3HVSA

Escherichia coli thiol peroxidase (tpx) wild type disulfide form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
SQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol peroxidase
publication title Structural changes common to catalysis in the Tpx peroxiredoxin subfamily.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 55
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hvsA00
1JZOA 4X43A 3D4TA 4IS0A 5CREA 4ACSA 1XW9A 4ZB8A 1WWJA 4TR4A 5COHA 3KCMA 3ERGA 2XPDA 1MDIA 5KN1A 2LJRA 4V2NA 4ECBA 3MAKA 5JCWA 3M8NA 3A2XA 5DAKA 19GSA 4L5LA 5F05A 4K7NA 4EUYA 2H66A 3H1NA 2FWHA 1YDKA 3CRUA 1HNBA 2C8UA 3IRAA 4FIWA 3WT2A 3UMAA 1BX9A 1OC3A 1WP0A 1XFLA 2KLXA 4F03A 3DIEA 4EE0A 1IYHA 5IOXA 2C3TA 2IMIA 2IN3A 4OFTA 1R26A 1F6MC 4DSSA 1SENA 2MBSA 1J9BA 5ELAA 1GH2A 4YQMA 3GHAA 1E6BA 4AJ8A 1VF4A 2HZFA 1TRWA 1M9AA 2JACA 4IQAA 3TKPA 4ZBDA 1TRVA 4GSSA 3KP8A 2R6KA 4GCIA 3M1GA 3LQ7A 2G0FA 4OMVA 2DJJA 1QFNA 1A8LA 5A4WA 1SJ6A 3KJYA 2PVQA 4XS4B 4RI7A 5IPHA 2F8AA 5HR2A 4JE1A 1DSBA 2H0GA 4ZB9A 2WB9A 2CVKA 4MJEA 2JSZA 4FYCA 5AIVA 4N30A 2FA4A 1B9XC 4ZB6A 2WRTA 2TRCP 2OE3A 3PH9A 3VPQA 4OO5A 1SKSB 3IAS2 2H8LA 4AJ6A 2CAQA 1SL1B 4V2LA 3EU4A 2CVBA 3APSA 3IA1A 2V6OA 2AUVA 5DQYA 3CTFA 4MABA 3Q18A 3FKFA 3NOFA 5DALA 3QAWA 1EGRA 4Q5RA 2J23A 3VFIA 5L71A 4H86A 5ECMB 5ENUA 3LEFA 2F3MA 3BBYA 3HVXA 2B5EA 3UEMA 3L78A 2RUEA 3QPMA 2KOKA 3GFKA 4N10A 1PMTA 2TIRA 1A8YA 1YEPA 1O6JA 2ES7A 3LWAA 2HZEB 2H73A 3OR5A 1H4OA 2OBIA 4F0CA 3QDNA 4X0XA 1W89A 1UC7A 6GSSA 4XCSA 4DVCA 1AQVA 4G9HA 2LJAA 5AGYA 4O32A 5AIXA 5G1LA 1MD4A 4MF5A 5C04A 1G6YA 3QAGA 6GSXA 1S3DA 3L4NA 5JWRB 4LLRA 4KDYA 3TCOA 4TR3A 5JCUA 1RQMA 1GL8A 2EC4A 3WD6A 2CZ3A 3EVIA 2GVPA 2N5BA 6GSTA 4K7OA 1GSUA 2MZCA 17GSA 1PKZA 4O7HA 4WKWA 2I81A 4WXTA 4KSOA 3P90A 2NPBA 1B48A 3J7Yk 3DRNA 3HZ8A 2HE3A 1OVNA 2A2SA 2GTUA 2L57A 3F6DA 1TOFA 3D5JA 1K3LA 1BJXA 2B7KA 3F4TA 2LV3A 3W8JA 1U3AA 4V1Ag 4MPFA 1N2AA 1OAZA 2EIQA 1WOUA 1T8EB 4HZ2A 4QQ7A 1X9WB 3DYRA 1CQHA 3VWVA 1M9BA 1F37A 2VOCA 1ERTA 3UJ1A 2VCWA 3P7XA 3TKRA 3W6GA 5LD0A 3G7YA 5D73A 4HEA2 2YWNA 2E2GA 2E7PA 3GUSA 1QQ2A 5A4UA 3HYPA 3IXRA 4IN0A 4OD7A 2ZUPA 1U6TA 5JWQB 1XVQA 4LL1B 4GQCA 3FZ5A 4ZL7A 5IIZA 3D6IA 4XTSA 3FR6A 3E0UA 1U88A 2AAWA 5C00A 4TKYA 4GRFA 1K0DA 2H75A 5ECPB 2X99A 2C0EA 4E8EA 20GSA 2B5XA 3MNGA 3HD5A 3NZNA 4NHZA 4KUNA 2GQMA 1KEBA 1MD3A 1EOGA 2FCHA 1EZKA 4Q5QA 3I9V2 1EP8A 2IMFA 5KEJA 3BCKA 2VAFA 1EV4A 4X1UA 12GSA 5EL8A 1M0UA 2VM1A 3ZVJD 1A2LA 5G1KA 4L8EA 22GSA 3TOUA 2LQQA 5F07A 1CQGA 5CYYA 3RBTA 2C1YA 2L5OA 3ZL5A 4OCFA 3LJRA 1R5AA 2FWEA 2WZ9A 3RPPA 3LSZA 5IMVA 2CV4A 4BVYA 1XBSA 1OC8A 2C4JA 1AQXA 2PGTA 3FZ4A 2H1BA 2BTOT 4WBRD 2L59A 2LKUA 1XOAA 2JZTA 4WR4A 4IJIA 4LMVA 1TI3A 1TJDA 2L5LA 4POBA 2LNSA 2C0GA 2KP2A 4QL7A 4O5RA 3GH9A 3EC3A 1Z6MA 2H1DA 1GULA 1BEDA 1A0FA 5KN2A 1SJIA 2R3XA 2X64A 3QAVA 5IMCA 2PVOC 3VK9A 4Z7XA 5E59A 2Z9SA 1JLVA 3CSHA 1GNWA 5G31A 3J7Yb 2DJ0A 2CX4A 6GSUA 1ZMAA 3F9UA 3VPTA 1Z5YE 6GSWA 3EINA 5G5FA 3LFLA 1TRSA 3CMIA 5INYA 1F3AA 2H6XA 2H72A 2GT5A 2CVDA 1O8XA 4J57E 1X9MB 2N5AA 4F82A 4YAPA 1U87A 5H5QA 1FB6A 2F51A 5HFGA 4GQFA 4EL1A 2JZSA 5KN0A 1YZXA 4FYUA 1VF2A 2HLSA 2F8FA 4XRDA 1GP1A 4GLTA 1XW5A 4KA0A 1BYEA 4PURA 5LNKe 3FK8A 2DIZA 5EPFA 4HU7A 2VL2A 4KCAA 2YWIA 3CYNA 2RM5A 3EE2A 2OA7A 2LQOA 2H1GA 3PR8A 3GYKA 3TKSE 3H4KA 4XS4A 2H70A 5D8IA 1EEJA 3D21A 5HR0A 1RW1A 13GSA 1VGLA 4NXIA 4RQXA 5EVOA 2XBIA 2YV9A 2PWJA 1THXA 3RAZA 2ON5A 3PINA 4JZQA 1AUCA 1NM3A 1PSQA 2R5GA 3QD9A 1V40A 4HQZA 4KDUA 2L6DA 1GUMA 2YPMA 1LBKA 5ECQB 4P3YB 1ERWA 3EURA 2LUSA 3L0HA 4RI6A 1LJRA 4HQSA 2EIOA 2P0GA 3IPZA 4IP1A 1FO5A 4TN8A 2H6YA 3QCPA 4POMA 4F9ZA 4NV2A 5IMDA 4LA1A 1M2BA 3W8SA 3HJPA 1NSWA 2H01A 4GF0A 18GSA 1YEXA 3F8UA 4TR1A 1WIKA 4XIHA 3U6VA 1TDIA 2IFQB 1X5EA 5DDLA 2NVLA 1SU9A 10GSA 4FH8A 2VCXA 1IYIA 2YJHA 3CSIA 2YN1A 1TU8A 3FZAA 3UARA 3S9FA 1AC1A 4G10A 4MZCA 3SWLA 4PUAA 4GSTA 1ZZYA 2GGTA 3H8QA 3QFBC 5EY6A 1FG4A 2VD1A 3HY2A 2B7JA 4MZBA 2CX3A 1XZOA 4V1Ap 4KE3A 1GUHA 4D73B 4N0VA 3ZLPA 3A5WA 1HD2A 3WGDA 1ZYEA 1Z7RA 3ZREA 1F2EA 2WFCA 1O73A 2YJ7A 5ECIB 2GSRA 4ZBAA 3FY7A 5ECOB 1YKCA 4ILFA 1JZRA 3KEBA 4QL9A 2LEGA 3DEXA 3ZRDA 2IL3A 2NBSA 4I8BA 5J4UA 1E2YA 1FW1A 2WS2A 4EKZA 1EV9A 1XPVA 3GSTA 2ON7A 2VCQA 2QKEA 5G2ZA 2M46A 2GZYA 3TKSA 1ON4A 3C1SA 2FWFA 2R2JA 5B6MA 1GTAA 3UVHA 1ZOFA 5DVBA 5DBQA 3GL5A 4TW5A 5CRWA 1SL2B 1ZGNA 4POKA 4MPGA 2XBQA 4KGIA 3G7IA 4AF2A 4O92A 3PGTA 3JCML 3E9JB 4PUFC 5GSTA 2OJLA 1Q4JA 2MYGA 2E0QA 2DMMA 4DSRA 2KP1A 4CW9A 4MK3A 2GSTA 1WMJA 2G2QA 4OO4A 3LYKA 3KD0A 4IKHA 3HXSA 3DVWA 4YQUA 2PERA 3CRTA 3L9SA 5A5KA 2HNLA 1XXUA 1YY7A 3ERWA 3KMOA 1K3YA 2PUKC 2YANA 1QGVA 2AV4A 2VUPA 5DCHA 2VLTA 2LSTA 2YZHA 3I43A 2K8SA 3HDCA 3LORA 3G7JA 3F4RA 1N8JA 2C3NA 2JADA 4IBPA 5H5SA 1SK2A 5AISA 5JCGA 1GTIA 3TJJA 4ZILA 1OKDA 2V1MA 4ZXGA 5IMFA 4EXJA 3IK7A 4Q5FA 1AXDA 5GAPD 1EP7A 4FO5A 5IMZA 3FR9A 5ID2B 1J0FA 2FHEA 4JRRA 4TXOA 2FA8A 2FLSA 2H76A 2IMDA 4J2FA 1KBNA 1XCCA 4K0NA 3C8EA 2O8VB 4KAEA 1GSSA 5B8AA 2LRNA 4HJMA 4IP6A 1GSEA 1X0RA 2B3SA 2NTOA 3DGQA 1WRYA 1B8XA 4JEDA 2IMEA 3F3QA 4DSSB 1VRSD 3QOUA 2H74A 1PL1A 3FHKA 3IR4A 2P5RA 4N11A 2VL3A 5HR1A 1PN9A 1V58A 5ELGA 5DQSA 4BVXA 3I69A 2RIIA 3F6FA 2PN8A 2YNXA 2KHPA 4E8HA 3GMFA 1Z3EA 1Z9HA 2HYXA 4EC0A 4L0WA 1ZYQB 1TXXA 3RDWA 3TDGA 2B1KA 1V57A 2MMNA 4PXOA 3I6AA 2GT6A 3H93A 2K9FA 2I1UA 5CRDA 3Q6OA 3ERFA 2CT6A 4POLA 3M9KA 4MA9A 3GSSA 1FAAA 3QR6A 1FHEA 3HJMA 4K8MA 1RK4A 3KP9A 1FVJA 5GZZB 4NWYA 16GSA 1UVZA 4I6XA 2HSHA 5CRHA 4DSQA 2WULA 2DIYA 9GSSA 2IMKA 3D22A 2L4QA 1SKRB 5LCZA 4G2EA 2YP6A 3L9VA 1JHBA 1UN2A 3KZQA 4F0BA 5DJMA 4I97A 1R5PA 1ERUA 2K6VA 4KCEA 4ML6A 4KDXA 4HOJA 5B8BA 1G0TA 1T4YA 3GA4A 5CRGA 2F9SA 2O87A 2ZCTA 5DJLA 5IOWA 4MF6A 1SYXA 2H6ZA 1PRXA 2H30A 1M99A 1OC9B 3A2VA 1R4WA 1J08A 1I9DA 2DSAA 2QC7A 1NHOA 2REMA 1NHYA 2OE0A 5ECNB 5J41A 2H19A 3ZTLA 3GIXA 11GSA 3VLNA 1WE0A 1NW2A 4PQIA 5HFIA 5B6NA 4AJ7A 3ZFLA 4BL7A 2IWTA 2C80A 1BQ7A 1XWBA 3N5OA 4HI7A 3HVSA 4XHMA 3GKXA 4JBBA 3GURA 5J9BA 1EGOA 1AW9A 3TJFA 2AB6A 2GDRA 2IFQA 2M72A 3WYWA 3TRPA 3FW2A 4RUVA 1GSQA 1M7TA 1TTZA 4G19A 4OFMA 1U3IA 2XC2A 3U5RE 1SD8A 3IOSA 2AHEA 1TW9A 3APQA 3H79A 3ZVJA 2BJXA 5IQYA 2AYTA 3C7MA 4PX1A 3FYGA 3GTUB 3GKNA 1A23A 4BWSA 1QK8A 5CO3A 4I5QA 5IO2A 2N5FA 1F9MA 4F2IA 1THOA 4WF4A 4KW6A 4D73A 2JL4A 14GSA 4NAXA 3KH9A 4N0ZA 1GUKA 2MMZA 1BAYA 3IV4A 2TRXA 2PBJA 1Z6NA 2E2MA 5GSSA 4OWYA 1ZCPA 1QXHA 8GSSA 2AJQB 4JR4A 5ECHB 3ZFBA 4KSMA 3UIWA 1GNEA 5G5EA 1A2MA 2A2RA 3TUEA 2ZNMA 3KIJA 1Z7PA 4GXZA 4RQRA 4TRXA 5DCGA 1GTBA 5F0GA 1TU7A 3VWUA 1T7PB 3FZ9A 1GLPA 2HRNA 3P8WA 3VWXA 1A24A 3DWVA 4LL4B 1GTUA 3IBHA 4IELA 4K9ZA 2VM2A 3GX0A 1K0OA 1XWAA 4ISDA 4ML1A 1Y25A 5J9CA 5ECKB 2O7KA 1KNGA 5D9VA 4WBJA 3V1WA 4LMWA 4HDEA 2EIRA 2YCDA 1JLWA 2GLRA 1MDKA 3GN3A 1EOHA 1ST9A 4ZBBA 4PNGA 1UA5A 4K7IA 4OCEA 1QUWA 2HXKA 1T00A 1JZDA 1XOBA 4ID0A 2P31A 2VLVA 3ME7A 2OE1A 2DC5A 4ULXA 4HU9A 3ZIJA 1HQOA 1O85A 2HZEA 3Q74A 4IVFA 3Q19A 1TK5B 5FWGA 3ZMKA 5H5RA 1GWCA 1G6WA 3CSJA 2R4VA 2DMLA 2VCZA 2X8GA 3MSZA 4PNFA 2B6MA 4K0GA 3M3MA 1W4VA 1HNCA 3BD2A 2VCVA 1GSYA 2LRCA 4BWQA 4KNDA 5D9WA 3US3A 1A2JA 1XWGA 4HUAA 2YWMA 3ZMLA 3HCZA 1XW6A 2VIMA 3DVXA 5ID2A 2MMOA 4IW9A 2CAIA 2H0IA 2PPTA 3EMPA 5CNWA 2WGRA 4L5OA 5J5NA 4ECCA 1K0MA 1FB0A 3D4MA 2DBCA 3MWHA 5HFKA 4FYBA 2QGVA 2HSYA 3DD3A 3D0ZA 2GZZA 3TKQA 5JWOB 4IHUA 3C71A 4PQ1A 4MZWA 1JFUA 2H1AA 3M9JA 3RHBA 3ZIVA 3UVTA 1TK8B 3SBCA 3A3TA 1TRUA 5CAXA 2B5YA 3UBLA 3K8NA 4I2TA 1ERVA 5G30A 3HZ4A 2PU9C 2OACA 4MJBA 2I4AA 4EDZA 3LXZA 3LYPA 1OE7A 3CTGA 4PGTA 1Y6EA 2WDUA 1I5GA 3EMXA 4NHWA 4EDYA 3M0FA 2V41A 2VL9A 1M2AA 2R37A 4GTUA 1LU4A 1SD9A 4KH7A 5IPGA 2VL2C 1XWCA 1DUGA 2H71A 3TJBA 4CDOA 2ALBA 1ACVA 5ECRB 3TRQA 5AN1A 1TP9A 5GAND 2L4CA 3ZYWA 4K2DA 2GSSA 5CP1A 3N9JA 2YZUA 3LXTA 4ZL9A 3ZITA 1AIUA 1YQ1A 3KGKA 2GQKA 1YF1A 4V2MA 1A0RP 1O81A 2HT9A 7GSSA 4TR1B 1GSDA 2FWGA 3IDVA 4MMMA 2OBKA 6GSYA 2MMAA 3G9BA 3TJKA 2YOIA 4YH2A 1URMA 3C73A 2X8HA 2FD3A 5D93A 2FGXA 4K6XA 5DAKB 1WPIA 2I3YA 2C3QA 3GKMA 3WT1A 2A4VA 4HS1A 3IHQA 1OC9A 4MLYA 2P5QA 4WEYA 3F4SA 3ED3A 5B7CA 1ZL9A 1M2DA 2V32A 3QFAC 2CZ2A 1YJ6A 3VWWA 1V98A 4Q5NA 3BJ5A 1GLQA 4OFNA 4ZIJA 3FEUA 5D96A 4MJAA 4NMUA 6GSVA 5F06A 1USBA 4K1FA 1V2AA 1HNAA 1BG5A 2O89A 1SJZA 3VI7A 3NIVA 5IMAA 1XWKA 2DJ2A 1X9SB 3O6TA 1B4QA 1VF1A 2FY6A 4IQ1A 1S3CA 3GV1A 2LS5A 1T3BA 4YQVA 5KN3A 4IJ3A 2LRTA 3TRXA 4AGSA 2V2GA 5ABRA 2CQ9A 3GX8A 3DMLA 4HJ2A 3O3TA 3IAM2 2K18A 1G7EA 1EEMA 3F3RA 5ECLB 2OADA 5FT3A 4TVEA 3HHVA 1SKWB 5F8BA 2GQLA 3GTUA 3ME8A 4XS6A 1JZWA 3KH7A 5DALB 3HA9A 3O76A 3TKSC 1OE8A 4ECJA 3HJOA 3CXGA 1VF3A 3APOA 3GH6A 2JU5A 3WGEA 3UOMA 1AQWA 5HQPA 5D9XA 1OYJA 1FVKA 2C0FA 1SL0B 4I2UA 1FOVA 5E4WA 1V9WA 1PX7A 4BPYA 1GSFA 2DJ3A 2K8VA 3TGZA 2X8CA 4EVMA 4J56E 4NPBA 3C1RA 1ILOA 1PD21 1O7UA 1MDJA 4KB3A 1SYRA 2D2ZA 2O85A 3BCIA 3EWLA 1B9YC 1MTCA 4WETA 4WR5A 4GWRA 1ABAA 4PQHA 3EYTA 2HFDA 5ECSA 2XHFA 4TR0A 2VD0A 2V6KA 1C72A 4MJCA 3P2AA 2GSQA 3RHCA 2VLUA 1O8WA 1T1VA 3F63A 3TB2A 4IGJA 1PQNA 2C0DA 1KTEA 3GNJA 1K0AA 3GL3A 2BMXA 4TXOB 1X5DA 4DEJA 1PKWA 2WJUA 3L9UA 3KMNA 2FNOA 1T4ZA 2LTKA 1G7OA 4MH3A 3UL3A 1B4PA 3IE3A 1DE1A 2IJYA 1K0BA 1WJKA 4ZL8A 3TOTA 3QMXA 1OKTA 1SK0A 2HI7A 3IC4A 4EO3A 4EF0A 1XIYA 4MDCA 3VI5A 1S3AA 3E3EA 1F3BA 2GZPA 4MH2A 1YF0A 3TJGA 4YAVA 1AAZA 2LJKA 4NV5A 2IPAA 2JSYA 2J9HA 4XRAA 5IO0A 2DLXA 2PMTA 4MF7A 2OKAA 2FUG2 1K3OA 2KUCA 2DJKA 2WCIA 1ML6A 2QSIA 2MBTA 1PX6A 3UBKA 1TK0B 2HRFA 3ZZXA 5IM9A 2CA8A 5FHIA 3GRXA 5D9TA 2YWOA 3LG6A 1Q98A 4L0UA 2GS3A 3CBUA 1R7HA 2LNTA 4ECIA 1TKDB 1TI1A 1H75A 1K0NA 2RUFA 3R2QA 3FR3A 5HR3A 3KM6A 2RM6A 3GKKA 4JR6A 1DE2A 3IK9A 1PA3A 1PGTA 4HZ4A 1MEKA 2M80A 1GRXA 3KXOA 3EU3A 3MDKA 3HVVA 4JU5A 2H0HA 3VURA 3DKSA 1X5CA 3UAPA 3ISOA 3RPNA 2JZRA 2XPEA 2NDOA 1K0CA 2DJ1A 2RLIA 3FRCA 5J3RA 1DBYA 4TXVA 2B1LA 4GSNA 4MP4A 1SK1A 2YV7A 2I9HA 1HYUA 1YKAA 3LGCA 4BA7A 2VO4A 2IIYA 3KTBA 4XS1A 3HKRA 3AY8A 1QMVA 3F0IA 3DXBA 3A2WA 1EWXA 3KTLA 1XVWA 4WF5A 3BOAA 5A4VA 2VCTA 2L6CA 4KX4A 4TOPA 3WGXA 4MCUA 1PL2A 4CHSA
chains in the Genus database with same CATH superfamily
1JZOA 4X43A 3D4TA 4IS0A 3R3EA 5CREA 4ACSA 1XW9A 4K2XA 4ZB8A 4G0KA 1WWJA 4TR4A 5COHA 5KOWA 3KCMA 3ERGA 2XPDA 1MDIA 5KN1A 2LJRA 4V2NA 4ECBA 3MAKA 5JCWA 3M8NA 3A2XA 5DAKA 19GSA 4L5LA 5F05A 4K7NA 4KF9A 4EUYA 2H66A 3H1NA 2FWHA 1YDKA 3CRUA 1HNBA 2C8UA 3IRAA 4FIWA 3WT2A 3UMAA 2A4HA 1BX9A 1OC3A 1WP0A 1XFLA 2KLXA 4F03A 3DIEA 4EE0A 1IYHA 5IOXA 2C3TA 2IMIA 2IN3A 4OFTA 1R26A 1F6MC 4DSSA 1SENA 2MBSA 1J9BA 1GH2A 5ELAA 4YQMA 3GHAA 4Z2RA 1E6BA 4AJ8A 1VF4A 2HZFA 1TRWA 1M9AA 2JACA 4IQAA 3TKPA 4ZBDA 1TRVA 4GSSA 3KP8A 2R6KA 4GCIA 3M1GA 3LQ7A 2G0FA 4OMVA 2DJJA 1QFNA 1A8LA 3A5IA 5A4WA 1SJ6A 3KJYA 2PVQA 4XS4B 4RI7A 5IPHA 2F8AA 5HR2A 4JE1A 1DSBA 2H0GA 4ZB9A 2WB9A 2CVKA 4MJEA 2JSZA 4FYCA 5AIVA 4N30A 2FA4A 1B9XC 4ZB6A 2WRTA 2TRCP 2OE3A 3PH9A 3VPQA 4OO5A 1SKSB 3IAS2 2H8LA 4AJ6A 2CAQA 1SL1B 4V2LA 3EU4A 2CVBA 3APSA 3IA1A 5BMUA 2V6OA 2AUVA 5DQYA 3CTFA 4MABA 3Q18A 3FKFA 3NOFA 5DALA 3QAWA 1EGRA 3MIXA 4Q5RA 2J23A 3VFIA 5L71A 4H86A 5ECMB 5ENUA 3LEFA 2F3MA 3BBYA 3HVXA 2B5EA 3UEMA 3L78A 2RUEA 3QPMA 2KOKA 3GFKA 4N10A 1PMTA 2TIRA 1A8YA 1YEPA 1O6JA 2ES7A 3LWAA 2HZEB 2H73A 3OR5A 1H4OA 2OBIA 4F0CA 3QDNA 4X0XA 1W89A 1UC7A 6GSSA 4XCSA 4DVCA 1AQVA 4G9HA 2LJAA 5AGYA 4O32A 5AIXA 5G1LA 1MD4A 4MF5A 5C04A 1G6YA 3QAGA 6GSXA 4YKGA 1S3DA 3L4NA 5JWRB 4LLRA 4KDYA 1XG8A 4TR3A 3TCOA 5JCUA 1RQMA 1ZYNA 1GL8A 2EC4A 3WD6A 2CZ3A 3EVIA 2GVPA 2N5BA 6GSTA 4K7OA 1GSUA 2MZCA 17GSA 1PKZA 4O7HA 4YKFA 4WKWA 2I81A 4WXTA 4KSOA 3P90A 2NPBA 4PTSA 1B48A 3J7Yk 3DRNA 3HZ8A 2HE3A 1OVNA 2A2SA 2GTUA 5BRTA 1M3IA 2L57A 3F6DA 1TOFA 3D5JA 1K3LA 1BJXA 2B7KA 3F4TA 2R0CA 2LV3A 3W8JA 1U3AA 2X4AA 4V1Ag 4MPFA 1N2AA 1OAZA 2EIQA 1WOUA 1T8EB 4HZ2A 4QQ7A 1X9WB 3DYRA 1CQHA 3VWVA 1M9BA 1F37A 2VOCA 1ERTA 3UJ1A 2VCWA 3P7XA 3TKRA 3W6GA 5LD0A 3G7YA 5D73A 4HEA2 2HRAA 4Z2UA 2YWNA 2E2GA 2E7PA 3GUSA 1QQ2A 5A4UA 3HYPA 3IXRA 4IN0A 4OD7A 2ZUPA 1U6TA 5JWQB 1XVQA 4LL1B 4GQCA 3FZ5A 4ZL7A 5IIZA 3D6IA 4XTSA 3FR6A 1ZYPA 3E0UA 1U88A 2AAWA 5C00A 4TKYA 4GRFA 1K0DA 2H75A 5ECPB 2X99A 2C0EA 4E8EA 20GSA 2B5XA 3MNGA 3HD5A 3NZNA 4NHZA 4KUNA 2GQMA 1KEBA 1MD3A 1EOGA 2FCHA 1EZKA 4Q5QA 4BIKA 3I9V2 1EP8A 2IMFA 5KEJA 3BCKA 2VAFA 1EV4A 4X1UA 12GSA 5EL8A 1M0UA 2VM1A 3ZVJD 1A2LA 5G1KA 4L8EA 22GSA 3TOUA 2LQQA 5F07A 1CQGA 5CYYA 3RBTA 2C1YA 2L5OA 3ZL5A 4OCFA 3LJRA 1R5AA 2FWEA 2WZ9A 3RPPA 3LSZA 5IMVA 2CV4A 4BVYA 1XBSA 1OC8A 2C4JA 1AQXA 2PGTA 3FZ4A 2H1BA 2BTOT 4WBRD 2L59A 2LKUA 1XOAA 2JZTA 3PPUA 4WR4A 4IJIA 4LMVA 1TI3A 1TJDA 2L5LA 4POBA 2LNSA 2C0GA 2KP2A 4QL7A 4O5RA 3GH9A 3EC3A 1Z6MA 2H1DA 1GULA 1BEDA 1A0FA 5KN2A 1SJIA 2R3XA 4BVXB 2X64A 3QAVA 5IMCA 2PVOC 3VK9A 4Z7XA 5E59A 1S3RA 2Z9SA 1JLVA 3CSHA 1GNWA 5G31A 3J7Yb 2DJ0A 2CX4A 6GSUA 1ZMAA 3F9UA 3VPTA 1Z5YE 6GSWA 3EINA 5G5FA 3LFLA 1TRSA 3CMIA 5INYA 1F3AA 2H6XA 2H72A 2GT5A 2CVDA 1O8XA 4J57E 1X9MB 2N5AA 1M3JA 4F82A 4YAPA 1U87A 5H5QA 1FB6A 2F51A 5HFGA 4GQFA 4EL1A 2JZSA 5KN0A 1YZXA 4FYUA 1VF2A 2HLSA 2F8FA 4XRDA 1GP1A 4GLTA 1XW5A 4KA0A 1BYEA 4PURA 5LNKe 3FK8A 2DIZA 5EPFA 4HU7A 2VL2A 4KCAA 2YWIA 3CYNA 2RM5A 3EE2A 2OA7A 2UZ8A 2LQOA 2H1GA 3PR8A 3GYKA 3TKSE 3H4KA 4XS4A 2H70A 5D8IA 1EEJA 3D21A 5HR0A 1RW1A 13GSA 1VGLA 4NXIA 4RQXA 5EVOA 2XBIA 2YV9A 2PWJA 1THXA 3RAZA 2ON5A 3PINA 4JZQA 1AUCA 1NM3A 1PSQA 2R5GA 3QD9A 1V40A 4HQZA 4KDUA 2L6DA 1GUMA 2YPMA 1LBKA 4A5PA 5ECQB 4P3YB 1ERWA 3EURA 2LUSA 3L0HA 4RI6A 1LJRA 4HQSA 2EIOA 2P0GA 3IPZA 4IP1A 1FO5A 4TN8A 2H6YA 3QCPA 4POMA 4F9ZA 4NV2A 5IMDA 4CY6A 4LA1A 1M2BA 3W8SA 3HJPA 1NSWA 2H01A 4GF0A 18GSA 1YEXA 3F8UA 4TR1A 1WIKA 4XIHA 3U6VA 1TDIA 2IFQB 1X5EA 5DDLA 2NVLA 1SU9A 10GSA 4FH8A 2VCXA 2DKIA 1IYIA 2YJHA 3CSIA 2YN1A 1TU8A 4G0LA 3FZAA 3UARA 3S9FA 1AC1A 4G10A 4MZCA 3SWLA 4PUAA 4G0IA 4GSTA 1ZZYA 2GGTA 3H8QA 3QFBC 5EY6A 1FG4A 2VD1A 4CY8A 3HY2A 2B7JA 4MZBA 2CX3A 1XZOA 4V1Ap 4KE3A 1GUHA 4D73B 4N0VA 3ZLPA 3A5WA 1HD2A 3WGDA 1ZYEA 1Z7RA 3ZREA 1F2EA 2WFCA 1O73A 2YJ7A 5ECIB 2GSRA 4ZBAA 3FY7A 5ECOB 1YKCA 4ILFA 1JZRA 3KEBA 4QL9A 2LEGA 3DEXA 3ZRDA 2IL3A 2NBSA 4I8BA 5J4UA 1E2YA 1FW1A 3LW9A 2WS2A 4EKZA 1EV9A 1XPVA 3GSTA 2ON7A 4HSCX 2VCQA 4X4JA 2QKEA 5G2ZA 2M46A 2GZYA 3TKSA 1ON4A 3C1SA 2FWFA 2R2JA 5B6MA 1GTAA 3UVHA 1ZOFA 5DVBA 5DBQA 3GL5A 4TW5A 5CRWA 1SL2B 1ZGNA 4POKA 4MPGA 2XBQA 4KGIA 3G7IA 4AF2A 4O92A 3PGTA 3JCML 3E9JB 4PUFC 1PN0A 5GSTA 2OJLA 1Q4JA 2MYGA 2E0QA 2DMMA 4DSRA 2KP1A 4CW9A 4MK3A 2GSTA 1WMJA 2G2QA 4OO4A 3LYKA 3KD0A 4IKHA 3HXSA 3DVWA 4YQUA 2PERA 3CRTA 3L9SA 2A2PA 5A5KA 2HNLA 1XXUA 1YY7A 3ERWA 2DKHA 3KMOA 1K3YA 2PUKC 3CQFA 2YANA 3FMWA 1QGVA 2AV4A 2VUPA 5DCHA 2VLTA 2LSTA 2YZHA 3I43A 2K8SA 3HDCA 3LORA 3G7JA 3F4RA 1N8JA 2C3NA 2JADA 4IBPA 5H5SA 4FQUA 1SK2A 5AISA 5JCGA 1GTIA 3TJJA 4ZILA 1OKDA 2V1MA 4ZXGA 5IMFA 4EXJA 3IK7A 4Q5FA 1AXDA 5GAPD 1EP7A 4FO5A 5IMZA 3FR9A 5ID2B 1J0FA 2FHEA 4JRRA 4TXOA 2FA8A 2FLSA 2H76A 2IMDA 4J2FA 1KBNA 1XCCA 4K0NA 3C8EA 2O8VB 4KAEA 1GSSA 5B8AA 2LRNA 4HJMA 4IP6A 1GSEA 1X0RA 2B3SA 2NTOA 3DGQA 1WRYA 1B8XA 4JEDA 2IMEA 3F3QA 4DSSB 1VRSD 3QOUA 2H74A 1PL1A 3FHKA 3IR4A 2P5RA 4N11A 2VL3A 4Z2TA 5HR1A 1PN9A 1V58A 5DQSA 5ELGA 4BVXA 3I69A 2RIIA 3F6FA 2PN8A 2YNXA 2KHPA 4E8HA 3GMFA 1Z3EA 1Z9HA 2HYXA 4EC0A 4L0WA 1ZYQB 1TXXA 3RDWA 3TDGA 2B1KA 1V57A 2MMNA 4PXOA 3I6AA 2GT6A 3H93A 2K9FA 2I1UA 5CRDA 3Q6OA 3ERFA 2CT6A 4POLA 3M9KA 4MA9A 3GSSA 1FAAA 3QR6A 1FHEA 3HJMA 4K8MA 1RK4A 3KP9A 1FVJA 5GZZB 2R0PA 4NWYA 16GSA 1UVZA 4I6XA 2HSHA 5CRHA 4DSQA 2WULA 2DIYA 9GSSA 2IMKA 3D22A 2L4QA 1SKRB 5LCZA 4G2EA 2YP6A 3L9VA 1JHBA 1UN2A 3KZQA 4F0BA 5DJMA 4I97A 1R5PA 1ERUA 2K6VA 4KCEA 4ML6A 4KDXA 3MYDA 4HOJA 5B8BA 1G0TA 1T4YA 3GA4A 5CRGA 2F9SA 2O87A 2ZCTA 5DJLA 5IOWA 4MF6A 1SYXA 2H6ZA 1PRXA 2H30A 1M99A 1OC9B 3A2VA 1R4WA 1J08A 1FOHA 1I9DA 2DSAA 2QC7A 1NHOA 2REMA 1NHYA 2OE0A 4O5QA 5ECNB 5J41A 2H19A 3ZTLA 3GIXA 11GSA 3VLNA 2X49A 1WE0A 4EIQA 1NW2A 4PQIA 5HFIA 5B6NA 4AJ7A 3ZFLA 4BL7A 2IWTA 2C80A 1BQ7A 1XWBA 3N5OA 4HI7A 3HVSA 4XHMA 3GKXA 4JBBA 3GURA 5J9BA 1EGOA 1AW9A 3TJFA 2AB6A 2GDRA 2IFQA 2M72A 3WYWA 3TRPA 3FW2A 4RUVA 1GSQA 1M7TA 1TTZA 4G19A 4OFMA 1U3IA 2XC2A 3U5RE 1SD8A 3IOSA 2AHEA 1TW9A 3APQA 3H79A 3ZVJA 2BJXA 5IQYA 2AYTA 3C7MA 4PX1A 3FYGA 3GTUB 3GKNA 1A23A 4BWSA 1QK8A 5CO3A 4I5QA 5IO2A 2N5FA 1F9MA 4F2IA 1THOA 4WF4A 4KW6A 4D73A 2JL4A 14GSA 4NAXA 3KH9A 4N0ZA 1GUKA 2MMZA 1BAYA 3IV4A 2TRXA 2PBJA 1Z6NA 2E2MA 5GSSA 4OWYA 1ZCPA 1QXHA 8GSSA 2AJQB 4JR4A 5ECHB 3ZFBA 4KSMA 3UIWA 1GNEA 5G5EA 1A2MA 2A2RA 3TUEA 2ZNMA 3KIJA 1Z7PA 4GXZA 4RQRA 4TRXA 5DCGA 1GTBA 5F0GA 1TU7A 3VWUA 1T7PB 3FZ9A 1GLPA 2HRNA 3P8WA 3VWXA 1A24A 3DWVA 4LL4B 1GTUA 3IBHA 4IELA 4K9ZA 2VM2A 3GX0A 1K0OA 1XWAA 4ISDA 4ML1A 4O5UA 1Y25A 5J9CA 5ECKB 2O7KA 1KNGA 5D9VA 4WBJA 3V1WA 4LMWA 4HDEA 2EIRA 2R0GA 2YCDA 4BVYB 1JLWA 2GLRA 1MDKA 3GN3A 4ICYA 1EOHA 1ST9A 4ZBBA 4PNGA 1UA5A 4K7IA 4OCEA 1QUWA 2HXKA 1T00A 2QA1A 1JZDA 1XOBA 4ID0A 2P31A 2VLVA 3ME7A 2OE1A 2DC5A 4ULXA 4HU9A 3ZIJA 1HQOA 1O85A 2HZEA 3Q74A 4IVFA 3Q19A 1TK5B 5FWGA 3ZMKA 5H5RA 1GWCA 1G6WA 3CSJA 4EIPA 2R4VA 2DMLA 2VCZA 2X8GA 3MSZA 4PNFA 2B6MA 4K0GA 3M3MA 1W4VA 1HNCA 3BD2A 2VCVA 1GSYA 2LRCA 4BWQA 4KNDA 5D9WA 3US3A 1A2JA 1XWGA 4HUAA 2YWMA 3ZMLA 3HCZA 1XW6A 2VIMA 3DVXA 5ID2A 2MMOA 4IW9A 2CAIA 2H0IA 2PPTA 3EMPA 5CNWA 2WGRA 4L5OA 5J5NA 4ECCA 1K0MA 1FB0A 3D4MA 2DBCA 3MWHA 5HFKA 4FYBA 2QGVA 2HSYA 3DD3A 3D0ZA 2GZZA 3TKQA 5JWOB 4IHUA 3C71A 4PQ1A 4MZWA 1JFUA 2H1AA 3M9JA 3RHBA 3ZIVA 3UVTA 1TK8B 3SBCA 3A3TA 1TRUA 5CAXA 2B5YA 3UBLA 3K8NA 4I2TA 1ERVA 5G30A 3HZ4A 2HSMA 2PU9C 2OACA 4MJBA 2I4AA 4EDZA 3LXZA 3LYPA 1OE7A 3CTGA 4PGTA 1Y6EA 2WDUA 1I5GA 3EMXA 3IC8A 4NHWA 4EDYA 3M0FA 2V41A 2VL9A 1M2AA 2R37A 4GTUA 1LU4A 1SD9A 4KH7A 5IPGA 2VL2C 1XWCA 1DUGA 2H71A 3TJBA 4CDOA 2ALBA 1ACVA 2QA2A 4K5SA 5ECRB 3TRQA 5AN1A 1TP9A 5GAND 2L4CA 3ZYWA 4K2DA 2GSSA 5CP1A 3N9JA 2YZUA 3LXTA 4ZL9A 3ZITA 1AIUA 1YQ1A 3KGKA 2GQKA 1YF1A 4V2MA 1A0RP 1O81A 2HT9A 7GSSA 4TR1B 1GSDA 2FWGA 3IDVA 4MMMA 2OBKA 6GSYA 2MMAA 3G9BA 3TJKA 2YOIA 4YH2A 1URMA 3C73A 2X8HA 2FD3A 5D93A 2FGXA 4K6XA 5DAKB 1WPIA 2I3YA 2C3QA 3GKMA 3WT1A 2A4VA 4HS1A 3IHQA 1OC9A 4MLYA 2P5QA 4WEYA 3F4SA 3ED3A 5B7CA 1ZL9A 1M2DA 2V32A 3QFAC 2CZ2A 1YJ6A 3VWWA 1V98A 4Q5NA 3BJ5A 1GLQA 4OFNA 4ZIJA 3FEUA 4MJAA 4NMUA 5D96A 6GSVA 5F06A 1USBA 4K1FA 1V2AA 1HNAA 1BG5A 2O89A 1SJZA 3VI7A 3NIVA 5IMAA 1XWKA 2DJ2A 1X9SB 3O6TA 1B4QA 1VF1A 2FY6A 4IQ1A 1S3CA 3GV1A 2LS5A 1T3BA 4YQVA 5KN3A 4IJ3A 2LRTA 3TRXA 4AGSA 2V2GA 5ABRA 2CQ9A 3GX8A 3DMLA 4HJ2A 3O3TA 3IAM2 2K18A 1G7EA 1EEMA 3F3RA 5ECLB 2OADA 5FT3A 4TVEA 3HHVA 1SKWB 5F8BA 2GQLA 3GTUA 3ME8A 4XS6A 1JZWA 3KH7A 5DALB 3HA9A 3O76A 3TKSC 1OE8A 4ECJA 3HJOA 3CXGA 1VF3A 3APOA 3GH6A 2JU5A 3WGEA 3UOMA 1AQWA 5HQPA 5D9XA 1OYJA 1FVKA 2C0FA 1SL0B 3HVNA 4I2UA 1FOVA 5E4WA 1V9WA 1PX7A 4BPYA 1GSFA 2DJ3A 2K8VA 3TGZA 2X8CA 4EVMA 4J56E 4NPBA 3C1RA 1ILOA 1PD21 1O7UA 1MDJA 4KB3A 1SYRA 2D2ZA 2O85A 3BCIA 3EWLA 1B9YC 1MTCA 4WETA 4WR5A 4GWRA 1ABAA 4PQHA 3EYTA 2HFDA 5ECSA 2XHFA 4TR0A 2VD0A 2V6KA 1C72A 4MJCA 3P2AA 2GSQA 1PFOA 2HRKA 3RHCA 2VLUA 1O8WA 1T1VA 3F63A 3TB2A 4IGJA 1PQNA 2C0DA 1KTEA 3GNJA 1K0AA 3GL3A 2BMXA 4TXOB 1X5DA 4DEJA 4USSA 1PKWA 2WJUA 3L9UA 3KMNA 2FNOA 1T4ZA 2LTKA 1G7OA 4MH3A 3UL3A 1B4PA 3IE3A 1DE1A 2IJYA 1K0BA 1WJKA 4ZL8A 3TOTA 3QMXA 1OKTA 1SK0A 2HI7A 3IC4A 4EO3A 4EF0A 1XIYA 4MDCA 3VI5A 1S3AA 3E3EA 1F3BA 2GZPA 4MH2A 1YF0A 3TJGA 4YAVA 1AAZA 2LJKA 4NV5A 2IPAA 2JSYA 2J9HA 4XRAA 5IO0A 2DLXA 2PMTA 4MF7A 2OKAA 2FUG2 1K3OA 2KUCA 2DJKA 2WCIA 1ML6A 2QSIA 2MBTA 1PX6A 3UBKA 1TK0B 2HRFA 3ZZXA 5IM9A 2CA8A 5FHIA 3GRXA 5KOXA 5D9TA 4MNNA 2YWOA 3LG6A 1Q98A 4L0UA 2GS3A 3CBUA 1R7HA 2LNTA 4ECIA 1TKDB 1TI1A 1H75A 1K0NA 2RUFA 3R2QA 3FR3A 5HR3A 3KM6A 2RM6A 3GKKA 4JR6A 1DE2A 3IK9A 1PA3A 1PGTA 3IHGA 4HZ4A 1MEKA 2M80A 3EPTA 1GRXA 3KXOA 3EU3A 3MDKA 3HVVA 4JU5A 2H0HA 3VURA 3DKSA 1X5CA 3UAPA 3ISOA 3RPNA 2JZRA 2XPEA 2NDOA 1K0CA 2DJ1A 2RLIA 4K5RA 3FRCA 5J3RA 1DBYA 4TXVA 2B1LA 4GSNA 4MP4A 1SK1A 2YV7A 2I9HA 1HYUA 1YKAA 3LGCA 4BA7A 2VO4A 2IIYA 3KTBA 4XS1A 3HKRA 3AY8A 1QMVA 3F0IA 3DXBA 3A2WA 1EWXA 3KTLA 1XVWA 4WF5A 3BOAA 5A4VA 2VCTA 2L6CA 4KX4A 4TOPA 3WGXA 4MCUA 1PL2A 4CHSA 4BL7B
chains in the Genus database with same CATH topology
1JZOA 4X43A 3D4TA 4IS0A 3R3EA 5CREA 4ACSA 1XW9A 4K2XA 4ZB8A 4G0KA 1WWJA 4TR4A 5COHA 5KOWA 3KCMA 3ERGA 2XPDA 1MDIA 5KN1A 2LJRA 4V2NA 4ECBA 3MAKA 5JCWA 3M8NA 3A2XA 5DAKA 19GSA 4L5LA 5F05A 4K7NA 4KF9A 4EUYA 2H66A 3H1NA 2FWHA 1YDKA 3CRUA 1HNBA 2C8UA 3IRAA 4FIWA 3WT2A 3UMAA 2A4HA 1BX9A 1OC3A 1WP0A 1XFLA 2KLXA 4F03A 3DIEA 4EE0A 1IYHA 5IOXA 2C3TA 2IMIA 2IN3A 4OFTA 1R26A 1F6MC 4DSSA 1SENA 2MBSA 1J9BA 1GH2A 5ELAA 4YQMA 3GHAA 4Z2RA 1E6BA 4AJ8A 1VF4A 2HZFA 1TRWA 1M9AA 2JACA 4IQAA 3TKPA 4ZBDA 1TRVA 4GSSA 3KP8A 2R6KA 4GCIA 3M1GA 3LQ7A 2G0FA 4OMVA 2DJJA 1QFNA 1A8LA 3A5IA 5A4WA 1SJ6A 3KJYA 2PVQA 4XS4B 4RI7A 5IPHA 2F8AA 5HR2A 4JE1A 1DSBA 2H0GA 4ZB9A 2WB9A 2CVKA 4MJEA 2JSZA 4FYCA 5AIVA 4N30A 2FA4A 1B9XC 4ZB6A 2WRTA 2TRCP 2OE3A 3PH9A 3VPQA 4OO5A 1SKSB 3IAS2 2H8LA 4AJ6A 2CAQA 1SL1B 4V2LA 3EU4A 2CVBA 3APSA 3IA1A 5BMUA 2V6OA 2AUVA 5DQYA 3CTFA 4MABA 3Q18A 3FKFA 3NOFA 5DALA 3QAWA 1EGRA 3MIXA 4Q5RA 2J23A 3VFIA 5L71A 4H86A 5ECMB 5ENUA 3LEFA 2F3MA 3BBYA 3HVXA 2B5EA 3UEMA 3L78A 2RUEA 3QPMA 2KOKA 3GFKA 4N10A 1PMTA 2TIRA 1A8YA 1YEPA 1O6JA 2ES7A 3LWAA 2HZEB 2H73A 3OR5A 1H4OA 2OBIA 4F0CA 3QDNA 4X0XA 1W89A 1UC7A 6GSSA 4XCSA 4DVCA 1AQVA 4G9HA 2LJAA 5AGYA 4O32A 5AIXA 5G1LA 1MD4A 4MF5A 5C04A 1G6YA 3QAGA 6GSXA 4YKGA 1S3DA 3L4NA 5JWRB 4LLRA 4KDYA 3TCOA 4TR3A 5JCUA 1RQMA 1ZYNA 1GL8A 2EC4A 3WD6A 2CZ3A 3EVIA 2GVPA 2N5BA 6GSTA 4K7OA 1GSUA 2MZCA 17GSA 1PKZA 4O7HA 4YKFA 4WKWA 2I81A 4WXTA 4KSOA 3P90A 2NPBA 4PTSA 1B48A 3J7Yk 3DRNA 3HZ8A 2HE3A 1OVNA 2A2SA 2GTUA 5BRTA 2L57A 3F6DA 1TOFA 3D5JA 1K3LA 1BJXA 2B7KA 3F4TA 2R0CA 2LV3A 3W8JA 1U3AA 2X4AA 4V1Ag 4MPFA 1N2AA 1OAZA 2EIQA 1WOUA 1T8EB 4HZ2A 4QQ7A 1X9WB 3DYRA 1CQHA 3VWVA 1M9BA 1F37A 2VOCA 1ERTA 3UJ1A 2VCWA 3P7XA 3TKRA 3W6GA 5LD0A 3G7YA 5D73A 4HEA2 2HRAA 4Z2UA 2YWNA 2E2GA 2E7PA 3GUSA 1QQ2A 5A4UA 3HYPA 3IXRA 4IN0A 4OD7A 2ZUPA 1U6TA 5JWQB 1XVQA 4LL1B 4GQCA 3FZ5A 4ZL7A 5IIZA 3D6IA 4XTSA 3FR6A 1ZYPA 3E0UA 1U88A 2AAWA 5C00A 4TKYA 4GRFA 1K0DA 2H75A 5ECPB 2X99A 2C0EA 4E8EA 20GSA 2B5XA 3MNGA 3HD5A 3NZNA 4NHZA 4KUNA 2GQMA 1KEBA 1MD3A 1EOGA 2FCHA 1EZKA 4Q5QA 3I9V2 1EP8A 2IMFA 5KEJA 3BCKA 2VAFA 1EV4A 4X1UA 12GSA 5EL8A 1M0UA 2VM1A 3ZVJD 1A2LA 5G1KA 4L8EA 22GSA 3TOUA 2LQQA 5F07A 1CQGA 5CYYA 3RBTA 2C1YA 2L5OA 3ZL5A 4OCFA 3LJRA 1R5AA 2FWEA 2WZ9A 3RPPA 3LSZA 5IMVA 2CV4A 4BVYA 1XBSA 1OC8A 2C4JA 1AQXA 2PGTA 3FZ4A 2H1BA 2BTOT 4WBRD 2L59A 2LKUA 1XOAA 2JZTA 3PPUA 4WR4A 4IJIA 4LMVA 1TI3A 1TJDA 2L5LA 4POBA 2LNSA 2C0GA 2KP2A 4QL7A 4O5RA 3GH9A 3EC3A 1Z6MA 2H1DA 1GULA 1BEDA 1A0FA 5KN2A 1SJIA 2R3XA 4BVXB 2X64A 3QAVA 5IMCA 2PVOC 3VK9A 4Z7XA 5E59A 2Z9SA 1JLVA 3CSHA 1GNWA 5G31A 3J7Yb 2DJ0A 2CX4A 6GSUA 1ZMAA 3F9UA 3VPTA 1Z5YE 6GSWA 3EINA 5G5FA 3LFLA 1TRSA 3CMIA 5INYA 1F3AA 2H6XA 2H72A 2GT5A 2CVDA 1O8XA 4J57E 1X9MB 2N5AA 4F82A 4YAPA 1U87A 5H5QA 1FB6A 2F51A 5HFGA 4GQFA 4EL1A 2JZSA 5KN0A 1YZXA 4FYUA 1VF2A 2HLSA 2F8FA 4XRDA 1GP1A 4GLTA 1XW5A 4KA0A 1BYEA 4PURA 5LNKe 3FK8A 2DIZA 5EPFA 4HU7A 2VL2A 4KCAA 2YWIA 3CYNA 2RM5A 3EE2A 2OA7A 2UZ8A 2LQOA 2H1GA 3PR8A 3GYKA 3TKSE 3H4KA 4XS4A 2H70A 5D8IA 1EEJA 3D21A 5HR0A 1RW1A 13GSA 1VGLA 4NXIA 4RQXA 5EVOA 2XBIA 2YV9A 2PWJA 1THXA 3RAZA 2ON5A 3PINA 4JZQA 1AUCA 1NM3A 1PSQA 2R5GA 3QD9A 1V40A 4HQZA 4KDUA 2L6DA 1GUMA 2YPMA 1LBKA 4A5PA 5ECQB 4P3YB 1ERWA 3EURA 2LUSA 3L0HA 4RI6A 1LJRA 4HQSA 2EIOA 2P0GA 3IPZA 4IP1A 1FO5A 4TN8A 2H6YA 3QCPA 4POMA 4F9ZA 4NV2A 5IMDA 4CY6A 4LA1A 1M2BA 3W8SA 3HJPA 1NSWA 2H01A 4GF0A 18GSA 1YEXA 3F8UA 4TR1A 1WIKA 4XIHA 3U6VA 1TDIA 2IFQB 1X5EA 5DDLA 2NVLA 1SU9A 10GSA 4FH8A 2VCXA 2DKIA 1IYIA 2YJHA 3CSIA 2YN1A 1TU8A 4G0LA 3FZAA 3UARA 3S9FA 1AC1A 4G10A 4MZCA 3SWLA 4PUAA 4G0IA 4GSTA 1ZZYA 2GGTA 3H8QA 3QFBC 5EY6A 1FG4A 2VD1A 4CY8A 3HY2A 2B7JA 4MZBA 2CX3A 1XZOA 4V1Ap 4KE3A 1GUHA 4D73B 4N0VA 3ZLPA 3A5WA 1HD2A 3WGDA 1ZYEA 1Z7RA 3ZREA 1F2EA 2WFCA 1O73A 2YJ7A 5ECIB 2GSRA 4ZBAA 3FY7A 5ECOB 1YKCA 4ILFA 1JZRA 3KEBA 4QL9A 2LEGA 3DEXA 3ZRDA 2IL3A 2NBSA 4I8BA 5J4UA 1E2YA 1FW1A 3LW9A 2WS2A 4EKZA 1EV9A 1XPVA 3GSTA 2ON7A 2VCQA 4X4JA 2QKEA 5G2ZA 2M46A 2GZYA 3TKSA 1ON4A 3C1SA 2FWFA 2R2JA 5B6MA 1GTAA 3UVHA 1ZOFA 5DVBA 5DBQA 3GL5A 4TW5A 5CRWA 1SL2B 1ZGNA 4POKA 4MPGA 2XBQA 4KGIA 3G7IA 4AF2A 4O92A 3PGTA 3JCML 3E9JB 4PUFC 1PN0A 5GSTA 2OJLA 1Q4JA 2MYGA 2E0QA 2DMMA 4DSRA 2KP1A 4CW9A 4MK3A 2GSTA 1WMJA 2G2QA 4OO4A 3LYKA 3KD0A 4IKHA 3HXSA 3DVWA 4YQUA 2PERA 3CRTA 3L9SA 2A2PA 5A5KA 2HNLA 1XXUA 1YY7A 3ERWA 2DKHA 3KMOA 1K3YA 2PUKC 2YANA 3FMWA 1QGVA 2AV4A 2VUPA 5DCHA 2VLTA 2LSTA 2YZHA 3I43A 2K8SA 3HDCA 3LORA 3G7JA 3F4RA 1N8JA 2C3NA 2JADA 4IBPA 5H5SA 4FQUA 1SK2A 5AISA 5JCGA 1GTIA 3TJJA 4ZILA 1OKDA 2V1MA 4ZXGA 5IMFA 4EXJA 3IK7A 4Q5FA 1AXDA 5GAPD 1EP7A 4FO5A 5IMZA 3FR9A 5ID2B 1J0FA 2FHEA 4JRRA 4TXOA 2FA8A 2FLSA 2H76A 2IMDA 4J2FA 1KBNA 1XCCA 4K0NA 3C8EA 2O8VB 4KAEA 1GSSA 5B8AA 2LRNA 4HJMA 4IP6A 1GSEA 1X0RA 2B3SA 2NTOA 3DGQA 1WRYA 1B8XA 4JEDA 2IMEA 3F3QA 4DSSB 1VRSD 3QOUA 2H74A 1PL1A 3FHKA 3IR4A 2P5RA 4N11A 2VL3A 4Z2TA 5HR1A 1PN9A 1V58A 5DQSA 5ELGA 4BVXA 3I69A 2RIIA 3F6FA 2PN8A 2YNXA 2KHPA 4E8HA 3GMFA 1Z3EA 1Z9HA 2HYXA 4EC0A 4L0WA 1ZYQB 1TXXA 3RDWA 3TDGA 2B1KA 1V57A 2MMNA 4PXOA 3I6AA 2GT6A 3H93A 2K9FA 2I1UA 5CRDA 3Q6OA 3ERFA 2CT6A 4POLA 3M9KA 4MA9A 3GSSA 1FAAA 3QR6A 1FHEA 3HJMA 4K8MA 1RK4A 3KP9A 1FVJA 5GZZB 2R0PA 4NWYA 16GSA 1UVZA 4I6XA 2HSHA 5CRHA 4DSQA 2WULA 2DIYA 9GSSA 2IMKA 3D22A 2L4QA 1SKRB 5LCZA 4G2EA 2YP6A 3L9VA 1JHBA 1UN2A 3KZQA 4F0BA 5DJMA 4I97A 1R5PA 1ERUA 2K6VA 4KCEA 4ML6A 4KDXA 3MYDA 4HOJA 5B8BA 1G0TA 1T4YA 3GA4A 5CRGA 2F9SA 2O87A 2ZCTA 5DJLA 5IOWA 4MF6A 1SYXA 2H6ZA 1PRXA 2H30A 1M99A 1OC9B 3A2VA 1R4WA 1J08A 1FOHA 1I9DA 2DSAA 2QC7A 1NHOA 2REMA 1NHYA 2OE0A 4O5QA 5ECNB 5J41A 2H19A 3ZTLA 3GIXA 11GSA 3VLNA 2X49A 1WE0A 4EIQA 1NW2A 4PQIA 5HFIA 5B6NA 4AJ7A 3ZFLA 4BL7A 2IWTA 2C80A 1BQ7A 1XWBA 3N5OA 4HI7A 3HVSA 4XHMA 3GKXA 4JBBA 3GURA 5J9BA 1EGOA 1AW9A 3TJFA 2AB6A 2GDRA 2IFQA 2M72A 3WYWA 3TRPA 3FW2A 4RUVA 1GSQA 1M7TA 1TTZA 4G19A 4OFMA 1U3IA 2XC2A 3U5RE 1SD8A 3IOSA 2AHEA 1TW9A 3APQA 3H79A 3ZVJA 2BJXA 5IQYA 2AYTA 3C7MA 4PX1A 3FYGA 3GTUB 3GKNA 1A23A 4BWSA 1QK8A 5CO3A 4I5QA 5IO2A 2N5FA 1F9MA 4F2IA 1THOA 4WF4A 4KW6A 4D73A 2JL4A 14GSA 4NAXA 3KH9A 4N0ZA 1GUKA 2MMZA 1BAYA 3IV4A 2TRXA 2PBJA 1Z6NA 2E2MA 5GSSA 4OWYA 1ZCPA 1QXHA 8GSSA 2AJQB 4JR4A 5ECHB 3ZFBA 4KSMA 3UIWA 1GNEA 5G5EA 1A2MA 2A2RA 3TUEA 2ZNMA 3KIJA 1Z7PA 4GXZA 4RQRA 4TRXA 5DCGA 1GTBA 5F0GA 1TU7A 3VWUA 1T7PB 3FZ9A 1GLPA 2HRNA 3P8WA 3VWXA 1A24A 3DWVA 4LL4B 1GTUA 3IBHA 4IELA 4K9ZA 2VM2A 3GX0A 1K0OA 1XWAA 4ISDA 4ML1A 4O5UA 1Y25A 5J9CA 5ECKB 2O7KA 1KNGA 5D9VA 4WBJA 3V1WA 4LMWA 4HDEA 2EIRA 2R0GA 2YCDA 4BVYB 1JLWA 2GLRA 1MDKA 3GN3A 4ICYA 1EOHA 1ST9A 4ZBBA 4PNGA 1UA5A 4K7IA 4OCEA 1QUWA 2HXKA 1T00A 2QA1A 1JZDA 1XOBA 4ID0A 2P31A 2VLVA 3ME7A 2OE1A 2DC5A 4ULXA 4HU9A 3ZIJA 1HQOA 1O85A 2HZEA 3Q74A 4IVFA 3Q19A 1TK5B 5FWGA 3ZMKA 5H5RA 1GWCA 1G6WA 3CSJA 4EIPA 2R4VA 2DMLA 2VCZA 2X8GA 3MSZA 4PNFA 2B6MA 4K0GA 3M3MA 1W4VA 1HNCA 3BD2A 2VCVA 1GSYA 2LRCA 4BWQA 4KNDA 5D9WA 3US3A 1A2JA 1XWGA 4HUAA 2YWMA 3ZMLA 3HCZA 1XW6A 2VIMA 3DVXA 5ID2A 2MMOA 4IW9A 2CAIA 2H0IA 2PPTA 3EMPA 5CNWA 2WGRA 4L5OA 5J5NA 4ECCA 1K0MA 1FB0A 3D4MA 2DBCA 3MWHA 5HFKA 4FYBA 2QGVA 2HSYA 3DD3A 3D0ZA 2GZZA 3TKQA 5JWOB 4IHUA 3C71A 4PQ1A 4MZWA 1JFUA 2H1AA 3M9JA 3RHBA 3ZIVA 3UVTA 1TK8B 3SBCA 3A3TA 1TRUA 5CAXA 2B5YA 3UBLA 3K8NA 4I2TA 1ERVA 5G30A 3HZ4A 2HSMA 2PU9C 2OACA 4MJBA 2I4AA 4EDZA 3LXZA 3LYPA 1OE7A 3CTGA 4PGTA 1Y6EA 2WDUA 1I5GA 3EMXA 3IC8A 4NHWA 4EDYA 3M0FA 2V41A 2VL9A 1M2AA 2R37A 4GTUA 1LU4A 1SD9A 4KH7A 5IPGA 2VL2C 1XWCA 1DUGA 2H71A 3TJBA 4CDOA 2ALBA 1ACVA 2QA2A 4K5SA 5ECRB 3TRQA 5AN1A 1TP9A 5GAND 2L4CA 3ZYWA 4K2DA 2GSSA 5CP1A 3N9JA 2YZUA 3LXTA 4ZL9A 3ZITA 1AIUA 1YQ1A 3KGKA 2GQKA 1YF1A 4V2MA 1A0RP 1O81A 2HT9A 7GSSA 4TR1B 1GSDA 2FWGA 3IDVA 4MMMA 2OBKA 6GSYA 2MMAA 3G9BA 3TJKA 2YOIA 4YH2A 1URMA 3C73A 2X8HA 2FD3A 5D93A 2FGXA 4K6XA 5DAKB 1WPIA 2I3YA 2C3QA 3GKMA 3WT1A 2A4VA 4HS1A 3IHQA 1OC9A 4MLYA 2P5QA 4WEYA 3F4SA 3ED3A 5B7CA 1ZL9A 1M2DA 2V32A 3QFAC 2CZ2A 1YJ6A 3VWWA 1V98A 4Q5NA 3BJ5A 1GLQA 4OFNA 4ZIJA 3FEUA 5D96A 4MJAA 4NMUA 6GSVA 5F06A 1USBA 4K1FA 1V2AA 1HNAA 1BG5A 2O89A 1SJZA 3VI7A 3NIVA 5IMAA 1XWKA 2DJ2A 1X9SB 3O6TA 1B4QA 1VF1A 2FY6A 4IQ1A 1S3CA 3GV1A 2LS5A 1T3BA 4YQVA 5KN3A 4IJ3A 2LRTA 3TRXA 4AGSA 2V2GA 5ABRA 2CQ9A 3GX8A 3DMLA 4HJ2A 3O3TA 3IAM2 2K18A 1G7EA 1EEMA 3F3RA 5ECLB 2OADA 5FT3A 4TVEA 3HHVA 1SKWB 5F8BA 2GQLA 3GTUA 3ME8A 4XS6A 1JZWA 3KH7A 5DALB 3HA9A 3O76A 3TKSC 1OE8A 4ECJA 3HJOA 3CXGA 1VF3A 3APOA 3GH6A 2JU5A 3WGEA 3UOMA 1AQWA 5HQPA 5D9XA 1OYJA 1FVKA 2C0FA 1SL0B 4I2UA 1FOVA 5E4WA 1V9WA 1PX7A 4BPYA 1GSFA 2DJ3A 2K8VA 3TGZA 2X8CA 4EVMA 4J56E 4NPBA 3C1RA 1ILOA 1PD21 1O7UA 1MDJA 4KB3A 1SYRA 2D2ZA 2O85A 3BCIA 3EWLA 1B9YC 1MTCA 4WETA 4WR5A 4GWRA 1ABAA 4PQHA 3EYTA 2HFDA 5ECSA 2XHFA 4TR0A 2VD0A 2V6KA 1C72A 4MJCA 3P2AA 2GSQA 2HRKA 3RHCA 2VLUA 1O8WA 1T1VA 3F63A 3TB2A 4IGJA 1PQNA 2C0DA 1KTEA 3GNJA 1K0AA 3GL3A 2BMXA 4TXOB 1X5DA 4DEJA 4USSA 1PKWA 2WJUA 3L9UA 3KMNA 2FNOA 1T4ZA 2LTKA 1G7OA 4MH3A 3UL3A 1B4PA 3IE3A 1DE1A 2IJYA 1K0BA 1WJKA 4ZL8A 3TOTA 3QMXA 1OKTA 1SK0A 2HI7A 3IC4A 4EO3A 4EF0A 1XIYA 4MDCA 3VI5A 1S3AA 3E3EA 1F3BA 2GZPA 4MH2A 1YF0A 3TJGA 4YAVA 1AAZA 2LJKA 4NV5A 2IPAA 2JSYA 2J9HA 4XRAA 5IO0A 2DLXA 2PMTA 4MF7A 2OKAA 2FUG2 1K3OA 2KUCA 2DJKA 2WCIA 1ML6A 2QSIA 2MBTA 1PX6A 3UBKA 1TK0B 2HRFA 3ZZXA 5IM9A 2CA8A 5FHIA 3GRXA 5KOXA 5D9TA 4MNNA 2YWOA 3LG6A 1Q98A 4L0UA 2GS3A 3CBUA 1R7HA 2LNTA 4ECIA 1TKDB 1TI1A 1H75A 1K0NA 2RUFA 3R2QA 3FR3A 5HR3A 3KM6A 2RM6A 3GKKA 4JR6A 1DE2A 3IK9A 1PA3A 1PGTA 3IHGA 4HZ4A 1MEKA 2M80A 3EPTA 1GRXA 3KXOA 3EU3A 3MDKA 3HVVA 4JU5A 2H0HA 3VURA 3DKSA 1X5CA 3UAPA 3ISOA 3RPNA 2JZRA 2XPEA 2NDOA 1K0CA 2DJ1A 2RLIA 4K5RA 3FRCA 5J3RA 1DBYA 4TXVA 2B1LA 4GSNA 4MP4A 1SK1A 2YV7A 2I9HA 1HYUA 1YKAA 3LGCA 4BA7A 2VO4A 2IIYA 3KTBA 4XS1A 3HKRA 3AY8A 1QMVA 3F0IA 3DXBA 3A2WA 1EWXA 3KTLA 1XVWA 4WF5A 3BOAA 5A4VA 2VCTA 2L6CA 4KX4A 4TOPA 3WGXA 4MCUA 1PL2A 4CHSA 4BL7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZO A;  4X43 A;  3D4T A;  4IS0 A;  5CRE A;  4ACS A;  1XW9 A;  4ZB8 A;  1WWJ A;  4TR4 A;  5COH A;  3KCM A;  3ERG A;  2XPD A;  1MDI A;  5KN1 A;  2LJR A;  4V2N A;  4ECB A;  3MAK A;  5JCW A;  3M8N A;  3A2X A;  5DAK A;  19GS A;  4L5L A;  5F05 A;  4K7N A;  4EUY A;  2H66 A;  3H1N A;  2FWH A;  1YDK A;  3CRU A;  1HNB A;  2C8U A;  3IRA A;  4FIW A;  3WT2 A;  3UMA A;  1BX9 A;  1OC3 A;  1WP0 A;  1XFL A;  2KLX A;  4F03 A;  3DIE A;  4EE0 A;  1IYH A;  5IOX A;  2C3T A;  2IMI A;  2IN3 A;  4OFT A;  1R26 A;  1F6M C;  4DSS A;  1SEN A;  2MBS A;  1J9B A;  5ELA A;  1GH2 A;  4YQM A;  3GHA A;  1E6B A;  4AJ8 A;  1VF4 A;  2HZF A;  1TRW A;  1M9A A;  2JAC A;  4IQA A;  3TKP A;  4ZBD A;  1TRV A;  4GSS A;  3KP8 A;  2R6K A;  4GCI A;  3M1G A;  3LQ7 A;  2G0F A;  4OMV A;  2DJJ A;  1QFN A;  1A8L A;  5A4W A;  1SJ6 A;  3KJY A;  2PVQ A;  4XS4 B;  4RI7 A;  5IPH A;  2F8A A;  5HR2 A;  4JE1 A;  1DSB A;  2H0G A;  4ZB9 A;  2WB9 A;  2CVK A;  4MJE A;  2JSZ A;  4FYC A;  5AIV A;  4N30 A;  2FA4 A;  1B9X C;  4ZB6 A;  2WRT A;  2TRC P;  2OE3 A;  3PH9 A;  3VPQ A;  4OO5 A;  1SKS B;  3IAS 2;  2H8L A;  4AJ6 A;  2CAQ A;  1SL1 B;  4V2L A;  3EU4 A;  2CVB A;  3APS A;  3IA1 A;  2V6O A;  2AUV A;  5DQY A;  3CTF A;  4MAB A;  3Q18 A;  3FKF A;  3NOF A;  5DAL A;  3QAW A;  1EGR A;  4Q5R A;  2J23 A;  3VFI A;  5L71 A;  4H86 A;  5ECM B;  5ENU A;  3LEF A;  2F3M A;  3BBY A;  3HVX A;  2B5E A;  3UEM A;  3L78 A;  2RUE A;  3QPM A;  2KOK A;  3GFK A;  4N10 A;  1PMT A;  2TIR A;  1A8Y A;  1YEP A;  1O6J A;  2ES7 A;  3LWA A;  2HZE B;  2H73 A;  3OR5 A;  1H4O A;  2OBI A;  4F0C A;  3QDN A;  4X0X A;  1W89 A;  1UC7 A;  6GSS A;  4XCS A;  4DVC A;  1AQV A;  4G9H A;  2LJA A;  5AGY A;  4O32 A;  5AIX A;  5G1L A;  1MD4 A;  4MF5 A;  5C04 A;  1G6Y A;  3QAG A;  6GSX A;  1S3D A;  3L4N A;  5JWR B;  4LLR A;  4KDY A;  3TCO A;  4TR3 A;  5JCU A;  1RQM A;  1GL8 A;  2EC4 A;  3WD6 A;  2CZ3 A;  3EVI A;  2GVP A;  2N5B A;  6GST A;  4K7O A;  1GSU A;  2MZC A;  17GS A;  1PKZ A;  4O7H A;  4WKW A;  2I81 A;  4WXT A;  4KSO A;  3P90 A;  2NPB A;  1B48 A;  3J7Y k;  3DRN A;  3HZ8 A;  2HE3 A;  1OVN A;  2A2S A;  2GTU A;  2L57 A;  3F6D A;  1TOF A;  3D5J A;  1K3L A;  1BJX A;  2B7K A;  3F4T A;  2LV3 A;  3W8J A;  1U3A A;  4V1A g;  4MPF A;  1N2A A;  1OAZ A;  2EIQ A;  1WOU A;  1T8E B;  4HZ2 A;  4QQ7 A;  1X9W B;  3DYR A;  1CQH A;  3VWV A;  1M9B A;  1F37 A;  2VOC A;  1ERT A;  3UJ1 A;  2VCW A;  3P7X A;  3TKR A;  3W6G A;  5LD0 A;  3G7Y A;  5D73 A;  4HEA 2;  2YWN A;  2E2G A;  2E7P A;  3GUS A;  1QQ2 A;  5A4U A;  3HYP A;  3IXR A;  4IN0 A;  4OD7 A;  2ZUP A;  1U6T A;  5JWQ B;  1XVQ A;  4LL1 B;  4GQC A;  3FZ5 A;  4ZL7 A;  5IIZ A;  3D6I A;  4XTS A;  3FR6 A;  3E0U A;  1U88 A;  2AAW A;  5C00 A;  4TKY A;  4GRF A;  1K0D A;  2H75 A;  5ECP B;  2X99 A;  2C0E A;  4E8E A;  20GS A;  2B5X A;  3MNG A;  3HD5 A;  3NZN A;  4NHZ A;  4KUN A;  2GQM A;  1KEB A;  1MD3 A;  1EOG A;  2FCH A;  1EZK A;  4Q5Q A;  3I9V 2;  1EP8 A;  2IMF A;  5KEJ A;  3BCK A;  2VAF A;  1EV4 A;  4X1U A;  12GS A;  5EL8 A;  1M0U A;  2VM1 A;  3ZVJ D;  1A2L A;  5G1K A;  4L8E A;  22GS A;  3TOU A;  2LQQ A;  5F07 A;  1CQG A;  5CYY A;  3RBT A;  2C1Y A;  2L5O A;  3ZL5 A;  4OCF A;  3LJR A;  1R5A A;  2FWE A;  2WZ9 A;  3RPP A;  3LSZ A;  5IMV A;  2CV4 A;  4BVY A;  1XBS A;  1OC8 A;  2C4J A;  1AQX A;  2PGT A;  3FZ4 A;  2H1B A;  2BTO T;  4WBR D;  2L59 A;  2LKU A;  1XOA A;  2JZT A;  4WR4 A;  4IJI A;  4LMV A;  1TI3 A;  1TJD A;  2L5L A;  4POB A;  2LNS A;  2C0G A;  2KP2 A;  4QL7 A;  4O5R A;  3GH9 A;  3EC3 A;  1Z6M A;  2H1D A;  1GUL A;  1BED A;  1A0F A;  5KN2 A;  1SJI A;  2R3X A;  2X64 A;  3QAV A;  5IMC A;  2PVO C;  3VK9 A;  4Z7X A;  5E59 A;  2Z9S A;  1JLV A;  3CSH A;  1GNW A;  5G31 A;  3J7Y b;  2DJ0 A;  2CX4 A;  6GSU A;  1ZMA A;  3F9U A;  3VPT A;  1Z5Y E;  6GSW A;  3EIN A;  5G5F A;  3LFL A;  1TRS A;  3CMI A;  5INY A;  1F3A A;  2H6X A;  2H72 A;  2GT5 A;  2CVD A;  1O8X A;  4J57 E;  1X9M B;  2N5A A;  4F82 A;  4YAP A;  1U87 A;  5H5Q A;  1FB6 A;  2F51 A;  5HFG A;  4GQF A;  4EL1 A;  2JZS A;  5KN0 A;  1YZX A;  4FYU A;  1VF2 A;  2HLS A;  2F8F A;  4XRD A;  1GP1 A;  4GLT A;  1XW5 A;  4KA0 A;  1BYE A;  4PUR A;  5LNK e;  3FK8 A;  2DIZ A;  5EPF A;  4HU7 A;  2VL2 A;  4KCA A;  2YWI A;  3CYN A;  2RM5 A;  3EE2 A;  2OA7 A;  2LQO A;  2H1G A;  3PR8 A;  3GYK A;  3TKS E;  3H4K A;  4XS4 A;  2H70 A;  5D8I A;  1EEJ A;  3D21 A;  5HR0 A;  1RW1 A;  13GS A;  1VGL A;  4NXI A;  4RQX A;  5EVO A;  2XBI A;  2YV9 A;  2PWJ A;  1THX A;  3RAZ A;  2ON5 A;  3PIN A;  4JZQ A;  1AUC A;  1NM3 A;  1PSQ A;  2R5G A;  3QD9 A;  1V40 A;  4HQZ A;  4KDU A;  2L6D A;  1GUM A;  2YPM A;  1LBK A;  5ECQ B;  4P3Y B;  1ERW A;  3EUR A;  2LUS A;  3L0H A;  4RI6 A;  1LJR A;  4HQS A;  2EIO A;  2P0G A;  3IPZ A;  4IP1 A;  1FO5 A;  4TN8 A;  2H6Y A;  3QCP A;  4POM A;  4F9Z A;  4NV2 A;  5IMD A;  4LA1 A;  1M2B A;  3W8S A;  3HJP A;  1NSW A;  2H01 A;  4GF0 A;  18GS A;  1YEX A;  3F8U A;  4TR1 A;  1WIK A;  4XIH A;  3U6V A;  1TDI A;  2IFQ B;  1X5E A;  5DDL A;  2NVL A;  1SU9 A;  10GS A;  4FH8 A;  2VCX A;  1IYI A;  2YJH A;  3CSI A;  2YN1 A;  1TU8 A;  3FZA A;  3UAR A;  3S9F A;  1AC1 A;  4G10 A;  4MZC A;  3SWL A;  4PUA A;  4GST A;  1ZZY A;  2GGT A;  3H8Q A;  3QFB C;  5EY6 A;  1FG4 A;  2VD1 A;  3HY2 A;  2B7J A;  4MZB A;  2CX3 A;  1XZO A;  4V1A p;  4KE3 A;  1GUH A;  4D73 B;  4N0V A;  3ZLP A;  3A5W A;  1HD2 A;  3WGD A;  1ZYE A;  1Z7R A;  3ZRE A;  1F2E A;  2WFC A;  1O73 A;  2YJ7 A;  5ECI B;  2GSR A;  4ZBA A;  3FY7 A;  5ECO B;  1YKC A;  4ILF A;  1JZR A;  3KEB A;  4QL9 A;  2LEG A;  3DEX A;  3ZRD A;  2IL3 A;  2NBS A;  4I8B A;  5J4U A;  1E2Y A;  1FW1 A;  2WS2 A;  4EKZ A;  1EV9 A;  1XPV A;  3GST A;  2ON7 A;  2VCQ A;  2QKE A;  5G2Z A;  2M46 A;  2GZY A;  3TKS A;  1ON4 A;  3C1S A;  2FWF A;  2R2J A;  5B6M A;  1GTA A;  3UVH A;  1ZOF A;  5DVB A;  5DBQ A;  3GL5 A;  4TW5 A;  5CRW A;  1SL2 B;  1ZGN A;  4POK A;  4MPG A;  2XBQ A;  4KGI A;  3G7I A;  4AF2 A;  4O92 A;  3PGT A;  3JCM L;  3E9J B;  4PUF C;  5GST A;  2OJL A;  1Q4J A;  2MYG A;  2E0Q A;  2DMM A;  4DSR A;  2KP1 A;  4CW9 A;  4MK3 A;  2GST A;  1WMJ A;  2G2Q A;  4OO4 A;  3LYK A;  3KD0 A;  4IKH A;  3HXS A;  3DVW A;  4YQU A;  2PER A;  3CRT A;  3L9S A;  5A5K A;  2HNL A;  1XXU A;  1YY7 A;  3ERW A;  3KMO A;  1K3Y A;  2PUK C;  2YAN A;  1QGV A;  2AV4 A;  2VUP A;  5DCH A;  2VLT A;  2LST A;  2YZH A;  3I43 A;  2K8S A;  3HDC A;  3LOR A;  3G7J A;  3F4R A;  1N8J A;  2C3N A;  2JAD A;  4IBP A;  5H5S A;  1SK2 A;  5AIS A;  5JCG A;  1GTI A;  3TJJ A;  4ZIL A;  1OKD A;  2V1M A;  4ZXG A;  5IMF A;  4EXJ A;  3IK7 A;  4Q5F A;  1AXD A;  5GAP D;  1EP7 A;  4FO5 A;  5IMZ A;  3FR9 A;  5ID2 B;  1J0F A;  2FHE A;  4JRR A;  4TXO A;  2FA8 A;  2FLS A;  2H76 A;  2IMD A;  4J2F A;  1KBN A;  1XCC A;  4K0N A;  3C8E A;  2O8V B;  4KAE A;  1GSS A;  5B8A A;  2LRN A;  4HJM A;  4IP6 A;  1GSE A;  1X0R A;  2B3S A;  2NTO A;  3DGQ A;  1WRY A;  1B8X A;  4JED A;  2IME A;  3F3Q A;  4DSS B;  1VRS D;  3QOU A;  2H74 A;  1PL1 A;  3FHK A;  3IR4 A;  2P5R A;  4N11 A;  2VL3 A;  5HR1 A;  1PN9 A;  1V58 A;  5ELG A;  5DQS A;  4BVX A;  3I69 A;  2RII A;  3F6F A;  2PN8 A;  2YNX A;  2KHP A;  4E8H A;  3GMF A;  1Z3E A;  1Z9H A;  2HYX A;  4EC0 A;  4L0W A;  1ZYQ B;  1TXX A;  3RDW A;  3TDG A;  2B1K A;  1V57 A;  2MMN A;  4PXO A;  3I6A A;  2GT6 A;  3H93 A;  2K9F A;  2I1U A;  5CRD A;  3Q6O A;  3ERF A;  2CT6 A;  4POL A;  3M9K A;  4MA9 A;  3GSS A;  1FAA A;  3QR6 A;  1FHE A;  3HJM A;  4K8M A;  1RK4 A;  3KP9 A;  1FVJ A;  5GZZ B;  4NWY A;  16GS A;  1UVZ A;  4I6X A;  2HSH A;  5CRH A;  4DSQ A;  2WUL A;  2DIY A;  9GSS A;  2IMK A;  3D22 A;  2L4Q A;  1SKR B;  5LCZ A;  4G2E A;  2YP6 A;  3L9V A;  1JHB A;  1UN2 A;  3KZQ A;  4F0B A;  5DJM A;  4I97 A;  1R5P A;  1ERU A;  2K6V A;  4KCE A;  4ML6 A;  4KDX A;  4HOJ A;  5B8B A;  1G0T A;  1T4Y A;  3GA4 A;  5CRG A;  2F9S A;  2O87 A;  2ZCT A;  5DJL A;  5IOW A;  4MF6 A;  1SYX A;  2H6Z A;  1PRX A;  2H30 A;  1M99 A;  1OC9 B;  3A2V A;  1R4W A;  1J08 A;  1I9D A;  2DSA A;  2QC7 A;  1NHO A;  2REM A;  1NHY A;  2OE0 A;  5ECN B;  5J41 A;  2H19 A;  3ZTL A;  3GIX A;  11GS A;  3VLN A;  1WE0 A;  1NW2 A;  4PQI A;  5HFI A;  5B6N A;  4AJ7 A;  3ZFL A;  4BL7 A;  2IWT A;  2C80 A;  1BQ7 A;  1XWB A;  3N5O A;  4HI7 A;  3HVS A;  4XHM A;  3GKX A;  4JBB A;  3GUR A;  5J9B A;  1EGO A;  1AW9 A;  3TJF A;  2AB6 A;  2GDR A;  2IFQ A;  2M72 A;  3WYW A;  3TRP A;  3FW2 A;  4RUV A;  1GSQ A;  1M7T A;  1TTZ A;  4G19 A;  4OFM A;  1U3I A;  2XC2 A;  3U5R E;  1SD8 A;  3IOS A;  2AHE A;  1TW9 A;  3APQ A;  3H79 A;  3ZVJ A;  2BJX A;  5IQY A;  2AYT A;  3C7M A;  4PX1 A;  3FYG A;  3GTU B;  3GKN A;  1A23 A;  4BWS A;  1QK8 A;  5CO3 A;  4I5Q A;  5IO2 A;  2N5F A;  1F9M A;  4F2I A;  1THO A;  4WF4 A;  4KW6 A;  4D73 A;  2JL4 A;  14GS A;  4NAX A;  3KH9 A;  4N0Z A;  1GUK A;  2MMZ A;  1BAY A;  3IV4 A;  2TRX A;  2PBJ A;  1Z6N A;  2E2M A;  5GSS A;  4OWY A;  1ZCP A;  1QXH A;  8GSS A;  2AJQ B;  4JR4 A;  5ECH B;  3ZFB A;  4KSM A;  3UIW A;  1GNE A;  5G5E A;  1A2M A;  2A2R A;  3TUE A;  2ZNM A;  3KIJ A;  1Z7P A;  4GXZ A;  4RQR A;  4TRX A;  5DCG A;  1GTB A;  5F0G A;  1TU7 A;  3VWU A;  1T7P B;  3FZ9 A;  1GLP A;  2HRN A;  3P8W A;  3VWX A;  1A24 A;  3DWV A;  4LL4 B;  1GTU A;  3IBH A;  4IEL A;  4K9Z A;  2VM2 A;  3GX0 A;  1K0O A;  1XWA A;  4ISD A;  4ML1 A;  1Y25 A;  5J9C A;  5ECK B;  2O7K A;  1KNG A;  5D9V A;  4WBJ A;  3V1W A;  4LMW A;  4HDE A;  2EIR A;  2YCD A;  1JLW A;  2GLR A;  1MDK A;  3GN3 A;  1EOH A;  1ST9 A;  4ZBB A;  4PNG A;  1UA5 A;  4K7I A;  4OCE A;  1QUW A;  2HXK A;  1T00 A;  1JZD A;  1XOB A;  4ID0 A;  2P31 A;  2VLV A;  3ME7 A;  2OE1 A;  2DC5 A;  4ULX A;  4HU9 A;  3ZIJ A;  1HQO A;  1O85 A;  2HZE A;  3Q74 A;  4IVF A;  3Q19 A;  1TK5 B;  5FWG A;  3ZMK A;  5H5R A;  1GWC A;  1G6W A;  3CSJ A;  2R4V A;  2DML A;  2VCZ A;  2X8G A;  3MSZ A;  4PNF A;  2B6M A;  4K0G A;  3M3M A;  1W4V A;  1HNC A;  3BD2 A;  2VCV A;  1GSY A;  2LRC A;  4BWQ A;  4KND A;  5D9W A;  3US3 A;  1A2J A;  1XWG A;  4HUA A;  2YWM A;  3ZML A;  3HCZ A;  1XW6 A;  2VIM A;  3DVX A;  5ID2 A;  2MMO A;  4IW9 A;  2CAI A;  2H0I A;  2PPT A;  3EMP A;  5CNW A;  2WGR A;  4L5O A;  5J5N A;  4ECC A;  1K0M A;  1FB0 A;  3D4M A;  2DBC A;  3MWH A;  5HFK A;  4FYB A;  2QGV A;  2HSY A;  3DD3 A;  3D0Z A;  2GZZ A;  3TKQ A;  5JWO B;  4IHU A;  3C71 A;  4PQ1 A;  4MZW A;  1JFU A;  2H1A A;  3M9J A;  3RHB A;  3ZIV A;  3UVT A;  1TK8 B;  3SBC A;  3A3T A;  1TRU A;  5CAX A;  2B5Y A;  3UBL A;  3K8N A;  4I2T A;  1ERV A;  5G30 A;  3HZ4 A;  2PU9 C;  2OAC A;  4MJB A;  2I4A A;  4EDZ A;  3LXZ A;  3LYP A;  1OE7 A;  3CTG A;  4PGT A;  1Y6E A;  2WDU A;  1I5G A;  3EMX A;  4NHW A;  4EDY A;  3M0F A;  2V41 A;  2VL9 A;  1M2A A;  2R37 A;  4GTU A;  1LU4 A;  1SD9 A;  4KH7 A;  5IPG A;  2VL2 C;  1XWC A;  1DUG A;  2H71 A;  3TJB A;  4CDO A;  2ALB A;  1ACV A;  5ECR B;  3TRQ A;  5AN1 A;  1TP9 A;  5GAN D;  2L4C A;  3ZYW A;  4K2D A;  2GSS A;  5CP1 A;  3N9J A;  2YZU A;  3LXT A;  4ZL9 A;  3ZIT A;  1AIU A;  1YQ1 A;  3KGK A;  2GQK A;  1YF1 A;  4V2M A;  1A0R P;  1O81 A;  2HT9 A;  7GSS A;  4TR1 B;  1GSD A;  2FWG A;  3IDV A;  4MMM A;  2OBK A;  6GSY A;  2MMA A;  3G9B A;  3TJK A;  2YOI A;  4YH2 A;  1URM A;  3C73 A;  2X8H A;  2FD3 A;  5D93 A;  2FGX A;  4K6X A;  5DAK B;  1WPI A;  2I3Y A;  2C3Q A;  3GKM A;  3WT1 A;  2A4V A;  4HS1 A;  3IHQ A;  1OC9 A;  4MLY A;  2P5Q A;  4WEY A;  3F4S A;  3ED3 A;  5B7C A;  1ZL9 A;  1M2D A;  2V32 A;  3QFA C;  2CZ2 A;  1YJ6 A;  3VWW A;  1V98 A;  4Q5N A;  3BJ5 A;  1GLQ A;  4OFN A;  4ZIJ A;  3FEU A;  5D96 A;  4MJA A;  4NMU A;  6GSV A;  5F06 A;  1USB A;  4K1F A;  1V2A A;  1HNA A;  1BG5 A;  2O89 A;  1SJZ A;  3VI7 A;  3NIV A;  5IMA A;  1XWK A;  2DJ2 A;  1X9S B;  3O6T A;  1B4Q A;  1VF1 A;  2FY6 A;  4IQ1 A;  1S3C A;  3GV1 A;  2LS5 A;  1T3B A;  4YQV A;  5KN3 A;  4IJ3 A;  2LRT A;  3TRX A;  4AGS A;  2V2G A;  5ABR A;  2CQ9 A;  3GX8 A;  3DML A;  4HJ2 A;  3O3T A;  3IAM 2;  2K18 A;  1G7E A;  1EEM A;  3F3R A;  5ECL B;  2OAD A;  5FT3 A;  4TVE A;  3HHV A;  1SKW B;  5F8B A;  2GQL A;  3GTU A;  3ME8 A;  4XS6 A;  1JZW A;  3KH7 A;  5DAL B;  3HA9 A;  3O76 A;  3TKS C;  1OE8 A;  4ECJ A;  3HJO A;  3CXG A;  1VF3 A;  3APO A;  3GH6 A;  2JU5 A;  3WGE A;  3UOM A;  1AQW A;  5HQP A;  5D9X A;  1OYJ A;  1FVK A;  2C0F A;  1SL0 B;  4I2U A;  1FOV A;  5E4W A;  1V9W A;  1PX7 A;  4BPY A;  1GSF A;  2DJ3 A;  2K8V A;  3TGZ A;  2X8C A;  4EVM A;  4J56 E;  4NPB A;  3C1R A;  1ILO A;  1PD2 1;  1O7U A;  1MDJ A;  4KB3 A;  1SYR A;  2D2Z A;  2O85 A;  3BCI A;  3EWL A;  1B9Y C;  1MTC A;  4WET A;  4WR5 A;  4GWR A;  1ABA A;  4PQH A;  3EYT A;  2HFD A;  5ECS A;  2XHF A;  4TR0 A;  2VD0 A;  2V6K A;  1C72 A;  4MJC A;  3P2A A;  2GSQ A;  3RHC A;  2VLU A;  1O8W A;  1T1V A;  3F63 A;  3TB2 A;  4IGJ A;  1PQN A;  2C0D A;  1KTE A;  3GNJ A;  1K0A A;  3GL3 A;  2BMX A;  4TXO B;  1X5D A;  4DEJ A;  1PKW A;  2WJU A;  3L9U A;  3KMN A;  2FNO A;  1T4Z A;  2LTK A;  1G7O A;  4MH3 A;  3UL3 A;  1B4P A;  3IE3 A;  1DE1 A;  2IJY A;  1K0B A;  1WJK A;  4ZL8 A;  3TOT A;  3QMX A;  1OKT A;  1SK0 A;  2HI7 A;  3IC4 A;  4EO3 A;  4EF0 A;  1XIY A;  4MDC A;  3VI5 A;  1S3A A;  3E3E A;  1F3B A;  2GZP A;  4MH2 A;  1YF0 A;  3TJG A;  4YAV A;  1AAZ A;  2LJK A;  4NV5 A;  2IPA A;  2JSY A;  2J9H A;  4XRA A;  5IO0 A;  2DLX A;  2PMT A;  4MF7 A;  2OKA A;  2FUG 2;  1K3O A;  2KUC A;  2DJK A;  2WCI A;  1ML6 A;  2QSI A;  2MBT A;  1PX6 A;  3UBK A;  1TK0 B;  2HRF A;  3ZZX A;  5IM9 A;  2CA8 A;  5FHI A;  3GRX A;  5D9T A;  2YWO A;  3LG6 A;  1Q98 A;  4L0U A;  2GS3 A;  3CBU A;  1R7H A;  2LNT A;  4ECI A;  1TKD B;  1TI1 A;  1H75 A;  1K0N A;  2RUF A;  3R2Q A;  3FR3 A;  5HR3 A;  3KM6 A;  2RM6 A;  3GKK A;  4JR6 A;  1DE2 A;  3IK9 A;  1PA3 A;  1PGT A;  4HZ4 A;  1MEK A;  2M80 A;  1GRX A;  3KXO A;  3EU3 A;  3MDK A;  3HVV A;  4JU5 A;  2H0H A;  3VUR A;  3DKS A;  1X5C A;  3UAP A;  3ISO A;  3RPN A;  2JZR A;  2XPE A;  2NDO A;  1K0C A;  2DJ1 A;  2RLI A;  3FRC A;  5J3R A;  1DBY A;  4TXV A;  2B1L A;  4GSN A;  4MP4 A;  1SK1 A;  2YV7 A;  2I9H A;  1HYU A;  1YKA A;  3LGC A;  4BA7 A;  2VO4 A;  2IIY A;  3KTB A;  4XS1 A;  3HKR A;  3AY8 A;  1QMV A;  3F0I A;  3DXB A;  3A2W A;  1EWX A;  3KTL A;  1XVW A;  4WF5 A;  3BOA A;  5A4V A;  2VCT A;  2L6C A;  4KX4 A;  4TOP A;  3WGX A;  4MCU A;  1PL2 A;  4CHS A; 
#chains in the Genus database with same CATH topology
 1JZO A;  4X43 A;  3D4T A;  4IS0 A;  3R3E A;  5CRE A;  4ACS A;  1XW9 A;  4K2X A;  4ZB8 A;  4G0K A;  1WWJ A;  4TR4 A;  5COH A;  5KOW A;  3KCM A;  3ERG A;  2XPD A;  1MDI A;  5KN1 A;  2LJR A;  4V2N A;  4ECB A;  3MAK A;  5JCW A;  3M8N A;  3A2X A;  5DAK A;  19GS A;  4L5L A;  5F05 A;  4K7N A;  4KF9 A;  4EUY A;  2H66 A;  3H1N A;  2FWH A;  1YDK A;  3CRU A;  1HNB A;  2C8U A;  3IRA A;  4FIW A;  3WT2 A;  3UMA A;  2A4H A;  1BX9 A;  1OC3 A;  1WP0 A;  1XFL A;  2KLX A;  4F03 A;  3DIE A;  4EE0 A;  1IYH A;  5IOX A;  2C3T A;  2IMI A;  2IN3 A;  4OFT A;  1R26 A;  1F6M C;  4DSS A;  1SEN A;  2MBS A;  1J9B A;  1GH2 A;  5ELA A;  4YQM A;  3GHA A;  4Z2R A;  1E6B A;  4AJ8 A;  1VF4 A;  2HZF A;  1TRW A;  1M9A A;  2JAC A;  4IQA A;  3TKP A;  4ZBD A;  1TRV A;  4GSS A;  3KP8 A;  2R6K A;  4GCI A;  3M1G A;  3LQ7 A;  2G0F A;  4OMV A;  2DJJ A;  1QFN A;  1A8L A;  3A5I A;  5A4W A;  1SJ6 A;  3KJY A;  2PVQ A;  4XS4 B;  4RI7 A;  5IPH A;  2F8A A;  5HR2 A;  4JE1 A;  1DSB A;  2H0G A;  4ZB9 A;  2WB9 A;  2CVK A;  4MJE A;  2JSZ A;  4FYC A;  5AIV A;  4N30 A;  2FA4 A;  1B9X C;  4ZB6 A;  2WRT A;  2TRC P;  2OE3 A;  3PH9 A;  3VPQ A;  4OO5 A;  1SKS B;  3IAS 2;  2H8L A;  4AJ6 A;  2CAQ A;  1SL1 B;  4V2L A;  3EU4 A;  2CVB A;  3APS A;  3IA1 A;  5BMU A;  2V6O A;  2AUV A;  5DQY A;  3CTF A;  4MAB A;  3Q18 A;  3FKF A;  3NOF A;  5DAL A;  3QAW A;  1EGR A;  3MIX A;  4Q5R A;  2J23 A;  3VFI A;  5L71 A;  4H86 A;  5ECM B;  5ENU A;  3LEF A;  2F3M A;  3BBY A;  3HVX A;  2B5E A;  3UEM A;  3L78 A;  2RUE A;  3QPM A;  2KOK A;  3GFK A;  4N10 A;  1PMT A;  2TIR A;  1A8Y A;  1YEP A;  1O6J A;  2ES7 A;  3LWA A;  2HZE B;  2H73 A;  3OR5 A;  1H4O A;  2OBI A;  4F0C A;  3QDN A;  4X0X A;  1W89 A;  1UC7 A;  6GSS A;  4XCS A;  4DVC A;  1AQV A;  4G9H A;  2LJA A;  5AGY A;  4O32 A;  5AIX A;  5G1L A;  1MD4 A;  4MF5 A;  5C04 A;  1G6Y A;  3QAG A;  6GSX A;  4YKG A;  1S3D A;  3L4N A;  5JWR B;  4LLR A;  4KDY A;  1XG8 A;  4TR3 A;  3TCO A;  5JCU A;  1RQM A;  1ZYN A;  1GL8 A;  2EC4 A;  3WD6 A;  2CZ3 A;  3EVI A;  2GVP A;  2N5B A;  6GST A;  4K7O A;  1GSU A;  2MZC A;  17GS A;  1PKZ A;  4O7H A;  4YKF A;  4WKW A;  2I81 A;  4WXT A;  4KSO A;  3P90 A;  2NPB A;  4PTS A;  1B48 A;  3J7Y k;  3DRN A;  3HZ8 A;  2HE3 A;  1OVN A;  2A2S A;  2GTU A;  5BRT A;  1M3I A;  2L57 A;  3F6D A;  1TOF A;  3D5J A;  1K3L A;  1BJX A;  2B7K A;  3F4T A;  2R0C A;  2LV3 A;  3W8J A;  1U3A A;  2X4A A;  4V1A g;  4MPF A;  1N2A A;  1OAZ A;  2EIQ A;  1WOU A;  1T8E B;  4HZ2 A;  4QQ7 A;  1X9W B;  3DYR A;  1CQH A;  3VWV A;  1M9B A;  1F37 A;  2VOC A;  1ERT A;  3UJ1 A;  2VCW A;  3P7X A;  3TKR A;  3W6G A;  5LD0 A;  3G7Y A;  5D73 A;  4HEA 2;  2HRA A;  4Z2U A;  2YWN A;  2E2G A;  2E7P A;  3GUS A;  1QQ2 A;  5A4U A;  3HYP A;  3IXR A;  4IN0 A;  4OD7 A;  2ZUP A;  1U6T A;  5JWQ B;  1XVQ A;  4LL1 B;  4GQC A;  3FZ5 A;  4ZL7 A;  5IIZ A;  3D6I A;  4XTS A;  3FR6 A;  1ZYP A;  3E0U A;  1U88 A;  2AAW A;  5C00 A;  4TKY A;  4GRF A;  1K0D A;  2H75 A;  5ECP B;  2X99 A;  2C0E A;  4E8E A;  20GS A;  2B5X A;  3MNG A;  3HD5 A;  3NZN A;  4NHZ A;  4KUN A;  2GQM A;  1KEB A;  1MD3 A;  1EOG A;  2FCH A;  1EZK A;  4Q5Q A;  4BIK A;  3I9V 2;  1EP8 A;  2IMF A;  5KEJ A;  3BCK A;  2VAF A;  1EV4 A;  4X1U A;  12GS A;  5EL8 A;  1M0U A;  2VM1 A;  3ZVJ D;  1A2L A;  5G1K A;  4L8E A;  22GS A;  3TOU A;  2LQQ A;  5F07 A;  1CQG A;  5CYY A;  3RBT A;  2C1Y A;  2L5O A;  3ZL5 A;  4OCF A;  3LJR A;  1R5A A;  2FWE A;  2WZ9 A;  3RPP A;  3LSZ A;  5IMV A;  2CV4 A;  4BVY A;  1XBS A;  1OC8 A;  2C4J A;  1AQX A;  2PGT A;  3FZ4 A;  2H1B A;  2BTO T;  4WBR D;  2L59 A;  2LKU A;  1XOA A;  2JZT A;  3PPU A;  4WR4 A;  4IJI A;  4LMV A;  1TI3 A;  1TJD A;  2L5L A;  4POB A;  2LNS A;  2C0G A;  2KP2 A;  4QL7 A;  4O5R A;  3GH9 A;  3EC3 A;  1Z6M A;  2H1D A;  1GUL A;  1BED A;  1A0F A;  5KN2 A;  1SJI A;  2R3X A;  4BVX B;  2X64 A;  3QAV A;  5IMC A;  2PVO C;  3VK9 A;  4Z7X A;  5E59 A;  1S3R A;  2Z9S A;  1JLV A;  3CSH A;  1GNW A;  5G31 A;  3J7Y b;  2DJ0 A;  2CX4 A;  6GSU A;  1ZMA A;  3F9U A;  3VPT A;  1Z5Y E;  6GSW A;  3EIN A;  5G5F A;  3LFL A;  1TRS A;  3CMI A;  5INY A;  1F3A A;  2H6X A;  2H72 A;  2GT5 A;  2CVD A;  1O8X A;  4J57 E;  1X9M B;  2N5A A;  1M3J A;  4F82 A;  4YAP A;  1U87 A;  5H5Q A;  1FB6 A;  2F51 A;  5HFG A;  4GQF A;  4EL1 A;  2JZS A;  5KN0 A;  1YZX A;  4FYU A;  1VF2 A;  2HLS A;  2F8F A;  4XRD A;  1GP1 A;  4GLT A;  1XW5 A;  4KA0 A;  1BYE A;  4PUR A;  5LNK e;  3FK8 A;  2DIZ A;  5EPF A;  4HU7 A;  2VL2 A;  4KCA A;  2YWI A;  3CYN A;  2RM5 A;  3EE2 A;  2OA7 A;  2UZ8 A;  2LQO A;  2H1G A;  3PR8 A;  3GYK A;  3TKS E;  3H4K A;  4XS4 A;  2H70 A;  5D8I A;  1EEJ A;  3D21 A;  5HR0 A;  1RW1 A;  13GS A;  1VGL A;  4NXI A;  4RQX A;  5EVO A;  2XBI A;  2YV9 A;  2PWJ A;  1THX A;  3RAZ A;  2ON5 A;  3PIN A;  4JZQ A;  1AUC A;  1NM3 A;  1PSQ A;  2R5G A;  3QD9 A;  1V40 A;  4HQZ A;  4KDU A;  2L6D A;  1GUM A;  2YPM A;  1LBK A;  4A5P A;  5ECQ B;  4P3Y B;  1ERW A;  3EUR A;  2LUS A;  3L0H A;  4RI6 A;  1LJR A;  4HQS A;  2EIO A;  2P0G A;  3IPZ A;  4IP1 A;  1FO5 A;  4TN8 A;  2H6Y A;  3QCP A;  4POM A;  4F9Z A;  4NV2 A;  5IMD A;  4CY6 A;  4LA1 A;  1M2B A;  3W8S A;  3HJP A;  1NSW A;  2H01 A;  4GF0 A;  18GS A;  1YEX A;  3F8U A;  4TR1 A;  1WIK A;  4XIH A;  3U6V A;  1TDI A;  2IFQ B;  1X5E A;  5DDL A;  2NVL A;  1SU9 A;  10GS A;  4FH8 A;  2VCX A;  2DKI A;  1IYI A;  2YJH A;  3CSI A;  2YN1 A;  1TU8 A;  4G0L A;  3FZA A;  3UAR A;  3S9F A;  1AC1 A;  4G10 A;  4MZC A;  3SWL A;  4PUA A;  4G0I A;  4GST A;  1ZZY A;  2GGT A;  3H8Q A;  3QFB C;  5EY6 A;  1FG4 A;  2VD1 A;  4CY8 A;  3HY2 A;  2B7J A;  4MZB A;  2CX3 A;  1XZO A;  4V1A p;  4KE3 A;  1GUH A;  4D73 B;  4N0V A;  3ZLP A;  3A5W A;  1HD2 A;  3WGD A;  1ZYE A;  1Z7R A;  3ZRE A;  1F2E A;  2WFC A;  1O73 A;  2YJ7 A;  5ECI B;  2GSR A;  4ZBA A;  3FY7 A;  5ECO B;  1YKC A;  4ILF A;  1JZR A;  3KEB A;  4QL9 A;  2LEG A;  3DEX A;  3ZRD A;  2IL3 A;  2NBS A;  4I8B A;  5J4U A;  1E2Y A;  1FW1 A;  3LW9 A;  2WS2 A;  4EKZ A;  1EV9 A;  1XPV A;  3GST A;  2ON7 A;  4HSC X;  2VCQ A;  4X4J A;  2QKE A;  5G2Z A;  2M46 A;  2GZY A;  3TKS A;  1ON4 A;  3C1S A;  2FWF A;  2R2J A;  5B6M A;  1GTA A;  3UVH A;  1ZOF A;  5DVB A;  5DBQ A;  3GL5 A;  4TW5 A;  5CRW A;  1SL2 B;  1ZGN A;  4POK A;  4MPG A;  2XBQ A;  4KGI A;  3G7I A;  4AF2 A;  4O92 A;  3PGT A;  3JCM L;  3E9J B;  4PUF C;  1PN0 A;  5GST A;  2OJL A;  1Q4J A;  2MYG A;  2E0Q A;  2DMM A;  4DSR A;  2KP1 A;  4CW9 A;  4MK3 A;  2GST A;  1WMJ A;  2G2Q A;  4OO4 A;  3LYK A;  3KD0 A;  4IKH A;  3HXS A;  3DVW A;  4YQU A;  2PER A;  3CRT A;  3L9S A;  2A2P A;  5A5K A;  2HNL A;  1XXU A;  1YY7 A;  3ERW A;  2DKH A;  3KMO A;  1K3Y A;  2PUK C;  3CQF A;  2YAN A;  3FMW A;  1QGV A;  2AV4 A;  2VUP A;  5DCH A;  2VLT A;  2LST A;  2YZH A;  3I43 A;  2K8S A;  3HDC A;  3LOR A;  3G7J A;  3F4R A;  1N8J A;  2C3N A;  2JAD A;  4IBP A;  5H5S A;  4FQU A;  1SK2 A;  5AIS A;  5JCG A;  1GTI A;  3TJJ A;  4ZIL A;  1OKD A;  2V1M A;  4ZXG A;  5IMF A;  4EXJ A;  3IK7 A;  4Q5F A;  1AXD A;  5GAP D;  1EP7 A;  4FO5 A;  5IMZ A;  3FR9 A;  5ID2 B;  1J0F A;  2FHE A;  4JRR A;  4TXO A;  2FA8 A;  2FLS A;  2H76 A;  2IMD A;  4J2F A;  1KBN A;  1XCC A;  4K0N A;  3C8E A;  2O8V B;  4KAE A;  1GSS A;  5B8A A;  2LRN A;  4HJM A;  4IP6 A;  1GSE A;  1X0R A;  2B3S A;  2NTO A;  3DGQ A;  1WRY A;  1B8X A;  4JED A;  2IME A;  3F3Q A;  4DSS B;  1VRS D;  3QOU A;  2H74 A;  1PL1 A;  3FHK A;  3IR4 A;  2P5R A;  4N11 A;  2VL3 A;  4Z2T A;  5HR1 A;  1PN9 A;  1V58 A;  5DQS A;  5ELG A;  4BVX A;  3I69 A;  2RII A;  3F6F A;  2PN8 A;  2YNX A;  2KHP A;  4E8H A;  3GMF A;  1Z3E A;  1Z9H A;  2HYX A;  4EC0 A;  4L0W A;  1ZYQ B;  1TXX A;  3RDW A;  3TDG A;  2B1K A;  1V57 A;  2MMN A;  4PXO A;  3I6A A;  2GT6 A;  3H93 A;  2K9F A;  2I1U A;  5CRD A;  3Q6O A;  3ERF A;  2CT6 A;  4POL A;  3M9K A;  4MA9 A;  3GSS A;  1FAA A;  3QR6 A;  1FHE A;  3HJM A;  4K8M A;  1RK4 A;  3KP9 A;  1FVJ A;  5GZZ B;  2R0P A;  4NWY A;  16GS A;  1UVZ A;  4I6X A;  2HSH A;  5CRH A;  4DSQ A;  2WUL A;  2DIY A;  9GSS A;  2IMK A;  3D22 A;  2L4Q A;  1SKR B;  5LCZ A;  4G2E A;  2YP6 A;  3L9V A;  1JHB A;  1UN2 A;  3KZQ A;  4F0B A;  5DJM A;  4I97 A;  1R5P A;  1ERU A;  2K6V A;  4KCE A;  4ML6 A;  4KDX A;  3MYD A;  4HOJ A;  5B8B A;  1G0T A;  1T4Y A;  3GA4 A;  5CRG A;  2F9S A;  2O87 A;  2ZCT A;  5DJL A;  5IOW A;  4MF6 A;  1SYX A;  2H6Z A;  1PRX A;  2H30 A;  1M99 A;  1OC9 B;  3A2V A;  1R4W A;  1J08 A;  1FOH A;  1I9D A;  2DSA A;  2QC7 A;  1NHO A;  2REM A;  1NHY A;  2OE0 A;  4O5Q A;  5ECN B;  5J41 A;  2H19 A;  3ZTL A;  3GIX A;  11GS A;  3VLN A;  2X49 A;  1WE0 A;  4EIQ A;  1NW2 A;  4PQI A;  5HFI A;  5B6N A;  4AJ7 A;  3ZFL A;  4BL7 A;  2IWT A;  2C80 A;  1BQ7 A;  1XWB A;  3N5O A;  4HI7 A;  3HVS A;  4XHM A;  3GKX A;  4JBB A;  3GUR A;  5J9B A;  1EGO A;  1AW9 A;  3TJF A;  2AB6 A;  2GDR A;  2IFQ A;  2M72 A;  3WYW A;  3TRP A;  3FW2 A;  4RUV A;  1GSQ A;  1M7T A;  1TTZ A;  4G19 A;  4OFM A;  1U3I A;  2XC2 A;  3U5R E;  1SD8 A;  3IOS A;  2AHE A;  1TW9 A;  3APQ A;  3H79 A;  3ZVJ A;  2BJX A;  5IQY A;  2AYT A;  3C7M A;  4PX1 A;  3FYG A;  3GTU B;  3GKN A;  1A23 A;  4BWS A;  1QK8 A;  5CO3 A;  4I5Q A;  5IO2 A;  2N5F A;  1F9M A;  4F2I A;  1THO A;  4WF4 A;  4KW6 A;  4D73 A;  2JL4 A;  14GS A;  4NAX A;  3KH9 A;  4N0Z A;  1GUK A;  2MMZ A;  1BAY A;  3IV4 A;  2TRX A;  2PBJ A;  1Z6N A;  2E2M A;  5GSS A;  4OWY A;  1ZCP A;  1QXH A;  8GSS A;  2AJQ B;  4JR4 A;  5ECH B;  3ZFB A;  4KSM A;  3UIW A;  1GNE A;  5G5E A;  1A2M A;  2A2R A;  3TUE A;  2ZNM A;  3KIJ A;  1Z7P A;  4GXZ A;  4RQR A;  4TRX A;  5DCG A;  1GTB A;  5F0G A;  1TU7 A;  3VWU A;  1T7P B;  3FZ9 A;  1GLP A;  2HRN A;  3P8W A;  3VWX A;  1A24 A;  3DWV A;  4LL4 B;  1GTU A;  3IBH A;  4IEL A;  4K9Z A;  2VM2 A;  3GX0 A;  1K0O A;  1XWA A;  4ISD A;  4ML1 A;  4O5U A;  1Y25 A;  5J9C A;  5ECK B;  2O7K A;  1KNG A;  5D9V A;  4WBJ A;  3V1W A;  4LMW A;  4HDE A;  2EIR A;  2R0G A;  2YCD A;  4BVY B;  1JLW A;  2GLR A;  1MDK A;  3GN3 A;  4ICY A;  1EOH A;  1ST9 A;  4ZBB A;  4PNG A;  1UA5 A;  4K7I A;  4OCE A;  1QUW A;  2HXK A;  1T00 A;  2QA1 A;  1JZD A;  1XOB A;  4ID0 A;  2P31 A;  2VLV A;  3ME7 A;  2OE1 A;  2DC5 A;  4ULX A;  4HU9 A;  3ZIJ A;  1HQO A;  1O85 A;  2HZE A;  3Q74 A;  4IVF A;  3Q19 A;  1TK5 B;  5FWG A;  3ZMK A;  5H5R A;  1GWC A;  1G6W A;  3CSJ A;  4EIP A;  2R4V A;  2DML A;  2VCZ A;  2X8G A;  3MSZ A;  4PNF A;  2B6M A;  4K0G A;  3M3M A;  1W4V A;  1HNC A;  3BD2 A;  2VCV A;  1GSY A;  2LRC A;  4BWQ A;  4KND A;  5D9W A;  3US3 A;  1A2J A;  1XWG A;  4HUA A;  2YWM A;  3ZML A;  3HCZ A;  1XW6 A;  2VIM A;  3DVX A;  5ID2 A;  2MMO A;  4IW9 A;  2CAI A;  2H0I A;  2PPT A;  3EMP A;  5CNW A;  2WGR A;  4L5O A;  5J5N A;  4ECC A;  1K0M A;  1FB0 A;  3D4M A;  2DBC A;  3MWH A;  5HFK A;  4FYB A;  2QGV A;  2HSY A;  3DD3 A;  3D0Z A;  2GZZ A;  3TKQ A;  5JWO B;  4IHU A;  3C71 A;  4PQ1 A;  4MZW A;  1JFU A;  2H1A A;  3M9J A;  3RHB A;  3ZIV A;  3UVT A;  1TK8 B;  3SBC A;  3A3T A;  1TRU A;  5CAX A;  2B5Y A;  3UBL A;  3K8N A;  4I2T A;  1ERV A;  5G30 A;  3HZ4 A;  2HSM A;  2PU9 C;  2OAC A;  4MJB A;  2I4A A;  4EDZ A;  3LXZ A;  3LYP A;  1OE7 A;  3CTG A;  4PGT A;  1Y6E A;  2WDU A;  1I5G A;  3EMX A;  3IC8 A;  4NHW A;  4EDY A;  3M0F A;  2V41 A;  2VL9 A;  1M2A A;  2R37 A;  4GTU A;  1LU4 A;  1SD9 A;  4KH7 A;  5IPG A;  2VL2 C;  1XWC A;  1DUG A;  2H71 A;  3TJB A;  4CDO A;  2ALB A;  1ACV A;  2QA2 A;  4K5S A;  5ECR B;  3TRQ A;  5AN1 A;  1TP9 A;  5GAN D;  2L4C A;  3ZYW A;  4K2D A;  2GSS A;  5CP1 A;  3N9J A;  2YZU A;  3LXT A;  4ZL9 A;  3ZIT A;  1AIU A;  1YQ1 A;  3KGK A;  2GQK A;  1YF1 A;  4V2M A;  1A0R P;  1O81 A;  2HT9 A;  7GSS A;  4TR1 B;  1GSD A;  2FWG A;  3IDV A;  4MMM A;  2OBK A;  6GSY A;  2MMA A;  3G9B A;  3TJK A;  2YOI A;  4YH2 A;  1URM A;  3C73 A;  2X8H A;  2FD3 A;  5D93 A;  2FGX A;  4K6X A;  5DAK B;  1WPI A;  2I3Y A;  2C3Q A;  3GKM A;  3WT1 A;  2A4V A;  4HS1 A;  3IHQ A;  1OC9 A;  4MLY A;  2P5Q A;  4WEY A;  3F4S A;  3ED3 A;  5B7C A;  1ZL9 A;  1M2D A;  2V32 A;  3QFA C;  2CZ2 A;  1YJ6 A;  3VWW A;  1V98 A;  4Q5N A;  3BJ5 A;  1GLQ A;  4OFN A;  4ZIJ A;  3FEU A;  4MJA A;  4NMU A;  5D96 A;  6GSV A;  5F06 A;  1USB A;  4K1F A;  1V2A A;  1HNA A;  1BG5 A;  2O89 A;  1SJZ A;  3VI7 A;  3NIV A;  5IMA A;  1XWK A;  2DJ2 A;  1X9S B;  3O6T A;  1B4Q A;  1VF1 A;  2FY6 A;  4IQ1 A;  1S3C A;  3GV1 A;  2LS5 A;  1T3B A;  4YQV A;  5KN3 A;  4IJ3 A;  2LRT A;  3TRX A;  4AGS A;  2V2G A;  5ABR A;  2CQ9 A;  3GX8 A;  3DML A;  4HJ2 A;  3O3T A;  3IAM 2;  2K18 A;  1G7E A;  1EEM A;  3F3R A;  5ECL B;  2OAD A;  5FT3 A;  4TVE A;  3HHV A;  1SKW B;  5F8B A;  2GQL A;  3GTU A;  3ME8 A;  4XS6 A;  1JZW A;  3KH7 A;  5DAL B;  3HA9 A;  3O76 A;  3TKS C;  1OE8 A;  4ECJ A;  3HJO A;  3CXG A;  1VF3 A;  3APO A;  3GH6 A;  2JU5 A;  3WGE A;  3UOM A;  1AQW A;  5HQP A;  5D9X A;  1OYJ A;  1FVK A;  2C0F A;  1SL0 B;  3HVN A;  4I2U A;  1FOV A;  5E4W A;  1V9W A;  1PX7 A;  4BPY A;  1GSF A;  2DJ3 A;  2K8V A;  3TGZ A;  2X8C A;  4EVM A;  4J56 E;  4NPB A;  3C1R A;  1ILO A;  1PD2 1;  1O7U A;  1MDJ A;  4KB3 A;  1SYR A;  2D2Z A;  2O85 A;  3BCI A;  3EWL A;  1B9Y C;  1MTC A;  4WET A;  4WR5 A;  4GWR A;  1ABA A;  4PQH A;  3EYT A;  2HFD A;  5ECS A;  2XHF A;  4TR0 A;  2VD0 A;  2V6K A;  1C72 A;  4MJC A;  3P2A A;  2GSQ A;  1PFO A;  2HRK A;  3RHC A;  2VLU A;  1O8W A;  1T1V A;  3F63 A;  3TB2 A;  4IGJ A;  1PQN A;  2C0D A;  1KTE A;  3GNJ A;  1K0A A;  3GL3 A;  2BMX A;  4TXO B;  1X5D A;  4DEJ A;  4USS A;  1PKW A;  2WJU A;  3L9U A;  3KMN A;  2FNO A;  1T4Z A;  2LTK A;  1G7O A;  4MH3 A;  3UL3 A;  1B4P A;  3IE3 A;  1DE1 A;  2IJY A;  1K0B A;  1WJK A;  4ZL8 A;  3TOT A;  3QMX A;  1OKT A;  1SK0 A;  2HI7 A;  3IC4 A;  4EO3 A;  4EF0 A;  1XIY A;  4MDC A;  3VI5 A;  1S3A A;  3E3E A;  1F3B A;  2GZP A;  4MH2 A;  1YF0 A;  3TJG A;  4YAV A;  1AAZ A;  2LJK A;  4NV5 A;  2IPA A;  2JSY A;  2J9H A;  4XRA A;  5IO0 A;  2DLX A;  2PMT A;  4MF7 A;  2OKA A;  2FUG 2;  1K3O A;  2KUC A;  2DJK A;  2WCI A;  1ML6 A;  2QSI A;  2MBT A;  1PX6 A;  3UBK A;  1TK0 B;  2HRF A;  3ZZX A;  5IM9 A;  2CA8 A;  5FHI A;  3GRX A;  5KOX A;  5D9T A;  4MNN A;  2YWO A;  3LG6 A;  1Q98 A;  4L0U A;  2GS3 A;  3CBU A;  1R7H A;  2LNT A;  4ECI A;  1TKD B;  1TI1 A;  1H75 A;  1K0N A;  2RUF A;  3R2Q A;  3FR3 A;  5HR3 A;  3KM6 A;  2RM6 A;  3GKK A;  4JR6 A;  1DE2 A;  3IK9 A;  1PA3 A;  1PGT A;  3IHG A;  4HZ4 A;  1MEK A;  2M80 A;  3EPT A;  1GRX A;  3KXO A;  3EU3 A;  3MDK A;  3HVV A;  4JU5 A;  2H0H A;  3VUR A;  3DKS A;  1X5C A;  3UAP A;  3ISO A;  3RPN A;  2JZR A;  2XPE A;  2NDO A;  1K0C A;  2DJ1 A;  2RLI A;  4K5R A;  3FRC A;  5J3R A;  1DBY A;  4TXV A;  2B1L A;  4GSN A;  4MP4 A;  1SK1 A;  2YV7 A;  2I9H A;  1HYU A;  1YKA A;  3LGC A;  4BA7 A;  2VO4 A;  2IIY A;  3KTB A;  4XS1 A;  3HKR A;  3AY8 A;  1QMV A;  3F0I A;  3DXB A;  3A2W A;  1EWX A;  3KTL A;  1XVW A;  4WF5 A;  3BOA A;  5A4V A;  2VCT A;  2L6C A;  4KX4 A;  4TOP A;  3WGX A;  4MCU A;  1PL2 A;  4CHS A;  4BL7 B; 
#chains in the Genus database with same CATH homology
 1JZO A;  4X43 A;  3D4T A;  4IS0 A;  3R3E A;  5CRE A;  4ACS A;  1XW9 A;  4K2X A;  4ZB8 A;  4G0K A;  1WWJ A;  4TR4 A;  5COH A;  5KOW A;  3KCM A;  3ERG A;  2XPD A;  1MDI A;  5KN1 A;  2LJR A;  4V2N A;  4ECB A;  3MAK A;  5JCW A;  3M8N A;  3A2X A;  5DAK A;  19GS A;  4L5L A;  5F05 A;  4K7N A;  4KF9 A;  4EUY A;  2H66 A;  3H1N A;  2FWH A;  1YDK A;  3CRU A;  1HNB A;  2C8U A;  3IRA A;  4FIW A;  3WT2 A;  3UMA A;  2A4H A;  1BX9 A;  1OC3 A;  1WP0 A;  1XFL A;  2KLX A;  4F03 A;  3DIE A;  4EE0 A;  1IYH A;  5IOX A;  2C3T A;  2IMI A;  2IN3 A;  4OFT A;  1R26 A;  1F6M C;  4DSS A;  1SEN A;  2MBS A;  1J9B A;  1GH2 A;  5ELA A;  4YQM A;  3GHA A;  4Z2R A;  1E6B A;  4AJ8 A;  1VF4 A;  2HZF A;  1TRW A;  1M9A A;  2JAC A;  4IQA A;  3TKP A;  4ZBD A;  1TRV A;  4GSS A;  3KP8 A;  2R6K A;  4GCI A;  3M1G A;  3LQ7 A;  2G0F A;  4OMV A;  2DJJ A;  1QFN A;  1A8L A;  3A5I A;  5A4W A;  1SJ6 A;  3KJY A;  2PVQ A;  4XS4 B;  4RI7 A;  5IPH A;  2F8A A;  5HR2 A;  4JE1 A;  1DSB A;  2H0G A;  4ZB9 A;  2WB9 A;  2CVK A;  4MJE A;  2JSZ A;  4FYC A;  5AIV A;  4N30 A;  2FA4 A;  1B9X C;  4ZB6 A;  2WRT A;  2TRC P;  2OE3 A;  3PH9 A;  3VPQ A;  4OO5 A;  1SKS B;  3IAS 2;  2H8L A;  4AJ6 A;  2CAQ A;  1SL1 B;  4V2L A;  3EU4 A;  2CVB A;  3APS A;  3IA1 A;  5BMU A;  2V6O A;  2AUV A;  5DQY A;  3CTF A;  4MAB A;  3Q18 A;  3FKF A;  3NOF A;  5DAL A;  3QAW A;  1EGR A;  3MIX A;  4Q5R A;  2J23 A;  3VFI A;  5L71 A;  4H86 A;  5ECM B;  5ENU A;  3LEF A;  2F3M A;  3BBY A;  3HVX A;  2B5E A;  3UEM A;  3L78 A;  2RUE A;  3QPM A;  2KOK A;  3GFK A;  4N10 A;  1PMT A;  2TIR A;  1A8Y A;  1YEP A;  1O6J A;  2ES7 A;  3LWA A;  2HZE B;  2H73 A;  3OR5 A;  1H4O A;  2OBI A;  4F0C A;  3QDN A;  4X0X A;  1W89 A;  1UC7 A;  6GSS A;  4XCS A;  4DVC A;  1AQV A;  4G9H A;  2LJA A;  5AGY A;  4O32 A;  5AIX A;  5G1L A;  1MD4 A;  4MF5 A;  5C04 A;  1G6Y A;  3QAG A;  6GSX A;  4YKG A;  1S3D A;  3L4N A;  5JWR B;  4LLR A;  4KDY A;  3TCO A;  4TR3 A;  5JCU A;  1RQM A;  1ZYN A;  1GL8 A;  2EC4 A;  3WD6 A;  2CZ3 A;  3EVI A;  2GVP A;  2N5B A;  6GST A;  4K7O A;  1GSU A;  2MZC A;  17GS A;  1PKZ A;  4O7H A;  4YKF A;  4WKW A;  2I81 A;  4WXT A;  4KSO A;  3P90 A;  2NPB A;  4PTS A;  1B48 A;  3J7Y k;  3DRN A;  3HZ8 A;  2HE3 A;  1OVN A;  2A2S A;  2GTU A;  5BRT A;  2L57 A;  3F6D A;  1TOF A;  3D5J A;  1K3L A;  1BJX A;  2B7K A;  3F4T A;  2R0C A;  2LV3 A;  3W8J A;  1U3A A;  2X4A A;  4V1A g;  4MPF A;  1N2A A;  1OAZ A;  2EIQ A;  1WOU A;  1T8E B;  4HZ2 A;  4QQ7 A;  1X9W B;  3DYR A;  1CQH A;  3VWV A;  1M9B A;  1F37 A;  2VOC A;  1ERT A;  3UJ1 A;  2VCW A;  3P7X A;  3TKR A;  3W6G A;  5LD0 A;  3G7Y A;  5D73 A;  4HEA 2;  2HRA A;  4Z2U A;  2YWN A;  2E2G A;  2E7P A;  3GUS A;  1QQ2 A;  5A4U A;  3HYP A;  3IXR A;  4IN0 A;  4OD7 A;  2ZUP A;  1U6T A;  5JWQ B;  1XVQ A;  4LL1 B;  4GQC A;  3FZ5 A;  4ZL7 A;  5IIZ A;  3D6I A;  4XTS A;  3FR6 A;  1ZYP A;  3E0U A;  1U88 A;  2AAW A;  5C00 A;  4TKY A;  4GRF A;  1K0D A;  2H75 A;  5ECP B;  2X99 A;  2C0E A;  4E8E A;  20GS A;  2B5X A;  3MNG A;  3HD5 A;  3NZN A;  4NHZ A;  4KUN A;  2GQM A;  1KEB A;  1MD3 A;  1EOG A;  2FCH A;  1EZK A;  4Q5Q A;  3I9V 2;  1EP8 A;  2IMF A;  5KEJ A;  3BCK A;  2VAF A;  1EV4 A;  4X1U A;  12GS A;  5EL8 A;  1M0U A;  2VM1 A;  3ZVJ D;  1A2L A;  5G1K A;  4L8E A;  22GS A;  3TOU A;  2LQQ A;  5F07 A;  1CQG A;  5CYY A;  3RBT A;  2C1Y A;  2L5O A;  3ZL5 A;  4OCF A;  3LJR A;  1R5A A;  2FWE A;  2WZ9 A;  3RPP A;  3LSZ A;  5IMV A;  2CV4 A;  4BVY A;  1XBS A;  1OC8 A;  2C4J A;  1AQX A;  2PGT A;  3FZ4 A;  2H1B A;  2BTO T;  4WBR D;  2L59 A;  2LKU A;  1XOA A;  2JZT A;  3PPU A;  4WR4 A;  4IJI A;  4LMV A;  1TI3 A;  1TJD A;  2L5L A;  4POB A;  2LNS A;  2C0G A;  2KP2 A;  4QL7 A;  4O5R A;  3GH9 A;  3EC3 A;  1Z6M A;  2H1D A;  1GUL A;  1BED A;  1A0F A;  5KN2 A;  1SJI A;  2R3X A;  4BVX B;  2X64 A;  3QAV A;  5IMC A;  2PVO C;  3VK9 A;  4Z7X A;  5E59 A;  2Z9S A;  1JLV A;  3CSH A;  1GNW A;  5G31 A;  3J7Y b;  2DJ0 A;  2CX4 A;  6GSU A;  1ZMA A;  3F9U A;  3VPT A;  1Z5Y E;  6GSW A;  3EIN A;  5G5F A;  3LFL A;  1TRS A;  3CMI A;  5INY A;  1F3A A;  2H6X A;  2H72 A;  2GT5 A;  2CVD A;  1O8X A;  4J57 E;  1X9M B;  2N5A A;  4F82 A;  4YAP A;  1U87 A;  5H5Q A;  1FB6 A;  2F51 A;  5HFG A;  4GQF A;  4EL1 A;  2JZS A;  5KN0 A;  1YZX A;  4FYU A;  1VF2 A;  2HLS A;  2F8F A;  4XRD A;  1GP1 A;  4GLT A;  1XW5 A;  4KA0 A;  1BYE A;  4PUR A;  5LNK e;  3FK8 A;  2DIZ A;  5EPF A;  4HU7 A;  2VL2 A;  4KCA A;  2YWI A;  3CYN A;  2RM5 A;  3EE2 A;  2OA7 A;  2UZ8 A;  2LQO A;  2H1G A;  3PR8 A;  3GYK A;  3TKS E;  3H4K A;  4XS4 A;  2H70 A;  5D8I A;  1EEJ A;  3D21 A;  5HR0 A;  1RW1 A;  13GS A;  1VGL A;  4NXI A;  4RQX A;  5EVO A;  2XBI A;  2YV9 A;  2PWJ A;  1THX A;  3RAZ A;  2ON5 A;  3PIN A;  4JZQ A;  1AUC A;  1NM3 A;  1PSQ A;  2R5G A;  3QD9 A;  1V40 A;  4HQZ A;  4KDU A;  2L6D A;  1GUM A;  2YPM A;  1LBK A;  4A5P A;  5ECQ B;  4P3Y B;  1ERW A;  3EUR A;  2LUS A;  3L0H A;  4RI6 A;  1LJR A;  4HQS A;  2EIO A;  2P0G A;  3IPZ A;  4IP1 A;  1FO5 A;  4TN8 A;  2H6Y A;  3QCP A;  4POM A;  4F9Z A;  4NV2 A;  5IMD A;  4CY6 A;  4LA1 A;  1M2B A;  3W8S A;  3HJP A;  1NSW A;  2H01 A;  4GF0 A;  18GS A;  1YEX A;  3F8U A;  4TR1 A;  1WIK A;  4XIH A;  3U6V A;  1TDI A;  2IFQ B;  1X5E A;  5DDL A;  2NVL A;  1SU9 A;  10GS A;  4FH8 A;  2VCX A;  2DKI A;  1IYI A;  2YJH A;  3CSI A;  2YN1 A;  1TU8 A;  4G0L A;  3FZA A;  3UAR A;  3S9F A;  1AC1 A;  4G10 A;  4MZC A;  3SWL A;  4PUA A;  4G0I A;  4GST A;  1ZZY A;  2GGT A;  3H8Q A;  3QFB C;  5EY6 A;  1FG4 A;  2VD1 A;  4CY8 A;  3HY2 A;  2B7J A;  4MZB A;  2CX3 A;  1XZO A;  4V1A p;  4KE3 A;  1GUH A;  4D73 B;  4N0V A;  3ZLP A;  3A5W A;  1HD2 A;  3WGD A;  1ZYE A;  1Z7R A;  3ZRE A;  1F2E A;  2WFC A;  1O73 A;  2YJ7 A;  5ECI B;  2GSR A;  4ZBA A;  3FY7 A;  5ECO B;  1YKC A;  4ILF A;  1JZR A;  3KEB A;  4QL9 A;  2LEG A;  3DEX A;  3ZRD A;  2IL3 A;  2NBS A;  4I8B A;  5J4U A;  1E2Y A;  1FW1 A;  3LW9 A;  2WS2 A;  4EKZ A;  1EV9 A;  1XPV A;  3GST A;  2ON7 A;  2VCQ A;  4X4J A;  2QKE A;  5G2Z A;  2M46 A;  2GZY A;  3TKS A;  1ON4 A;  3C1S A;  2FWF A;  2R2J A;  5B6M A;  1GTA A;  3UVH A;  1ZOF A;  5DVB A;  5DBQ A;  3GL5 A;  4TW5 A;  5CRW A;  1SL2 B;  1ZGN A;  4POK A;  4MPG A;  2XBQ A;  4KGI A;  3G7I A;  4AF2 A;  4O92 A;  3PGT A;  3JCM L;  3E9J B;  4PUF C;  1PN0 A;  5GST A;  2OJL A;  1Q4J A;  2MYG A;  2E0Q A;  2DMM A;  4DSR A;  2KP1 A;  4CW9 A;  4MK3 A;  2GST A;  1WMJ A;  2G2Q A;  4OO4 A;  3LYK A;  3KD0 A;  4IKH A;  3HXS A;  3DVW A;  4YQU A;  2PER A;  3CRT A;  3L9S A;  2A2P A;  5A5K A;  2HNL A;  1XXU A;  1YY7 A;  3ERW A;  2DKH A;  3KMO A;  1K3Y A;  2PUK C;  2YAN A;  3FMW A;  1QGV A;  2AV4 A;  2VUP A;  5DCH A;  2VLT A;  2LST A;  2YZH A;  3I43 A;  2K8S A;  3HDC A;  3LOR A;  3G7J A;  3F4R A;  1N8J A;  2C3N A;  2JAD A;  4IBP A;  5H5S A;  4FQU A;  1SK2 A;  5AIS A;  5JCG A;  1GTI A;  3TJJ A;  4ZIL A;  1OKD A;  2V1M A;  4ZXG A;  5IMF A;  4EXJ A;  3IK7 A;  4Q5F A;  1AXD A;  5GAP D;  1EP7 A;  4FO5 A;  5IMZ A;  3FR9 A;  5ID2 B;  1J0F A;  2FHE A;  4JRR A;  4TXO A;  2FA8 A;  2FLS A;  2H76 A;  2IMD A;  4J2F A;  1KBN A;  1XCC A;  4K0N A;  3C8E A;  2O8V B;  4KAE A;  1GSS A;  5B8A A;  2LRN A;  4HJM A;  4IP6 A;  1GSE A;  1X0R A;  2B3S A;  2NTO A;  3DGQ A;  1WRY A;  1B8X A;  4JED A;  2IME A;  3F3Q A;  4DSS B;  1VRS D;  3QOU A;  2H74 A;  1PL1 A;  3FHK A;  3IR4 A;  2P5R A;  4N11 A;  2VL3 A;  4Z2T A;  5HR1 A;  1PN9 A;  1V58 A;  5DQS A;  5ELG A;  4BVX A;  3I69 A;  2RII A;  3F6F A;  2PN8 A;  2YNX A;  2KHP A;  4E8H A;  3GMF A;  1Z3E A;  1Z9H A;  2HYX A;  4EC0 A;  4L0W A;  1ZYQ B;  1TXX A;  3RDW A;  3TDG A;  2B1K A;  1V57 A;  2MMN A;  4PXO A;  3I6A A;  2GT6 A;  3H93 A;  2K9F A;  2I1U A;  5CRD A;  3Q6O A;  3ERF A;  2CT6 A;  4POL A;  3M9K A;  4MA9 A;  3GSS A;  1FAA A;  3QR6 A;  1FHE A;  3HJM A;  4K8M A;  1RK4 A;  3KP9 A;  1FVJ A;  5GZZ B;  2R0P A;  4NWY A;  16GS A;  1UVZ A;  4I6X A;  2HSH A;  5CRH A;  4DSQ A;  2WUL A;  2DIY A;  9GSS A;  2IMK A;  3D22 A;  2L4Q A;  1SKR B;  5LCZ A;  4G2E A;  2YP6 A;  3L9V A;  1JHB A;  1UN2 A;  3KZQ A;  4F0B A;  5DJM A;  4I97 A;  1R5P A;  1ERU A;  2K6V A;  4KCE A;  4ML6 A;  4KDX A;  3MYD A;  4HOJ A;  5B8B A;  1G0T A;  1T4Y A;  3GA4 A;  5CRG A;  2F9S A;  2O87 A;  2ZCT A;  5DJL A;  5IOW A;  4MF6 A;  1SYX A;  2H6Z A;  1PRX A;  2H30 A;  1M99 A;  1OC9 B;  3A2V A;  1R4W A;  1J08 A;  1FOH A;  1I9D A;  2DSA A;  2QC7 A;  1NHO A;  2REM A;  1NHY A;  2OE0 A;  4O5Q A;  5ECN B;  5J41 A;  2H19 A;  3ZTL A;  3GIX A;  11GS A;  3VLN A;  2X49 A;  1WE0 A;  4EIQ A;  1NW2 A;  4PQI A;  5HFI A;  5B6N A;  4AJ7 A;  3ZFL A;  4BL7 A;  2IWT A;  2C80 A;  1BQ7 A;  1XWB A;  3N5O A;  4HI7 A;  3HVS A;  4XHM A;  3GKX A;  4JBB A;  3GUR A;  5J9B A;  1EGO A;  1AW9 A;  3TJF A;  2AB6 A;  2GDR A;  2IFQ A;  2M72 A;  3WYW A;  3TRP A;  3FW2 A;  4RUV A;  1GSQ A;  1M7T A;  1TTZ A;  4G19 A;  4OFM A;  1U3I A;  2XC2 A;  3U5R E;  1SD8 A;  3IOS A;  2AHE A;  1TW9 A;  3APQ A;  3H79 A;  3ZVJ A;  2BJX A;  5IQY A;  2AYT A;  3C7M A;  4PX1 A;  3FYG A;  3GTU B;  3GKN A;  1A23 A;  4BWS A;  1QK8 A;  5CO3 A;  4I5Q A;  5IO2 A;  2N5F A;  1F9M A;  4F2I A;  1THO A;  4WF4 A;  4KW6 A;  4D73 A;  2JL4 A;  14GS A;  4NAX A;  3KH9 A;  4N0Z A;  1GUK A;  2MMZ A;  1BAY A;  3IV4 A;  2TRX A;  2PBJ A;  1Z6N A;  2E2M A;  5GSS A;  4OWY A;  1ZCP A;  1QXH A;  8GSS A;  2AJQ B;  4JR4 A;  5ECH B;  3ZFB A;  4KSM A;  3UIW A;  1GNE A;  5G5E A;  1A2M A;  2A2R A;  3TUE A;  2ZNM A;  3KIJ A;  1Z7P A;  4GXZ A;  4RQR A;  4TRX A;  5DCG A;  1GTB A;  5F0G A;  1TU7 A;  3VWU A;  1T7P B;  3FZ9 A;  1GLP A;  2HRN A;  3P8W A;  3VWX A;  1A24 A;  3DWV A;  4LL4 B;  1GTU A;  3IBH A;  4IEL A;  4K9Z A;  2VM2 A;  3GX0 A;  1K0O A;  1XWA A;  4ISD A;  4ML1 A;  4O5U A;  1Y25 A;  5J9C A;  5ECK B;  2O7K A;  1KNG A;  5D9V A;  4WBJ A;  3V1W A;  4LMW A;  4HDE A;  2EIR A;  2R0G A;  2YCD A;  4BVY B;  1JLW A;  2GLR A;  1MDK A;  3GN3 A;  4ICY A;  1EOH A;  1ST9 A;  4ZBB A;  4PNG A;  1UA5 A;  4K7I A;  4OCE A;  1QUW A;  2HXK A;  1T00 A;  2QA1 A;  1JZD A;  1XOB A;  4ID0 A;  2P31 A;  2VLV A;  3ME7 A;  2OE1 A;  2DC5 A;  4ULX A;  4HU9 A;  3ZIJ A;  1HQO A;  1O85 A;  2HZE A;  3Q74 A;  4IVF A;  3Q19 A;  1TK5 B;  5FWG A;  3ZMK A;  5H5R A;  1GWC A;  1G6W A;  3CSJ A;  4EIP A;  2R4V A;  2DML A;  2VCZ A;  2X8G A;  3MSZ A;  4PNF A;  2B6M A;  4K0G A;  3M3M A;  1W4V A;  1HNC A;  3BD2 A;  2VCV A;  1GSY A;  2LRC A;  4BWQ A;  4KND A;  5D9W A;  3US3 A;  1A2J A;  1XWG A;  4HUA A;  2YWM A;  3ZML A;  3HCZ A;  1XW6 A;  2VIM A;  3DVX A;  5ID2 A;  2MMO A;  4IW9 A;  2CAI A;  2H0I A;  2PPT A;  3EMP A;  5CNW A;  2WGR A;  4L5O A;  5J5N A;  4ECC A;  1K0M A;  1FB0 A;  3D4M A;  2DBC A;  3MWH A;  5HFK A;  4FYB A;  2QGV A;  2HSY A;  3DD3 A;  3D0Z A;  2GZZ A;  3TKQ A;  5JWO B;  4IHU A;  3C71 A;  4PQ1 A;  4MZW A;  1JFU A;  2H1A A;  3M9J A;  3RHB A;  3ZIV A;  3UVT A;  1TK8 B;  3SBC A;  3A3T A;  1TRU A;  5CAX A;  2B5Y A;  3UBL A;  3K8N A;  4I2T A;  1ERV A;  5G30 A;  3HZ4 A;  2HSM A;  2PU9 C;  2OAC A;  4MJB A;  2I4A A;  4EDZ A;  3LXZ A;  3LYP A;  1OE7 A;  3CTG A;  4PGT A;  1Y6E A;  2WDU A;  1I5G A;  3EMX A;  3IC8 A;  4NHW A;  4EDY A;  3M0F A;  2V41 A;  2VL9 A;  1M2A A;  2R37 A;  4GTU A;  1LU4 A;  1SD9 A;  4KH7 A;  5IPG A;  2VL2 C;  1XWC A;  1DUG A;  2H71 A;  3TJB A;  4CDO A;  2ALB A;  1ACV A;  2QA2 A;  4K5S A;  5ECR B;  3TRQ A;  5AN1 A;  1TP9 A;  5GAN D;  2L4C A;  3ZYW A;  4K2D A;  2GSS A;  5CP1 A;  3N9J A;  2YZU A;  3LXT A;  4ZL9 A;  3ZIT A;  1AIU A;  1YQ1 A;  3KGK A;  2GQK A;  1YF1 A;  4V2M A;  1A0R P;  1O81 A;  2HT9 A;  7GSS A;  4TR1 B;  1GSD A;  2FWG A;  3IDV A;  4MMM A;  2OBK A;  6GSY A;  2MMA A;  3G9B A;  3TJK A;  2YOI A;  4YH2 A;  1URM A;  3C73 A;  2X8H A;  2FD3 A;  5D93 A;  2FGX A;  4K6X A;  5DAK B;  1WPI A;  2I3Y A;  2C3Q A;  3GKM A;  3WT1 A;  2A4V A;  4HS1 A;  3IHQ A;  1OC9 A;  4MLY A;  2P5Q A;  4WEY A;  3F4S A;  3ED3 A;  5B7C A;  1ZL9 A;  1M2D A;  2V32 A;  3QFA C;  2CZ2 A;  1YJ6 A;  3VWW A;  1V98 A;  4Q5N A;  3BJ5 A;  1GLQ A;  4OFN A;  4ZIJ A;  3FEU A;  5D96 A;  4MJA A;  4NMU A;  6GSV A;  5F06 A;  1USB A;  4K1F A;  1V2A A;  1HNA A;  1BG5 A;  2O89 A;  1SJZ A;  3VI7 A;  3NIV A;  5IMA A;  1XWK A;  2DJ2 A;  1X9S B;  3O6T A;  1B4Q A;  1VF1 A;  2FY6 A;  4IQ1 A;  1S3C A;  3GV1 A;  2LS5 A;  1T3B A;  4YQV A;  5KN3 A;  4IJ3 A;  2LRT A;  3TRX A;  4AGS A;  2V2G A;  5ABR A;  2CQ9 A;  3GX8 A;  3DML A;  4HJ2 A;  3O3T A;  3IAM 2;  2K18 A;  1G7E A;  1EEM A;  3F3R A;  5ECL B;  2OAD A;  5FT3 A;  4TVE A;  3HHV A;  1SKW B;  5F8B A;  2GQL A;  3GTU A;  3ME8 A;  4XS6 A;  1JZW A;  3KH7 A;  5DAL B;  3HA9 A;  3O76 A;  3TKS C;  1OE8 A;  4ECJ A;  3HJO A;  3CXG A;  1VF3 A;  3APO A;  3GH6 A;  2JU5 A;  3WGE A;  3UOM A;  1AQW A;  5HQP A;  5D9X A;  1OYJ A;  1FVK A;  2C0F A;  1SL0 B;  4I2U A;  1FOV A;  5E4W A;  1V9W A;  1PX7 A;  4BPY A;  1GSF A;  2DJ3 A;  2K8V A;  3TGZ A;  2X8C A;  4EVM A;  4J56 E;  4NPB A;  3C1R A;  1ILO A;  1PD2 1;  1O7U A;  1MDJ A;  4KB3 A;  1SYR A;  2D2Z A;  2O85 A;  3BCI A;  3EWL A;  1B9Y C;  1MTC A;  4WET A;  4WR5 A;  4GWR A;  1ABA A;  4PQH A;  3EYT A;  2HFD A;  5ECS A;  2XHF A;  4TR0 A;  2VD0 A;  2V6K A;  1C72 A;  4MJC A;  3P2A A;  2GSQ A;  2HRK A;  3RHC A;  2VLU A;  1O8W A;  1T1V A;  3F63 A;  3TB2 A;  4IGJ A;  1PQN A;  2C0D A;  1KTE A;  3GNJ A;  1K0A A;  3GL3 A;  2BMX A;  4TXO B;  1X5D A;  4DEJ A;  4USS A;  1PKW A;  2WJU A;  3L9U A;  3KMN A;  2FNO A;  1T4Z A;  2LTK A;  1G7O A;  4MH3 A;  3UL3 A;  1B4P A;  3IE3 A;  1DE1 A;  2IJY A;  1K0B A;  1WJK A;  4ZL8 A;  3TOT A;  3QMX A;  1OKT A;  1SK0 A;  2HI7 A;  3IC4 A;  4EO3 A;  4EF0 A;  1XIY A;  4MDC A;  3VI5 A;  1S3A A;  3E3E A;  1F3B A;  2GZP A;  4MH2 A;  1YF0 A;  3TJG A;  4YAV A;  1AAZ A;  2LJK A;  4NV5 A;  2IPA A;  2JSY A;  2J9H A;  4XRA A;  5IO0 A;  2DLX A;  2PMT A;  4MF7 A;  2OKA A;  2FUG 2;  1K3O A;  2KUC A;  2DJK A;  2WCI A;  1ML6 A;  2QSI A;  2MBT A;  1PX6 A;  3UBK A;  1TK0 B;  2HRF A;  3ZZX A;  5IM9 A;  2CA8 A;  5FHI A;  3GRX A;  5KOX A;  5D9T A;  4MNN A;  2YWO A;  3LG6 A;  1Q98 A;  4L0U A;  2GS3 A;  3CBU A;  1R7H A;  2LNT A;  4ECI A;  1TKD B;  1TI1 A;  1H75 A;  1K0N A;  2RUF A;  3R2Q A;  3FR3 A;  5HR3 A;  3KM6 A;  2RM6 A;  3GKK A;  4JR6 A;  1DE2 A;  3IK9 A;  1PA3 A;  1PGT A;  3IHG A;  4HZ4 A;  1MEK A;  2M80 A;  3EPT A;  1GRX A;  3KXO A;  3EU3 A;  3MDK A;  3HVV A;  4JU5 A;  2H0H A;  3VUR A;  3DKS A;  1X5C A;  3UAP A;  3ISO A;  3RPN A;  2JZR A;  2XPE A;  2NDO A;  1K0C A;  2DJ1 A;  2RLI A;  4K5R A;  3FRC A;  5J3R A;  1DBY A;  4TXV A;  2B1L A;  4GSN A;  4MP4 A;  1SK1 A;  2YV7 A;  2I9H A;  1HYU A;  1YKA A;  3LGC A;  4BA7 A;  2VO4 A;  2IIY A;  3KTB A;  4XS1 A;  3HKR A;  3AY8 A;  1QMV A;  3F0I A;  3DXB A;  3A2W A;  1EWX A;  3KTL A;  1XVW A;  4WF5 A;  3BOA A;  5A4V A;  2VCT A;  2L6C A;  4KX4 A;  4TOP A;  3WGX A;  4MCU A;  1PL2 A;  4CHS A;  4BL7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...