3HVQA

Crystal structure of a complex between protein phosphatase 1 alpha (pp1) and the pp1 binding and pdz domains of neurabin
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Spinophilin directs protein phosphatase 1 specificity by blocking substrate binding sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase regulator
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
total genus 110
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 3hvqA00
3CK2A 4ZVZA 2WDDA 4H1YP 4IYPC 4LU9A 2HYPA 2IE4C 3THOB 5GTUA 4H2GA 3P71C 2KKNA 1QFCA 4FBWA 4KKZA 2USHA 4DSYA 3QFKA 1Z2WA 5C1VA 2IE3C 4ORBA 1M63A 1HP1A 3QFNA 1JK7A 3IVEA 4UWQA 5JPEA 4IL1A 3C9FA 4I5LC 3E7AA 2Z06A 4MP0A 3PSOA 4OR9A 1S70A 3FGAC 4MOVA 3GVEA 3HVQA 4H2FA 1HO5A 3DSDA 1QHWA 3QFOA 3H61A 2GJUA 4ZX2A 2QFPA 2AHDA 3THNA 3H69A 2Q8UA 3T1IA 2WDCA 4H2IA 2NYLC 4UT2A 3RL5A 1OIDA 2BQ8X 2O8AA 1KBPA 1OIEA 4KBPA 5J28A 4I5NC 3DW8C 2XMOA 4FBQA 1XZWA 2ZBMA 1SU1A 4H1SA 1T71A 3H67A 4HD0A 2QJCA 3C5WC 3RL3A 3AUZA 2WDEA 4V0WA 4JA9A 1WARA 3K7VC 2P6BA 2CV9A 3DSCA 3ICFA 2BDXA 4YKEA 3TGHA 2Z1AA 4UT3B 4WWLA 5IOHA 1WAO1 2A22A 3H62B 1V73A 3EGGA 4Q7FA 1T70A 2WDFA 3QFMA 3N5UA 1FJMA 4FCXA 4O43A 5B8IA 1II7A 5INBA 5F3WA 2JOGA 2BCDA 5JJTA 1NNWA 1UTEA 1U32A 2Z72A 4V0XA 3PSNA 1XM7A 4TUGA 1AUIA 1HPUA 1Z2XA 2YVTA 3EGHA 3H64A 3IB7A 3RQZA 4M0VA 1MF8A 4F0ZA 1S3LA 2NPPC 3K7WC 4B2OA 1S8EA 4O4KA 2O8GA 1W24A 3RL4A 2HY1A 1IT6A 3ZU0A 3V4YA 2HYOA 2IAEC 3ZTVA 4TUIA 5EQVA 4FBKA 2NXFA 1S95A 4ORAA 3H66A 3KBPA 4J6OA 2R17A 4O24A 1G5BA 4V0VA 3H63A 2QFRA 4H2BA 4JA7A 4O5GA 4MOYA 5JPFA 3H68A 1USHA 3H60A 2DFJA 3IVDA 4DT2A 4XPNA 5DNYA 3E7BA 1OI8A 2NYMC 4LACC 1TCOA 4NZVA 3AV0A 3LL8A 3IB8A 1UF3A 3QG5C 4ORCA 4UT3A 1S3NA 4G9JA 3JYFA 1S3MA 4DHLA 4LTYA 5HPEA
chains in the Genus database with same CATH superfamily
3CK2A 4ZVZA 2WDDA 4H1YP 4IYPC 4LU9A 2HYPA 2IE4C 3THOB 5GTUA 4H2GA 3P71C 2KKNA 1QFCA 4FBWA 4KKZA 2USHA 4DSYA 3QFKA 1Z2WA 3E0JA 2IE3C 4ORBA 5C1VA 1M63A 1HP1A 3QFNA 1JK7A 3IVEA 4UWQA 5JPEA 4IL1A 3C9FA 4I5LC 3E7AA 2Z06A 4MP0A 3PSOA 4OR9A 1S70A 3FGAC 4MOVA 3GVEA 3HVQA 4H2FA 1HO5A 3DSDA 1QHWA 3QFOA 3H61A 2GJUA 4ZX2A 2QFPA 2AHDA 3THNA 3H69A 2Q8UA 3T1IA 2WDCA 2ZO9B 4H2IA 2NYLC 4UT2A 3RL5A 1OIDA 2BQ8X 2O8AA 1KBPA 2DXNA 1OIEA 4KBPA 5J28A 4I5NC 3DW8C 2XMOA 4FBQA 1XZWA 2ZBMA 1SU1A 4H1SA 1T71A 3H67A 4HD0A 2QJCA 3C5WC 3RL3A 3AUZA 2WDEA 4V0WA 4JA9A 1WARA 3K7VC 2P6BA 2CV9A 3DSCA 3ICFA 2BDXA 4YKEA 3TGHA 2Z1AA 4UT3B 4WWLA 5IOHA 2DXLA 1WAO1 2A22A 3H62B 1V73A 3EGGA 4Q7FA 1T70A 2WDFA 3QFMA 3N5UA 1FJMA 4FCXA 4O43A 5B8IA 1II7A 5INBA 5F3WA 2JOGA 2ZOAA 2BCDA 3D03A 5JJTA 2YEQA 1NNWA 1UTEA 1U32A 2Z72A 4V0XA 3PSNA 1XM7A 4TUGA 1AUIA 1HPUA 1Z2XA 2YVTA 3EGHA 3H64A 3IB7A 3RQZA 4M0VA 1MF8A 4F0ZA 1S3LA 2NPPC 3K7WC 4B2OA 1S8EA 4O4KA 2O8GA 1W24A 3RL4A 2HY1A 1IT6A 3ZU0A 3V4YA 2HYOA 2IAEC 3ZTVA 4TUIA 5EQVA 4FBKA 2NXFA 1S95A 4ORAA 3H66A 3KBPA 4J6OA 2R17A 4O24A 1G5BA 4V0VA 3H63A 2QFRA 4H2BA 4JA7A 4O5GA 4MOYA 5JPFA 3H68A 1USHA 3H60A 2DFJA 3IVDA 3FLOA 4XPNA 4DT2A 5DNYA 3E7BA 1OI8A 2NYMC 4LACC 1TCOA 4NZVA 3AV0A 3LL8A 3IB8A 1UF3A 3QG5C 4ORCA 4UT3A 1S3NA 4G9JA 3JYFA 1S3MA 4DHLA 4LTYA 5HPEA
chains in the Genus database with same CATH topology
3CK2A 4ZVZA 2WDDA 4H1YP 4IYPC 4LU9A 2HYPA 2IE4C 3THOB 5GTUA 4H2GA 3P71C 2KKNA 1QFCA 4FBWA 4KKZA 2USHA 4DSYA 3QFKA 1Z2WA 3E0JA 2IE3C 4ORBA 5C1VA 1M63A 1HP1A 3QFNA 1JK7A 3IVEA 4UWQA 5JPEA 4IL1A 3C9FA 4I5LC 3E7AA 2Z06A 4MP0A 3PSOA 4OR9A 1S70A 3FGAC 4MOVA 3GVEA 3HVQA 4H2FA 1HO5A 3DSDA 1QHWA 3QFOA 3H61A 2GJUA 4ZX2A 2QFPA 2AHDA 3THNA 3H69A 2Q8UA 3T1IA 2WDCA 2ZO9B 4H2IA 2NYLC 4UT2A 3RL5A 1OIDA 2BQ8X 2O8AA 1KBPA 2DXNA 1OIEA 4KBPA 5J28A 4I5NC 3DW8C 2XMOA 4FBQA 1XZWA 2ZBMA 1SU1A 4H1SA 1T71A 3H67A 4HD0A 2QJCA 3C5WC 3RL3A 3AUZA 2WDEA 4V0WA 4JA9A 1WARA 3K7VC 2P6BA 2CV9A 3DSCA 3ICFA 2BDXA 4YKEA 3TGHA 2Z1AA 4UT3B 4WWLA 5IOHA 2DXLA 1WAO1 2A22A 3H62B 1V73A 3EGGA 4Q7FA 1T70A 2WDFA 3QFMA 3N5UA 1FJMA 4FCXA 4O43A 5B8IA 1II7A 5INBA 5F3WA 2JOGA 2ZOAA 2BCDA 3D03A 5JJTA 2YEQA 1NNWA 1UTEA 1U32A 2Z72A 4V0XA 3PSNA 1XM7A 4TUGA 1AUIA 1HPUA 1Z2XA 2YVTA 3EGHA 3H64A 3IB7A 3RQZA 4M0VA 1MF8A 4F0ZA 1S3LA 2NPPC 3K7WC 4B2OA 1S8EA 4O4KA 2O8GA 1W24A 3RL4A 2HY1A 1IT6A 3ZU0A 3V4YA 2HYOA 2IAEC 3ZTVA 4TUIA 5EQVA 4FBKA 2NXFA 1S95A 4ORAA 3H66A 3KBPA 4J6OA 2R17A 4O24A 1G5BA 4V0VA 3H63A 2QFRA 4H2BA 4JA7A 4O5GA 4MOYA 5JPFA 3H68A 1USHA 3H60A 2DFJA 3IVDA 3FLOA 4XPNA 4DT2A 5DNYA 3E7BA 1OI8A 2NYMC 4LACC 1TCOA 4NZVA 3AV0A 3LL8A 3IB8A 1UF3A 3QG5C 4ORCA 4UT3A 1S3NA 4G9JA 3JYFA 1S3MA 4DHLA 4LTYA 5HPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK2 A;  4ZVZ A;  2WDD A;  4H1Y P;  4IYP C;  4LU9 A;  2HYP A;  2IE4 C;  3THO B;  5GTU A;  4H2G A;  3P71 C;  2KKN A;  1QFC A;  4FBW A;  4KKZ A;  2USH A;  4DSY A;  3QFK A;  1Z2W A;  5C1V A;  2IE3 C;  4ORB A;  1M63 A;  1HP1 A;  3QFN A;  1JK7 A;  3IVE A;  4UWQ A;  5JPE A;  4IL1 A;  3C9F A;  4I5L C;  3E7A A;  2Z06 A;  4MP0 A;  3PSO A;  4OR9 A;  1S70 A;  3FGA C;  4MOV A;  3GVE A;  3HVQ A;  4H2F A;  1HO5 A;  3DSD A;  1QHW A;  3QFO A;  3H61 A;  2GJU A;  4ZX2 A;  2QFP A;  2AHD A;  3THN A;  3H69 A;  2Q8U A;  3T1I A;  2WDC A;  4H2I A;  2NYL C;  4UT2 A;  3RL5 A;  1OID A;  2BQ8 X;  2O8A A;  1KBP A;  1OIE A;  4KBP A;  5J28 A;  4I5N C;  3DW8 C;  2XMO A;  4FBQ A;  1XZW A;  2ZBM A;  1SU1 A;  4H1S A;  1T71 A;  3H67 A;  4HD0 A;  2QJC A;  3C5W C;  3RL3 A;  3AUZ A;  2WDE A;  4V0W A;  4JA9 A;  1WAR A;  3K7V C;  2P6B A;  2CV9 A;  3DSC A;  3ICF A;  2BDX A;  4YKE A;  3TGH A;  2Z1A A;  4UT3 B;  4WWL A;  5IOH A;  1WAO 1;  2A22 A;  3H62 B;  1V73 A;  3EGG A;  4Q7F A;  1T70 A;  2WDF A;  3QFM A;  3N5U A;  1FJM A;  4FCX A;  4O43 A;  5B8I A;  1II7 A;  5INB A;  5F3W A;  2JOG A;  2BCD A;  5JJT A;  1NNW A;  1UTE A;  1U32 A;  2Z72 A;  4V0X A;  3PSN A;  1XM7 A;  4TUG A;  1AUI A;  1HPU A;  1Z2X A;  2YVT A;  3EGH A;  3H64 A;  3IB7 A;  3RQZ A;  4M0V A;  1MF8 A;  4F0Z A;  1S3L A;  2NPP C;  3K7W C;  4B2O A;  1S8E A;  4O4K A;  2O8G A;  1W24 A;  3RL4 A;  2HY1 A;  1IT6 A;  3ZU0 A;  3V4Y A;  2HYO A;  2IAE C;  3ZTV A;  4TUI A;  5EQV A;  4FBK A;  2NXF A;  1S95 A;  4ORA A;  3H66 A;  3KBP A;  4J6O A;  2R17 A;  4O24 A;  1G5B A;  4V0V A;  3H63 A;  2QFR A;  4H2B A;  4JA7 A;  4O5G A;  4MOY A;  5JPF A;  3H68 A;  1USH A;  3H60 A;  2DFJ A;  3IVD A;  4DT2 A;  4XPN A;  5DNY A;  3E7B A;  1OI8 A;  2NYM C;  4LAC C;  1TCO A;  4NZV A;  3AV0 A;  3LL8 A;  3IB8 A;  1UF3 A;  3QG5 C;  4ORC A;  4UT3 A;  1S3N A;  4G9J A;  3JYF A;  1S3M A;  4DHL A;  4LTY A;  5HPE A; 
#chains in the Genus database with same CATH topology
 3CK2 A;  4ZVZ A;  2WDD A;  4H1Y P;  4IYP C;  4LU9 A;  2HYP A;  2IE4 C;  3THO B;  5GTU A;  4H2G A;  3P71 C;  2KKN A;  1QFC A;  4FBW A;  4KKZ A;  2USH A;  4DSY A;  3QFK A;  1Z2W A;  3E0J A;  2IE3 C;  4ORB A;  5C1V A;  1M63 A;  1HP1 A;  3QFN A;  1JK7 A;  3IVE A;  4UWQ A;  5JPE A;  4IL1 A;  3C9F A;  4I5L C;  3E7A A;  2Z06 A;  4MP0 A;  3PSO A;  4OR9 A;  1S70 A;  3FGA C;  4MOV A;  3GVE A;  3HVQ A;  4H2F A;  1HO5 A;  3DSD A;  1QHW A;  3QFO A;  3H61 A;  2GJU A;  4ZX2 A;  2QFP A;  2AHD A;  3THN A;  3H69 A;  2Q8U A;  3T1I A;  2WDC A;  2ZO9 B;  4H2I A;  2NYL C;  4UT2 A;  3RL5 A;  1OID A;  2BQ8 X;  2O8A A;  1KBP A;  2DXN A;  1OIE A;  4KBP A;  5J28 A;  4I5N C;  3DW8 C;  2XMO A;  4FBQ A;  1XZW A;  2ZBM A;  1SU1 A;  4H1S A;  1T71 A;  3H67 A;  4HD0 A;  2QJC A;  3C5W C;  3RL3 A;  3AUZ A;  2WDE A;  4V0W A;  4JA9 A;  1WAR A;  3K7V C;  2P6B A;  2CV9 A;  3DSC A;  3ICF A;  2BDX A;  4YKE A;  3TGH A;  2Z1A A;  4UT3 B;  4WWL A;  5IOH A;  2DXL A;  1WAO 1;  2A22 A;  3H62 B;  1V73 A;  3EGG A;  4Q7F A;  1T70 A;  2WDF A;  3QFM A;  3N5U A;  1FJM A;  4FCX A;  4O43 A;  5B8I A;  1II7 A;  5INB A;  5F3W A;  2JOG A;  2ZOA A;  2BCD A;  3D03 A;  5JJT A;  2YEQ A;  1NNW A;  1UTE A;  1U32 A;  2Z72 A;  4V0X A;  3PSN A;  1XM7 A;  4TUG A;  1AUI A;  1HPU A;  1Z2X A;  2YVT A;  3EGH A;  3H64 A;  3IB7 A;  3RQZ A;  4M0V A;  1MF8 A;  4F0Z A;  1S3L A;  2NPP C;  3K7W C;  4B2O A;  1S8E A;  4O4K A;  2O8G A;  1W24 A;  3RL4 A;  2HY1 A;  1IT6 A;  3ZU0 A;  3V4Y A;  2HYO A;  2IAE C;  3ZTV A;  4TUI A;  5EQV A;  4FBK A;  2NXF A;  1S95 A;  4ORA A;  3H66 A;  3KBP A;  4J6O A;  2R17 A;  4O24 A;  1G5B A;  4V0V A;  3H63 A;  2QFR A;  4H2B A;  4JA7 A;  4O5G A;  4MOY A;  5JPF A;  3H68 A;  1USH A;  3H60 A;  2DFJ A;  3IVD A;  3FLO A;  4XPN A;  4DT2 A;  5DNY A;  3E7B A;  1OI8 A;  2NYM C;  4LAC C;  1TCO A;  4NZV A;  3AV0 A;  3LL8 A;  3IB8 A;  1UF3 A;  3QG5 C;  4ORC A;  4UT3 A;  1S3N A;  4G9J A;  3JYF A;  1S3M A;  4DHL A;  4LTY A;  5HPE A; 
#chains in the Genus database with same CATH homology
 3CK2 A;  4ZVZ A;  2WDD A;  4H1Y P;  4IYP C;  4LU9 A;  2HYP A;  2IE4 C;  3THO B;  5GTU A;  4H2G A;  3P71 C;  2KKN A;  1QFC A;  4FBW A;  4KKZ A;  2USH A;  4DSY A;  3QFK A;  1Z2W A;  3E0J A;  2IE3 C;  4ORB A;  5C1V A;  1M63 A;  1HP1 A;  3QFN A;  1JK7 A;  3IVE A;  4UWQ A;  5JPE A;  4IL1 A;  3C9F A;  4I5L C;  3E7A A;  2Z06 A;  4MP0 A;  3PSO A;  4OR9 A;  1S70 A;  3FGA C;  4MOV A;  3GVE A;  3HVQ A;  4H2F A;  1HO5 A;  3DSD A;  1QHW A;  3QFO A;  3H61 A;  2GJU A;  4ZX2 A;  2QFP A;  2AHD A;  3THN A;  3H69 A;  2Q8U A;  3T1I A;  2WDC A;  2ZO9 B;  4H2I A;  2NYL C;  4UT2 A;  3RL5 A;  1OID A;  2BQ8 X;  2O8A A;  1KBP A;  2DXN A;  1OIE A;  4KBP A;  5J28 A;  4I5N C;  3DW8 C;  2XMO A;  4FBQ A;  1XZW A;  2ZBM A;  1SU1 A;  4H1S A;  1T71 A;  3H67 A;  4HD0 A;  2QJC A;  3C5W C;  3RL3 A;  3AUZ A;  2WDE A;  4V0W A;  4JA9 A;  1WAR A;  3K7V C;  2P6B A;  2CV9 A;  3DSC A;  3ICF A;  2BDX A;  4YKE A;  3TGH A;  2Z1A A;  4UT3 B;  4WWL A;  5IOH A;  2DXL A;  1WAO 1;  2A22 A;  3H62 B;  1V73 A;  3EGG A;  4Q7F A;  1T70 A;  2WDF A;  3QFM A;  3N5U A;  1FJM A;  4FCX A;  4O43 A;  5B8I A;  1II7 A;  5INB A;  5F3W A;  2JOG A;  2ZOA A;  2BCD A;  3D03 A;  5JJT A;  2YEQ A;  1NNW A;  1UTE A;  1U32 A;  2Z72 A;  4V0X A;  3PSN A;  1XM7 A;  4TUG A;  1AUI A;  1HPU A;  1Z2X A;  2YVT A;  3EGH A;  3H64 A;  3IB7 A;  3RQZ A;  4M0V A;  1MF8 A;  4F0Z A;  1S3L A;  2NPP C;  3K7W C;  4B2O A;  1S8E A;  4O4K A;  2O8G A;  1W24 A;  3RL4 A;  2HY1 A;  1IT6 A;  3ZU0 A;  3V4Y A;  2HYO A;  2IAE C;  3ZTV A;  4TUI A;  5EQV A;  4FBK A;  2NXF A;  1S95 A;  4ORA A;  3H66 A;  3KBP A;  4J6O A;  2R17 A;  4O24 A;  1G5B A;  4V0V A;  3H63 A;  2QFR A;  4H2B A;  4JA7 A;  4O5G A;  4MOY A;  5JPF A;  3H68 A;  1USH A;  3H60 A;  2DFJ A;  3IVD A;  3FLO A;  4XPN A;  4DT2 A;  5DNY A;  3E7B A;  1OI8 A;  2NYM C;  4LAC C;  1TCO A;  4NZV A;  3AV0 A;  3LL8 A;  3IB8 A;  1UF3 A;  3QG5 C;  4ORC A;  4UT3 A;  1S3N A;  4G9J A;  3JYF A;  1S3M A;  4DHL A;  4LTY A;  5HPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...