX7A 2JKTI 3WS4A 1CI8A 2Y2HA 2QYBA 5HSQA 1SHVA 4GKUA 2ZL1B 1DJAA 3UMDA 3VV4A 4IJGA 5J7EA 1TD5A 4S2JA 3FG8A 3G34A 1CEGA 3HLCA 4K0XA 1HD8A 5GHXA 1XGIA 2JHEA 3IXGA 4GZBA 3WWXA 2A24B 2D01A 3EEHA 3BFFA 5J3WA 3ULFA 2EWVA 1F5MA 4IEDA 3BECA 4ESPA 2W3FA 3A0SA 5I5LA 2ACGA 3OCLA 5CECA 3SH7A 4IHQA 4XUXA 3NI9A 1H8MA 4K91A 4QD4A 3VP1A 3M2JA 3ZG5A 3BFDA 4OQ0A 4GHIA 4ZTKA 1PW8A 4HJ3A 3HVFA 1YQSA 3SS5A 2PHYA 2P9VB 3D72A 4WEJA 3T1SA 2PT7A 2VV8A 3EWKA 1GSXA 4E04A 5IU1A 3VOLA 4LFUA 4BBVA 4EEUA 3IXHA 4OPZA 4XUZA 4ZAMA
chains in the Genus database with same CATH topology
1L0FA 3NCKA 1S0WA 2PU4A 1S6RA 1DJBA 3MFDA 4KZ6A 3HLFA 5U47A 4RX2A 2IWCA 1DY6A 2CC1A 1HTZA 4WM9A 2ZC5B 1U60A 1SDNA 1ERQA 4QU3A 5DF7A 3UN7A 3HBRA 2ZQDA 1JWPA 5F82A 4BENA 1BULA 1JWZA 4KQQA 3C5AA 5CEDA 4ZDXA 1VM1A 1W79A 2WKEA 3UE1A 1BSGA 4L0LA 1RGYA 4N92A 4OOLA 4MBKA 2R9WA 3VOZA 5HAQA 4OLDA 3CJMA 3W4QA 5A92A 5A93A 4OPQA 4Y7PA 3IXDA 1ESIA 5GLDA 2XF3A 2DCFA 3LO7A 1Q2QA 5CGXA 3IXBA 5HW3A 4HBTA 4D2OA 3IWIA 5FI6A 4EBLA 1XX2A 4B4ZA 1EI5A 2OLVA 1PW1A 3HLGA 1BLSA 4DF6A 1K25A 1GHPA 2V20A 5F1FA 2HDRA 5GLCA 1H5XA 4CPKA 4U0XA 3MZDA 5EVLA 4E3LA 2EX8A 1PZOA 1K57A 4PPRA 3N6IA 4R23A 3VMAA 1H8YA 3G32A 4MBFA 4E3MA 2Z2LB 4GD8A 3GMWA 4OPYA 2BLSA 1PYYA 2ZQ9A 3W4PA 2WKIA 3CG5A 4LCMA 2Y2KA 5CGSA 2C6WB 3ZNTA 1EWZA 4QY6A 3G2YA 2IWBA 2V2FF 4QB8A 2Y4AA 3A3JA 1JTDA 2EXBA 1O7EA 4JKTA 2WKHA 1E4DA 4LCLA 1TVFA 2H5SA 2A49A 1JVJA 4XXRA 4GB7A 2XK1A 4CJNA 3C4PA 4RX3A 1NY0A 4PM5A 4NETA 4JXGA 1XGJA 1YLPA 3PBTA 1ESUA 1M6KA 3UPNA 5HFOA 5CRFA 4R4SA 1K57C 2WUQA 4EUZA 1FQGA 4K0WA 3I7JA 5JYPA 2H10A 2ZQ8A 2Y91A 1NZUA 3HLWA 4U3TA 5CHUA 5DVAA 2Y2JA 2HP9A 2DRWA 2ZMAA 1ZG6A 3CMZA 4N1XA 4S2NC 4IVIA 3D4FA 1NYYA 4PM7A 5FSRA 1RGZA 3O86A 4KZ7A 3VSKA 3ZVTA 4JPMA 1GHIA 3IF5A 3ITBA 3FKVA 4UAAA 4OP5A 3UE3A 2Z2MB 1PIOA 4O7DA 4GNUA 5IHVA 2Y59A 1DJCA 1YT4A 1ALQA 4JXSA 1N9BA 5EPHA 5FATA 3S1YA 5EUAA 3MXRA 1AXBA 2ZJ9A 4NK3A 5DTSA 4GD6A 4ZBEA 1ZKJA 3IF6A 2GDNA 4KZ3A 4S2LA 1H8ZA 1M40A 3C7UA 4DKIA 1MWUA 3ZGAB 3Q7ZA 1BUEA 3E2LA 4OQIA 3MKFA 2OV5A 1LHYA 4FH2A 3A3DA 3AGEA 4WYYA 3UO9A 1MWSA 3IH9A 5GHYA 2OLUA 3TG9A 3PTEA 5AQAA 2B5RA 1MWTA 1YLZA 4E6WA 5TFQA 4BD0A 3FKWA 5CGWA 3MBZA 2FFFB 1FCOA 1K56D 4C3QA 5GL9A 4X68A 3OCNA 3C7VA 1FR1A 3WS2A 4OKPA 5E2GA 3ZDJA 4HEFA 4C75A 1JTGA 4A5RA 2J9PA 1Z6FA 1W8YA 3NDEA 4R3BA 3SH8A 2PU2A 4LV0A 4P6BA 1KVMA 4R3JA 3WS5A 4R0QA 3HUMA 4R4RA 3ZG0A 1W7FA 3NBLA 2XGNA 4PM6A 1K38A 1ZC2A 2V1ZA 3MZEA 3Q7VA 3G4PA 4MLLA 3RXXA 3GTCA 3N4IA 1BLCA 1RCJA 1IELA 4DXBA 3DW0A 5FAPA 1YLYA 3W8KA 3P09A 4LV1A 3A3IA 2P9VA 4P87A 1MBLA 1WYCA 3PBOA 4S2KA 1TEMA 5EVID 2XFSA 2VGKA 3WRZA 1LLBA 3DTMA 3BLSA 4FCFA 4B88A 5FAQA 1XXMA 2PBYA 3BRMA 2EX9A 3G30A 3SOIA 3WS0A 4LENA 5HARA 1IYPA 1FCMA 1TDGA 3IQAA 1XP4A 1RP5A 4Y0TA 2JBFA 4DXCA 4ZJ1A 5EVIA 2VGJA 4PM8A 3QNCA 3IWQA 3IHAA 1KGFA 4HESA 3ZG8B 3V39A 2Y2MA 2WZZA 1L0GA 4X69A 4X56A 4EV4A 2G2WA 4KQRA 5DTTA 4UA9A 3NY4A 1L2SA 3UDXA 4DE0A 1HZOA 1IYSA 3TSGA 3PBRA 1K54C 5FQMA 2WK0A 3IH8A 3WS1A 4BQMA 3OC2A 3V3SA 5KSCA 3EQUA 4S2MA 3QNBA 3GRJA 4IBXA 2HDSA 4S2NA 5M1AA 5FAOA 3UNWA 4WMCD 2ZQ7A 4E3IA 4ZJ2A 1TDLA 3PBQA 4MNRA 5EVIC 1ZG4A 4E3JA 1PWDA 1BZAA 3LCEA 3VSLA 1GA0A 1FSYA 3OPLA 1BTLA 3M6HA 1K6RA 4GDNA 3OPPA 3S4XA 3GR2A 4FH4A 3MZFA 4FSFA 3IWOA 1FR6A 1MKIA 4GDBA 3V3RA 1W8QA 1E3UD 2A3UA 1YMSA 1K4FA 4WMCA 5D3OA 4ZJ3A 1QMFA 3E2KA 2J8YA 4BD1A 2QPNA 2Y2LA 2H0YA 3IHBA 1E25A 1KDWA 2WADA 3SH9A 2HP6A 5KZHA 3NIAA 1G6AA 2OSUA 3MXSA 4S2OA 1YLWA 1NYMA 2H0TA 1E3UA 4N1HA 1MY8A 2ZQAA 5CERA 4DRTA 1BLPA 3IF6B 5E2FA 3HLBA 5EOEA 2QMIA 1CK3A 2ZC4B 5FQIA 1GA9A 5A90A 5BOHA 1YLJA 5AQBA 5DTKA 2IWDA 4WBGA 4IBRA 2BG1A 2Y2PA 3HLEA 1IKGA 3BFGA 1KVLA 4UHUA 5M18A 4OVDA 4UA6A 5FQKA 3SS3A 4OONA 5DF8A 3RJUA 2Y55A 1NJ4A 4KZ5A 3HUOA 3N7WA 5E2EA 1LL5A 3N8SA 3ZNYA 1FCNA 4Q8IA 1W5DA 1YMXA 1FSWA 3HREA 2ZC6B 4RYEA 3N8RA 3G2ZA 2EFXA 4FD8A 3ZCZA 2J7VA 1XKZA 3NC8A 1NXYA 4KQOA 4RA7A 5EOOA 3P98A 5F1GA 3M6BA 2XQZA 4DDSA 3PBNA 4X53A 3UDFA 1WE4A 3JYIA 2ZC3B 4ID4A 2ZM8A 4HBUA 4IVKA 3ZFZA 4H8RA 4P0MA 4BL2A 4EBNA 5J8XA 3Q07A 3BFCA 4KG2A 3PAGA 4JXVA 2X02A 4KZBA 3VP2A 1CEFA 4EBPA 4KZ4A 1QMEA 3IT9A 5FQ9A 1K56A 2WAFA 2E8IA 1VQQA 1K6SA 3WRTA 1JWVA 4KZ8A 4EQIA 4E6XA 3UPOA 1L0EA 3LEZA 5FASA 1I2WA 3N8LA 4GN2A 4JF5A 4JBFA 5HX9A 2XH9A 3HL9A 4PM9A 3GVBA 4JF4A 5TR7A 1KE3A 2RL3A 2ZC7A 1KE0A 4U0TA 1MWRA 4E3KA 4OQGA 1BT5A 4LV2A 2Q9NA 4B4XA 1N4OA 2XFTA 3BFEA 1K54A 2J9OA 3G35A 4GOGA 4OH0A 3DWKA 4Z9QA 4E3NA 1C3BA 1IEMA 1YM1A 3FYZA 2Q9MA 3PBSA 4P85A 2WYXA 3OZHA 1GHMA 5E43A 5CHMA 1LI9A 4MBHA 5DF9A 4R1GA 3MKEA 5CXWA 3Q1FA 3ZVWA 4QY5A 1K55C 1ONGA 2WGIA 5E2HA 3TOIA 1MXOA 3ZG9B 2ZLYA 1PWCA 1ONHA 3VP0A 4LV3A 2G2UA 1CI9A 1MPLA 1PWGA 2HP5A 3NDGA 3GSGA 4KG5A 2WGWA 2WGVA 3CZDA 1YLTA 2R9XA 5KMWA 3UPPA 1KGEA 3O87A 4OQHA 4N9LA 4OP8A 4OOYA 5EE8A 5FI7A 2Y2OA 4YINA 1ES2A 5I94A 4S2PA 2WAEA 2HPBA 4M3KA 4X55A 3BM6A 1Q2PA 2XLNA 5FA7A 2Y2QA 5HAIA 2XR0A 2ZM0A 3VFFA 1HVBA 4BJPA 1NZOA 4DE1A 1NRFA 3W4OA 4C6YA 2JCHA 3A3FA 5CHJA 3VOYA 4JF6A 3S22A 3WS4A 4WELA 1CI8A 1OMEA 2Y2HA 2XEPA 4KZAA 5HAPA 1SHVA 4GKUA 4PMAA 3FV7A 4F94A 5EECA 5FI2A 5GLAA 1LI0A 4E3OA 3EQVA 1DJAA 5TGFA 1SCWA 1XA1A 3RXWA 4S2JA 1IYQA 4KZ9A 3UY6A 2C5WB 3G34A 1ES3A 1CEGA 3HLCA 4K0XA 3Q81A 4QJGA 1HD8A 1BLHA 3V5MA 5GHXA 1SDEA 1XGIA 2Y2IA 1PZPA 3UDIA 4WZ4A 2X71A 1GCEA 3IXGA 4GZBA 2ZD8A 5CEBA 3WWXA 3QHYA 4DE2A 4JLFA 3LY4A 3BFFA 3BEBA 1XPBA 2XD1A 5CTMA 1K4EA 1KE4A 4EWFA 5GLBA 4N9KA 1SKFA 3Q82A 5FDHA 2EXAA 3FZCA 4MEZA 4WZ5A 4Y0OA 4IEDA 3G31A 4BL3A 5GHZA 4BLMA 3HUNA 4YFMA 3VP3A 3PAEA 3BECA 2EX6A 3FWLA 2FFYA 2EFUA 3C4OA 3UE0A 1KDSA 2ZM2A 3OCLA 1O07A 3B3XA 2WZXA 3A3EA 3O88A 5CECA 1J9MA 3SH7A 5KSHA 1ES4A 3M2KA 3BYDA 4OOMA 4XUXA 5FQQA 2JE5A 4WEKA 3NI9A 5G18A 4K91A 4QD4A 2Y2NA 3O3VA 3VP1A 2ZQCA 4S2IA 4X6TA 3M2JA 1KGGA 3ZG5A 1L0DA 2I72A 5L2FA 3ZG7B 3AGDA 4WZ5C 5F83A 3V50A 2EX2A 3GQZA 3BFDA 1PI5A 4OQ0A 1XA7A 2P74A 2UWXA 1PW8A 2HDUA 4UA7A 4ZTKA 2XDMA 3Q7VB 3SS4A 2X01A 3VP4A 1K55A 3ZHHA 3ITAA 3LY3A 4RVAA 5M19A 5A91A 4Y0UA 3HVFA 1YQSA 1WYBA 3SS5A 4DDYA 5CTNA 2P9VB 5HL1A 1I5QA 1PI4A 4WEJA 5AQ9A 4JXWA 1ES5A 1ERMA 1Y54A 3HLDA 5AQ7A 3GV9A 3AGFA 4KG6A 4OPRA 3OPHA 3VFHA 1LL9A 2RCXA 5FQJA 1IYOA 3ISGA 3BLMA 2DNSA 1I2SA 4KENB 2QZ6A 5JYOA 2XD5A 3IF6C 1IKIA 5EVIB 3IXHA 2WGWB 1FOFA 2HDQA 1EROA 1G68A 2Y2GA 4OPZA 4XUZA 4ZAMA 3DWZA 3OPRA 2JC7A 4QHCA 4DE3A 4OLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0F A;  3NCK A;  1S0W A;  2PU4 A;  1S6R A;  1DJB A;  3MFD A;  4KZ6 A;  3HLF A;  5U47 A;  4RX2 A;  2IWC A;  1DY6 A;  2CC1 A;  1HTZ A;  4WM9 A;  2ZC5 B;  1U60 A;  1SDN A;  1ERQ A;  4QU3 A;  5DF7 A;  3UN7 A;  3HBR A;  2ZQD A;  1JWP A;  5F82 A;  4BEN A;  1BUL A;  1JWZ A;  4KQQ A;  3C5A A;  5CED A;  4ZDX A;  1VM1 A;  1W79 A;  2WKE A;  3UE1 A;  1BSG A;  4L0L A;  1RGY A;  4N92 A;  4OOL A;  4MBK A;  2R9W A;  3VOZ A;  5HAQ A;  4OLD A;  3CJM A;  3W4Q A;  5A92 A;  5A93 A;  4OPQ A;  4Y7P A;  3IXD A;  1ESI A;  5GLD A;  2XF3 A;  2DCF A;  3LO7 A;  1Q2Q A;  5CGX A;  3IXB A;  5HW3 A;  4HBT A;  4D2O A;  3IWI A;  5FI6 A;  4EBL A;  1XX2 A;  4B4Z A;  1EI5 A;  2OLV A;  1PW1 A;  3HLG A;  1BLS A;  4DF6 A;  1K25 A;  1GHP A;  2V20 A;  5F1F A;  2HDR A;  5GLC A;  1H5X A;  4CPK A;  4U0X A;  3MZD A;  5EVL A;  4E3L A;  2EX8 A;  1PZO A;  1K57 A;  4PPR A;  3N6I A;  4R23 A;  3VMA A;  1H8Y A;  3G32 A;  4MBF A;  4E3M A;  2Z2L B;  4GD8 A;  3GMW A;  4OPY A;  2BLS A;  1PYY A;  2ZQ9 A;  3W4P A;  2WKI A;  3CG5 A;  4LCM A;  2Y2K A;  5CGS A;  2C6W B;  3ZNT A;  1EWZ A;  4QY6 A;  3G2Y A;  2IWB A;  2V2F F;  4QB8 A;  2Y4A A;  3A3J A;  1JTD A;  2EXB A;  1O7E A;  4JKT A;  2WKH A;  1E4D A;  4LCL A;  1TVF A;  2H5S A;  2A49 A;  1JVJ A;  4XXR A;  4GB7 A;  2XK1 A;  4CJN A;  3C4P A;  4RX3 A;  1NY0 A;  4PM5 A;  4NET A;  4JXG A;  1XGJ A;  1YLP A;  3PBT A;  1ESU A;  1M6K A;  3UPN A;  5HFO A;  5CRF A;  4R4S A;  1K57 C;  2WUQ A;  4EUZ A;  1FQG A;  4K0W A;  3I7J A;  5JYP A;  2H10 A;  2ZQ8 A;  2Y91 A;  1NZU A;  3HLW A;  4U3T A;  5CHU A;  5DVA A;  2Y2J A;  2HP9 A;  2DRW A;  2ZMA A;  1ZG6 A;  3CMZ A;  4N1X A;  4S2N C;  4IVI A;  3D4F A;  1NYY A;  4PM7 A;  5FSR A;  1RGZ A;  3O86 A;  4KZ7 A;  3VSK A;  3ZVT A;  4JPM A;  1GHI A;  3IF5 A;  3ITB A;  3FKV A;  4UAA A;  4OP5 A;  3UE3 A;  2Z2M B;  1PIO A;  4O7D A;  4GNU A;  5IHV A;  2Y59 A;  1DJC A;  1YT4 A;  1ALQ A;  4JXS A;  1N9B A;  5EPH A;  5FAT A;  3S1Y A;  5EUA A;  3MXR A;  1AXB A;  2ZJ9 A;  4NK3 A;  5DTS A;  4GD6 A;  4ZBE A;  1ZKJ A;  3IF6 A;  2GDN A;  4KZ3 A;  4S2L A;  1H8Z A;  1M40 A;  3C7U A;  4DKI A;  1MWU A;  3ZGA B;  3Q7Z A;  1BUE A;  3E2L A;  4OQI A;  3MKF A;  2OV5 A;  1LHY A;  4FH2 A;  3A3D A;  3AGE A;  4WYY A;  3UO9 A;  1MWS A;  3IH9 A;  5GHY A;  2OLU A;  3TG9 A;  3PTE A;  5AQA A;  2B5R A;  1MWT A;  1YLZ A;  4E6W A;  5TFQ A;  4BD0 A;  3FKW A;  5CGW A;  3MBZ A;  2FFF B;  1FCO A;  1K56 D;  4C3Q A;  5GL9 A;  4X68 A;  3OCN A;  3C7V A;  1FR1 A;  3WS2 A;  4OKP A;  5E2G A;  3ZDJ A;  4HEF A;  4C75 A;  1JTG A;  4A5R A;  2J9P A;  1Z6F A;  1W8Y A;  3NDE A;  4R3B A;  3SH8 A;  2PU2 A;  4LV0 A;  4P6B A;  1KVM A;  4R3J A;  3WS5 A;  4R0Q A;  3HUM A;  4R4R A;  3ZG0 A;  1W7F A;  3NBL A;  2XGN A;  4PM6 A;  1K38 A;  1ZC2 A;  2V1Z A;  3MZE A;  3Q7V A;  3G4P A;  4MLL A;  3RXX A;  3GTC A;  3N4I A;  1BLC A;  1RCJ A;  1IEL A;  4DXB A;  3DW0 A;  5FAP A;  1YLY A;  3W8K A;  3P09 A;  4LV1 A;  3A3I A;  2P9V A;  4P87 A;  1MBL A;  1WYC A;  3PBO A;  4S2K A;  1TEM A;  5EVI D;  2XFS A;  2VGK A;  3WRZ A;  1LLB A;  3DTM A;  3BLS A;  4FCF A;  4B88 A;  5FAQ A;  1XXM A;  2PBY A;  3BRM A;  2EX9 A;  3G30 A;  3SOI A;  3WS0 A;  4LEN A;  5HAR A;  1IYP A;  1FCM A;  1TDG A;  3IQA A;  1XP4 A;  1RP5 A;  4Y0T A;  2JBF A;  4DXC A;  4ZJ1 A;  5EVI A;  2VGJ A;  4PM8 A;  3QNC A;  3IWQ A;  3IHA A;  1KGF A;  4HES A;  3ZG8 B;  3V39 A;  2Y2M A;  2WZZ A;  1L0G A;  4X69 A;  4X56 A;  4EV4 A;  2G2W A;  4KQR A;  5DTT A;  4UA9 A;  3NY4 A;  1L2S A;  3UDX A;  4DE0 A;  1HZO A;  1IYS A;  3TSG A;  3PBR A;  1K54 C;  5FQM A;  2WK0 A;  3IH8 A;  3WS1 A;  4BQM A;  3OC2 A;  3V3S A;  5KSC A;  3EQU A;  4S2M A;  3QNB A;  3GRJ A;  4IBX A;  2HDS A;  4S2N A;  5M1A A;  5FAO A;  3UNW A;  4WMC D;  2ZQ7 A;  4E3I A;  4ZJ2 A;  1TDL A;  3PBQ A;  4MNR A;  5EVI C;  1ZG4 A;  4E3J A;  1PWD A;  1BZA A;  3LCE A;  3VSL A;  1GA0 A;  1FSY A;  3OPL A;  1BTL A;  3M6H A;  1K6R A;  4GDN A;  3OPP A;  3S4X A;  3GR2 A;  4FH4 A;  3MZF A;  4FSF A;  3IWO A;  1FR6 A;  1MKI A;  4GDB A;  3V3R A;  1W8Q A;  1E3U D;  2A3U A;  1YMS A;  1K4F A;  4WMC A;  5D3O A;  4ZJ3 A;  1QMF A;  3E2K A;  2J8Y A;  4BD1 A;  2QPN A;  2Y2L A;  2H0Y A;  3IHB A;  1E25 A;  1KDW A;  2WAD A;  3SH9 A;  2HP6 A;  5KZH A;  3NIA A;  1G6A A;  2OSU A;  3MXS A;  4S2O A;  1YLW A;  1NYM A;  2H0T A;  1E3U A;  4N1H A;  1MY8 A;  2ZQA A;  5CER A;  4DRT A;  1BLP A;  3IF6 B;  5E2F A;  3HLB A;  5EOE A;  2QMI A;  1CK3 A;  2ZC4 B;  5FQI A;  1GA9 A;  5A90 A;  5BOH A;  1YLJ A;  5AQB A;  5DTK A;  2IWD A;  4WBG A;  4IBR A;  2BG1 A;  2Y2P A;  3HLE A;  1IKG A;  3BFG A;  1KVL A;  4UHU A;  5M18 A;  4OVD A;  4UA6 A;  5FQK A;  3SS3 A;  4OON A;  5DF8 A;  3RJU A;  2Y55 A;  1NJ4 A;  4KZ5 A;  3HUO A;  3N7W A;  5E2E A;  1LL5 A;  3N8S A;  3ZNY A;  1FCN A;  4Q8I A;  1W5D A;  1YMX A;  1FSW A;  3HRE A;  2ZC6 B;  4RYE A;  3N8R A;  3G2Z A;  2EFX A;  4FD8 A;  3ZCZ A;  2J7V A;  1XKZ A;  3NC8 A;  1NXY A;  4KQO A;  4RA7 A;  5EOO A;  3P98 A;  5F1G A;  3M6B A;  2XQZ A;  4DDS A;  3PBN A;  4X53 A;  3UDF A;  1WE4 A;  3JYI A;  2ZC3 B;  4ID4 A;  2ZM8 A;  4HBU A;  4IVK A;  3ZFZ A;  4H8R A;  4P0M A;  4BL2 A;  4EBN A;  5J8X A;  3Q07 A;  3BFC A;  4KG2 A;  3PAG A;  4JXV A;  2X02 A;  4KZB A;  3VP2 A;  1CEF A;  4EBP A;  4KZ4 A;  1QME A;  3IT9 A;  5FQ9 A;  1K56 A;  2WAF A;  2E8I A;  1VQQ A;  1K6S A;  3WRT A;  1JWV A;  4KZ8 A;  4EQI A;  4E6X A;  3UPO A;  1L0E A;  3LEZ A;  5FAS A;  1I2W A;  3N8L A;  4GN2 A;  4JF5 A;  4JBF A;  5HX9 A;  2XH9 A;  3HL9 A;  4PM9 A;  3GVB A;  4JF4 A;  5TR7 A;  1KE3 A;  2RL3 A;  2ZC7 A;  1KE0 A;  4U0T A;  1MWR A;  4E3K A;  4OQG A;  1BT5 A;  4LV2 A;  2Q9N A;  4B4X A;  1N4O A;  2XFT A;  3BFE A;  1K54 A;  2J9O A;  3G35 A;  4GOG A;  4OH0 A;  3DWK A;  4Z9Q A;  4E3N A;  1C3B A;  1IEM A;  1YM1 A;  3FYZ A;  2Q9M A;  3PBS A;  4P85 A;  2WYX A;  3OZH A;  1GHM A;  5E43 A;  5CHM A;  1LI9 A;  4MBH A;  5DF9 A;  4R1G A;  3MKE A;  5CXW A;  3Q1F A;  3ZVW A;  4QY5 A;  1K55 C;  1ONG A;  2WGI A;  5E2H A;  3TOI A;  1MXO A;  3ZG9 B;  2ZLY A;  1PWC A;  1ONH A;  3VP0 A;  4LV3 A;  2G2U A;  1CI9 A;  1MPL A;  1PWG A;  2HP5 A;  3NDG A;  3GSG A;  4KG5 A;  2WGW A;  2WGV A;  3CZD A;  1YLT A;  2R9X A;  5KMW A;  3UPP A;  1KGE A;  3O87 A;  4OQH A;  4N9L A;  4OP8 A;  4OOY A;  5EE8 A;  5FI7 A;  2Y2O A;  4YIN A;  1ES2 A;  5I94 A;  4S2P A;  2WAE A;  2HPB A;  4M3K A;  4X55 A;  3BM6 A;  1Q2P A;  2XLN A;  5FA7 A;  2Y2Q A;  5HAI A;  2XR0 A;  2ZM0 A;  3VFF A;  1HVB A;  4BJP A;  1NZO A;  4DE1 A;  1NRF A;  3W4O A;  4C6Y A;  2JCH A;  3A3F A;  5CHJ A;  3VOY A;  4JF6 A;  3S22 A;  3WS4 A;  4WEL A;  1CI8 A;  1OME A;  2Y2H A;  2XEP A;  4KZA A;  5HAP A;  1SHV A;  4GKU A;  4PMA A;  3FV7 A;  4F94 A;  5EEC A;  5FI2 A;  5GLA A;  1LI0 A;  4E3O A;  3EQV A;  1DJA A;  5TGF A;  1SCW A;  1XA1 A;  3RXW A;  4S2J A;  1IYQ A;  4KZ9 A;  3UY6 A;  2C5W B;  3G34 A;  1ES3 A;  1CEG A;  3HLC A;  4K0X A;  3Q81 A;  4QJG A;  1HD8 A;  1BLH A;  3V5M A;  5GHX A;  1SDE A;  1XGI A;  2Y2I A;  1PZP A;  3UDI A;  4WZ4 A;  2X71 A;  1GCE A;  3IXG A;  4GZB A;  2ZD8 A;  5CEB A;  3WWX A;  3QHY A;  4DE2 A;  4JLF A;  3LY4 A;  3BFF A;  3BEB A;  1XPB A;  2XD1 A;  5CTM A;  1K4E A;  1KE4 A;  4EWF A;  5GLB A;  4N9K A;  1SKF A;  3Q82 A;  5FDH A;  2EXA A;  3FZC A;  4MEZ A;  4WZ5 A;  4Y0O A;  4IED A;  3G31 A;  4BL3 A;  5GHZ A;  4BLM A;  3HUN A;  4YFM A;  3VP3 A;  3PAE A;  3BEC A;  2EX6 A;  3FWL A;  2FFY A;  2EFU A;  3C4O A;  3UE0 A;  1KDS A;  2ZM2 A;  3OCL A;  1O07 A;  3B3X A;  2WZX A;  3A3E A;  3O88 A;  5CEC A;  1J9M A;  3SH7 A;  5KSH A;  1ES4 A;  3M2K A;  3BYD A;  4OOM A;  4XUX A;  5FQQ A;  2JE5 A;  4WEK A;  3NI9 A;  5G18 A;  4K91 A;  4QD4 A;  2Y2N A;  3O3V A;  3VP1 A;  2ZQC A;  4S2I A;  4X6T A;  3M2J A;  1KGG A;  3ZG5 A;  1L0D A;  2I72 A;  5L2F A;  3ZG7 B;  3AGD A;  4WZ5 C;  5F83 A;  3V50 A;  2EX2 A;  3GQZ A;  3BFD A;  1PI5 A;  4OQ0 A;  1XA7 A;  2P74 A;  2UWX A;  1PW8 A;  2HDU A;  4UA7 A;  4ZTK A;  2XDM A;  3Q7V B;  3SS4 A;  2X01 A;  3VP4 A;  1K55 A;  3ZHH A;  3ITA A;  3LY3 A;  4RVA A;  5M19 A;  5A91 A;  4Y0U A;  3HVF A;  1YQS A;  1WYB A;  3SS5 A;  4DDY A;  5CTN A;  2P9V B;  5HL1 A;  1I5Q A;  1PI4 A;  4WEJ A;  5AQ9 A;  4JXW A;  1ES5 A;  1ERM A;  1Y54 A;  3HLD A;  5AQ7 A;  3GV9 A;  3AGF A;  4KG6 A;  4OPR A;  3OPH A;  3VFH A;  1LL9 A;  2RCX A;  5FQJ A;  1IYO A;  3ISG A;  3BLM A;  2DNS A;  1I2S A;  4KEN B;  2QZ6 A;  5JYO A;  2XD5 A;  3IF6 C;  1IKI A;  5EVI B;  3IXH A;  2WGW B;  1FOF A;  2HDQ A;  1ERO A;  1G68 A;  2Y2G A;  4OPZ A;  4XUZ A;  4ZAM A;  3DWZ A;  3OPR A;  2JC7 A;  4QHC A;  4DE3 A;  4OLG A; 
#chains in the Genus database with same CATH topology
 1U60 A;  1SDN A;  5DJU A;  2K2N A;  2GZA A;  2ZQD A;  1JWP A;  5F82 A;  3C30 A;  4LLO B;  3C5A A;  3NUL A;  1STZ A;  3DAV A;  1BSG A;  4IUH A;  5A92 A;  5L8M A;  1ESI A;  1V9Z A;  5GLD A;  2DCF A;  3IXB A;  4WUJ A;  4D2O A;  4EBL A;  2M1C A;  2OLV A;  1PW1 A;  4NXF A;  4DN0 A;  4DF6 A;  1GHP A;  4U0X A;  4MMN A;  4PAU A;  4PPR A;  2XA7 M;  3N6I A;  4MBF A;  1TS0 A;  2BLS A;  1P9R A;  2P08 A;  4XT2 A;  4OPY A;  2ZQ9 A;  3S7Q A;  3CG5 A;  2Y2K A;  5CGS A;  2VV7 A;  4JKT A;  2ZMV A;  4LCL A;  2H5S A;  3IS2 B;  4G3W A;  4GB7 A;  3CI6 A;  4CJN A;  4PM5 A;  1YLP A;  4CLC B;  2OWJ A;  5CRF A;  4HIA A;  1K57 C;  2WUQ A;  1FQG A;  1OTE A;  2PR5 A;  4R38 A;  5JYP A;  2Y91 A;  2UV0 E;  3HLW A;  4U3T A;  2DRW A;  1TS7 A;  3CMZ A;  4IVI A;  3MQ0 A;  4KZ7 A;  4JPM A;  3ITB A;  3UE3 A;  5IHV A;  2Y59 A;  4JXS A;  1N9B A;  3HJK A;  5EPH A;  3S1Y A;  4NK3 A;  1S67 L;  3NHQ A;  3NOT C;  3R7W B;  3C7U A;  4WYY A;  3UO9 A;  5GHY A;  1VHM A;  5TFQ A;  4BD0 A;  3MSH A;  4ETZ A;  1K56 D;  2L4R A;  2VGL M;  5E2G A;  3ZDJ A;  4HEF A;  1Z6F A;  4R3B A;  1BYW A;  2W27 A;  1KVM A;  1Z09 A;  4R0Q A;  1W7F A;  3NBL A;  1LSV A;  3DBA A;  3Q7V A;  3GTC A;  3VE3 A;  1IEL A;  4DXB A;  1YLY A;  1P0Z A;  3W8K A;  3PBO A;  5EVI D;  4O0P A;  3LFV A;  2W0N A;  1OJG A;  1T1B A;  4M4X A;  3WS0 A;  2O9B A;  4LEN A;  3S7P A;  5EVI A;  2KX6 A;  3TJZ C;  1L0G A;  4EV4 A;  4Y17 A;  4UA9 A;  3NY4 A;  4DE0 A;  3TSG A;  2D02 A;  4IBX A;  4S2N A;  3UNW A;  1S1Y A;  3H82 A;  2ZQ7 A;  1BZA A;  2V8F A;  3KSF A;  1BTL A;  4DJ3 A;  3S4X A;  4FSF A;  3C38 A;  3GR2 A;  3MZF A;  4ZRR A;  3IWO A;  3KX0 X;  1MKI A;  2QHK A;  1K4F A;  2V9A A;  4ZJ3 A;  3E2K A;  2J8Y A;  4Q0H A;  3IHB A;  4Y3I A;  2WAD A;  2HP6 A;  4JGR A;  2ZQA A;  5CER A;  4DRT A;  2Y8H A;  3P01 A;  3HLB A;  2QMI A;  2V0W A;  1CK3 A;  2L1M A;  1Y28 A;  1GA9 A;  4JGQ A;  5BOH A;  1OTD A;  1PNE A;  2QJ5 A;  1KOU A;  2Z6D A;  2Y2P A;  4Y5F A;  3HLE A;  3KSI A;  1KVL A;  5DF8 A;  2Y55 A;  3EOI A;  1NJ4 A;  4RYE A;  4FOF A;  3N8R A;  4H6J A;  1W63 M;  1YPR A;  1NXY A;  3NOU C;  4DDS A;  1LSW A;  2K7S A;  5EVE A;  3ZFZ A;  4EBP A;  3BQ8 A;  2W1T B;  1QME A;  3IT9 A;  2WAF A;  3H7W A;  5HL6 A;  3ZYT A;  3E98 A;  2HF6 A;  4KZ8 A;  4GN2 A;  3E4P A;  4JF5 A;  3F1P A;  3HL9 A;  3T12 B;  2ZC7 A;  2LB9 A;  4I5S A;  4U0T A;  2JKF A;  1N4O A;  3G35 A;  2CMN A;  4E3N A;  3FYZ A;  2LB5 A;  3OZH A;  1GHM A;  3CLO A;  2OOL A;  1LI9 A;  1UWP X;  3DTE A;  4L9F A;  4QY5 A;  1SKO B;  2M7V A;  1S4R A;  1PWC A;  4LV3 A;  3LEQ A;  1CI9 A;  1MPL A;  2HP5 A;  1W63 Q;  3GSG A;  4MN7 A;  3B47 A;  2EWW A;  4N9L A;  3A0R A;  4RQ9 A;  4OP8 A;  4OOY A;  1X0O A;  2Y2O A;  1ES2 A;  2VEA A;  4S2P A;  3BM6 A;  1HVB A;  1D06 A;  4C6Y A;  4I38 A;  1XJ3 A;  4WEL A;  2XEP A;  5HAP A;  4PMA A;  3FV7 A;  5EEC A;  5GLA A;  2KLI A;  4E3O A;  3EQV A;  2PBD P;  1SCW A;  3BQA A;  4LRZ E;  1P97 A;  4I3A A;  4G3K A;  1VEU A;  3TE8 A;  4QJG A;  3V5M A;  1SDE A;  3MFX A;  3PYP A;  2X71 A;  2W3G A;  4DE2 A;  3BEB A;  4EWF A;  2EXA A;  3FZC A;  3T4S A;  4Y0O A;  3G31 A;  4HHD A;  4BL3 A;  2M7U A;  4BLM A;  3HUN A;  3PAE A;  3F1N B;  4P6Z M;  1O07 A;  4DJ2 A;  5KSH A;  2A2L A;  1N9L A;  1NLZ A;  2Y2N A;  2ZQC A;  4S2I A;  2QWS A;  3IBJ A;  1L0D A;  2I72 A;  5FDS A;  4ARZ B;  5K5B A;  2EX2 A;  3GQZ A;  2L0W A;  3LIA A;  2UWX A;  2HDU A;  4UA7 A;  3DTI A;  3VP4 A;  2XDM A;  3SS4 A;  1K55 A;  5M19 A;  5A91 A;  4GJ4 A;  1PI4 A;  3GV9 A;  3AGF A;  3CPT B;  3OPH A;  2RCX A;  1IYO A;  1D7E A;  4EEP A;  2DNS A;  1TF1 A;  4KEN B;  2QZ6 A;  4X1L A;  1DP9 A;  4HI4 A;  2WGW B;  1S66 L;  3DWZ A;  2JC7 A;  4QHC A;  4DE3 A;  1L0F A;  3NCK A;  1LSX A;  1S6R A;  1F98 A;  3MFD A;  4KZ6 A;  5U47 A;  3JPU A;  1ERQ A;  5DF7 A;  3UN7 A;  3HBR A;  4BEN A;  1BUL A;  4KUK A;  4KQQ A;  2BTF P;  4WL9 A;  1VB6 A;  4ZDX A;  1VM1 A;  1XFN A;  4L0L A;  1AWI A;  3VOZ A;  1J3W A;  3W4Q A;  3KYE A;  2XF3 A;  3LO7 A;  3P7N A;  1Q2Q A;  5HW3 A;  4HBT A;  4NXG A;  1IOU A;  3UE6 A;  4B4Z A;  4L9G A;  2WKQ A;  1ZTU A;  5F1F A;  4KUO A;  4QPR A;  4CPK A;  5EVL A;  1PZO A;  1K57 A;  3VMA A;  1H8Y A;  4GD8 A;  4LCM A;  2Y4A A;  4GW9 A;  1F2K A;  4HY8 A;  1E4D A;  1NLY A;  4LRY C;  3H9W A;  4XXR A;  2XK1 A;  4NET A;  1V9Y A;  3UB9 A;  5HWT A;  3F1O B;  1M6K A;  1CF0 A;  2VA0 A;  5HFO A;  1UGU A;  1PRQ A;  4R4S A;  4K0W A;  2H10 A;  1OPX A;  3G6O A;  3RTY A;  3SW1 A;  2Y2J A;  3CHW P;  3IX3 A;  1MZU A;  3C8C A;  1NYY A;  3LIC A;  1ODV A;  3IF5 A;  3U4L P;  3T4O A;  3FKV A;  4OP5 A;  2Z2M B;  1PIO A;  4O7D A;  1NRJ A;  4EBN A;  5FAT A;  1ALQ A;  5EUA A;  3MXR A;  2ZJ9 A;  4ZBE A;  3IF6 A;  1H8Z A;  1BUE A;  3E2L A;  4OQI A;  3MKF A;  2OV5 A;  1LHY A;  3TG9 A;  3IH9 A;  5AQA A;  4E6W A;  2FFF B;  3C7V A;  4B93 A;  1UWN X;  1G28 A;  1K0K A;  4C75 A;  1JTG A;  2J9P A;  3MXQ A;  4FUW A;  3BW6 A;  1W8Y A;  3SH8 A;  2PU2 A;  1GSV A;  3HUM A;  3ZG0 A;  5EV0 A;  2XGN A;  1TS8 A;  1K38 A;  1ZC2 A;  2V1Z A;  3N4I A;  3NJA A;  1BLC A;  4D60 A;  3DW0 A;  4LV1 A;  3UB6 A;  2P9V A;  3QP8 A;  1N9O A;  3BLS A;  4FCF A;  3G30 A;  1IYP A;  1XP4 A;  4ZJ1 A;  2VGJ A;  3QNC A;  3LIF A;  4HP9 A;  1KGF A;  3ZG8 B;  2ZOH A;  2Y2M A;  2WZZ A;  4X69 A;  3D9Y A;  3LR0 A;  4X56 A;  5DTT A;  4BWI A;  1HZO A;  1YKD A;  4BQM A;  4Y2F A;  3OC2 A;  5C5K A;  5KSC A;  4S2M A;  3QNB A;  5FAO A;  5HDC A;  4E3I A;  2HV1 A;  1TDL A;  4MNR A;  4ZJ2 A;  1ZG4 A;  3LCE A;  3OLO A;  3BJN A;  4UQI S;  3VSL A;  4GDN A;  3OPP A;  2W3H A;  1FR6 A;  2PDR A;  4GDB A;  1W8Q A;  1E3U D;  1QMF A;  2Y2L A;  3CUE C;  2Y79 A;  1E25 A;  1KDW A;  2JKR M;  5F5Y A;  2JKR I;  1E3U A;  2H0T A;  2H28 A;  4N1H A;  1MY8 A;  5TJJ A;  1BLP A;  4CLC D;  5FQI A;  5A90 A;  5HD5 A;  2IA2 A;  3KYZ A;  2IWD A;  3MMH A;  4UHU A;  4OVD A;  4CLC A;  5FQK A;  3OBF A;  3MR0 A;  3IBR A;  3HUO A;  3N8S A;  4Q8I A;  1W5D A;  1YMX A;  1FSW A;  2Z6C A;  3HRE A;  2EFX A;  2J7V A;  3NC8 A;  3QP1 A;  4RA7 A;  5F1G A;  3P98 A;  5FL3 A;  3M6B A;  2XQZ A;  3W2Z A;  3UDF A;  2ZC3 B;  4IVK A;  4HBU A;  5J8X A;  5F6A A;  3BFC A;  5AVE A;  4BMW A;  2X02 A;  3VP2 A;  1CEF A;  4KZ4 A;  1K56 A;  3RH8 B;  3R7W A;  1S4S A;  5LBR A;  3WRT A;  1JWV A;  3N8L A;  5HX9 A;  2B18 A;  2RL3 A;  3LR5 A;  3E0Y A;  3PHY A;  3C2W A;  3BFE A;  2XFT A;  1K54 A;  3ICY A;  3RFB A;  1C3B A;  3PBS A;  3LYX A;  4P85 A;  5E43 A;  5DF9 A;  4R1G A;  3O5Y A;  2MJ6 A;  2WGI A;  5E2H A;  3VP0 A;  4LRX C;  1PWG A;  3CIT A;  3CZD A;  5KMW A;  1YSQ A;  1T1C A;  1D1J A;  5I94 A;  2WAE A;  2HPB A;  1Q2P A;  3B33 A;  2XLN A;  3H82 B;  5HAI A;  3VFF A;  3CAX A;  4Y15 A;  2V1A A;  3EGD C;  3S22 A;  1FIK A;  4QWO A;  5EM1 A;  1A0K A;  4KZA A;  1MKM A;  2B95 A;  2QKP A;  4NXE A;  4F94 A;  1XA1 A;  3RXW A;  5L09 A;  1ES3 A;  3Q81 A;  1BLH A;  4DMZ A;  2Y2I A;  3KYQ A;  3UDI A;  4O01 A;  2PD8 A;  3FPV A;  2ZD8 A;  2O0Y A;  4R3A A;  1XPB A;  5F69 A;  5CTM A;  5GLB A;  4N9K A;  3Q82 A;  2GJ3 A;  3T1R A;  3MQO A;  5DKL A;  5GHZ A;  4YFM A;  3VP3 A;  2EX6 A;  4CLC E;  2FFY A;  2E8J A;  1KDS A;  4H6J B;  3B3X A;  2WZX A;  3O88 A;  4OOM A;  4PKY G;  2B02 A;  4WEK A;  5AVF A;  5G18 A;  2INW A;  4X6T A;  2VJW A;  1VET A;  3UME A;  5L2F A;  3ZG7 B;  3AGD A;  4O8G A;  4WZ5 C;  1DP6 A;  5F83 A;  3V50 A;  4R6L A;  1PI5 A;  1XA7 A;  3F1P B;  3K3D A;  3LY3 A;  4RVA A;  4NKP A;  5J4E A;  5AQ9 A;  1ES5 A;  1S1Z A;  1Y54 A;  3HLD A;  4Q0J A;  5AQ7 A;  4KG6 A;  4OPR A;  3VFH A;  1LL9 A;  4MCW A;  3ISG A;  2XA7 S;  3BLM A;  1I2S A;  2XD5 A;  4L9E A;  3A0V A;  2HDQ A;  1ERO A;  1G68 A;  2Y2G A;  3TRC A;  2P04 A;  1OT9 A;  4LPZ A;  2W1T A;  1S0W A;  3UB7 A;  2PU4 A;  1DJB A;  2IWC A;  4WM9 A;  4X1M A;  1G6O A;  4QU3 A;  4K08 A;  5CED A;  1JWZ A;  2WKE A;  3UE1 A;  2JKG A;  4PHT A;  1RGY A;  4OOL A;  2R9W A;  5HAQ A;  4OLD A;  2KDK A;  1DRM A;  4OPQ A;  4Y7P A;  3IXD A;  4IUK A;  3IWI A;  5FI6 A;  4EQ1 A;  1XX2 A;  1EI5 A;  5TBM B;  1BLS A;  1K25 A;  2V20 A;  5GLC A;  2P7J A;  4E3L A;  4YNR A;  4R23 A;  2Z2L B;  5HDS A;  3GMW A;  2GNX A;  2HJ9 C;  5G4Y A;  1F9I A;  3W4P A;  2C6W B;  1EWZ A;  3JVU A;  2IWB A;  2V2F F;  4QB8 A;  1JTD A;  2EXB A;  1O7E A;  4WLA A;  3V67 A;  3KSH A;  5DFY A;  1NY0 A;  1XGJ A;  1T18 A;  3PBT A;  1PFL A;  5F68 A;  5HD3 A;  3I7J A;  4EES A;  1NZU A;  3LUQ A;  5CHU A;  5DVA A;  2HP9 A;  2ZMA A;  4GS9 B;  1ZG6 A;  4S2N C;  2PR6 A;  3VSK A;  3ZVT A;  2J3T C;  1GHI A;  4UAA A;  1DJC A;  1YT4 A;  1AXB A;  5KIZ A;  1ZKJ A;  1M40 A;  1MWU A;  3ZGA B;  4F3L B;  4FH2 A;  1MWS A;  2OLU A;  2B5R A;  3F1N A;  1MWT A;  1MC0 A;  1YLZ A;  1OT6 A;  5IS1 A;  3K3C A;  3FKW A;  5CGW A;  1FCO A;  1OJ5 A;  5GL9 A;  4EER A;  4X68 A;  3LR4 A;  4FTX A;  3S7O A;  4OKP A;  4EUV A;  4P6B A;  4R3J A;  3WS5 A;  4ARZ A;  3KO6 A;  4HQA A;  4PM6 A;  2W1R A;  3QP2 A;  2G7U A;  1RCJ A;  5FAP A;  1OTB A;  3P09 A;  4P87 A;  3A3I A;  1MBL A;  1WYC A;  4S2K A;  1TEM A;  2OAP 1;  4MN5 A;  2VGK A;  4GLQ A;  4WF0 A;  3DTM A;  5DJT A;  3CPT A;  4B88 A;  1XXM A;  5HAR A;  1TDG A;  3IQA A;  3T50 A;  3T4J A;  4Y0T A;  1RP5 A;  4DXC A;  1OTI A;  3LGO A;  4I3J A;  4PM8 A;  1H3Q A;  3IWQ A;  2YKF A;  4AFI A;  1YAX A;  5FEF A;  2ZOI A;  3EEA A;  2G2W A;  4KQR A;  1L2S A;  2OWH A;  3PBR A;  2K31 A;  3IH8 A;  3WS1 A;  5DFX A;  4EU0 A;  3EQU A;  3GRJ A;  3T1X A;  2VK3 A;  3OOV A;  4WMC D;  3QP5 A;  3IX4 A;  3PBQ A;  1H0M A;  1PWD A;  1GA0 A;  1FSY A;  3OPL A;  3M6H A;  4NEE D;  1LT0 A;  1OTA A;  4JGO A;  2I9V A;  3TW8 A;  3PXP A;  3V3R A;  2A3U A;  4WMC A;  5D3O A;  2HJE A;  4BD1 A;  2H0Y A;  2ZL1 A;  4B9O A;  4G3V A;  3B42 A;  3SH9 A;  5KZH A;  1G6A A;  2HGV A;  4HP4 A;  4S2O A;  1YLW A;  1NYM A;  2VKS A;  1XJ4 A;  2PRF A;  3IF6 B;  5E2F A;  2ZC4 B;  4GHI B;  2A24 A;  1YLJ A;  5AQB A;  4WBG A;  2VLG A;  3F1O A;  4UA6 A;  3RJU A;  2FZ0 A;  4KZ5 A;  1LL5 A;  4Y13 A;  5HDD A;  2ZC6 B;  3G2Z A;  3ZCZ A;  3GEC A;  3PBN A;  1WE4 A;  5L10 A;  4WN5 A;  1DP8 A;  4ID4 A;  5A8B A;  3Q07 A;  4KG2 A;  3PAG A;  4JXV A;  4EW7 A;  2PYR A;  1SZV A;  2E8I A;  3R4K A;  4HJ4 A;  4EQI A;  5FAS A;  4JBF A;  3UB5 P;  2XH9 A;  2ZMF A;  4LGW A;  3GVB A;  4JF4 A;  5TR7 A;  4ME4 A;  3BY9 A;  1KE0 A;  2YKH A;  1MWR A;  4E3K A;  4MDZ A;  1BT5 A;  1IFQ A;  2Q9N A;  4B4X A;  2J9O A;  4GOG A;  3DWK A;  4Z9Q A;  1YM1 A;  4I3I A;  3T4Q A;  2WYX A;  2PYP A;  4R70 A;  1XFQ A;  3MKE A;  1K55 C;  3TOI A;  1MXO A;  2XRN A;  2FH5 A;  3NDG A;  4KG5 A;  1KGE A;  3O87 A;  4OQH A;  2VX8 A;  5EE8 A;  3KSG A;  4XT2 B;  4YIN A;  5HPI A;  2ZBB A;  3E4O A;  5FA7 A;  2XR0 A;  4P6Z S;  2ZM0 A;  1NZO A;  3W4O A;  2JCH A;  2O99 A;  3A3F A;  3VOY A;  4YOF A;  5G4Z A;  4GCZ A;  1OME A;  3ZQ5 A;  5FI2 A;  1LI0 A;  2DMW A;  3BY8 A;  2OAQ 1;  5TGF A;  1IYQ A;  4KZ9 A;  2O9A A;  3L7H A;  3UY6 A;  3EGX C;  2C5W B;  1PZP A;  2O9C A;  4WZ4 A;  1GCE A;  5CEB A;  3QHY A;  4JLF A;  3LY4 A;  4EET B;  2XD1 A;  1L3L A;  1K4E A;  1KE4 A;  1SKF A;  5FDH A;  5HZH A;  4MEZ A;  4WZ5 A;  3IS2 A;  2EA9 A;  3FWL A;  2NUT C;  3C4O A;  2EFU A;  3UE0 A;  2ZM2 A;  3IX8 A;  3A3E A;  1J9M A;  1ES4 A;  3M2K A;  3BYD A;  5FQQ A;  2JE5 A;  2BAS A;  2XSS A;  3L9K A;  3O3V A;  1KGG A;  3T4T A;  5HPF A;  4BBT A;  3LIB A;  1Y4O A;  2P74 A;  3Q7V B;  2X01 A;  3ZHH A;  3ITA A;  4Y0U A;  1WYB A;  4DDY A;  5CTN A;  5HL1 A;  1I5Q A;  4JXW A;  4ETX A;  1ERM A;  3CWF A;  3SZT A;  5FQJ A;  1YSP A;  5JYO A;  3IF6 C;  2PD7 A;  1IKI A;  5EVI B;  1FOF A;  3GDI A;  3OPR A;  5DKK A;  4OLG A;  1ACF A;  2VZW A;  3HLF A;  4BBU A;  4RX2 A;  4Z1W A;  1DY6 A;  2CC1 A;  1HTZ A;  3LR3 A;  2ZC5 B;  4HJ6 A;  3BWL A;  1XJ2 A;  1W79 A;  1FIL A;  4II7 A;  4N92 A;  5HWW A;  4MBK A;  5A93 A;  2V0U A;  3CJM A;  3MJQ A;  4HNB A;  2V8C A;  5CGX A;  3LI9 A;  3NOP C;  4X25 A;  5IT5 A;  3HLG A;  4CQH A;  1CQA A;  2HDR A;  1H5X A;  3MZD A;  1NWZ A;  2EX8 A;  2J3T D;  3G32 A;  2J80 A;  4E3M A;  1PYY A;  3D3O A;  2WKI A;  3ZNT A;  4QY6 A;  3G2Y A;  3A3J A;  2J3W A;  3HJI A;  2WKH A;  3MF0 A;  1TVF A;  1LL8 A;  2A49 A;  3LIE A;  1JVJ A;  3C4P A;  3JVV A;  4RX3 A;  1G5U A;  2VV6 A;  4JXG A;  1ESU A;  1XJ6 A;  4EUZ A;  2ZQ8 A;  4N1X A;  3D4F A;  4PM7 A;  5FSR A;  1VET B;  1RGZ A;  3O86 A;  4GNU A;  3UPN A;  5DTS A;  3H7W B;  4GD6 A;  2GDN A;  4KZ3 A;  4S2L A;  4DKI A;  3Q7Z A;  2NUP C;  3A3D A;  3AGE A;  1EW0 A;  2XRO A;  3K2N A;  3PTE A;  1WA9 A;  3QP4 A;  3MBZ A;  2HZ5 A;  5FEG A;  4HH2 A;  4UEY A;  4C3Q A;  1JNU A;  4YWZ A;  3QP6 A;  3OCN A;  1FR1 A;  3T4K A;  3WS2 A;  3VE4 A;  4A5R A;  3HCY A;  3T1Q B;  3NDE A;  4LV0 A;  4CLC C;  3NEC A;  4R4R A;  2W3D A;  4KQD A;  5L07 A;  3MZE A;  3G4P A;  4MLL A;  3RXX A;  1P9W A;  2XFS A;  3WRZ A;  1LLB A;  5FAQ A;  2PBY A;  3BRM A;  2EX9 A;  5AJG A;  3SOI A;  1FCM A;  2JBF A;  3IHA A;  4HES A;  3V39 A;  1CJF A;  1SKO A;  5MC7 A;  1VEU B;  3U2A A;  2WKP A;  3UDX A;  1IYS A;  5EFW A;  1K54 C;  5FQM A;  2WK0 A;  4HOI A;  3V3S A;  1T1A A;  2HDS A;  5M1A A;  1GSW A;  2JN7 A;  1ZHH B;  1T19 A;  5EVI C;  4E3J A;  5EM0 A;  1K6R A;  4FH4 A;  2V1B A;  1YMS A;  2VGL S;  5TBM A;  2QPN A;  4JGP A;  3NIA A;  3FPW A;  3PR6 A;  2OSU A;  3MXS A;  2QJ7 A;  3FC7 A;  2W3E A;  4NG2 A;  5HWV A;  5EOE A;  1N9N A;  4I39 A;  5DTK A;  4IBR A;  2BG1 A;  1IKG A;  3BFG A;  3LI8 A;  5M18 A;  3SS3 A;  4OON A;  2R78 A;  3N7W A;  5E2E A;  3ZNY A;  1FCN A;  3S7N A;  4FD8 A;  4UQI M;  4GS9 A;  1XKZ A;  5EOO A;  4KQO A;  4X53 A;  4EXO A;  3JYI A;  2ZM8 A;  4H8R A;  4P0M A;  4BL2 A;  4Q0I A;  4KZB A;  1TS6 A;  5FQ9 A;  2GX5 A;  1VQQ A;  1K6S A;  2PAV P;  3UPO A;  4E6X A;  1L0E A;  3LEZ A;  1I2W A;  4F3L A;  4MN6 A;  4NXB A;  4PM9 A;  1KE3 A;  2AVX A;  3LID A;  3MS6 A;  4LV2 A;  4OQG A;  2WKR A;  4OH0 A;  1IEM A;  2Q9M A;  2KOI A;  4PKY A;  5CHM A;  3DTK A;  4MBH A;  1HLU P;  3T4L A;  5CXW A;  3Q1F A;  3ZVW A;  1ONG A;  3ZG9 B;  2ZLY A;  1ONH A;  2G2U A;  2WGW A;  2WGV A;  1YLT A;  2R9X A;  3UPP A;  2Q0O A;  3E4Q A;  5FI7 A;  4M3K A;  4X55 A;  3CUE A;  2Y2Q A;  4BJP A;  4DE1 A;  1NRF A;  5CHJ A;  3UB8 A;  4JF6 A;  4HH3 A;  2JKT M;  3MQQ A;  5CX7 A;  2JKT I;  3WS4 A;  1CI8 A;  2Y2H A;  2QYB A;  5HSQ A;  1SHV A;  4GKU A;  2ZL1 B;  1DJA A;  3UMD A;  3VV4 A;  4IJG A;  5J7E A;  1TD5 A;  4S2J A;  3FG8 A;  3G34 A;  1CEG A;  3HLC A;  4K0X A;  1HD8 A;  5GHX A;  1XGI A;  2JHE A;  3IXG A;  4GZB A;  3WWX A;  2A24 B;  2D01 A;  3EEH A;  3BFF A;  5J3W A;  3ULF A;  2EWV A;  1F5M A;  4IED A;  3BEC A;  4ESP A;  2W3F A;  3A0S A;  5I5L A;  2ACG A;  3OCL A;  5CEC A;  3SH7 A;  4IHQ A;  4XUX A;  3NI9 A;  1H8M A;  4K91 A;  4QD4 A;  3VP1 A;  3M2J A;  3ZG5 A;  3BFD A;  4OQ0 A;  4GHI A;  4ZTK A;  1PW8 A;  4HJ3 A;  3HVF A;  1YQS A;  3SS5 A;  2PHY A;  2P9V B;  3D72 A;  4WEJ A;  3T1S A;  2PT7 A;  2VV8 A;  3EWK A;  1GSX A;  4E04 A;  5IU1 A;  3VOL A;  4LFU A;  4BBV A;  4EEU A;  3IXH A;  4OPZ A;  4XUZ A;  4ZAM A; 
#chains in the Genus database with same CATH homology
 1L0F A;  3NCK A;  1S0W A;  2PU4 A;  1S6R A;  1DJB A;  3MFD A;  4KZ6 A;  3HLF A;  5U47 A;  4RX2 A;  2IWC A;  1DY6 A;  2CC1 A;  1HTZ A;  4WM9 A;  2ZC5 B;  1U60 A;  1SDN A;  1ERQ A;  4QU3 A;  5DF7 A;  3UN7 A;  3HBR A;  2ZQD A;  1JWP A;  5F82 A;  4BEN A;  1BUL A;  1JWZ A;  4KQQ A;  3C5A A;  5CED A;  4ZDX A;  1VM1 A;  1W79 A;  2WKE A;  3UE1 A;  1BSG A;  4L0L A;  1RGY A;  4N92 A;  4OOL A;  4MBK A;  2R9W A;  3VOZ A;  5HAQ A;  4OLD A;  3CJM A;  3W4Q A;  5A92 A;  5A93 A;  4OPQ A;  4Y7P A;  3IXD A;  1ESI A;  5GLD A;  2XF3 A;  2DCF A;  3LO7 A;  1Q2Q A;  5CGX A;  3IXB A;  5HW3 A;  4HBT A;  4D2O A;  3IWI A;  5FI6 A;  4EBL A;  1XX2 A;  4B4Z A;  1EI5 A;  2OLV A;  1PW1 A;  3HLG A;  1BLS A;  4DF6 A;  1K25 A;  1GHP A;  2V20 A;  5F1F A;  2HDR A;  5GLC A;  1H5X A;  4CPK A;  4U0X A;  3MZD A;  5EVL A;  4E3L A;  2EX8 A;  1PZO A;  1K57 A;  4PPR A;  3N6I A;  4R23 A;  3VMA A;  1H8Y A;  3G32 A;  4MBF A;  4E3M A;  2Z2L B;  4GD8 A;  3GMW A;  4OPY A;  2BLS A;  1PYY A;  2ZQ9 A;  3W4P A;  2WKI A;  3CG5 A;  4LCM A;  2Y2K A;  5CGS A;  2C6W B;  3ZNT A;  1EWZ A;  4QY6 A;  3G2Y A;  2IWB A;  2V2F F;  4QB8 A;  2Y4A A;  3A3J A;  1JTD A;  2EXB A;  1O7E A;  4JKT A;  2WKH A;  1E4D A;  4LCL A;  1TVF A;  2H5S A;  2A49 A;  1JVJ A;  4XXR A;  4GB7 A;  2XK1 A;  4CJN A;  3C4P A;  4RX3 A;  1NY0 A;  4PM5 A;  4NET A;  4JXG A;  1XGJ A;  1YLP A;  3PBT A;  1ESU A;  1M6K A;  3UPN A;  5HFO A;  5CRF A;  4R4S A;  1K57 C;  2WUQ A;  4EUZ A;  1FQG A;  4K0W A;  3I7J A;  5JYP A;  2H10 A;  2ZQ8 A;  2Y91 A;  1NZU A;  3HLW A;  4U3T A;  5CHU A;  5DVA A;  2Y2J A;  2HP9 A;  2DRW A;  2ZMA A;  1ZG6 A;  3CMZ A;  4N1X A;  4S2N C;  4IVI A;  3D4F A;  1NYY A;  4PM7 A;  5FSR A;  1RGZ A;  3O86 A;  4KZ7 A;  3VSK A;  3ZVT A;  4JPM A;  1GHI A;  3IF5 A;  3ITB A;  3FKV A;  4UAA A;  4OP5 A;  3UE3 A;  2Z2M B;  1PIO A;  4O7D A;  4GNU A;  5IHV A;  2Y59 A;  1DJC A;  1YT4 A;  1ALQ A;  4JXS A;  1N9B A;  5EPH A;  5FAT A;  3S1Y A;  5EUA A;  3MXR A;  1AXB A;  2ZJ9 A;  4NK3 A;  5DTS A;  4GD6 A;  4ZBE A;  1ZKJ A;  3IF6 A;  2GDN A;  4KZ3 A;  4S2L A;  1H8Z A;  1M40 A;  3C7U A;  4DKI A;  1MWU A;  3ZGA B;  3Q7Z A;  1BUE A;  3E2L A;  4OQI A;  3MKF A;  2OV5 A;  1LHY A;  4FH2 A;  3A3D A;  3AGE A;  4WYY A;  3UO9 A;  1MWS A;  3IH9 A;  5GHY A;  2OLU A;  3TG9 A;  3PTE A;  5AQA A;  2B5R A;  1MWT A;  1YLZ A;  4E6W A;  5TFQ A;  4BD0 A;  3FKW A;  5CGW A;  3MBZ A;  2FFF B;  1FCO A;  1K56 D;  4C3Q A;  5GL9 A;  4X68 A;  3OCN A;  3C7V A;  1FR1 A;  3WS2 A;  4OKP A;  5E2G A;  3ZDJ A;  4HEF A;  4C75 A;  1JTG A;  4A5R A;  2J9P A;  1Z6F A;  1W8Y A;  3NDE A;  4R3B A;  3SH8 A;  2PU2 A;  4LV0 A;  4P6B A;  1KVM A;  4R3J A;  3WS5 A;  4R0Q A;  3HUM A;  4R4R A;  3ZG0 A;  1W7F A;  3NBL A;  2XGN A;  4PM6 A;  1K38 A;  1ZC2 A;  2V1Z A;  3MZE A;  3Q7V A;  3G4P A;  4MLL A;  3RXX A;  3GTC A;  3N4I A;  1BLC A;  1RCJ A;  1IEL A;  4DXB A;  3DW0 A;  5FAP A;  1YLY A;  3W8K A;  3P09 A;  4LV1 A;  3A3I A;  2P9V A;  4P87 A;  1MBL A;  1WYC A;  3PBO A;  4S2K A;  1TEM A;  5EVI D;  2XFS A;  2VGK A;  3WRZ A;  1LLB A;  3DTM A;  3BLS A;  4FCF A;  4B88 A;  5FAQ A;  1XXM A;  2PBY A;  3BRM A;  2EX9 A;  3G30 A;  3SOI A;  3WS0 A;  4LEN A;  5HAR A;  1IYP A;  1FCM A;  1TDG A;  3IQA A;  1XP4 A;  1RP5 A;  4Y0T A;  2JBF A;  4DXC A;  4ZJ1 A;  5EVI A;  2VGJ A;  4PM8 A;  3QNC A;  3IWQ A;  3IHA A;  1KGF A;  4HES A;  3ZG8 B;  3V39 A;  2Y2M A;  2WZZ A;  1L0G A;  4X69 A;  4X56 A;  4EV4 A;  2G2W A;  4KQR A;  5DTT A;  4UA9 A;  3NY4 A;  1L2S A;  3UDX A;  4DE0 A;  1HZO A;  1IYS A;  3TSG A;  3PBR A;  1K54 C;  5FQM A;  2WK0 A;  3IH8 A;  3WS1 A;  4BQM A;  3OC2 A;  3V3S A;  5KSC A;  3EQU A;  4S2M A;  3QNB A;  3GRJ A;  4IBX A;  2HDS A;  4S2N A;  5M1A A;  5FAO A;  3UNW A;  4WMC D;  2ZQ7 A;  4E3I A;  4ZJ2 A;  1TDL A;  3PBQ A;  4MNR A;  5EVI C;  1ZG4 A;  4E3J A;  1PWD A;  1BZA A;  3LCE A;  3VSL A;  1GA0 A;  1FSY A;  3OPL A;  1BTL A;  3M6H A;  1K6R A;  4GDN A;  3OPP A;  3S4X A;  3GR2 A;  4FH4 A;  3MZF A;  4FSF A;  3IWO A;  1FR6 A;  1MKI A;  4GDB A;  3V3R A;  1W8Q A;  1E3U D;  2A3U A;  1YMS A;  1K4F A;  4WMC A;  5D3O A;  4ZJ3 A;  1QMF A;  3E2K A;  2J8Y A;  4BD1 A;  2QPN A;  2Y2L A;  2H0Y A;  3IHB A;  1E25 A;  1KDW A;  2WAD A;  3SH9 A;  2HP6 A;  5KZH A;  3NIA A;  1G6A A;  2OSU A;  3MXS A;  4S2O A;  1YLW A;  1NYM A;  2H0T A;  1E3U A;  4N1H A;  1MY8 A;  2ZQA A;  5CER A;  4DRT A;  1BLP A;  3IF6 B;  5E2F A;  3HLB A;  5EOE A;  2QMI A;  1CK3 A;  2ZC4 B;  5FQI A;  1GA9 A;  5A90 A;  5BOH A;  1YLJ A;  5AQB A;  5DTK A;  2IWD A;  4WBG A;  4IBR A;  2BG1 A;  2Y2P A;  3HLE A;  1IKG A;  3BFG A;  1KVL A;  4UHU A;  5M18 A;  4OVD A;  4UA6 A;  5FQK A;  3SS3 A;  4OON A;  5DF8 A;  3RJU A;  2Y55 A;  1NJ4 A;  4KZ5 A;  3HUO A;  3N7W A;  5E2E A;  1LL5 A;  3N8S A;  3ZNY A;  1FCN A;  4Q8I A;  1W5D A;  1YMX A;  1FSW A;  3HRE A;  2ZC6 B;  4RYE A;  3N8R A;  3G2Z A;  2EFX A;  4FD8 A;  3ZCZ A;  2J7V A;  1XKZ A;  3NC8 A;  1NXY A;  4KQO A;  4RA7 A;  5EOO A;  3P98 A;  5F1G A;  3M6B A;  2XQZ A;  4DDS A;  3PBN A;  4X53 A;  3UDF A;  1WE4 A;  3JYI A;  2ZC3 B;  4ID4 A;  2ZM8 A;  4HBU A;  4IVK A;  3ZFZ A;  4H8R A;  4P0M A;  4BL2 A;  4EBN A;  5J8X A;  3Q07 A;  3BFC A;  4KG2 A;  3PAG A;  4JXV A;  2X02 A;  4KZB A;  3VP2 A;  1CEF A;  4EBP A;  4KZ4 A;  1QME A;  3IT9 A;  5FQ9 A;  1K56 A;  2WAF A;  2E8I A;  1VQQ A;  1K6S A;  3WRT A;  1JWV A;  4KZ8 A;  4EQI A;  4E6X A;  3UPO A;  1L0E A;  3LEZ A;  5FAS A;  1I2W A;  3N8L A;  4GN2 A;  4JF5 A;  4JBF A;  5HX9 A;  2XH9 A;  3HL9 A;  4PM9 A;  3GVB A;  4JF4 A;  5TR7 A;  1KE3 A;  2RL3 A;  2ZC7 A;  1KE0 A;  4U0T A;  1MWR A;  4E3K A;  4OQG A;  1BT5 A;  4LV2 A;  2Q9N A;  4B4X A;  1N4O A;  2XFT A;  3BFE A;  1K54 A;  2J9O A;  3G35 A;  4GOG A;  4OH0 A;  3DWK A;  4Z9Q A;  4E3N A;  1C3B A;  1IEM A;  1YM1 A;  3FYZ A;  2Q9M A;  3PBS A;  4P85 A;  2WYX A;  3OZH A;  1GHM A;  5E43 A;  5CHM A;  1LI9 A;  4MBH A;  5DF9 A;  4R1G A;  3MKE A;  5CXW A;  3Q1F A;  3ZVW A;  4QY5 A;  1K55 C;  1ONG A;  2WGI A;  5E2H A;  3TOI A;  1MXO A;  3ZG9 B;  2ZLY A;  1PWC A;  1ONH A;  3VP0 A;  4LV3 A;  2G2U A;  1CI9 A;  1MPL A;  1PWG A;  2HP5 A;  3NDG A;  3GSG A;  4KG5 A;  2WGW A;  2WGV A;  3CZD A;  1YLT A;  2R9X A;  5KMW A;  3UPP A;  1KGE A;  3O87 A;  4OQH A;  4N9L A;  4OP8 A;  4OOY A;  5EE8 A;  5FI7 A;  2Y2O A;  4YIN A;  1ES2 A;  5I94 A;  4S2P A;  2WAE A;  2HPB A;  4M3K A;  4X55 A;  3BM6 A;  1Q2P A;  2XLN A;  5FA7 A;  2Y2Q A;  5HAI A;  2XR0 A;  2ZM0 A;  3VFF A;  1HVB A;  4BJP A;  1NZO A;  4DE1 A;  1NRF A;  3W4O A;  4C6Y A;  2JCH A;  3A3F A;  5CHJ A;  3VOY A;  4JF6 A;  3S22 A;  3WS4 A;  4WEL A;  1CI8 A;  1OME A;  2Y2H A;  2XEP A;  4KZA A;  5HAP A;  1SHV A;  4GKU A;  4PMA A;  3FV7 A;  4F94 A;  5EEC A;  5FI2 A;  5GLA A;  1LI0 A;  4E3O A;  3EQV A;  1DJA A;  5TGF A;  1SCW A;  1XA1 A;  3RXW A;  4S2J A;  1IYQ A;  4KZ9 A;  3UY6 A;  2C5W B;  3G34 A;  1ES3 A;  1CEG A;  3HLC A;  4K0X A;  3Q81 A;  4QJG A;  1HD8 A;  1BLH A;  3V5M A;  5GHX A;  1SDE A;  1XGI A;  2Y2I A;  1PZP A;  3UDI A;  4WZ4 A;  2X71 A;  1GCE A;  3IXG A;  4GZB A;  2ZD8 A;  5CEB A;  3WWX A;  3QHY A;  4DE2 A;  4JLF A;  3LY4 A;  3BFF A;  3BEB A;  1XPB A;  2XD1 A;  5CTM A;  1K4E A;  1KE4 A;  4EWF A;  5GLB A;  4N9K A;  1SKF A;  3Q82 A;  5FDH A;  2EXA A;  3FZC A;  4MEZ A;  4WZ5 A;  4Y0O A;  4IED A;  3G31 A;  4BL3 A;  5GHZ A;  4BLM A;  3HUN A;  4YFM A;  3VP3 A;  3PAE A;  3BEC A;  2EX6 A;  3FWL A;  2FFY A;  2EFU A;  3C4O A;  3UE0 A;  1KDS A;  2ZM2 A;  3OCL A;  1O07 A;  3B3X A;  2WZX A;  3A3E A;  3O88 A;  5CEC A;  1J9M A;  3SH7 A;  5KSH A;  1ES4 A;  3M2K A;  3BYD A;  4OOM A;  4XUX A;  5FQQ A;  2JE5 A;  4WEK A;  3NI9 A;  5G18 A;  4K91 A;  4QD4 A;  2Y2N A;  3O3V A;  3VP1 A;  2ZQC A;  4S2I A;  4X6T A;  3M2J A;  1KGG A;  3ZG5 A;  1L0D A;  2I72 A;  5L2F A;  3ZG7 B;  3AGD A;  4WZ5 C;  5F83 A;  3V50 A;  2EX2 A;  3GQZ A;  3BFD A;  1PI5 A;  4OQ0 A;  1XA7 A;  2P74 A;  2UWX A;  1PW8 A;  2HDU A;  4UA7 A;  4ZTK A;  2XDM A;  3Q7V B;  3SS4 A;  2X01 A;  3VP4 A;  1K55 A;  3ZHH A;  3ITA A;  3LY3 A;  4RVA A;  5M19 A;  5A91 A;  4Y0U A;  3HVF A;  1YQS A;  1WYB A;  3SS5 A;  4DDY A;  5CTN A;  2P9V B;  5HL1 A;  1I5Q A;  1PI4 A;  4WEJ A;  5AQ9 A;  4JXW A;  1ES5 A;  1ERM A;  1Y54 A;  3HLD A;  5AQ7 A;  3GV9 A;  3AGF A;  4KG6 A;  4OPR A;  3OPH A;  3VFH A;  1LL9 A;  2RCX A;  5FQJ A;  1IYO A;  3ISG A;  3BLM A;  2DNS A;  1I2S A;  4KEN B;  2QZ6 A;  5JYO A;  2XD5 A;  3IF6 C;  1IKI A;  5EVI B;  3IXH A;  2WGW B;  1FOF A;  2HDQ A;  1ERO A;  1G68 A;  2Y2G A;  4OPZ A;  4XUZ A;  4ZAM A;  3DWZ A;  3OPR A;  2JC7 A;  4QHC A;  4DE3 A;  4OLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...