3HVQA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of neurabin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 110
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3hvqA00
2Z1AA 3QFMA 5EQVA 3ZTVA 3ZU0A 2QFPA 4ORAA 4ZX2A 1Z2XA 4ZVZA 2DFJA 4ORBA 1V73A 4LACC 4UT3A 4LTYA 1II7A 4OR9A 3DW8C 3QFNA 1S3MA 5INBA 2USHA 3KBPA 3QFKA 2HY1A 1WARA 3GVEA 3JYFA 3QFOA 4IL1A 2R17A 4V0XA 1HP1A 3C5WC 2CV9A 3CK2A 3IB8A 2GJUA 2IAEC 2WDEA 1S95A 2ZBMA 4NZVA 2QJCA 3H68A 1QHWA 2XMOA 3IVDA 1NNWA 2WDFA 3ICFA 1G5BA 5GTUA 3LL8A 4H2FA 4H2GA 4O4KA 2NYMC 4J6OA 1MF8A 1HO5A 4KBPA 1S3NA 1HPUA 4H1YP 4FBQA 4JA7A 4WWLA 1IT6A 2BQ8X 2A22A 1U32A 1W24A 4MOYA 2BDXA 4KKZA 3EGGA 4YKEA 5IOHA 3PSOA 4FCXA 1UF3A 3FGAC 4UT2A 5JPFA 4Q7FA 5JPEA 3RL5A 4MP0A 3C9FA 3T1IA 1S3LA 4UWQA 1SU1A 3RL3A 3THNA 4H2BA 4O24A 4DHLA 5F3WA 2KKNA 1T70A 3K7WC 1FJMA 2WDCA 2Z72A 4XPNA 2Z06A 5C1VA 5DNYA 3IVEA 1T71A 1OIEA 4I5NC 4I5LC 4HD0A 4V0WA 3THOB 1S8EA 4B2OA 1XZWA 5B8IA 3H61A 1USHA 4TUIA 2QFRA 1M63A 1OIDA 3HVQA 3H69A 4TUGA 4FBKA 3DSDA 4DT2A 1Z2WA 1AUIA 3TGHA 3DSCA 2NPPC 4H2IA 3AV0A 3H66A 5JJTA 3P71C 2BCDA 2IE4C 4V0VA 3IB7A 1S70A 4MOVA 2O8AA 3H64A 1OI8A 4JA9A 2O8GA 3RL4A 3E7BA 4G9JA 3E7AA 4DSYA 3H62B 3H67A 2HYOA 4UT3B 4O43A 2HYPA 1XM7A 4M0VA 2AHDA 4IYPC 4ORCA 2WDDA 4H1SA 1WAO1 3V4YA 2NXFA 2JOGA 2NYLC 3N5UA 1KBPA 2Q8UA 1UTEA 5HPEA 3QG5C 4FBWA 1TCOA 3AUZA 3EGHA 3H60A 4O5GA 2P6BA 2IE3C 5J28A 1QFCA 2YVTA 1JK7A 3H63A 4LU9A 4F0ZA 3RQZA 3K7VC 3PSNA
chains in the Genus database with same CATH superfamily
2Z1AA 3QFMA 5EQVA 3ZTVA 3ZU0A 2QFPA 4ORAA 4ZX2A 3FLOA 1Z2XA 4ZVZA 2DFJA 4ORBA 1V73A 4LACC 4UT3A 4LTYA 2YEQA 1II7A 4OR9A 3DW8C 3QFNA 1S3MA 5INBA 2USHA 3KBPA 3QFKA 2HY1A 1WARA 3GVEA 3JYFA 3QFOA 4IL1A 2R17A 4V0XA 1HP1A 3C5WC 2CV9A 3CK2A 3IB8A 2GJUA 2IAEC 2WDEA 1S95A 2ZBMA 4NZVA 2QJCA 3E0JA 3H68A 1QHWA 2XMOA 3IVDA 1NNWA 2WDFA 3ICFA 1G5BA 5GTUA 3LL8A 4H2FA 4H2GA 4O4KA 2NYMC 4J6OA 1MF8A 1HO5A 4KBPA 1S3NA 1HPUA 4H1YP 4FBQA 4JA7A 4WWLA 1IT6A 2BQ8X 2A22A 1U32A 1W24A 4MOYA 2ZO9B 2BDXA 4KKZA 3EGGA 4YKEA 5IOHA 3PSOA 4FCXA 1UF3A 3FGAC 4UT2A 5JPFA 4Q7FA 5JPEA 3RL5A 4MP0A 3C9FA 3T1IA 1S3LA 4UWQA 1SU1A 3RL3A 3THNA 3D03A 4H2BA 4O24A 4DHLA 5F3WA 2KKNA 1T70A 3K7WC 1FJMA 2WDCA 2Z72A 4XPNA 2Z06A 5C1VA 5DNYA 3IVEA 1T71A 1OIEA 4I5NC 4I5LC 4HD0A 4V0WA 3THOB 1S8EA 4B2OA 1XZWA 5B8IA 3H61A 1USHA 4TUIA 2QFRA 1M63A 1OIDA 3HVQA 3H69A 4TUGA 4FBKA 2DXNA 3DSDA 4DT2A 1Z2WA 1AUIA 3TGHA 3DSCA 2NPPC 4H2IA 3AV0A 3H66A 5JJTA 2ZOAA 3P71C 2BCDA 2IE4C 4V0VA 3IB7A 1S70A 4MOVA 2O8AA 3H64A 1OI8A 4JA9A 2O8GA 3RL4A 3E7BA 4G9JA 3E7AA 4DSYA 3H62B 3H67A 2HYOA 4UT3B 4O43A 2HYPA 1XM7A 4M0VA 2AHDA 4IYPC 4ORCA 2WDDA 4H1SA 1WAO1 3V4YA 2NXFA 2JOGA 2NYLC 3N5UA 1KBPA 2Q8UA 1UTEA 5HPEA 3QG5C 4FBWA 1TCOA 3AUZA 3EGHA 3H60A 4O5GA 2P6BA 2DXLA 2IE3C 5J28A 1QFCA 2YVTA 1JK7A 3H63A 4LU9A 4F0ZA 3RQZA 3K7VC 3PSNA
chains in the Genus database with same CATH topology
2Z1AA 3QFMA 5EQVA 3ZTVA 3ZU0A 2QFPA 4ORAA 4ZX2A 3FLOA 1Z2XA 4ZVZA 2DFJA 4ORBA 1V73A 4LACC 4UT3A 4LTYA 2YEQA 1II7A 4OR9A 3DW8C 3QFNA 1S3MA 5INBA 2USHA 3KBPA 3QFKA 2HY1A 1WARA 3GVEA 3JYFA 3QFOA 4IL1A 2R17A 4V0XA 1HP1A 3C5WC 2CV9A 3CK2A 3IB8A 2GJUA 2IAEC 2WDEA 1S95A 2ZBMA 4NZVA 2QJCA 3E0JA 3H68A 1QHWA 2XMOA 3IVDA 1NNWA 2WDFA 3ICFA 1G5BA 5GTUA 3LL8A 4H2FA 4H2GA 4O4KA 2NYMC 4J6OA 1MF8A 1HO5A 4KBPA 1S3NA 1HPUA 4H1YP 4FBQA 4JA7A 4WWLA 1IT6A 2BQ8X 2A22A 1U32A 1W24A 4MOYA 2ZO9B 2BDXA 4KKZA 3EGGA 4YKEA 5IOHA 3PSOA 4FCXA 1UF3A 3FGAC 4UT2A 5JPFA 4Q7FA 5JPEA 3RL5A 4MP0A 3C9FA 3T1IA 1S3LA 4UWQA 1SU1A 3RL3A 3THNA 3D03A 4H2BA 4O24A 4DHLA 5F3WA 2KKNA 1T70A 3K7WC 1FJMA 2WDCA 2Z72A 4XPNA 2Z06A 5C1VA 5DNYA 3IVEA 1T71A 1OIEA 4I5NC 4I5LC 4HD0A 4V0WA 3THOB 1S8EA 4B2OA 1XZWA 5B8IA 3H61A 1USHA 4TUIA 2QFRA 1M63A 1OIDA 3HVQA 3H69A 4TUGA 4FBKA 2DXNA 3DSDA 4DT2A 1Z2WA 1AUIA 3TGHA 3DSCA 2NPPC 4H2IA 3AV0A 3H66A 5JJTA 2ZOAA 3P71C 2BCDA 2IE4C 4V0VA 3IB7A 1S70A 4MOVA 2O8AA 3H64A 1OI8A 4JA9A 2O8GA 3RL4A 3E7BA 4G9JA 3E7AA 4DSYA 3H62B 3H67A 2HYOA 4UT3B 4O43A 2HYPA 1XM7A 4M0VA 2AHDA 4IYPC 4ORCA 2WDDA 4H1SA 1WAO1 3V4YA 2NXFA 2JOGA 2NYLC 3N5UA 1KBPA 2Q8UA 1UTEA 5HPEA 3QG5C 4FBWA 1TCOA 3AUZA 3EGHA 3H60A 4O5GA 2P6BA 2DXLA 2IE3C 5J28A 1QFCA 2YVTA 1JK7A 3H63A 4LU9A 4F0ZA 3RQZA 3K7VC 3PSNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z1A A;  3QFM A;  5EQV A;  3ZTV A;  3ZU0 A;  2QFP A;  4ORA A;  4ZX2 A;  1Z2X A;  4ZVZ A;  2DFJ A;  4ORB A;  1V73 A;  4LAC C;  4UT3 A;  4LTY A;  1II7 A;  4OR9 A;  3DW8 C;  3QFN A;  1S3M A;  5INB A;  2USH A;  3KBP A;  3QFK A;  2HY1 A;  1WAR A;  3GVE A;  3JYF A;  3QFO A;  4IL1 A;  2R17 A;  4V0X A;  1HP1 A;  3C5W C;  2CV9 A;  3CK2 A;  3IB8 A;  2GJU A;  2IAE C;  2WDE A;  1S95 A;  2ZBM A;  4NZV A;  2QJC A;  3H68 A;  1QHW A;  2XMO A;  3IVD A;  1NNW A;  2WDF A;  3ICF A;  1G5B A;  5GTU A;  3LL8 A;  4H2F A;  4H2G A;  4O4K A;  2NYM C;  4J6O A;  1MF8 A;  1HO5 A;  4KBP A;  1S3N A;  1HPU A;  4H1Y P;  4FBQ A;  4JA7 A;  4WWL A;  1IT6 A;  2BQ8 X;  2A22 A;  1U32 A;  1W24 A;  4MOY A;  2BDX A;  4KKZ A;  3EGG A;  4YKE A;  5IOH A;  3PSO A;  4FCX A;  1UF3 A;  3FGA C;  4UT2 A;  5JPF A;  4Q7F A;  5JPE A;  3RL5 A;  4MP0 A;  3C9F A;  3T1I A;  1S3L A;  4UWQ A;  1SU1 A;  3RL3 A;  3THN A;  4H2B A;  4O24 A;  4DHL A;  5F3W A;  2KKN A;  1T70 A;  3K7W C;  1FJM A;  2WDC A;  2Z72 A;  4XPN A;  2Z06 A;  5C1V A;  5DNY A;  3IVE A;  1T71 A;  1OIE A;  4I5N C;  4I5L C;  4HD0 A;  4V0W A;  3THO B;  1S8E A;  4B2O A;  1XZW A;  5B8I A;  3H61 A;  1USH A;  4TUI A;  2QFR A;  1M63 A;  1OID A;  3HVQ A;  3H69 A;  4TUG A;  4FBK A;  3DSD A;  4DT2 A;  1Z2W A;  1AUI A;  3TGH A;  3DSC A;  2NPP C;  4H2I A;  3AV0 A;  3H66 A;  5JJT A;  3P71 C;  2BCD A;  2IE4 C;  4V0V A;  3IB7 A;  1S70 A;  4MOV A;  2O8A A;  3H64 A;  1OI8 A;  4JA9 A;  2O8G A;  3RL4 A;  3E7B A;  4G9J A;  3E7A A;  4DSY A;  3H62 B;  3H67 A;  2HYO A;  4UT3 B;  4O43 A;  2HYP A;  1XM7 A;  4M0V A;  2AHD A;  4IYP C;  4ORC A;  2WDD A;  4H1S A;  1WAO 1;  3V4Y A;  2NXF A;  2JOG A;  2NYL C;  3N5U A;  1KBP A;  2Q8U A;  1UTE A;  5HPE A;  3QG5 C;  4FBW A;  1TCO A;  3AUZ A;  3EGH A;  3H60 A;  4O5G A;  2P6B A;  2IE3 C;  5J28 A;  1QFC A;  2YVT A;  1JK7 A;  3H63 A;  4LU9 A;  4F0Z A;  3RQZ A;  3K7V C;  3PSN A; 
#chains in the Genus database with same CATH topology
 2Z1A A;  3QFM A;  5EQV A;  3ZTV A;  3ZU0 A;  2QFP A;  4ORA A;  4ZX2 A;  3FLO A;  1Z2X A;  4ZVZ A;  2DFJ A;  4ORB A;  1V73 A;  4LAC C;  4UT3 A;  4LTY A;  2YEQ A;  1II7 A;  4OR9 A;  3DW8 C;  3QFN A;  1S3M A;  5INB A;  2USH A;  3KBP A;  3QFK A;  2HY1 A;  1WAR A;  3GVE A;  3JYF A;  3QFO A;  4IL1 A;  2R17 A;  4V0X A;  1HP1 A;  3C5W C;  2CV9 A;  3CK2 A;  3IB8 A;  2GJU A;  2IAE C;  2WDE A;  1S95 A;  2ZBM A;  4NZV A;  2QJC A;  3E0J A;  3H68 A;  1QHW A;  2XMO A;  3IVD A;  1NNW A;  2WDF A;  3ICF A;  1G5B A;  5GTU A;  3LL8 A;  4H2F A;  4H2G A;  4O4K A;  2NYM C;  4J6O A;  1MF8 A;  1HO5 A;  4KBP A;  1S3N A;  1HPU A;  4H1Y P;  4FBQ A;  4JA7 A;  4WWL A;  1IT6 A;  2BQ8 X;  2A22 A;  1U32 A;  1W24 A;  4MOY A;  2ZO9 B;  2BDX A;  4KKZ A;  3EGG A;  4YKE A;  5IOH A;  3PSO A;  4FCX A;  1UF3 A;  3FGA C;  4UT2 A;  5JPF A;  4Q7F A;  5JPE A;  3RL5 A;  4MP0 A;  3C9F A;  3T1I A;  1S3L A;  4UWQ A;  1SU1 A;  3RL3 A;  3THN A;  3D03 A;  4H2B A;  4O24 A;  4DHL A;  5F3W A;  2KKN A;  1T70 A;  3K7W C;  1FJM A;  2WDC A;  2Z72 A;  4XPN A;  2Z06 A;  5C1V A;  5DNY A;  3IVE A;  1T71 A;  1OIE A;  4I5N C;  4I5L C;  4HD0 A;  4V0W A;  3THO B;  1S8E A;  4B2O A;  1XZW A;  5B8I A;  3H61 A;  1USH A;  4TUI A;  2QFR A;  1M63 A;  1OID A;  3HVQ A;  3H69 A;  4TUG A;  4FBK A;  2DXN A;  3DSD A;  4DT2 A;  1Z2W A;  1AUI A;  3TGH A;  3DSC A;  2NPP C;  4H2I A;  3AV0 A;  3H66 A;  5JJT A;  2ZOA A;  3P71 C;  2BCD A;  2IE4 C;  4V0V A;  3IB7 A;  1S70 A;  4MOV A;  2O8A A;  3H64 A;  1OI8 A;  4JA9 A;  2O8G A;  3RL4 A;  3E7B A;  4G9J A;  3E7A A;  4DSY A;  3H62 B;  3H67 A;  2HYO A;  4UT3 B;  4O43 A;  2HYP A;  1XM7 A;  4M0V A;  2AHD A;  4IYP C;  4ORC A;  2WDD A;  4H1S A;  1WAO 1;  3V4Y A;  2NXF A;  2JOG A;  2NYL C;  3N5U A;  1KBP A;  2Q8U A;  1UTE A;  5HPE A;  3QG5 C;  4FBW A;  1TCO A;  3AUZ A;  3EGH A;  3H60 A;  4O5G A;  2P6B A;  2DXL A;  2IE3 C;  5J28 A;  1QFC A;  2YVT A;  1JK7 A;  3H63 A;  4LU9 A;  4F0Z A;  3RQZ A;  3K7V C;  3PSN A; 
#chains in the Genus database with same CATH homology
 2Z1A A;  3QFM A;  5EQV A;  3ZTV A;  3ZU0 A;  2QFP A;  4ORA A;  4ZX2 A;  3FLO A;  1Z2X A;  4ZVZ A;  2DFJ A;  4ORB A;  1V73 A;  4LAC C;  4UT3 A;  4LTY A;  2YEQ A;  1II7 A;  4OR9 A;  3DW8 C;  3QFN A;  1S3M A;  5INB A;  2USH A;  3KBP A;  3QFK A;  2HY1 A;  1WAR A;  3GVE A;  3JYF A;  3QFO A;  4IL1 A;  2R17 A;  4V0X A;  1HP1 A;  3C5W C;  2CV9 A;  3CK2 A;  3IB8 A;  2GJU A;  2IAE C;  2WDE A;  1S95 A;  2ZBM A;  4NZV A;  2QJC A;  3E0J A;  3H68 A;  1QHW A;  2XMO A;  3IVD A;  1NNW A;  2WDF A;  3ICF A;  1G5B A;  5GTU A;  3LL8 A;  4H2F A;  4H2G A;  4O4K A;  2NYM C;  4J6O A;  1MF8 A;  1HO5 A;  4KBP A;  1S3N A;  1HPU A;  4H1Y P;  4FBQ A;  4JA7 A;  4WWL A;  1IT6 A;  2BQ8 X;  2A22 A;  1U32 A;  1W24 A;  4MOY A;  2ZO9 B;  2BDX A;  4KKZ A;  3EGG A;  4YKE A;  5IOH A;  3PSO A;  4FCX A;  1UF3 A;  3FGA C;  4UT2 A;  5JPF A;  4Q7F A;  5JPE A;  3RL5 A;  4MP0 A;  3C9F A;  3T1I A;  1S3L A;  4UWQ A;  1SU1 A;  3RL3 A;  3THN A;  3D03 A;  4H2B A;  4O24 A;  4DHL A;  5F3W A;  2KKN A;  1T70 A;  3K7W C;  1FJM A;  2WDC A;  2Z72 A;  4XPN A;  2Z06 A;  5C1V A;  5DNY A;  3IVE A;  1T71 A;  1OIE A;  4I5N C;  4I5L C;  4HD0 A;  4V0W A;  3THO B;  1S8E A;  4B2O A;  1XZW A;  5B8I A;  3H61 A;  1USH A;  4TUI A;  2QFR A;  1M63 A;  1OID A;  3HVQ A;  3H69 A;  4TUG A;  4FBK A;  2DXN A;  3DSD A;  4DT2 A;  1Z2W A;  1AUI A;  3TGH A;  3DSC A;  2NPP C;  4H2I A;  3AV0 A;  3H66 A;  5JJT A;  2ZOA A;  3P71 C;  2BCD A;  2IE4 C;  4V0V A;  3IB7 A;  1S70 A;  4MOV A;  2O8A A;  3H64 A;  1OI8 A;  4JA9 A;  2O8G A;  3RL4 A;  3E7B A;  4G9J A;  3E7A A;  4DSY A;  3H62 B;  3H67 A;  2HYO A;  4UT3 B;  4O43 A;  2HYP A;  1XM7 A;  4M0V A;  2AHD A;  4IYP C;  4ORC A;  2WDD A;  4H1S A;  1WAO 1;  3V4Y A;  2NXF A;  2JOG A;  2NYL C;  3N5U A;  1KBP A;  2Q8U A;  1UTE A;  5HPE A;  3QG5 C;  4FBW A;  1TCO A;  3AUZ A;  3EGH A;  3H60 A;  4O5G A;  2P6B A;  2DXL A;  2IE3 C;  5J28 A;  1QFC A;  2YVT A;  1JK7 A;  3H63 A;  4LU9 A;  4F0Z A;  3RQZ A;  3K7V C;  3PSN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...