3HVQA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of neurabin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
total genus 110
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3hvqA00
2YVTA 3THOB 3FGAC 4UT3A 4FBWA 3H62B 1OIEA 4I5NC 4B2OA 1S3MA 4ORCA 4G9JA 1S3LA 4V0VA 3K7VC 4UWQA 2ZBMA 1TCOA 4LU9A 2HYPA 4DSYA 3RL3A 4MOVA 3ZTVA 3V4YA 2NYLC 4ORBA 1U32A 3HVQA 3H67A 5JPFA 3IB7A 1WAO1 2P6BA 3C5WC 3ICFA 4O5GA 2QJCA 3IB8A 2WDEA 3KBPA 3H64A 3RL5A 2Z72A 4LTYA 2AHDA 3H63A 3GVEA 4XPNA 2WDFA 3H69A 4YKEA 4O4KA 2R17A 1XM7A 1Z2XA 2Z06A 5INBA 4H1SA 4V0WA 1UF3A 2HY1A 3EGGA 4O24A 5C1VA 5IOHA 1XZWA 1OIDA 2O8GA 2BCDA 4IYPC 3K7WC 2BQ8X 1S3NA 1SU1A 4JA7A 4H2BA 3JYFA 1S70A 4KBPA 4TUGA 2WDCA 4ZX2A 2NPPC 3H66A 1QFCA 1IT6A 2JOGA 3AUZA 3LL8A 1HO5A 4FCXA 4LACC 3CK2A 3H61A 1Z2WA 2KKNA 3IVDA 3EGHA 3QFNA 4NZVA 3TGHA 1T71A 5B8IA 4UT3B 4KKZA 2BDXA 1HP1A 1NNWA 3H68A 5JPEA 1T70A 2IE3C 3PSOA 3DSCA 2DFJA 2NYMC 2WDDA 2XMOA 3RQZA 4J6OA 2QFPA 2IE4C 1FJMA 1M63A 4FBQA 4UT2A 4M0VA 3AV0A 4H2IA 2GJUA 1JK7A 3DW8C 5F3WA 1G5BA 3PSNA 4TUIA 3E7BA 2QFRA 4ZVZA 2HYOA 3P71C 4FBKA 2A22A 4DHLA 1WARA 5HPEA 3IVEA 4OR9A 4MP0A 1UTEA 3QFOA 2CV9A 1KBPA 3RL4A 3QFKA 5GTUA 1AUIA 4JA9A 3C9FA 4H2GA 4MOYA 5JJTA 4V0XA 3THNA 5J28A 3QFMA 2O8AA 1USHA 4ORAA 4WWLA 5EQVA 4F0ZA 1V73A 1MF8A 3QG5C 2IAEC 1S95A 1QHWA 4Q7FA 2USHA 1W24A 1S8EA 1OI8A 1HPUA 4DT2A 4H2FA 3DSDA 4I5LC 3E7AA 4IL1A 4H1YP 3ZU0A 2Z1AA 4O43A 1II7A 5DNYA 2NXFA 4HD0A 3N5UA 2Q8UA 3T1IA 3H60A
chains in the Genus database with same CATH superfamily
2YVTA 3THOB 3FGAC 4UT3A 4FBWA 3H62B 1OIEA 4I5NC 4B2OA 1S3MA 4ORCA 2ZO9B 4G9JA 1S3LA 4V0VA 3K7VC 4UWQA 2ZBMA 1TCOA 4LU9A 2HYPA 4DSYA 3RL3A 2DXLA 4MOVA 3ZTVA 3V4YA 2NYLC 4ORBA 1U32A 3HVQA 3H67A 5JPFA 3IB7A 1WAO1 2P6BA 3C5WC 3ICFA 4O5GA 2QJCA 3IB8A 2WDEA 3KBPA 3H64A 3RL5A 2Z72A 4LTYA 2AHDA 3H63A 3GVEA 4XPNA 2WDFA 3H69A 4YKEA 4O4KA 2R17A 1XM7A 1Z2XA 2Z06A 5INBA 4H1SA 4V0WA 1UF3A 2HY1A 3EGGA 4O24A 5C1VA 5IOHA 1XZWA 1OIDA 2O8GA 2BCDA 4IYPC 3K7WC 2BQ8X 1S3NA 1SU1A 2ZOAA 4H2BA 4JA7A 3JYFA 1S70A 4KBPA 4TUGA 2WDCA 4ZX2A 2NPPC 3H66A 1QFCA 1IT6A 2JOGA 3AUZA 3LL8A 3D03A 1HO5A 4FCXA 4LACC 3CK2A 3H61A 1Z2WA 2KKNA 3IVDA 3E0JA 3EGHA 3QFNA 4NZVA 3TGHA 1T71A 5B8IA 4UT3B 4KKZA 2BDXA 1HP1A 1NNWA 3H68A 5JPEA 1T70A 2IE3C 3PSOA 3DSCA 2DFJA 2NYMC 2WDDA 2XMOA 2DXNA 3RQZA 4J6OA 2QFPA 2IE4C 1FJMA 1M63A 4FBQA 4UT2A 4M0VA 3AV0A 4H2IA 2GJUA 1JK7A 3DW8C 5F3WA 1G5BA 2YEQA 3PSNA 4TUIA 3E7BA 2QFRA 4ZVZA 2HYOA 3P71C 4FBKA 2A22A 4DHLA 1WARA 5HPEA 3IVEA 4OR9A 4MP0A 1UTEA 3QFOA 2CV9A 1KBPA 3RL4A 3QFKA 5GTUA 1AUIA 4JA9A 3C9FA 4H2GA 4MOYA 5JJTA 3FLOA 4V0XA 3THNA 3QFMA 5J28A 2O8AA 1USHA 4ORAA 4WWLA 5EQVA 4F0ZA 1V73A 1MF8A 3QG5C 2IAEC 1S95A 1QHWA 4Q7FA 2USHA 1W24A 1S8EA 1OI8A 1HPUA 4DT2A 4H2FA 3DSDA 4I5LC 3E7AA 4IL1A 4H1YP 3ZU0A 2Z1AA 4O43A 1II7A 5DNYA 2NXFA 4HD0A 3N5UA 2Q8UA 3T1IA 3H60A
chains in the Genus database with same CATH topology
2YVTA 3THOB 3FGAC 4UT3A 4FBWA 3H62B 1OIEA 4I5NC 4B2OA 1S3MA 4ORCA 2ZO9B 4G9JA 1S3LA 4V0VA 3K7VC 4UWQA 2ZBMA 1TCOA 4LU9A 2HYPA 4DSYA 3RL3A 2DXLA 4MOVA 3ZTVA 3V4YA 2NYLC 4ORBA 1U32A 3HVQA 3H67A 5JPFA 3IB7A 1WAO1 2P6BA 3C5WC 3ICFA 4O5GA 2QJCA 3IB8A 2WDEA 3KBPA 3H64A 3RL5A 2Z72A 4LTYA 2AHDA 3H63A 3GVEA 4XPNA 2WDFA 3H69A 4YKEA 4O4KA 2R17A 1XM7A 1Z2XA 2Z06A 5INBA 4H1SA 4V0WA 1UF3A 2HY1A 3EGGA 4O24A 5C1VA 5IOHA 1XZWA 1OIDA 2O8GA 2BCDA 4IYPC 3K7WC 2BQ8X 1S3NA 1SU1A 2ZOAA 4H2BA 4JA7A 3JYFA 1S70A 4KBPA 4TUGA 2WDCA 4ZX2A 2NPPC 3H66A 1QFCA 1IT6A 2JOGA 3AUZA 3LL8A 3D03A 1HO5A 4FCXA 4LACC 3CK2A 3H61A 1Z2WA 2KKNA 3IVDA 3E0JA 3EGHA 3QFNA 4NZVA 3TGHA 1T71A 5B8IA 4UT3B 4KKZA 2BDXA 1HP1A 1NNWA 3H68A 5JPEA 1T70A 2IE3C 3PSOA 3DSCA 2DFJA 2NYMC 2WDDA 2XMOA 2DXNA 3RQZA 4J6OA 2QFPA 2IE4C 1FJMA 1M63A 4FBQA 4UT2A 4M0VA 3AV0A 4H2IA 2GJUA 1JK7A 3DW8C 5F3WA 1G5BA 2YEQA 3PSNA 4TUIA 3E7BA 2QFRA 4ZVZA 2HYOA 3P71C 4FBKA 2A22A 4DHLA 1WARA 5HPEA 3IVEA 4OR9A 4MP0A 1UTEA 3QFOA 2CV9A 1KBPA 3RL4A 3QFKA 5GTUA 1AUIA 4JA9A 3C9FA 4H2GA 4MOYA 5JJTA 3FLOA 4V0XA 3THNA 3QFMA 5J28A 2O8AA 1USHA 4ORAA 4WWLA 5EQVA 4F0ZA 1V73A 1MF8A 3QG5C 2IAEC 1S95A 1QHWA 4Q7FA 2USHA 1W24A 1S8EA 1OI8A 1HPUA 4DT2A 4H2FA 3DSDA 4I5LC 3E7AA 4IL1A 4H1YP 3ZU0A 2Z1AA 4O43A 1II7A 5DNYA 2NXFA 4HD0A 3N5UA 2Q8UA 3T1IA 3H60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVT A;  3THO B;  3FGA C;  4UT3 A;  4FBW A;  3H62 B;  1OIE A;  4I5N C;  4B2O A;  1S3M A;  4ORC A;  4G9J A;  1S3L A;  4V0V A;  3K7V C;  4UWQ A;  2ZBM A;  1TCO A;  4LU9 A;  2HYP A;  4DSY A;  3RL3 A;  4MOV A;  3ZTV A;  3V4Y A;  2NYL C;  4ORB A;  1U32 A;  3HVQ A;  3H67 A;  5JPF A;  3IB7 A;  1WAO 1;  2P6B A;  3C5W C;  3ICF A;  4O5G A;  2QJC A;  3IB8 A;  2WDE A;  3KBP A;  3H64 A;  3RL5 A;  2Z72 A;  4LTY A;  2AHD A;  3H63 A;  3GVE A;  4XPN A;  2WDF A;  3H69 A;  4YKE A;  4O4K A;  2R17 A;  1XM7 A;  1Z2X A;  2Z06 A;  5INB A;  4H1S A;  4V0W A;  1UF3 A;  2HY1 A;  3EGG A;  4O24 A;  5C1V A;  5IOH A;  1XZW A;  1OID A;  2O8G A;  2BCD A;  4IYP C;  3K7W C;  2BQ8 X;  1S3N A;  1SU1 A;  4JA7 A;  4H2B A;  3JYF A;  1S70 A;  4KBP A;  4TUG A;  2WDC A;  4ZX2 A;  2NPP C;  3H66 A;  1QFC A;  1IT6 A;  2JOG A;  3AUZ A;  3LL8 A;  1HO5 A;  4FCX A;  4LAC C;  3CK2 A;  3H61 A;  1Z2W A;  2KKN A;  3IVD A;  3EGH A;  3QFN A;  4NZV A;  3TGH A;  1T71 A;  5B8I A;  4UT3 B;  4KKZ A;  2BDX A;  1HP1 A;  1NNW A;  3H68 A;  5JPE A;  1T70 A;  2IE3 C;  3PSO A;  3DSC A;  2DFJ A;  2NYM C;  2WDD A;  2XMO A;  3RQZ A;  4J6O A;  2QFP A;  2IE4 C;  1FJM A;  1M63 A;  4FBQ A;  4UT2 A;  4M0V A;  3AV0 A;  4H2I A;  2GJU A;  1JK7 A;  3DW8 C;  5F3W A;  1G5B A;  3PSN A;  4TUI A;  3E7B A;  2QFR A;  4ZVZ A;  2HYO A;  3P71 C;  4FBK A;  2A22 A;  4DHL A;  1WAR A;  5HPE A;  3IVE A;  4OR9 A;  4MP0 A;  1UTE A;  3QFO A;  2CV9 A;  1KBP A;  3RL4 A;  3QFK A;  5GTU A;  1AUI A;  4JA9 A;  3C9F A;  4H2G A;  4MOY A;  5JJT A;  4V0X A;  3THN A;  5J28 A;  3QFM A;  2O8A A;  1USH A;  4ORA A;  4WWL A;  5EQV A;  4F0Z A;  1V73 A;  1MF8 A;  3QG5 C;  2IAE C;  1S95 A;  1QHW A;  4Q7F A;  2USH A;  1W24 A;  1S8E A;  1OI8 A;  1HPU A;  4DT2 A;  4H2F A;  3DSD A;  4I5L C;  3E7A A;  4IL1 A;  4H1Y P;  3ZU0 A;  2Z1A A;  4O43 A;  1II7 A;  5DNY A;  2NXF A;  4HD0 A;  3N5U A;  2Q8U A;  3T1I A;  3H60 A; 
#chains in the Genus database with same CATH topology
 2YVT A;  3THO B;  3FGA C;  4UT3 A;  4FBW A;  3H62 B;  1OIE A;  4I5N C;  4B2O A;  1S3M A;  4ORC A;  2ZO9 B;  4G9J A;  1S3L A;  4V0V A;  3K7V C;  4UWQ A;  2ZBM A;  1TCO A;  4LU9 A;  2HYP A;  4DSY A;  3RL3 A;  2DXL A;  4MOV A;  3ZTV A;  3V4Y A;  2NYL C;  4ORB A;  1U32 A;  3HVQ A;  3H67 A;  5JPF A;  3IB7 A;  1WAO 1;  2P6B A;  3C5W C;  3ICF A;  4O5G A;  2QJC A;  3IB8 A;  2WDE A;  3KBP A;  3H64 A;  3RL5 A;  2Z72 A;  4LTY A;  2AHD A;  3H63 A;  3GVE A;  4XPN A;  2WDF A;  3H69 A;  4YKE A;  4O4K A;  2R17 A;  1XM7 A;  1Z2X A;  2Z06 A;  5INB A;  4H1S A;  4V0W A;  1UF3 A;  2HY1 A;  3EGG A;  4O24 A;  5C1V A;  5IOH A;  1XZW A;  1OID A;  2O8G A;  2BCD A;  4IYP C;  3K7W C;  2BQ8 X;  1S3N A;  1SU1 A;  2ZOA A;  4H2B A;  4JA7 A;  3JYF A;  1S70 A;  4KBP A;  4TUG A;  2WDC A;  4ZX2 A;  2NPP C;  3H66 A;  1QFC A;  1IT6 A;  2JOG A;  3AUZ A;  3LL8 A;  3D03 A;  1HO5 A;  4FCX A;  4LAC C;  3CK2 A;  3H61 A;  1Z2W A;  2KKN A;  3IVD A;  3E0J A;  3EGH A;  3QFN A;  4NZV A;  3TGH A;  1T71 A;  5B8I A;  4UT3 B;  4KKZ A;  2BDX A;  1HP1 A;  1NNW A;  3H68 A;  5JPE A;  1T70 A;  2IE3 C;  3PSO A;  3DSC A;  2DFJ A;  2NYM C;  2WDD A;  2XMO A;  2DXN A;  3RQZ A;  4J6O A;  2QFP A;  2IE4 C;  1FJM A;  1M63 A;  4FBQ A;  4UT2 A;  4M0V A;  3AV0 A;  4H2I A;  2GJU A;  1JK7 A;  3DW8 C;  5F3W A;  1G5B A;  2YEQ A;  3PSN A;  4TUI A;  3E7B A;  2QFR A;  4ZVZ A;  2HYO A;  3P71 C;  4FBK A;  2A22 A;  4DHL A;  1WAR A;  5HPE A;  3IVE A;  4OR9 A;  4MP0 A;  1UTE A;  3QFO A;  2CV9 A;  1KBP A;  3RL4 A;  3QFK A;  5GTU A;  1AUI A;  4JA9 A;  3C9F A;  4H2G A;  4MOY A;  5JJT A;  3FLO A;  4V0X A;  3THN A;  3QFM A;  5J28 A;  2O8A A;  1USH A;  4ORA A;  4WWL A;  5EQV A;  4F0Z A;  1V73 A;  1MF8 A;  3QG5 C;  2IAE C;  1S95 A;  1QHW A;  4Q7F A;  2USH A;  1W24 A;  1S8E A;  1OI8 A;  1HPU A;  4DT2 A;  4H2F A;  3DSD A;  4I5L C;  3E7A A;  4IL1 A;  4H1Y P;  3ZU0 A;  2Z1A A;  4O43 A;  1II7 A;  5DNY A;  2NXF A;  4HD0 A;  3N5U A;  2Q8U A;  3T1I A;  3H60 A; 
#chains in the Genus database with same CATH homology
 2YVT A;  3THO B;  3FGA C;  4UT3 A;  4FBW A;  3H62 B;  1OIE A;  4I5N C;  4B2O A;  1S3M A;  4ORC A;  2ZO9 B;  4G9J A;  1S3L A;  4V0V A;  3K7V C;  4UWQ A;  2ZBM A;  1TCO A;  4LU9 A;  2HYP A;  4DSY A;  3RL3 A;  2DXL A;  4MOV A;  3ZTV A;  3V4Y A;  2NYL C;  4ORB A;  1U32 A;  3HVQ A;  3H67 A;  5JPF A;  3IB7 A;  1WAO 1;  2P6B A;  3C5W C;  3ICF A;  4O5G A;  2QJC A;  3IB8 A;  2WDE A;  3KBP A;  3H64 A;  3RL5 A;  2Z72 A;  4LTY A;  2AHD A;  3H63 A;  3GVE A;  4XPN A;  2WDF A;  3H69 A;  4YKE A;  4O4K A;  2R17 A;  1XM7 A;  1Z2X A;  2Z06 A;  5INB A;  4H1S A;  4V0W A;  1UF3 A;  2HY1 A;  3EGG A;  4O24 A;  5C1V A;  5IOH A;  1XZW A;  1OID A;  2O8G A;  2BCD A;  4IYP C;  3K7W C;  2BQ8 X;  1S3N A;  1SU1 A;  2ZOA A;  4H2B A;  4JA7 A;  3JYF A;  1S70 A;  4KBP A;  4TUG A;  2WDC A;  4ZX2 A;  2NPP C;  3H66 A;  1QFC A;  1IT6 A;  2JOG A;  3AUZ A;  3LL8 A;  3D03 A;  1HO5 A;  4FCX A;  4LAC C;  3CK2 A;  3H61 A;  1Z2W A;  2KKN A;  3IVD A;  3E0J A;  3EGH A;  3QFN A;  4NZV A;  3TGH A;  1T71 A;  5B8I A;  4UT3 B;  4KKZ A;  2BDX A;  1HP1 A;  1NNW A;  3H68 A;  5JPE A;  1T70 A;  2IE3 C;  3PSO A;  3DSC A;  2DFJ A;  2NYM C;  2WDD A;  2XMO A;  2DXN A;  3RQZ A;  4J6O A;  2QFP A;  2IE4 C;  1FJM A;  1M63 A;  4FBQ A;  4UT2 A;  4M0V A;  3AV0 A;  4H2I A;  2GJU A;  1JK7 A;  3DW8 C;  5F3W A;  1G5B A;  2YEQ A;  3PSN A;  4TUI A;  3E7B A;  2QFR A;  4ZVZ A;  2HYO A;  3P71 C;  4FBK A;  2A22 A;  4DHL A;  1WAR A;  5HPE A;  3IVE A;  4OR9 A;  4MP0 A;  1UTE A;  3QFO A;  2CV9 A;  1KBP A;  3RL4 A;  3QFK A;  5GTU A;  1AUI A;  4JA9 A;  3C9F A;  4H2G A;  4MOY A;  5JJT A;  3FLO A;  4V0X A;  3THN A;  3QFM A;  5J28 A;  2O8A A;  1USH A;  4ORA A;  4WWL A;  5EQV A;  4F0Z A;  1V73 A;  1MF8 A;  3QG5 C;  2IAE C;  1S95 A;  1QHW A;  4Q7F A;  2USH A;  1W24 A;  1S8E A;  1OI8 A;  1HPU A;  4DT2 A;  4H2F A;  3DSD A;  4I5L C;  3E7A A;  4IL1 A;  4H1Y P;  3ZU0 A;  2Z1A A;  4O43 A;  1II7 A;  5DNY A;  2NXF A;  4HD0 A;  3N5U A;  2Q8U A;  3T1I A;  3H60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...