3HVXA

Escherichia coli thiol peroxidase (tpx) resolving cysteine to serine mutant (c95s) with an intermolecular disulfide bond
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
167
Chain Sequence
SQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLSISADLPFAQSRFSGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol peroxidase
publication title Structural changes common to catalysis in the Tpx peroxiredoxin subfamily.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 52
structure length 167
sequence length 167
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3hvxA00
2VL2A 2K6VA 2JADA 3DVWA 2TIRA 4EDYA 2L4CA 2H66A 2VM2A 4IS0A 3DWVA 4ZIJA 5G2ZA 3KD0A 4NMUA 2LTKA 5C00A 2GZPA 2CVDA 4O7HA 2AAWA 4GSNA 1W4VA 2E0QA 2R6KA 1YF0A 2F9SA 3CBUA 2WGRA 1DSBA 5ECOB 5KN0A 5ECLB 1B8XA 4KE3A 3TJBA 4I6XA 3LYPA 1RW1A 2KLXA 2LS5A 4X1UA 3QOUA 1TTZA 4ECCA 3F4SA 2C3TA 3KIJA 3O3TA 3ZVJA 5JWQB 2IFQB 2YPMA 1MTCA 2YV7A 3HD5A 3HJOA 1S3DA 3GA4A 1NM3A 2N5FA 1OC9A 2C1YA 1SJZA 2YANA 3APSA 2WFCA 5D73A 2V2GA 4OMVA 1WRYA 1TK8B 4ZL8A 3TKSA 1PX6A 1OVNA 4YQUA 4KNDA 3ZIVA 4XS4A 1PA3A 3KH9A 3FZ5A 2MBSA 3H4KA 3G7IA 1WE0A 3MNGA 3KGKA 1PRXA 3ERGA 3UOMA 4GLTA 4DSQA 3G9BA 5HFGA 1OE8A 1BQ7A 2HRFA 5JCUA 5J41A 3ZITA 2XPDA 1ST9A 1XCCA 5IO0A 5LCZA 2YZUA 2RLIA 1PKZA 1K0BA 1H75A 4GF0A 3ME7A 1B9XC 2IMIA 2QSIA 11GSA 4DVCA 5EY6A 4K2DA 4PXOA 1HNAA 3QPMA 3QAWA 1QQ2A 2NDOA 2OJLA 19GSA 1PL1A 1ZZYA 2YNXA 4NPBA 3HYPA 1TRWA 2H1BA 2LSTA 4P3YB 1O6JA 2YV9A 4PUFC 2FHEA 3SBCA 2QC7A 1M9AA 1K0DA 2C3NA 5F06A 3LXZA 3C8EA 2AV4A 3GX0A 1X9MB 3D4MA 4TXOA 1BAYA 2XBIA 1MEKA 4ZL9A 1SL1B 3MWHA 1AAZA 8GSSA 4F0BA 3KJYA 3EINA 3C71A 5ECQB 5CRWA 4I97A 4MMMA 1SU9A 4ECJA 2HLSA 2FWGA 1GWCA 1BX9A 2YWNA 3C1SA 4MH2A 1KNGA 2LRNA 4ML6A 3QAVA 4TR4A 5D93A 4K7NA 2D2ZA 2H74A 1B9YC 3ISOA 1YY7A 3F9UA 4PQIA 1WPIA 5ECPB 1QK8A 2L6DA 4FH8A 1GSQA 2VD1A 3DXBA 2C4JA 3HA9A 4OO5A 1TK5B 3RAZA 3TJFA 3P7XA 1WOUA 1FG4A 2MMAA 2M46A 4XS6A 2FWHA 2N5BA 3DVXA 4PQHA 2ON7A 3GTUA 4XIHA 1I9DA 2L4QA 1X5EA 4POBA 1XZOA 2A2RA 1PD21 2VLTA 4F82A 3H93A 2H72A 1XOBA 2HI7A 3CTGA 4G2EA 1W89A 3BOAA 5IPHA 4KH7A 4ZXGA 2IIYA 1LJRA 3I69A 2VUPA 1F37A 4FO5A 3IC4A 5D8IA 3IDVA 4KUNA 1F9MA 1PL2A 1HYUA 2HSHA 2LUSA 4IP6A 4TW5A 2JZRA 3IV4A 1SJIA 2VCZA 3FZ9A 2FWFA 2K8VA 2CZ2A 3KMOA 4L5OA 2I4AA 1QFNA 4ID0A 3ME8A 4LA1A 1X9SB 3DMLA 2VD0A 3KZQA 2I3YA 2GQMA 5F07A 2M80A 4MH3A 1ERUA 2C3QA 4MZCA 5G1KA 3EWLA 5ELGA 2AHEA 4EKZA 2VCWA 1YDKA 1MD3A 12GSA 3GSSA 1DE1A 3GH6A 2H8LA 2C80A 3LSZA 5LD0A 4J57E 4WBJA 4MA9A 3HZ4A 2HZEB 1YF1A 4HU7A 2G2QA 2HE3A 4PX1A 3ZREA 5ECHB 1YEXA 1TJDA 3GKNA 1SD8A 3DKSA 1ZGNA 1J9BA 3FK8A 3RBTA 1B4QA 1TU7A 1O81A 4H86A 3M9JA 2XBQA 5IMAA 3GV1A 4EL1A 2VCQA 4K7IA 2H0HA 1XBSA 2K9FA 1SK1A 2DJ1A 1TOFA 2OBKA 4ZL7A 5IPGA 5ID2A 2L5LA 3G7JA 3WT2A 4BVXA 1VF2A 1GSFA 1GTAA 5F0GA 3WGXA 5GZZB 2GSQA 1VF4A 5A4WA 2WRTA 2XC2A 4K9ZA 4ILFA 2PGTA 2PVOC 2JZTA 1THOA 3GHAA 3D4TA 4L0UA 3LGCA 1GULA 2FLSA 1WP0A 1X0RA 7GSSA 4MABA 4KW6A 3QDNA 3S9FA 1XWKA 4IJ3A 5CAXA 5DBQA 3ZMKA 4NWYA 4HJMA 2WULA 4HQSA 4IQAA 2B1LA 3LYKA 5B7CA 5IM9A 4YQMA 2IPAA 4IBPA 3VPQA 4HJ2A 3F4RA 4ECIA 2NPBA 1OC3A 1DE2A 3TKPA 1KBNA 2P5RA 2ZUPA 2PN8A 4CW9A 1ILOA 2MMZA 5HR3A 3FZAA 5J5NA 2JL4A 5H5RA 1DUGA 2AJQB 1C72A 2I9HA 4ACSA 3IE3A 2DIZA 3EU4A 5CREA 1TU8A 1AW9A 3I6AA 1R5PA 2GVPA 2HZFA 2VO4A 1XFLA 4N30A 1M2AA 2J23A 2GQLA 4XCSA 1GSEA 4KGIA 4HZ2A 2QGVA 3GN3A 2CV4A 4K8MA 2H6ZA 4OFNA 5H5QA 3FEUA 4LL4B 3VPTA 1PN9A 22GSA 2F3MA 2HXKA 3UJ1A 5IOXA 1ZOFA 2PU9C 14GSA 2YJHA 2R37A 2H70A 5KN1A 1O8WA 5AN1A 3LJRA 6GSUA 1BYEA 3EYTA 2YWMA 1U6TA 1S3AA 3KH7A 5F8BA 2DC5A 4MJEA 4NAXA 2EIRA 5L71A 1YJ6A 2GGTA 3TRXA 2AB6A 4JRRA 3C73A 4OCEA 1N8JA 2IFQA 4RQXA 1NW2A 1VF1A 1RQMA 5JWOB 3GMFA 2B1KA 3U5RE 1WWJA 3A2WA 3A5WA 1Y25A 1X5CA 2VLVA 2L57A 1GTUA 5B8BA 3GKKA 2DIYA 3LEFA 4FYBA 3M9KA 4TR1B 1IYIA 1AQWA 2O87A 1GSSA 2YOIA 3HVVA 2Z9SA 1HNCA 2CVKA 3CYNA 1GNWA 1EZKA 4PGTA 4EO3A 2GZZA 3O76A 4BL7A 2RM5A 4F9ZA 1FW1A 1PSQA 2DJ3A 2CVBA 2B5YA 4QL9A 3KM6A 1AC1A 3D22A 3VFIA 4JZQA 2AUVA 2DJJA 3FZ4A 3J7Yb 2IMEA 4EDZA 3V1WA 4V2NA 2FNOA 4TN8A 4GCIA 1OE7A 3GIXA 1GUMA 5CNWA 2H6XA 2YWOA 1SK0A 2V6KA 5D9XA 2H0GA 2H1DA 2RUEA 3E9JB 4RUVA 2BMXA 2B7JA 2DLXA 2DBCA 2V6OA 3ZZXA 4X0XA 3CSJA 5ECNB 3NOFA 3FR3A 1A0RP 2H30A 3HJMA 4IELA 5IMVA 3NZNA 6GSTA 5ECIB 3M0FA 1KTEA 3QD9A 1J0FA 4JBBA 1K0MA 1M9BA 2MZCA 3UEMA 5ECKB 2HT9A 2H73A 2FUG2 3I43A 3UVTA 4TR3A 3MDKA 3RPNA 5IMFA 1A24A 1GNEA 2GT5A 4X43A 1CQGA 3GSTA 4ISDA 5HR2A 1SD9A 5GAPD 2EIOA 1WIKA 2NVLA 4J56E 4GRFA 5A4UA 3LFLA 2IN3A 1FAAA 3PR8A 4TRXA 1O73A 2V41A 4MJCA 4O32A 1JHBA 5COHA 2VCTA 1G7OA 3GKXA 1ML6A 2WS2A 1F6MC 4V1Ap 5DAKB 4L5LA 5ABRA 3ZMLA 2LNTA 4ULXA 2F8AA 3APQA 2VCVA 3LG6A 2YJ7A 1T4ZA 1V9WA 4EE0A 3GUSA 4Q5QA 2VOCA 1XW9A 1M7TA 2GTUA 2YP6A 2JACA 2X8CA 3NIVA 2H6YA 5HQPA 5CRDA 4N10A 3KTBA 3UAPA 1GSDA 3DD3A 5J4UA 5INYA 5DJLA 2IL3A 2C0GA 5D9TA 2YZHA 5KN3A 5IMDA 3IK9A 2H1GA 5AGYA 2X99A 3KTLA 3RHBA 4WF4A 1F3BA 1SL0B 3D0ZA 3FKFA 3IK7A 2X8GA 2O85A 3GYKA 1OC8A 2TRXA 2LJKA 2H75A 2JZSA 5B8AA 2MYGA 1Z9HA 2GLRA 4D73B 3WD6A 3I9V2 10GSA 3L9SA 1U87A 3DRNA 4MCUA 1Z7PA 3ZTLA 1U3IA 2X8HA 3M3MA 1GUKA 2H76A 5G31A 3L4NA 4TVEA 4XS1A 3C7MA 4V1Ag 1ERVA 4I5QA 3QCPA 2R2JA 3F8UA 4MZBA 1FB0A 3A3TA 4OFMA 2BTOT 3E0UA 1X9WB 4N0ZA 3ZIJA 3HHVA 3ERWA 5HR0A 4AGSA 1WMJA 4JR6A 3WT1A 5DQSA 5J9CA 2WJUA 2HZEA 3TJGA 4XS4B 3F3RA 3PH9A 3RPPA 4KDUA 2F51A 3VI7A 3GRXA 1HNBA 3Q19A 4MF5A 1HQOA 1A2JA 2JU5A 4MP4A 1NHOA 4RI7A 3VWXA 4BVYA 1SKWB 5DALA 3P90A 2EIQA 3GURA 6GSXA 1TXXA 2R3XA 1XWCA 2NBSA 4WKWA 4WXTA 2WCIA 4FYCA 5ECMB 1Y6EA 3DYRA 3ZYWA 1YZXA 2PERA 4KCEA 2DMMA 4F2IA 3FR6A 2CT6A 5DVBA 3UIWA 3TJJA 4O5RA 5A5KA 3TOUA 2OACA 5B6NA 3UVHA 2LRCA 5FT3A 2PMTA 1FOVA 2VL9A 2GQKA 4E8HA 4IVFA 3DEXA 4JU5A 4PURA 1R5AA 5CYYA 4XRDA 1V98A 3UARA 3TUEA 3QFAC 2CZ3A 1T4YA 1E2YA 4G19A 1FHEA 3OR5A 2GS3A 2REMA 4POMA 5HFIA 4NHZA 3IAS2 2KP2A 4DSRA 1Z3EA 1MDKA 3K8NA 1UN2A 1TP9A 4ML1A 4QQ7A 1M2DA 2QKEA 3J7Yk 2MMOA 2VL2C 2B5EA 3H79A 1QGVA 3GTUB 4CHSA 3MAKA 4GQFA 2C0EA 3N5OA 3IR4A 3HVSA 2YN1A 1R7HA 2PUKC 3SWLA 5J3RA 2EC4A 2E2GA 2J9HA 1GUHA 1GTBA 3TDGA 4GTUA 4IW9A 5CRGA 3IBHA 4V2LA 1QMVA 5B6MA 2VL3A 4I2UA 1XW6A 3IOSA 2RIIA 3FYGA 4F03A 1UC7A 1A8YA 1XOAA 4TR1A 1K0AA 4IJIA 2R4VA 2P5QA 5E59A 2HNLA 4O92A 1QXHA 3WYWA 4KDXA 3U6VA 4KSOA 3US3A 3ZFBA 2PWJA 4JEDA 3CRUA 3FHKA 1EOGA 4ZBAA 1K0CA 3A2VA 4K0GA 3VLNA 3W8JA 3QFBC 3HY2A 5KN2A 2E2MA 4K7OA 4OCFA 3Q18A 1G0TA 3L9UA 5E4WA 1FVKA 3TKSC 3BJ5A 2GDRA 5DDLA 4MF6A 2PVQA 4WBRD 4HEA2 3AY8A 3PGTA 1F3AA 2ZNMA 4K1FA 1JZDA 2O8VB 1XW5A 2MMNA 1EEJA 1XVQA 2KOKA 1TK0B 4KCAA 3PINA 1VF3A 3LORA 1PKWA 1Z6MA 1K3OA 1TI1A 1X5DA 1U3AA 4FYUA 1BEDA 1BJXA 1GLPA 3IHQA 4BA7A 2LRTA 4IKHA 1ERTA 5HR1A 3W6GA 2H1AA 4XRAA 5G5FA 17GSA 3KXOA 1R26A 3DGQA 4MJAA 2H19A 4J2FA 4GSTA 1AQVA 5JCWA 5ELAA 4QL7A 2IMDA 3QR6A 2LV3A 4HUAA 3ZLPA 5IQYA 1PQNA 1CQHA 1DBYA 1SKRB 4HDEA 4AJ7A 5ID2B 2OE3A 2C0FA 2YCDA 3EE2A 3BBYA 5G5EA 1GL8A 1NHYA 2I81A 1XXUA 1YKAA 1XWGA 2O89A 1EEMA 3Q74A 4GXZA 5ENUA 5CP1A 3FRCA 3TKQA 2WZ9A 3EMXA 1B48A 4RI6A 2V1MA 20GSA 3GNJA 2LEGA 5DAKA 2KUCA 2OE0A 1Q98A 4XTSA 5D9WA 3E3EA 5ECSA 2KHPA 1GRXA 2I1UA 4HS1A 4NHWA 1SJ6A 2DJ0A 3W8SA 1YEPA 1UVZA 5FHIA 1MDIA 5G30A 4TXVA 4AJ6A 1TW9A 1A8LA 4MZWA 2TRCP 4PQ1A 2LQOA 1HD2A 1SYXA 2FWEA 4WR4A 5LNKe 2F8FA 5CO3A 3CTFA 4HOJA 4AF2A 1FB6A 4POKA 1G6YA 1SENA 4K0NA 4PUAA 1M99A 1G7EA 4HI7A 2OADA 2B5XA 3HXSA 3GKMA 1ZYEA 2OA7A 1K0NA 3L0HA 2P0GA 1V57A 3DIEA 3HDCA 4D73A 3VURA 3WGEA 1T1VA 1A23A 5DCHA 5F05A 1A0FA 4POLA 1O8XA 4N11A 2N5AA 4IP1A 2R5GA 1V2AA 4L8EA 3VK9A 2DJ2A 2A2SA 2LJAA 4LLRA 4EC0A 3M1GA 5CRHA 3ZVJD 6GSSA 18GSA 3LQ7A 3C1RA 4EXJA 1B4PA 2LJRA 4DSSB 3CMIA 1JFUA 1GTIA 1JZWA 2ON5A 1GP1A 2C8UA 3LXTA 5ECRB 3BCKA 3H8QA 1A2LA 3CXGA 4GSSA 4OO4A 2ES7A 3VWVA 1OYJA 3HZ8A 1R4WA 2VLUA 3IAM2 4KX4A 5G1LA 2GSRA 1FO5A 2HRNA 3GX8A 4HZ4A 2L6CA 4Q5NA 1XIYA 2VIMA 1K3LA 2WDUA 3P2AA 1XWAA 3VWWA 4MK3A 4AJ8A 4BPYA 1T00A 3A2XA 5AIXA 3D21A 3BD2A 4TKYA 4IHUA 1ON4A 1LBKA 4CDOA 1EV4A 1XPVA 1AXDA 1U88A 3ZL5A 5JWRB 4GWRA 1J08A 3GL5A 4I8BA 1QUWA 5KEJA 2LQQA 1VGLA 3P8WA 3L78A 1BG5A 4XHMA 4Q5FA 3F4TA 3IXRA 1YQ1A 2V32A 5IMZA 2LKUA 3KEBA 4NXIA 1V58A 2VCXA 2GSTA 3EU3A 2O7KA 3FY7A 1TKDB 1ERWA 1SL2B 3QMXA 3TOTA 1NSWA 3TJKA 4ZB6A 3UL3A 1THXA 2ZCTA 4YQVA 2L59A 1PMTA 1LU4A 3HJPA 4WEYA 3KP8A 1TRVA 1OC9B 4ZILA 2A4VA 2H71A 1TRUA 1AUCA 1WJKA 6GSWA 2DSAA 4FIWA 3F0IA 4MPFA 4ZBDA 1H4OA 2CAIA 4ZBBA 5GSTA 1T3BA 1E6BA 1ZCPA 1GLQA 3GFKA 2XPEA 3HKRA 1V40A 1YKCA 5IIZA 3EMPA 3LWAA 2AYTA 2NTOA 2C0DA 1USBA 1FVJA 2K8SA 1ABAA 2BJXA 3EVIA 5EVOA 2GZYA 5A4VA 2YWIA 2B6MA 4K6XA 2LNSA 4MPGA 2K18A 3Q6OA 1JZOA 3EURA 1Z6NA 5JCGA 1ZL9A 2IMKA 1UA5A 3IPZA 5AIVA 3TB2A 4ECBA 4KA0A 5C04A 1RK4A 3KMNA 3F6DA 2VAFA 5H5SA 1G6WA 3D6IA 4TXOB 4EF0A 2IJYA 2E7PA 3CRTA 4WETA 1T8EB 5AISA 4EVMA 1KEBA 2WB9A 3APOA 3FR9A 2OBIA 5IOWA 2CX3A 2HYXA 1XVWA 3HVXA 1ZMAA 4I2TA 4KSMA 3F6FA 1AQXA 3TCOA 4BWQA 3G7YA 4WF5A 4LMVA 2M72A 4V2MA 3CSIA 4PNGA 3UBLA 1AIUA 2L5OA 3KCMA 2FA8A 4OD7A 5GAND 4RQRA 4L0WA 1N2AA 3EC3A 3R2QA 3M8NA 3KP9A 4NV5A 4YH2A 3L9VA 4LL1B 2B7KA 1EP8A 5IMCA 2JSYA 4F0CA 3VI5A 5HFKA 1SYRA 1O85A 4Z7XA 4BWSA 4N0VA 3MSZA 13GSA 2CQ9A 1OKTA 4YAVA 4MDCA 1PGTA 5EPFA 1M0UA 1EOHA 5D96A 1JLWA 1SKSB 4G10A 3ED3A 5DALB 1XWBA 4KAEA 4IGJA 1TDIA 4JR4A 2PBJA 4ZB8A 2FA4A 2FD3A 4IQ1A 6GSVA 2GT6A 1Q4JA 4YAPA 3IRAA 5DJMA 4E8EA 2RM6A 1K0OA 2CAQA 1A2MA 3IA1A 1EV9A 2HSYA 1OAZA 1ACVA 2IMFA 4EUYA 2FCHA 3ZRDA 2FGXA 3H1NA 16GSA 3GL3A 3BCIA 3RHCA 2ALBA 2FY6A 1GH2A 1S3CA 1EP7A 1URMA 4MF7A 3O6TA 1EGOA 1JZRA 4MLYA 1MD4A 4HU9A 5DCGA 2B3SA 2X64A 2MBTA 1Z5YE 1VRSD 4LMWA 4TR0A 3TGZA 5FWGA 3QAGA 4ZB9A 2H0IA 4OFTA 2IWTA 1ZYQB 1I5GA 4JE1A 2XHFA 4KDYA 4DEJA 1OKDA 2DJKA 1MDJA 1GSYA 3TRPA 3FW2A 2JSZA 3RDWA 1TRSA 2G0FA 4WR5A 3UMAA 1K3YA 3ZFLA 2GSSA 1M2BA 4Q5RA 1TI3A 3F63A 2OE1A 4G9HA 3WGDA 3UBKA 3HCZA 4PNFA 5D9VA 3CSHA 3TKSE 1EGRA 3ERFA 5DQYA 1T7PB 5J9BA 3F3QA 3TKRA 3VWUA 1JLVA 2P31A 5EL8A 4DSSA 3D5JA 4NV2A 1SK2A 4GQCA 2DMLA 2RUFA 2KP1A 2PPTA 2H01A 3TRQA 2VM1A 2OKAA 6GSYA 5IO2A 3N9JA 4OWYA 4IN0A 1EWXA 5GSSA 1Z7RA 3JCML 1F2EA 1GSUA 4TOPA 3GH9A 9GSSA 4MJBA 1O7UA 2CA8A 1IYHA 2HFDA 1PX7A 4KB3A 2CX4A 4HQZA
chains in the Genus database with same CATH superfamily
2VL2A 2K6VA 2JADA 3DVWA 2TIRA 4EDYA 2L4CA 2H66A 2VM2A 2A4HA 4CY8A 4IS0A 3DWVA 4ZIJA 5G2ZA 3KD0A 4NMUA 2LTKA 5C00A 2GZPA 2CVDA 4O7HA 2AAWA 1M3JA 4GSNA 1W4VA 2E0QA 2R6KA 1YF0A 2F9SA 3CBUA 2WGRA 1DSBA 5ECOB 5KN0A 5ECLB 1B8XA 4KE3A 3TJBA 4I6XA 3LYPA 1RW1A 2KLXA 1ZYNA 2LS5A 4X1UA 3QOUA 1TTZA 4Z2RA 4ECCA 3F4SA 2C3TA 3KIJA 3O3TA 3ZVJA 4PTSA 5JWQB 2IFQB 2YPMA 1MTCA 2YV7A 3HD5A 3HJOA 1S3DA 3GA4A 1NM3A 2N5FA 1OC9A 2C1YA 1SJZA 2YANA 3APSA 2WFCA 5D73A 2V2GA 4OMVA 1WRYA 1TK8B 4ZL8A 3TKSA 1PX6A 4O5QA 1OVNA 4YQUA 4KNDA 3ZIVA 4XS4A 1PA3A 3KH9A 3FZ5A 2MBSA 3H4KA 3G7IA 1WE0A 3MNGA 3KGKA 1PRXA 3ERGA 3UOMA 4GLTA 4DSQA 2A2PA 3G9BA 5HFGA 4Z2UA 1OE8A 1BQ7A 2HRFA 5JCUA 5J41A 3ZITA 2XPDA 1ST9A 4K2XA 1XCCA 5IO0A 5LCZA 2YZUA 2RLIA 1PKZA 1K0BA 1H75A 3MYDA 4GF0A 3ME7A 1B9XC 2IMIA 2QSIA 11GSA 4DVCA 5EY6A 5BRTA 4K2DA 4PXOA 1HNAA 3QPMA 3QAWA 1QQ2A 2NDOA 2OJLA 19GSA 1PL1A 3HVNA 1ZZYA 2YNXA 4NPBA 3HYPA 1TRWA 2H1BA 2LSTA 4P3YB 1O6JA 2YV9A 4PUFC 2FHEA 3SBCA 2QC7A 1M9AA 1K0DA 2C3NA 5F06A 3LXZA 3C8EA 2AV4A 3GX0A 1X9MB 3D4MA 4TXOA 1BAYA 2XBIA 1MEKA 4ZL9A 1SL1B 3MWHA 1AAZA 8GSSA 4F0BA 3KJYA 3EINA 3C71A 5ECQB 3FMWA 5CRWA 4I97A 4MMMA 1SU9A 4ECJA 2HLSA 1M3IA 2FWGA 1GWCA 1BX9A 2YWNA 3C1SA 4MH2A 1KNGA 2LRNA 4ML6A 3QAVA 4TR4A 5D93A 4K7NA 2D2ZA 2H74A 1B9YC 3ISOA 1YY7A 3F9UA 4PQIA 1WPIA 5ECPB 1QK8A 2L6DA 4FH8A 1GSQA 2VD1A 3DXBA 2C4JA 3HA9A 4OO5A 1TK5B 3RAZA 3TJFA 3P7XA 1WOUA 1FG4A 2MMAA 2M46A 4XS6A 2FWHA 2N5BA 3DVXA 4PQHA 2ON7A 3GTUA 4XIHA 1I9DA 2L4QA 1X5EA 4POBA 1XZOA 4YKGA 2A2RA 1PD21 2VLTA 4F82A 4YKFA 3H93A 2H72A 1XOBA 2HI7A 3CTGA 4G2EA 1W89A 3BOAA 5IPHA 4KH7A 4ZXGA 2IIYA 1LJRA 3I69A 2VUPA 4EIQA 1F37A 4FO5A 3IC4A 5D8IA 3IDVA 4KUNA 1F9MA 1PL2A 1HYUA 2HSHA 2LUSA 4IP6A 4TW5A 2JZRA 3IV4A 1SJIA 3PPUA 2VCZA 3FZ9A 2FWFA 2K8VA 2CZ2A 3KMOA 4L5OA 1XG8A 2I4AA 1QFNA 4ID0A 3ME8A 4LA1A 1X9SB 3DMLA 2VD0A 3KZQA 2I3YA 2GQMA 5F07A 2M80A 4MH3A 1ERUA 2C3QA 4MZCA 5G1KA 3EWLA 5ELGA 2AHEA 4EKZA 2VCWA 1YDKA 1MD3A 12GSA 3GSSA 1DE1A 3GH6A 4CY6A 2H8LA 2C80A 3LSZA 5LD0A 4J57E 2R0CA 4WBJA 4MA9A 3HZ4A 2HZEB 1YF1A 4HU7A 2G2QA 2HE3A 4PX1A 3ZREA 5ECHB 1YEXA 1TJDA 3GKNA 1SD8A 3DKSA 1ZGNA 1J9BA 3FK8A 3RBTA 1B4QA 1TU7A 1O81A 4H86A 3M9JA 2XBQA 5IMAA 3GV1A 4EL1A 2VCQA 4K7IA 2H0HA 1XBSA 2K9FA 1SK1A 2DJ1A 1TOFA 2OBKA 4ZL7A 5IPGA 5ID2A 2L5LA 3G7JA 3WT2A 4BVXA 1VF2A 1GSFA 1GTAA 5F0GA 3WGXA 5GZZB 2GSQA 1VF4A 5A4WA 2WRTA 2XC2A 4K9ZA 4ILFA 2PGTA 2PVOC 2JZTA 1THOA 3GHAA 3D4TA 4L0UA 3LGCA 1GULA 2FLSA 1WP0A 1X0RA 7GSSA 4MABA 4KW6A 3QDNA 3S9FA 1XWKA 4IJ3A 5CAXA 5DBQA 3ZMKA 4NWYA 4HJMA 2WULA 4HQSA 4IQAA 2B1LA 3LYKA 5B7CA 5IM9A 4YQMA 2IPAA 4IBPA 3VPQA 4HJ2A 3F4RA 4ECIA 2NPBA 1OC3A 1DE2A 3TKPA 1KBNA 2P5RA 2ZUPA 2PN8A 4CW9A 1ILOA 2MMZA 5HR3A 3FZAA 5J5NA 2JL4A 5H5RA 1DUGA 2AJQB 1C72A 2I9HA 4ACSA 3IE3A 2DIZA 3EU4A 5CREA 1TU8A 1AW9A 3I6AA 1R5PA 2GVPA 2HZFA 2VO4A 1XFLA 4N30A 1M2AA 2J23A 2GQLA 4XCSA 1GSEA 4KGIA 4HZ2A 2QGVA 3GN3A 2CV4A 4K8MA 2H6ZA 4OFNA 5H5QA 3FEUA 4LL4B 3VPTA 1PN9A 22GSA 2F3MA 2HXKA 3LW9A 3UJ1A 5IOXA 1ZOFA 2PU9C 14GSA 2YJHA 2R37A 2H70A 5KN1A 1O8WA 5AN1A 3LJRA 6GSUA 1BYEA 3EYTA 2YWMA 1U6TA 1S3AA 3KH7A 5F8BA 2DC5A 4MJEA 4NAXA 2EIRA 5L71A 1YJ6A 2GGTA 3TRXA 2AB6A 4JRRA 3C73A 4OCEA 1N8JA 2IFQA 4RQXA 1NW2A 1VF1A 1RQMA 5JWOB 3IC8A 3GMFA 2B1KA 3U5RE 1WWJA 3A2WA 3A5WA 1Y25A 1X5CA 2VLVA 2L57A 1GTUA 5B8BA 4K5SA 3GKKA 2DIYA 3LEFA 4FYBA 3M9KA 4TR1B 1IYIA 1AQWA 2O87A 4G0IA 1GSSA 2YOIA 3HVVA 2Z9SA 1HNCA 2CVKA 3CYNA 1GNWA 1EZKA 4PGTA 4EO3A 2GZZA 3O76A 4BL7A 2RM5A 4F9ZA 1FW1A 1PSQA 2DJ3A 2CVBA 2B5YA 4QL9A 3KM6A 1AC1A 3D22A 3VFIA 4JZQA 2AUVA 2DJJA 3FZ4A 3J7Yb 2IMEA 4EDZA 3V1WA 4V2NA 2FNOA 4TN8A 4GCIA 1OE7A 3GIXA 1GUMA 5CNWA 2H6XA 2YWOA 1SK0A 2V6KA 5D9XA 2H0GA 2H1DA 2RUEA 3E9JB 4RUVA 2BMXA 2B7JA 2DLXA 4G0LA 2DBCA 2V6OA 3ZZXA 4X0XA 3CSJA 5ECNB 3NOFA 3FR3A 1A0RP 2H30A 3HJMA 4IELA 5IMVA 3NZNA 6GSTA 5ECIB 3M0FA 1KTEA 3QD9A 1J0FA 4JBBA 1K0MA 1M9BA 2MZCA 3UEMA 5ECKB 2HT9A 2H73A 2FUG2 3I43A 3UVTA 4TR3A 3MDKA 3RPNA 5IMFA 1A24A 1GNEA 2GT5A 4X43A 1CQGA 3GSTA 4ISDA 5HR2A 1SD9A 5GAPD 2EIOA 1WIKA 2NVLA 4J56E 4GRFA 5A4UA 3LFLA 2IN3A 1FAAA 3PR8A 4TRXA 1O73A 2V41A 4MJCA 4O32A 1JHBA 5COHA 2VCTA 1G7OA 3GKXA 1ML6A 2WS2A 1F6MC 4V1Ap 5DAKB 4L5LA 5ABRA 3ZMLA 2LNTA 4ULXA 2F8AA 3APQA 2VCVA 3LG6A 2YJ7A 1T4ZA 1V9WA 4EE0A 3GUSA 4Q5QA 2VOCA 1XW9A 1M7TA 2GTUA 3IHGA 2YP6A 2JACA 2X8CA 3NIVA 2H6YA 5HQPA 5CRDA 4N10A 3KTBA 3UAPA 1GSDA 3DD3A 5J4UA 5INYA 5DJLA 2IL3A 2C0GA 5D9TA 2YZHA 5KN3A 5IMDA 3IK9A 2H1GA 5AGYA 2X99A 3KTLA 3RHBA 4WF4A 1F3BA 1SL0B 3D0ZA 3FKFA 3IK7A 2X8GA 2O85A 3GYKA 1OC8A 2TRXA 2LJKA 2H75A 2JZSA 5B8AA 2MYGA 1Z9HA 2GLRA 4D73B 3WD6A 3I9V2 10GSA 4KF9A 3L9SA 1U87A 3DRNA 4MCUA 1Z7PA 3ZTLA 1U3IA 2X8HA 3M3MA 1GUKA 2H76A 5G31A 3L4NA 1FOHA 4TVEA 4XS1A 3C7MA 4V1Ag 1ERVA 4I5QA 3QCPA 2R2JA 3F8UA 4MZBA 1FB0A 4Z2TA 3A3TA 4OFMA 2BTOT 3E0UA 1X9WB 4N0ZA 3ZIJA 3HHVA 3ERWA 5HR0A 4O5UA 3A5IA 4AGSA 1WMJA 4JR6A 3WT1A 5DQSA 5J9CA 2WJUA 2HZEA 3TJGA 4XS4B 3F3RA 3PH9A 3RPPA 4KDUA 2F51A 3VI7A 3GRXA 1HNBA 3Q19A 4MF5A 1HQOA 3EPTA 1A2JA 2JU5A 4MP4A 1NHOA 4RI7A 3VWXA 2UZ8A 4BVYA 1SKWB 5DALA 3P90A 2EIQA 3GURA 6GSXA 1TXXA 2R3XA 1XWCA 2NBSA 4WKWA 4WXTA 2WCIA 4K5RA 4FYCA 5ECMB 1Y6EA 3DYRA 3ZYWA 1YZXA 2PERA 4KCEA 2DMMA 4F2IA 3FR6A 2CT6A 5DVBA 3UIWA 3TJJA 4MNNA 4O5RA 5A5KA 3TOUA 2OACA 5B6NA 3UVHA 2LRCA 5FT3A 2PMTA 1FOVA 2VL9A 2GQKA 4E8HA 4IVFA 3DEXA 4JU5A 4PURA 1R5AA 5CYYA 4XRDA 1V98A 3UARA 3TUEA 3QFAC 2CZ3A 1T4YA 1E2YA 4G19A 1FHEA 3OR5A 2GS3A 3CQFA 2REMA 4POMA 5HFIA 4NHZA 3IAS2 2KP2A 4DSRA 1Z3EA 1MDKA 3K8NA 1UN2A 1TP9A 4ML1A 4QQ7A 4BIKA 1M2DA 2QKEA 3J7Yk 2MMOA 2VL2C 2B5EA 3H79A 1QGVA 3GTUB 4CHSA 3MAKA 4GQFA 2C0EA 3N5OA 3IR4A 3HVSA 2YN1A 1R7HA 2PUKC 3SWLA 5J3RA 2EC4A 2E2GA 2J9HA 1GUHA 1GTBA 3TDGA 4GTUA 4IW9A 5CRGA 3IBHA 4V2LA 1QMVA 5B6MA 2VL3A 4I2UA 1XW6A 3IOSA 2RIIA 3FYGA 4F03A 1UC7A 1A8YA 1XOAA 4TR1A 4IJIA 1K0AA 2R4VA 2P5QA 5E59A 2HNLA 4O92A 1QXHA 3WYWA 4KDXA 3U6VA 4KSOA 3US3A 3ZFBA 2PWJA 4JEDA 4HSCX 3CRUA 3FHKA 1EOGA 4ZBAA 1K0CA 3A2VA 4K0GA 3VLNA 3W8JA 3QFBC 3HY2A 5KN2A 2E2MA 4K7OA 4OCFA 3Q18A 1G0TA 3L9UA 5E4WA 1FVKA 3TKSC 3BJ5A 2GDRA 5DDLA 4MF6A 2PVQA 4WBRD 4HEA2 3AY8A 3PGTA 1F3AA 2ZNMA 4K1FA 1JZDA 2O8VB 1XW5A 2MMNA 1EEJA 1XVQA 2KOKA 1TK0B 4KCAA 3PINA 1VF3A 3LORA 1PKWA 3MIXA 1Z6MA 1K3OA 1TI1A 1X5DA 1U3AA 4FYUA 1BEDA 1BJXA 1GLPA 3IHQA 4BA7A 2LRTA 4IKHA 1ERTA 5HR1A 3W6GA 2H1AA 4XRAA 5G5FA 17GSA 3KXOA 1R26A 3DGQA 4MJAA 2H19A 4J2FA 4GSTA 1AQVA 5JCWA 5ELAA 4QL7A 2IMDA 2QA2A 3QR6A 2LV3A 4HUAA 3ZLPA 5IQYA 1PQNA 1CQHA 1DBYA 1SKRB 4HDEA 4AJ7A 5ID2B 4BVXB 2OE3A 2C0FA 2YCDA 3EE2A 3BBYA 5G5EA 1GL8A 1NHYA 2I81A 1XXUA 1YKAA 1XWGA 2O89A 1EEMA 3Q74A 4GXZA 5ENUA 5KOWA 5CP1A 3FRCA 3TKQA 2WZ9A 3EMXA 1B48A 4RI6A 2V1MA 20GSA 3GNJA 2LEGA 5DAKA 2KUCA 2OE0A 1Q98A 4XTSA 5D9WA 3E3EA 2KHPA 5ECSA 1GRXA 2I1UA 4HS1A 4NHWA 1SJ6A 2DJ0A 3W8SA 1YEPA 1UVZA 5FHIA 1MDIA 2DKHA 5G30A 4TXVA 4AJ6A 1TW9A 1A8LA 4MZWA 2TRCP 4PQ1A 2LQOA 1HD2A 1SYXA 2FWEA 4WR4A 5LNKe 2F8FA 5CO3A 3CTFA 4HOJA 4AF2A 2QA1A 1FB6A 4POKA 1G6YA 1SENA 4K0NA 4PUAA 1M99A 1G7EA 4HI7A 2OADA 2B5XA 3HXSA 3GKMA 1ZYEA 2OA7A 1K0NA 3L0HA 2P0GA 1V57A 3DIEA 3HDCA 4D73A 3VURA 3WGEA 1T1VA 1A23A 5DCHA 5F05A 1A0FA 4POLA 4FQUA 1O8XA 4N11A 2HRKA 2N5AA 4IP1A 2R5GA 1V2AA 4L8EA 3VK9A 2DJ2A 2A2SA 2LJAA 4LLRA 4EC0A 3M1GA 5CRHA 3ZVJD 6GSSA 18GSA 3LQ7A 3C1RA 4EXJA 1B4PA 2LJRA 4DSSB 3CMIA 1JFUA 1GTIA 1JZWA 2ON5A 1GP1A 2C8UA 3LXTA 5ECRB 3BCKA 3H8QA 1A2LA 3CXGA 4GSSA 4OO4A 2ES7A 3VWVA 1OYJA 3HZ8A 1R4WA 2VLUA 3IAM2 4BL7B 4KX4A 5G1LA 2GSRA 1FO5A 2HRNA 3GX8A 4HZ4A 2L6CA 4Q5NA 1XIYA 2VIMA 1K3LA 2WDUA 3P2AA 1XWAA 3VWWA 4MK3A 4AJ8A 4BPYA 1T00A 3A2XA 5AIXA 3D21A 3BD2A 4TKYA 4IHUA 1ON4A 1LBKA 4CDOA 1EV4A 1XPVA 1AXDA 1U88A 3ZL5A 5JWRB 4GWRA 1J08A 3GL5A 4I8BA 1QUWA 5KEJA 2LQQA 1VGLA 3P8WA 3L78A 1BG5A 1PFOA 4XHMA 4Q5FA 3F4TA 3IXRA 1YQ1A 2V32A 5IMZA 2HSMA 2LKUA 3KEBA 4NXIA 1V58A 2R0PA 2VCXA 2GSTA 3EU3A 2O7KA 3FY7A 1TKDB 1ERWA 1SL2B 3QMXA 3TOTA 1NSWA 3TJKA 4ZB6A 3UL3A 2X49A 1THXA 2ZCTA 4YQVA 2L59A 1PMTA 1LU4A 3HJPA 4WEYA 3KP8A 1TRVA 1OC9B 4ZILA 2A4VA 2H71A 1TRUA 1AUCA 1WJKA 6GSWA 2DSAA 4FIWA 3F0IA 4MPFA 4ZBDA 1H4OA 2CAIA 4ZBBA 5GSTA 1T3BA 1E6BA 1ZCPA 1GLQA 3GFKA 2XPEA 3HKRA 1V40A 1YKCA 5IIZA 3EMPA 3LWAA 4A5PA 2AYTA 2NTOA 2C0DA 1USBA 1FVJA 2K8SA 1ABAA 2BJXA 3EVIA 5EVOA 2GZYA 5A4VA 2YWIA 2B6MA 4K6XA 2HRAA 2LNSA 4MPGA 4X4JA 2K18A 3R3EA 3Q6OA 1JZOA 3EURA 1Z6NA 5JCGA 1ZL9A 2IMKA 1UA5A 3IPZA 5AIVA 3TB2A 2R0GA 4ECBA 4KA0A 5C04A 1RK4A 3KMNA 3F6DA 2VAFA 5H5SA 1G6WA 3D6IA 4TXOB 2X4AA 4EF0A 2IJYA 2E7PA 3CRTA 4WETA 1T8EB 5AISA 4EVMA 1KEBA 2WB9A 3APOA 3FR9A 2OBIA 5IOWA 2CX3A 2HYXA 1XVWA 3HVXA 1ZMAA 4I2TA 4KSMA 3F6FA 1AQXA 3TCOA 4BWQA 3G7YA 4WF5A 4ICYA 4LMVA 2M72A 4V2MA 3CSIA 4PNGA 3UBLA 1AIUA 2L5OA 3KCMA 2FA8A 4OD7A 5GAND 4RQRA 4L0WA 1N2AA 3EC3A 3R2QA 3M8NA 3KP9A 4NV5A 4YH2A 3L9VA 4LL1B 2B7KA 1EP8A 5IMCA 2JSYA 4F0CA 3VI5A 5HFKA 1SYRA 1O85A 4Z7XA 4BWSA 4N0VA 3MSZA 13GSA 2CQ9A 1OKTA 4YAVA 4MDCA 1PGTA 5EPFA 1M0UA 1EOHA 5D96A 1JLWA 1SKSB 4G10A 4BVYB 3ED3A 5DALB 1XWBA 4KAEA 4IGJA 1TDIA 4JR4A 2PBJA 4ZB8A 2FA4A 2FD3A 4IQ1A 6GSVA 2GT6A 1Q4JA 5BMUA 4YAPA 3IRAA 5DJMA 4E8EA 2RM6A 1K0OA 2CAQA 4G0KA 1A2MA 3IA1A 1EV9A 2HSYA 1OAZA 1S3RA 1ACVA 2IMFA 4EIPA 4EUYA 2FCHA 3ZRDA 2FGXA 3H1NA 16GSA 3GL3A 1PN0A 3BCIA 3RHCA 2ALBA 2FY6A 1GH2A 1S3CA 1EP7A 1URMA 4MF7A 3O6TA 1EGOA 1JZRA 4MLYA 1MD4A 4HU9A 4USSA 5DCGA 2B3SA 2X64A 2MBTA 1Z5YE 1VRSD 1ZYPA 4LMWA 4TR0A 3TGZA 5FWGA 3QAGA 4ZB9A 2H0IA 4OFTA 2IWTA 1ZYQB 1I5GA 4JE1A 2XHFA 4KDYA 4DEJA 1OKDA 2DJKA 1MDJA 1GSYA 3TRPA 3FW2A 2JSZA 3RDWA 1TRSA 2G0FA 4WR5A 3UMAA 1K3YA 3ZFLA 2GSSA 1M2BA 4Q5RA 1TI3A 3F63A 2OE1A 4G9HA 3WGDA 3UBKA 3HCZA 4PNFA 5D9VA 3CSHA 3TKSE 1EGRA 3ERFA 5DQYA 1T7PB 5J9BA 3F3QA 3TKRA 3VWUA 1JLVA 2P31A 5EL8A 4DSSA 3D5JA 4NV2A 1SK2A 4GQCA 2DMLA 2RUFA 2KP1A 2PPTA 2DKIA 2H01A 3TRQA 2VM1A 5KOXA 2OKAA 6GSYA 5IO2A 3N9JA 4OWYA 4IN0A 1EWXA 5GSSA 1Z7RA 3JCML 1F2EA 1GSUA 4TOPA 3GH9A 9GSSA 4MJBA 1O7UA 2CA8A 1IYHA 2HFDA 1PX7A 4KB3A 2CX4A 4HQZA
chains in the Genus database with same CATH topology
2VL2A 2K6VA 2JADA 3DVWA 2TIRA 4EDYA 2L4CA 2H66A 2VM2A 2A4HA 4CY8A 4IS0A 3DWVA 4ZIJA 5G2ZA 3KD0A 4NMUA 2LTKA 5C00A 2GZPA 2CVDA 4O7HA 2AAWA 4GSNA 1W4VA 2E0QA 2R6KA 1YF0A 2F9SA 3CBUA 2WGRA 1DSBA 5ECOB 5KN0A 5ECLB 1B8XA 4KE3A 3TJBA 4I6XA 3LYPA 1RW1A 2KLXA 1ZYNA 2LS5A 4X1UA 3QOUA 1TTZA 4Z2RA 4ECCA 3F4SA 2C3TA 3KIJA 3O3TA 3ZVJA 4PTSA 5JWQB 2IFQB 2YPMA 1MTCA 2YV7A 3HD5A 3HJOA 1S3DA 3GA4A 1NM3A 2N5FA 1OC9A 2C1YA 1SJZA 2YANA 3APSA 2WFCA 5D73A 2V2GA 4OMVA 1WRYA 1TK8B 4ZL8A 3TKSA 1PX6A 4O5QA 1OVNA 4YQUA 4KNDA 3ZIVA 4XS4A 1PA3A 3KH9A 3FZ5A 2MBSA 3H4KA 3G7IA 1WE0A 3MNGA 3KGKA 1PRXA 3ERGA 3UOMA 4GLTA 4DSQA 2A2PA 3G9BA 5HFGA 4Z2UA 1OE8A 1BQ7A 2HRFA 5JCUA 5J41A 3ZITA 2XPDA 1ST9A 4K2XA 1XCCA 5IO0A 5LCZA 2YZUA 2RLIA 1PKZA 1K0BA 1H75A 3MYDA 4GF0A 3ME7A 1B9XC 2IMIA 2QSIA 11GSA 4DVCA 5EY6A 5BRTA 4K2DA 4PXOA 1HNAA 3QPMA 3QAWA 1QQ2A 2NDOA 2OJLA 19GSA 1PL1A 1ZZYA 2YNXA 4NPBA 3HYPA 1TRWA 2H1BA 2LSTA 4P3YB 1O6JA 2YV9A 4PUFC 2FHEA 3SBCA 2QC7A 1M9AA 1K0DA 2C3NA 5F06A 3LXZA 3C8EA 2AV4A 3GX0A 1X9MB 3D4MA 4TXOA 1BAYA 2XBIA 1MEKA 4ZL9A 1SL1B 3MWHA 1AAZA 8GSSA 4F0BA 3KJYA 3EINA 3C71A 5ECQB 3FMWA 5CRWA 4I97A 4MMMA 1SU9A 4ECJA 2HLSA 2FWGA 1GWCA 1BX9A 2YWNA 3C1SA 4MH2A 1KNGA 2LRNA 4ML6A 3QAVA 4TR4A 5D93A 4K7NA 2D2ZA 2H74A 1B9YC 3ISOA 1YY7A 3F9UA 4PQIA 1WPIA 5ECPB 1QK8A 2L6DA 4FH8A 1GSQA 2VD1A 3DXBA 2C4JA 3HA9A 4OO5A 1TK5B 3RAZA 3TJFA 3P7XA 1WOUA 1FG4A 2MMAA 2M46A 4XS6A 2FWHA 2N5BA 3DVXA 4PQHA 2ON7A 3GTUA 4XIHA 1I9DA 2L4QA 1X5EA 4POBA 1XZOA 4YKGA 2A2RA 1PD21 2VLTA 4F82A 4YKFA 3H93A 2H72A 1XOBA 2HI7A 3CTGA 4G2EA 1W89A 3BOAA 5IPHA 4KH7A 4ZXGA 2IIYA 1LJRA 3I69A 2VUPA 4EIQA 1F37A 4FO5A 3IC4A 5D8IA 3IDVA 4KUNA 1F9MA 1PL2A 1HYUA 2HSHA 2LUSA 4IP6A 4TW5A 2JZRA 3IV4A 1SJIA 3PPUA 2VCZA 3FZ9A 2FWFA 2K8VA 2CZ2A 3KMOA 4L5OA 2I4AA 1QFNA 4ID0A 3ME8A 4LA1A 1X9SB 3DMLA 2VD0A 3KZQA 2I3YA 2GQMA 5F07A 2M80A 4MH3A 1ERUA 2C3QA 4MZCA 5G1KA 3EWLA 5ELGA 2AHEA 4EKZA 2VCWA 1YDKA 1MD3A 12GSA 3GSSA 1DE1A 3GH6A 4CY6A 2H8LA 2C80A 3LSZA 5LD0A 4J57E 2R0CA 4WBJA 4MA9A 3HZ4A 2HZEB 1YF1A 4HU7A 2G2QA 2HE3A 4PX1A 3ZREA 5ECHB 1YEXA 1TJDA 3GKNA 1SD8A 3DKSA 1ZGNA 1J9BA 3FK8A 3RBTA 1B4QA 1TU7A 1O81A 4H86A 3M9JA 2XBQA 5IMAA 3GV1A 4EL1A 2VCQA 4K7IA 2H0HA 1XBSA 2K9FA 1SK1A 2DJ1A 1TOFA 2OBKA 4ZL7A 5IPGA 5ID2A 2L5LA 3G7JA 3WT2A 4BVXA 1VF2A 1GSFA 1GTAA 5F0GA 3WGXA 5GZZB 2GSQA 1VF4A 5A4WA 2WRTA 2XC2A 4K9ZA 4ILFA 2PGTA 2PVOC 2JZTA 1THOA 3GHAA 3D4TA 4L0UA 3LGCA 1GULA 2FLSA 1WP0A 1X0RA 7GSSA 4MABA 4KW6A 3QDNA 3S9FA 1XWKA 4IJ3A 5CAXA 5DBQA 3ZMKA 4NWYA 4HJMA 2WULA 4HQSA 4IQAA 2B1LA 3LYKA 5B7CA 5IM9A 4YQMA 2IPAA 4IBPA 3VPQA 4HJ2A 3F4RA 4ECIA 2NPBA 1OC3A 1DE2A 3TKPA 1KBNA 2P5RA 2ZUPA 2PN8A 4CW9A 1ILOA 2MMZA 5HR3A 3FZAA 5J5NA 2JL4A 5H5RA 1DUGA 2AJQB 1C72A 2I9HA 4ACSA 3IE3A 2DIZA 3EU4A 5CREA 1TU8A 1AW9A 3I6AA 1R5PA 2GVPA 2HZFA 2VO4A 1XFLA 4N30A 1M2AA 2J23A 2GQLA 4XCSA 1GSEA 4KGIA 4HZ2A 2QGVA 3GN3A 2CV4A 4K8MA 2H6ZA 4OFNA 5H5QA 3FEUA 4LL4B 3VPTA 1PN9A 22GSA 2F3MA 2HXKA 3LW9A 3UJ1A 5IOXA 1ZOFA 2PU9C 14GSA 2YJHA 2R37A 2H70A 5KN1A 1O8WA 5AN1A 3LJRA 6GSUA 1BYEA 3EYTA 2YWMA 1U6TA 1S3AA 3KH7A 5F8BA 2DC5A 4MJEA 4NAXA 2EIRA 5L71A 1YJ6A 2GGTA 3TRXA 2AB6A 4JRRA 3C73A 4OCEA 1N8JA 2IFQA 4RQXA 1NW2A 1VF1A 1RQMA 5JWOB 3IC8A 3GMFA 2B1KA 3U5RE 1WWJA 3A2WA 3A5WA 1Y25A 1X5CA 2VLVA 2L57A 1GTUA 5B8BA 4K5SA 3GKKA 2DIYA 3LEFA 4FYBA 3M9KA 4TR1B 1IYIA 1AQWA 2O87A 4G0IA 1GSSA 2YOIA 3HVVA 2Z9SA 1HNCA 2CVKA 3CYNA 1GNWA 1EZKA 4PGTA 4EO3A 2GZZA 3O76A 4BL7A 2RM5A 4F9ZA 1FW1A 1PSQA 2DJ3A 2CVBA 2B5YA 4QL9A 3KM6A 1AC1A 3D22A 3VFIA 4JZQA 2AUVA 2DJJA 3FZ4A 3J7Yb 2IMEA 4EDZA 3V1WA 4V2NA 2FNOA 4TN8A 4GCIA 1OE7A 3GIXA 1GUMA 5CNWA 2H6XA 2YWOA 1SK0A 2V6KA 5D9XA 2H0GA 2H1DA 2RUEA 3E9JB 4RUVA 2BMXA 2B7JA 2DLXA 4G0LA 2DBCA 2V6OA 3ZZXA 4X0XA 3CSJA 5ECNB 3NOFA 3FR3A 1A0RP 2H30A 3HJMA 4IELA 5IMVA 3NZNA 6GSTA 5ECIB 3M0FA 1KTEA 3QD9A 1J0FA 4JBBA 1K0MA 1M9BA 2MZCA 3UEMA 5ECKB 2HT9A 2H73A 2FUG2 3I43A 3UVTA 4TR3A 3MDKA 3RPNA 5IMFA 1A24A 1GNEA 2GT5A 4X43A 1CQGA 3GSTA 4ISDA 5HR2A 1SD9A 5GAPD 2EIOA 1WIKA 2NVLA 4J56E 4GRFA 5A4UA 3LFLA 2IN3A 1FAAA 3PR8A 4TRXA 1O73A 2V41A 4MJCA 4O32A 1JHBA 5COHA 2VCTA 1G7OA 3GKXA 1ML6A 2WS2A 1F6MC 4V1Ap 5DAKB 4L5LA 5ABRA 3ZMLA 2LNTA 4ULXA 2F8AA 3APQA 2VCVA 3LG6A 2YJ7A 1T4ZA 1V9WA 4EE0A 3GUSA 4Q5QA 2VOCA 1XW9A 1M7TA 2GTUA 3IHGA 2YP6A 2JACA 2X8CA 3NIVA 2H6YA 5HQPA 5CRDA 4N10A 3KTBA 3UAPA 1GSDA 3DD3A 5J4UA 5INYA 5DJLA 2IL3A 2C0GA 5D9TA 2YZHA 5KN3A 5IMDA 3IK9A 2H1GA 5AGYA 2X99A 3KTLA 3RHBA 4WF4A 1F3BA 1SL0B 3D0ZA 3FKFA 3IK7A 2X8GA 2O85A 3GYKA 1OC8A 2TRXA 2LJKA 2H75A 2JZSA 5B8AA 2MYGA 1Z9HA 2GLRA 4D73B 3WD6A 3I9V2 10GSA 4KF9A 3L9SA 1U87A 3DRNA 4MCUA 1Z7PA 3ZTLA 1U3IA 2X8HA 3M3MA 1GUKA 2H76A 5G31A 3L4NA 1FOHA 4TVEA 4XS1A 3C7MA 4V1Ag 1ERVA 4I5QA 3QCPA 2R2JA 3F8UA 4MZBA 1FB0A 4Z2TA 3A3TA 4OFMA 2BTOT 3E0UA 1X9WB 4N0ZA 3ZIJA 3HHVA 3ERWA 5HR0A 4O5UA 3A5IA 4AGSA 1WMJA 4JR6A 3WT1A 5DQSA 5J9CA 2WJUA 2HZEA 3TJGA 4XS4B 3F3RA 3PH9A 3RPPA 4KDUA 2F51A 3VI7A 3GRXA 1HNBA 3Q19A 4MF5A 1HQOA 3EPTA 1A2JA 2JU5A 4MP4A 1NHOA 4RI7A 3VWXA 2UZ8A 4BVYA 1SKWB 5DALA 3P90A 2EIQA 3GURA 6GSXA 1TXXA 2R3XA 1XWCA 2NBSA 4WKWA 4WXTA 2WCIA 4K5RA 4FYCA 5ECMB 1Y6EA 3DYRA 3ZYWA 1YZXA 2PERA 4KCEA 2DMMA 4F2IA 3FR6A 2CT6A 5DVBA 3UIWA 3TJJA 4MNNA 4O5RA 5A5KA 3TOUA 2OACA 5B6NA 3UVHA 2LRCA 5FT3A 2PMTA 1FOVA 2VL9A 2GQKA 4E8HA 4IVFA 3DEXA 4JU5A 4PURA 1R5AA 5CYYA 4XRDA 1V98A 3UARA 3TUEA 3QFAC 2CZ3A 1T4YA 1E2YA 4G19A 1FHEA 3OR5A 2GS3A 2REMA 4POMA 5HFIA 4NHZA 3IAS2 2KP2A 4DSRA 1Z3EA 1MDKA 3K8NA 1UN2A 1TP9A 4ML1A 4QQ7A 1M2DA 2QKEA 3J7Yk 2MMOA 2VL2C 2B5EA 3H79A 1QGVA 3GTUB 4CHSA 3MAKA 4GQFA 2C0EA 3N5OA 3IR4A 3HVSA 2YN1A 1R7HA 2PUKC 3SWLA 5J3RA 2EC4A 2E2GA 2J9HA 1GUHA 1GTBA 3TDGA 4GTUA 4IW9A 5CRGA 3IBHA 4V2LA 1QMVA 5B6MA 2VL3A 4I2UA 1XW6A 3IOSA 2RIIA 3FYGA 4F03A 1UC7A 1A8YA 1XOAA 4TR1A 4IJIA 1K0AA 2R4VA 2P5QA 5E59A 2HNLA 4O92A 1QXHA 3WYWA 4KDXA 3U6VA 4KSOA 3US3A 3ZFBA 2PWJA 4JEDA 3CRUA 3FHKA 1EOGA 4ZBAA 1K0CA 3A2VA 4K0GA 3VLNA 3W8JA 3QFBC 3HY2A 5KN2A 2E2MA 4K7OA 4OCFA 3Q18A 1G0TA 3L9UA 5E4WA 1FVKA 3TKSC 3BJ5A 2GDRA 5DDLA 4MF6A 2PVQA 4WBRD 4HEA2 3AY8A 3PGTA 1F3AA 2ZNMA 4K1FA 1JZDA 2O8VB 1XW5A 2MMNA 1EEJA 1XVQA 2KOKA 1TK0B 4KCAA 3PINA 1VF3A 3LORA 1PKWA 3MIXA 1Z6MA 1K3OA 1TI1A 1X5DA 1U3AA 4FYUA 1BEDA 1BJXA 1GLPA 3IHQA 4BA7A 2LRTA 4IKHA 1ERTA 5HR1A 3W6GA 2H1AA 4XRAA 5G5FA 17GSA 3KXOA 1R26A 3DGQA 4MJAA 2H19A 4J2FA 4GSTA 1AQVA 5JCWA 5ELAA 4QL7A 2IMDA 2QA2A 3QR6A 2LV3A 4HUAA 3ZLPA 5IQYA 1PQNA 1CQHA 1DBYA 1SKRB 4HDEA 4AJ7A 5ID2B 4BVXB 2OE3A 2C0FA 2YCDA 3EE2A 3BBYA 5G5EA 1GL8A 1NHYA 2I81A 1XXUA 1YKAA 1XWGA 2O89A 1EEMA 3Q74A 4GXZA 5ENUA 5KOWA 5CP1A 3FRCA 3TKQA 2WZ9A 3EMXA 1B48A 4RI6A 2V1MA 20GSA 3GNJA 2LEGA 5DAKA 2KUCA 2OE0A 1Q98A 4XTSA 5D9WA 3E3EA 2KHPA 5ECSA 1GRXA 2I1UA 4HS1A 4NHWA 1SJ6A 2DJ0A 3W8SA 1YEPA 1UVZA 5FHIA 1MDIA 2DKHA 5G30A 4TXVA 4AJ6A 1TW9A 1A8LA 4MZWA 2TRCP 4PQ1A 2LQOA 1HD2A 1SYXA 2FWEA 4WR4A 5LNKe 2F8FA 5CO3A 3CTFA 4HOJA 4AF2A 2QA1A 1FB6A 4POKA 1G6YA 1SENA 4K0NA 4PUAA 1M99A 1G7EA 4HI7A 2OADA 2B5XA 3HXSA 3GKMA 1ZYEA 2OA7A 1K0NA 3L0HA 2P0GA 1V57A 3DIEA 3HDCA 4D73A 3VURA 3WGEA 1T1VA 1A23A 5DCHA 5F05A 1A0FA 4POLA 4FQUA 1O8XA 4N11A 2HRKA 2N5AA 4IP1A 2R5GA 1V2AA 4L8EA 3VK9A 2DJ2A 2A2SA 2LJAA 4LLRA 4EC0A 3M1GA 5CRHA 3ZVJD 6GSSA 18GSA 3LQ7A 3C1RA 4EXJA 1B4PA 2LJRA 4DSSB 3CMIA 1JFUA 1GTIA 1JZWA 2ON5A 1GP1A 2C8UA 3LXTA 5ECRB 3BCKA 3H8QA 1A2LA 3CXGA 4GSSA 4OO4A 2ES7A 3VWVA 1OYJA 3HZ8A 1R4WA 2VLUA 3IAM2 4BL7B 4KX4A 5G1LA 2GSRA 1FO5A 2HRNA 3GX8A 4HZ4A 2L6CA 4Q5NA 1XIYA 2VIMA 1K3LA 2WDUA 3P2AA 1XWAA 3VWWA 4MK3A 4AJ8A 4BPYA 1T00A 3A2XA 5AIXA 3D21A 3BD2A 4TKYA 4IHUA 1ON4A 1LBKA 4CDOA 1EV4A 1XPVA 1AXDA 1U88A 3ZL5A 5JWRB 4GWRA 1J08A 3GL5A 4I8BA 1QUWA 5KEJA 2LQQA 1VGLA 3P8WA 3L78A 1BG5A 4XHMA 4Q5FA 3F4TA 3IXRA 1YQ1A 2V32A 5IMZA 2HSMA 2LKUA 3KEBA 4NXIA 1V58A 2R0PA 2VCXA 2GSTA 3EU3A 2O7KA 3FY7A 1TKDB 1ERWA 1SL2B 3QMXA 3TOTA 1NSWA 3TJKA 4ZB6A 3UL3A 2X49A 1THXA 2ZCTA 4YQVA 2L59A 1PMTA 1LU4A 3HJPA 4WEYA 3KP8A 1TRVA 1OC9B 4ZILA 2A4VA 2H71A 1TRUA 1AUCA 1WJKA 6GSWA 2DSAA 4FIWA 3F0IA 4MPFA 4ZBDA 1H4OA 2CAIA 4ZBBA 5GSTA 1T3BA 1E6BA 1ZCPA 1GLQA 3GFKA 2XPEA 3HKRA 1V40A 1YKCA 5IIZA 3EMPA 3LWAA 4A5PA 2AYTA 2NTOA 2C0DA 1USBA 1FVJA 2K8SA 1ABAA 2BJXA 3EVIA 5EVOA 2GZYA 5A4VA 2YWIA 2B6MA 4K6XA 2HRAA 2LNSA 4MPGA 4X4JA 2K18A 3R3EA 3Q6OA 1JZOA 3EURA 1Z6NA 5JCGA 1ZL9A 2IMKA 1UA5A 3IPZA 5AIVA 3TB2A 2R0GA 4ECBA 4KA0A 5C04A 1RK4A 3KMNA 3F6DA 2VAFA 5H5SA 1G6WA 3D6IA 4TXOB 2X4AA 4EF0A 2IJYA 2E7PA 3CRTA 4WETA 1T8EB 5AISA 4EVMA 1KEBA 2WB9A 3APOA 3FR9A 2OBIA 5IOWA 2CX3A 2HYXA 1XVWA 3HVXA 1ZMAA 4I2TA 4KSMA 3F6FA 1AQXA 3TCOA 4BWQA 3G7YA 4WF5A 4ICYA 4LMVA 2M72A 4V2MA 3CSIA 4PNGA 3UBLA 1AIUA 2L5OA 3KCMA 2FA8A 4OD7A 5GAND 4RQRA 4L0WA 1N2AA 3EC3A 3R2QA 3M8NA 3KP9A 4NV5A 4YH2A 3L9VA 4LL1B 2B7KA 1EP8A 5IMCA 2JSYA 4F0CA 3VI5A 5HFKA 1SYRA 1O85A 4Z7XA 4BWSA 4N0VA 3MSZA 13GSA 2CQ9A 1OKTA 4YAVA 4MDCA 1PGTA 5EPFA 1M0UA 1EOHA 5D96A 1JLWA 1SKSB 4G10A 4BVYB 3ED3A 5DALB 1XWBA 4KAEA 4IGJA 1TDIA 4JR4A 2PBJA 4ZB8A 2FA4A 2FD3A 4IQ1A 6GSVA 2GT6A 1Q4JA 5BMUA 4YAPA 3IRAA 5DJMA 4E8EA 2RM6A 1K0OA 2CAQA 4G0KA 1A2MA 3IA1A 1EV9A 2HSYA 1OAZA 1ACVA 2IMFA 4EIPA 4EUYA 2FCHA 3ZRDA 2FGXA 3H1NA 16GSA 3GL3A 1PN0A 3BCIA 3RHCA 2ALBA 2FY6A 1GH2A 1S3CA 1EP7A 1URMA 4MF7A 3O6TA 1EGOA 1JZRA 4MLYA 1MD4A 4HU9A 4USSA 5DCGA 2B3SA 2X64A 2MBTA 1Z5YE 1VRSD 1ZYPA 4LMWA 4TR0A 3TGZA 5FWGA 3QAGA 4ZB9A 2H0IA 4OFTA 2IWTA 1ZYQB 1I5GA 4JE1A 2XHFA 4KDYA 4DEJA 1OKDA 2DJKA 1MDJA 1GSYA 3TRPA 3FW2A 2JSZA 3RDWA 1TRSA 2G0FA 4WR5A 3UMAA 1K3YA 3ZFLA 2GSSA 1M2BA 4Q5RA 1TI3A 3F63A 2OE1A 4G9HA 3WGDA 3UBKA 3HCZA 4PNFA 5D9VA 3CSHA 3TKSE 1EGRA 3ERFA 5DQYA 1T7PB 5J9BA 3F3QA 3TKRA 3VWUA 1JLVA 2P31A 5EL8A 4DSSA 3D5JA 4NV2A 1SK2A 4GQCA 2DMLA 2RUFA 2KP1A 2PPTA 2DKIA 2H01A 3TRQA 2VM1A 5KOXA 2OKAA 6GSYA 5IO2A 3N9JA 4OWYA 4IN0A 1EWXA 5GSSA 1Z7RA 3JCML 1F2EA 1GSUA 4TOPA 3GH9A 9GSSA 4MJBA 1O7UA 2CA8A 1IYHA 2HFDA 1PX7A 4KB3A 2CX4A 4HQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL2 A;  2K6V A;  2JAD A;  3DVW A;  2TIR A;  4EDY A;  2L4C A;  2H66 A;  2VM2 A;  4IS0 A;  3DWV A;  4ZIJ A;  5G2Z A;  3KD0 A;  4NMU A;  2LTK A;  5C00 A;  2GZP A;  2CVD A;  4O7H A;  2AAW A;  4GSN A;  1W4V A;  2E0Q A;  2R6K A;  1YF0 A;  2F9S A;  3CBU A;  2WGR A;  1DSB A;  5ECO B;  5KN0 A;  5ECL B;  1B8X A;  4KE3 A;  3TJB A;  4I6X A;  3LYP A;  1RW1 A;  2KLX A;  2LS5 A;  4X1U A;  3QOU A;  1TTZ A;  4ECC A;  3F4S A;  2C3T A;  3KIJ A;  3O3T A;  3ZVJ A;  5JWQ B;  2IFQ B;  2YPM A;  1MTC A;  2YV7 A;  3HD5 A;  3HJO A;  1S3D A;  3GA4 A;  1NM3 A;  2N5F A;  1OC9 A;  2C1Y A;  1SJZ A;  2YAN A;  3APS A;  2WFC A;  5D73 A;  2V2G A;  4OMV A;  1WRY A;  1TK8 B;  4ZL8 A;  3TKS A;  1PX6 A;  1OVN A;  4YQU A;  4KND A;  3ZIV A;  4XS4 A;  1PA3 A;  3KH9 A;  3FZ5 A;  2MBS A;  3H4K A;  3G7I A;  1WE0 A;  3MNG A;  3KGK A;  1PRX A;  3ERG A;  3UOM A;  4GLT A;  4DSQ A;  3G9B A;  5HFG A;  1OE8 A;  1BQ7 A;  2HRF A;  5JCU A;  5J41 A;  3ZIT A;  2XPD A;  1ST9 A;  1XCC A;  5IO0 A;  5LCZ A;  2YZU A;  2RLI A;  1PKZ A;  1K0B A;  1H75 A;  4GF0 A;  3ME7 A;  1B9X C;  2IMI A;  2QSI A;  11GS A;  4DVC A;  5EY6 A;  4K2D A;  4PXO A;  1HNA A;  3QPM A;  3QAW A;  1QQ2 A;  2NDO A;  2OJL A;  19GS A;  1PL1 A;  1ZZY A;  2YNX A;  4NPB A;  3HYP A;  1TRW A;  2H1B A;  2LST A;  4P3Y B;  1O6J A;  2YV9 A;  4PUF C;  2FHE A;  3SBC A;  2QC7 A;  1M9A A;  1K0D A;  2C3N A;  5F06 A;  3LXZ A;  3C8E A;  2AV4 A;  3GX0 A;  1X9M B;  3D4M A;  4TXO A;  1BAY A;  2XBI A;  1MEK A;  4ZL9 A;  1SL1 B;  3MWH A;  1AAZ A;  8GSS A;  4F0B A;  3KJY A;  3EIN A;  3C71 A;  5ECQ B;  5CRW A;  4I97 A;  4MMM A;  1SU9 A;  4ECJ A;  2HLS A;  2FWG A;  1GWC A;  1BX9 A;  2YWN A;  3C1S A;  4MH2 A;  1KNG A;  2LRN A;  4ML6 A;  3QAV A;  4TR4 A;  5D93 A;  4K7N A;  2D2Z A;  2H74 A;  1B9Y C;  3ISO A;  1YY7 A;  3F9U A;  4PQI A;  1WPI A;  5ECP B;  1QK8 A;  2L6D A;  4FH8 A;  1GSQ A;  2VD1 A;  3DXB A;  2C4J A;  3HA9 A;  4OO5 A;  1TK5 B;  3RAZ A;  3TJF A;  3P7X A;  1WOU A;  1FG4 A;  2MMA A;  2M46 A;  4XS6 A;  2FWH A;  2N5B A;  3DVX A;  4PQH A;  2ON7 A;  3GTU A;  4XIH A;  1I9D A;  2L4Q A;  1X5E A;  4POB A;  1XZO A;  2A2R A;  1PD2 1;  2VLT A;  4F82 A;  3H93 A;  2H72 A;  1XOB A;  2HI7 A;  3CTG A;  4G2E A;  1W89 A;  3BOA A;  5IPH A;  4KH7 A;  4ZXG A;  2IIY A;  1LJR A;  3I69 A;  2VUP A;  1F37 A;  4FO5 A;  3IC4 A;  5D8I A;  3IDV A;  4KUN A;  1F9M A;  1PL2 A;  1HYU A;  2HSH A;  2LUS A;  4IP6 A;  4TW5 A;  2JZR A;  3IV4 A;  1SJI A;  2VCZ A;  3FZ9 A;  2FWF A;  2K8V A;  2CZ2 A;  3KMO A;  4L5O A;  2I4A A;  1QFN A;  4ID0 A;  3ME8 A;  4LA1 A;  1X9S B;  3DML A;  2VD0 A;  3KZQ A;  2I3Y A;  2GQM A;  5F07 A;  2M80 A;  4MH3 A;  1ERU A;  2C3Q A;  4MZC A;  5G1K A;  3EWL A;  5ELG A;  2AHE A;  4EKZ A;  2VCW A;  1YDK A;  1MD3 A;  12GS A;  3GSS A;  1DE1 A;  3GH6 A;  2H8L A;  2C80 A;  3LSZ A;  5LD0 A;  4J57 E;  4WBJ A;  4MA9 A;  3HZ4 A;  2HZE B;  1YF1 A;  4HU7 A;  2G2Q A;  2HE3 A;  4PX1 A;  3ZRE A;  5ECH B;  1YEX A;  1TJD A;  3GKN A;  1SD8 A;  3DKS A;  1ZGN A;  1J9B A;  3FK8 A;  3RBT A;  1B4Q A;  1TU7 A;  1O81 A;  4H86 A;  3M9J A;  2XBQ A;  5IMA A;  3GV1 A;  4EL1 A;  2VCQ A;  4K7I A;  2H0H A;  1XBS A;  2K9F A;  1SK1 A;  2DJ1 A;  1TOF A;  2OBK A;  4ZL7 A;  5IPG A;  5ID2 A;  2L5L A;  3G7J A;  3WT2 A;  4BVX A;  1VF2 A;  1GSF A;  1GTA A;  5F0G A;  3WGX A;  5GZZ B;  2GSQ A;  1VF4 A;  5A4W A;  2WRT A;  2XC2 A;  4K9Z A;  4ILF A;  2PGT A;  2PVO C;  2JZT A;  1THO A;  3GHA A;  3D4T A;  4L0U A;  3LGC A;  1GUL A;  2FLS A;  1WP0 A;  1X0R A;  7GSS A;  4MAB A;  4KW6 A;  3QDN A;  3S9F A;  1XWK A;  4IJ3 A;  5CAX A;  5DBQ A;  3ZMK A;  4NWY A;  4HJM A;  2WUL A;  4HQS A;  4IQA A;  2B1L A;  3LYK A;  5B7C A;  5IM9 A;  4YQM A;  2IPA A;  4IBP A;  3VPQ A;  4HJ2 A;  3F4R A;  4ECI A;  2NPB A;  1OC3 A;  1DE2 A;  3TKP A;  1KBN A;  2P5R A;  2ZUP A;  2PN8 A;  4CW9 A;  1ILO A;  2MMZ A;  5HR3 A;  3FZA A;  5J5N A;  2JL4 A;  5H5R A;  1DUG A;  2AJQ B;  1C72 A;  2I9H A;  4ACS A;  3IE3 A;  2DIZ A;  3EU4 A;  5CRE A;  1TU8 A;  1AW9 A;  3I6A A;  1R5P A;  2GVP A;  2HZF A;  2VO4 A;  1XFL A;  4N30 A;  1M2A A;  2J23 A;  2GQL A;  4XCS A;  1GSE A;  4KGI A;  4HZ2 A;  2QGV A;  3GN3 A;  2CV4 A;  4K8M A;  2H6Z A;  4OFN A;  5H5Q A;  3FEU A;  4LL4 B;  3VPT A;  1PN9 A;  22GS A;  2F3M A;  2HXK A;  3UJ1 A;  5IOX A;  1ZOF A;  2PU9 C;  14GS A;  2YJH A;  2R37 A;  2H70 A;  5KN1 A;  1O8W A;  5AN1 A;  3LJR A;  6GSU A;  1BYE A;  3EYT A;  2YWM A;  1U6T A;  1S3A A;  3KH7 A;  5F8B A;  2DC5 A;  4MJE A;  4NAX A;  2EIR A;  5L71 A;  1YJ6 A;  2GGT A;  3TRX A;  2AB6 A;  4JRR A;  3C73 A;  4OCE A;  1N8J A;  2IFQ A;  4RQX A;  1NW2 A;  1VF1 A;  1RQM A;  5JWO B;  3GMF A;  2B1K A;  3U5R E;  1WWJ A;  3A2W A;  3A5W A;  1Y25 A;  1X5C A;  2VLV A;  2L57 A;  1GTU A;  5B8B A;  3GKK A;  2DIY A;  3LEF A;  4FYB A;  3M9K A;  4TR1 B;  1IYI A;  1AQW A;  2O87 A;  1GSS A;  2YOI A;  3HVV A;  2Z9S A;  1HNC A;  2CVK A;  3CYN A;  1GNW A;  1EZK A;  4PGT A;  4EO3 A;  2GZZ A;  3O76 A;  4BL7 A;  2RM5 A;  4F9Z A;  1FW1 A;  1PSQ A;  2DJ3 A;  2CVB A;  2B5Y A;  4QL9 A;  3KM6 A;  1AC1 A;  3D22 A;  3VFI A;  4JZQ A;  2AUV A;  2DJJ A;  3FZ4 A;  3J7Y b;  2IME A;  4EDZ A;  3V1W A;  4V2N A;  2FNO A;  4TN8 A;  4GCI A;  1OE7 A;  3GIX A;  1GUM A;  5CNW A;  2H6X A;  2YWO A;  1SK0 A;  2V6K A;  5D9X A;  2H0G A;  2H1D A;  2RUE A;  3E9J B;  4RUV A;  2BMX A;  2B7J A;  2DLX A;  2DBC A;  2V6O A;  3ZZX A;  4X0X A;  3CSJ A;  5ECN B;  3NOF A;  3FR3 A;  1A0R P;  2H30 A;  3HJM A;  4IEL A;  5IMV A;  3NZN A;  6GST A;  5ECI B;  3M0F A;  1KTE A;  3QD9 A;  1J0F A;  4JBB A;  1K0M A;  1M9B A;  2MZC A;  3UEM A;  5ECK B;  2HT9 A;  2H73 A;  2FUG 2;  3I43 A;  3UVT A;  4TR3 A;  3MDK A;  3RPN A;  5IMF A;  1A24 A;  1GNE A;  2GT5 A;  4X43 A;  1CQG A;  3GST A;  4ISD A;  5HR2 A;  1SD9 A;  5GAP D;  2EIO A;  1WIK A;  2NVL A;  4J56 E;  4GRF A;  5A4U A;  3LFL A;  2IN3 A;  1FAA A;  3PR8 A;  4TRX A;  1O73 A;  2V41 A;  4MJC A;  4O32 A;  1JHB A;  5COH A;  2VCT A;  1G7O A;  3GKX A;  1ML6 A;  2WS2 A;  1F6M C;  4V1A p;  5DAK B;  4L5L A;  5ABR A;  3ZML A;  2LNT A;  4ULX A;  2F8A A;  3APQ A;  2VCV A;  3LG6 A;  2YJ7 A;  1T4Z A;  1V9W A;  4EE0 A;  3GUS A;  4Q5Q A;  2VOC A;  1XW9 A;  1M7T A;  2GTU A;  2YP6 A;  2JAC A;  2X8C A;  3NIV A;  2H6Y A;  5HQP A;  5CRD A;  4N10 A;  3KTB A;  3UAP A;  1GSD A;  3DD3 A;  5J4U A;  5INY A;  5DJL A;  2IL3 A;  2C0G A;  5D9T A;  2YZH A;  5KN3 A;  5IMD A;  3IK9 A;  2H1G A;  5AGY A;  2X99 A;  3KTL A;  3RHB A;  4WF4 A;  1F3B A;  1SL0 B;  3D0Z A;  3FKF A;  3IK7 A;  2X8G A;  2O85 A;  3GYK A;  1OC8 A;  2TRX A;  2LJK A;  2H75 A;  2JZS A;  5B8A A;  2MYG A;  1Z9H A;  2GLR A;  4D73 B;  3WD6 A;  3I9V 2;  10GS A;  3L9S A;  1U87 A;  3DRN A;  4MCU A;  1Z7P A;  3ZTL A;  1U3I A;  2X8H A;  3M3M A;  1GUK A;  2H76 A;  5G31 A;  3L4N A;  4TVE A;  4XS1 A;  3C7M A;  4V1A g;  1ERV A;  4I5Q A;  3QCP A;  2R2J A;  3F8U A;  4MZB A;  1FB0 A;  3A3T A;  4OFM A;  2BTO T;  3E0U A;  1X9W B;  4N0Z A;  3ZIJ A;  3HHV A;  3ERW A;  5HR0 A;  4AGS A;  1WMJ A;  4JR6 A;  3WT1 A;  5DQS A;  5J9C A;  2WJU A;  2HZE A;  3TJG A;  4XS4 B;  3F3R A;  3PH9 A;  3RPP A;  4KDU A;  2F51 A;  3VI7 A;  3GRX A;  1HNB A;  3Q19 A;  4MF5 A;  1HQO A;  1A2J A;  2JU5 A;  4MP4 A;  1NHO A;  4RI7 A;  3VWX A;  4BVY A;  1SKW B;  5DAL A;  3P90 A;  2EIQ A;  3GUR A;  6GSX A;  1TXX A;  2R3X A;  1XWC A;  2NBS A;  4WKW A;  4WXT A;  2WCI A;  4FYC A;  5ECM B;  1Y6E A;  3DYR A;  3ZYW A;  1YZX A;  2PER A;  4KCE A;  2DMM A;  4F2I A;  3FR6 A;  2CT6 A;  5DVB A;  3UIW A;  3TJJ A;  4O5R A;  5A5K A;  3TOU A;  2OAC A;  5B6N A;  3UVH A;  2LRC A;  5FT3 A;  2PMT A;  1FOV A;  2VL9 A;  2GQK A;  4E8H A;  4IVF A;  3DEX A;  4JU5 A;  4PUR A;  1R5A A;  5CYY A;  4XRD A;  1V98 A;  3UAR A;  3TUE A;  3QFA C;  2CZ3 A;  1T4Y A;  1E2Y A;  4G19 A;  1FHE A;  3OR5 A;  2GS3 A;  2REM A;  4POM A;  5HFI A;  4NHZ A;  3IAS 2;  2KP2 A;  4DSR A;  1Z3E A;  1MDK A;  3K8N A;  1UN2 A;  1TP9 A;  4ML1 A;  4QQ7 A;  1M2D A;  2QKE A;  3J7Y k;  2MMO A;  2VL2 C;  2B5E A;  3H79 A;  1QGV A;  3GTU B;  4CHS A;  3MAK A;  4GQF A;  2C0E A;  3N5O A;  3IR4 A;  3HVS A;  2YN1 A;  1R7H A;  2PUK C;  3SWL A;  5J3R A;  2EC4 A;  2E2G A;  2J9H A;  1GUH A;  1GTB A;  3TDG A;  4GTU A;  4IW9 A;  5CRG A;  3IBH A;  4V2L A;  1QMV A;  5B6M A;  2VL3 A;  4I2U A;  1XW6 A;  3IOS A;  2RII A;  3FYG A;  4F03 A;  1UC7 A;  1A8Y A;  1XOA A;  4TR1 A;  1K0A A;  4IJI A;  2R4V A;  2P5Q A;  5E59 A;  2HNL A;  4O92 A;  1QXH A;  3WYW A;  4KDX A;  3U6V A;  4KSO A;  3US3 A;  3ZFB A;  2PWJ A;  4JED A;  3CRU A;  3FHK A;  1EOG A;  4ZBA A;  1K0C A;  3A2V A;  4K0G A;  3VLN A;  3W8J A;  3QFB C;  3HY2 A;  5KN2 A;  2E2M A;  4K7O A;  4OCF A;  3Q18 A;  1G0T A;  3L9U A;  5E4W A;  1FVK A;  3TKS C;  3BJ5 A;  2GDR A;  5DDL A;  4MF6 A;  2PVQ A;  4WBR D;  4HEA 2;  3AY8 A;  3PGT A;  1F3A A;  2ZNM A;  4K1F A;  1JZD A;  2O8V B;  1XW5 A;  2MMN A;  1EEJ A;  1XVQ A;  2KOK A;  1TK0 B;  4KCA A;  3PIN A;  1VF3 A;  3LOR A;  1PKW A;  1Z6M A;  1K3O A;  1TI1 A;  1X5D A;  1U3A A;  4FYU A;  1BED A;  1BJX A;  1GLP A;  3IHQ A;  4BA7 A;  2LRT A;  4IKH A;  1ERT A;  5HR1 A;  3W6G A;  2H1A A;  4XRA A;  5G5F A;  17GS A;  3KXO A;  1R26 A;  3DGQ A;  4MJA A;  2H19 A;  4J2F A;  4GST A;  1AQV A;  5JCW A;  5ELA A;  4QL7 A;  2IMD A;  3QR6 A;  2LV3 A;  4HUA A;  3ZLP A;  5IQY A;  1PQN A;  1CQH A;  1DBY A;  1SKR B;  4HDE A;  4AJ7 A;  5ID2 B;  2OE3 A;  2C0F A;  2YCD A;  3EE2 A;  3BBY A;  5G5E A;  1GL8 A;  1NHY A;  2I81 A;  1XXU A;  1YKA A;  1XWG A;  2O89 A;  1EEM A;  3Q74 A;  4GXZ A;  5ENU A;  5CP1 A;  3FRC A;  3TKQ A;  2WZ9 A;  3EMX A;  1B48 A;  4RI6 A;  2V1M A;  20GS A;  3GNJ A;  2LEG A;  5DAK A;  2KUC A;  2OE0 A;  1Q98 A;  4XTS A;  5D9W A;  3E3E A;  5ECS A;  2KHP A;  1GRX A;  2I1U A;  4HS1 A;  4NHW A;  1SJ6 A;  2DJ0 A;  3W8S A;  1YEP A;  1UVZ A;  5FHI A;  1MDI A;  5G30 A;  4TXV A;  4AJ6 A;  1TW9 A;  1A8L A;  4MZW A;  2TRC P;  4PQ1 A;  2LQO A;  1HD2 A;  1SYX A;  2FWE A;  4WR4 A;  5LNK e;  2F8F A;  5CO3 A;  3CTF A;  4HOJ A;  4AF2 A;  1FB6 A;  4POK A;  1G6Y A;  1SEN A;  4K0N A;  4PUA A;  1M99 A;  1G7E A;  4HI7 A;  2OAD A;  2B5X A;  3HXS A;  3GKM A;  1ZYE A;  2OA7 A;  1K0N A;  3L0H A;  2P0G A;  1V57 A;  3DIE A;  3HDC A;  4D73 A;  3VUR A;  3WGE A;  1T1V A;  1A23 A;  5DCH A;  5F05 A;  1A0F A;  4POL A;  1O8X A;  4N11 A;  2N5A A;  4IP1 A;  2R5G A;  1V2A A;  4L8E A;  3VK9 A;  2DJ2 A;  2A2S A;  2LJA A;  4LLR A;  4EC0 A;  3M1G A;  5CRH A;  3ZVJ D;  6GSS A;  18GS A;  3LQ7 A;  3C1R A;  4EXJ A;  1B4P A;  2LJR A;  4DSS B;  3CMI A;  1JFU A;  1GTI A;  1JZW A;  2ON5 A;  1GP1 A;  2C8U A;  3LXT A;  5ECR B;  3BCK A;  3H8Q A;  1A2L A;  3CXG A;  4GSS A;  4OO4 A;  2ES7 A;  3VWV A;  1OYJ A;  3HZ8 A;  1R4W A;  2VLU A;  3IAM 2;  4KX4 A;  5G1L A;  2GSR A;  1FO5 A;  2HRN A;  3GX8 A;  4HZ4 A;  2L6C A;  4Q5N A;  1XIY A;  2VIM A;  1K3L A;  2WDU A;  3P2A A;  1XWA A;  3VWW A;  4MK3 A;  4AJ8 A;  4BPY A;  1T00 A;  3A2X A;  5AIX A;  3D21 A;  3BD2 A;  4TKY A;  4IHU A;  1ON4 A;  1LBK A;  4CDO A;  1EV4 A;  1XPV A;  1AXD A;  1U88 A;  3ZL5 A;  5JWR B;  4GWR A;  1J08 A;  3GL5 A;  4I8B A;  1QUW A;  5KEJ A;  2LQQ A;  1VGL A;  3P8W A;  3L78 A;  1BG5 A;  4XHM A;  4Q5F A;  3F4T A;  3IXR A;  1YQ1 A;  2V32 A;  5IMZ A;  2LKU A;  3KEB A;  4NXI A;  1V58 A;  2VCX A;  2GST A;  3EU3 A;  2O7K A;  3FY7 A;  1TKD B;  1ERW A;  1SL2 B;  3QMX A;  3TOT A;  1NSW A;  3TJK A;  4ZB6 A;  3UL3 A;  1THX A;  2ZCT A;  4YQV A;  2L59 A;  1PMT A;  1LU4 A;  3HJP A;  4WEY A;  3KP8 A;  1TRV A;  1OC9 B;  4ZIL A;  2A4V A;  2H71 A;  1TRU A;  1AUC A;  1WJK A;  6GSW A;  2DSA A;  4FIW A;  3F0I A;  4MPF A;  4ZBD A;  1H4O A;  2CAI A;  4ZBB A;  5GST A;  1T3B A;  1E6B A;  1ZCP A;  1GLQ A;  3GFK A;  2XPE A;  3HKR A;  1V40 A;  1YKC A;  5IIZ A;  3EMP A;  3LWA A;  2AYT A;  2NTO A;  2C0D A;  1USB A;  1FVJ A;  2K8S A;  1ABA A;  2BJX A;  3EVI A;  5EVO A;  2GZY A;  5A4V A;  2YWI A;  2B6M A;  4K6X A;  2LNS A;  4MPG A;  2K18 A;  3Q6O A;  1JZO A;  3EUR A;  1Z6N A;  5JCG A;  1ZL9 A;  2IMK A;  1UA5 A;  3IPZ A;  5AIV A;  3TB2 A;  4ECB A;  4KA0 A;  5C04 A;  1RK4 A;  3KMN A;  3F6D A;  2VAF A;  5H5S A;  1G6W A;  3D6I A;  4TXO B;  4EF0 A;  2IJY A;  2E7P A;  3CRT A;  4WET A;  1T8E B;  5AIS A;  4EVM A;  1KEB A;  2WB9 A;  3APO A;  3FR9 A;  2OBI A;  5IOW A;  2CX3 A;  2HYX A;  1XVW A;  3HVX A;  1ZMA A;  4I2T A;  4KSM A;  3F6F A;  1AQX A;  3TCO A;  4BWQ A;  3G7Y A;  4WF5 A;  4LMV A;  2M72 A;  4V2M A;  3CSI A;  4PNG A;  3UBL A;  1AIU A;  2L5O A;  3KCM A;  2FA8 A;  4OD7 A;  5GAN D;  4RQR A;  4L0W A;  1N2A A;  3EC3 A;  3R2Q A;  3M8N A;  3KP9 A;  4NV5 A;  4YH2 A;  3L9V A;  4LL1 B;  2B7K A;  1EP8 A;  5IMC A;  2JSY A;  4F0C A;  3VI5 A;  5HFK A;  1SYR A;  1O85 A;  4Z7X A;  4BWS A;  4N0V A;  3MSZ A;  13GS A;  2CQ9 A;  1OKT A;  4YAV A;  4MDC A;  1PGT A;  5EPF A;  1M0U A;  1EOH A;  5D96 A;  1JLW A;  1SKS B;  4G10 A;  3ED3 A;  5DAL B;  1XWB A;  4KAE A;  4IGJ A;  1TDI A;  4JR4 A;  2PBJ A;  4ZB8 A;  2FA4 A;  2FD3 A;  4IQ1 A;  6GSV A;  2GT6 A;  1Q4J A;  4YAP A;  3IRA A;  5DJM A;  4E8E A;  2RM6 A;  1K0O A;  2CAQ A;  1A2M A;  3IA1 A;  1EV9 A;  2HSY A;  1OAZ A;  1ACV A;  2IMF A;  4EUY A;  2FCH A;  3ZRD A;  2FGX A;  3H1N A;  16GS A;  3GL3 A;  3BCI A;  3RHC A;  2ALB A;  2FY6 A;  1GH2 A;  1S3C A;  1EP7 A;  1URM A;  4MF7 A;  3O6T A;  1EGO A;  1JZR A;  4MLY A;  1MD4 A;  4HU9 A;  5DCG A;  2B3S A;  2X64 A;  2MBT A;  1Z5Y E;  1VRS D;  4LMW A;  4TR0 A;  3TGZ A;  5FWG A;  3QAG A;  4ZB9 A;  2H0I A;  4OFT A;  2IWT A;  1ZYQ B;  1I5G A;  4JE1 A;  2XHF A;  4KDY A;  4DEJ A;  1OKD A;  2DJK A;  1MDJ A;  1GSY A;  3TRP A;  3FW2 A;  2JSZ A;  3RDW A;  1TRS A;  2G0F A;  4WR5 A;  3UMA A;  1K3Y A;  3ZFL A;  2GSS A;  1M2B A;  4Q5R A;  1TI3 A;  3F63 A;  2OE1 A;  4G9H A;  3WGD A;  3UBK A;  3HCZ A;  4PNF A;  5D9V A;  3CSH A;  3TKS E;  1EGR A;  3ERF A;  5DQY A;  1T7P B;  5J9B A;  3F3Q A;  3TKR A;  3VWU A;  1JLV A;  2P31 A;  5EL8 A;  4DSS A;  3D5J A;  4NV2 A;  1SK2 A;  4GQC A;  2DML A;  2RUF A;  2KP1 A;  2PPT A;  2H01 A;  3TRQ A;  2VM1 A;  2OKA A;  6GSY A;  5IO2 A;  3N9J A;  4OWY A;  4IN0 A;  1EWX A;  5GSS A;  1Z7R A;  3JCM L;  1F2E A;  1GSU A;  4TOP A;  3GH9 A;  9GSS A;  4MJB A;  1O7U A;  2CA8 A;  1IYH A;  2HFD A;  1PX7 A;  4KB3 A;  2CX4 A;  4HQZ A; 
#chains in the Genus database with same CATH topology
 2VL2 A;  2K6V A;  2JAD A;  3DVW A;  2TIR A;  4EDY A;  2L4C A;  2H66 A;  2VM2 A;  2A4H A;  4CY8 A;  4IS0 A;  3DWV A;  4ZIJ A;  5G2Z A;  3KD0 A;  4NMU A;  2LTK A;  5C00 A;  2GZP A;  2CVD A;  4O7H A;  2AAW A;  1M3J A;  4GSN A;  1W4V A;  2E0Q A;  2R6K A;  1YF0 A;  2F9S A;  3CBU A;  2WGR A;  1DSB A;  5ECO B;  5KN0 A;  5ECL B;  1B8X A;  4KE3 A;  3TJB A;  4I6X A;  3LYP A;  1RW1 A;  2KLX A;  1ZYN A;  2LS5 A;  4X1U A;  3QOU A;  1TTZ A;  4Z2R A;  4ECC A;  3F4S A;  2C3T A;  3KIJ A;  3O3T A;  3ZVJ A;  4PTS A;  5JWQ B;  2IFQ B;  2YPM A;  1MTC A;  2YV7 A;  3HD5 A;  3HJO A;  1S3D A;  3GA4 A;  1NM3 A;  2N5F A;  1OC9 A;  2C1Y A;  1SJZ A;  2YAN A;  3APS A;  2WFC A;  5D73 A;  2V2G A;  4OMV A;  1WRY A;  1TK8 B;  4ZL8 A;  3TKS A;  1PX6 A;  4O5Q A;  1OVN A;  4YQU A;  4KND A;  3ZIV A;  4XS4 A;  1PA3 A;  3KH9 A;  3FZ5 A;  2MBS A;  3H4K A;  3G7I A;  1WE0 A;  3MNG A;  3KGK A;  1PRX A;  3ERG A;  3UOM A;  4GLT A;  4DSQ A;  2A2P A;  3G9B A;  5HFG A;  4Z2U A;  1OE8 A;  1BQ7 A;  2HRF A;  5JCU A;  5J41 A;  3ZIT A;  2XPD A;  1ST9 A;  4K2X A;  1XCC A;  5IO0 A;  5LCZ A;  2YZU A;  2RLI A;  1PKZ A;  1K0B A;  1H75 A;  3MYD A;  4GF0 A;  3ME7 A;  1B9X C;  2IMI A;  2QSI A;  11GS A;  4DVC A;  5EY6 A;  5BRT A;  4K2D A;  4PXO A;  1HNA A;  3QPM A;  3QAW A;  1QQ2 A;  2NDO A;  2OJL A;  19GS A;  1PL1 A;  3HVN A;  1ZZY A;  2YNX A;  4NPB A;  3HYP A;  1TRW A;  2H1B A;  2LST A;  4P3Y B;  1O6J A;  2YV9 A;  4PUF C;  2FHE A;  3SBC A;  2QC7 A;  1M9A A;  1K0D A;  2C3N A;  5F06 A;  3LXZ A;  3C8E A;  2AV4 A;  3GX0 A;  1X9M B;  3D4M A;  4TXO A;  1BAY A;  2XBI A;  1MEK A;  4ZL9 A;  1SL1 B;  3MWH A;  1AAZ A;  8GSS A;  4F0B A;  3KJY A;  3EIN A;  3C71 A;  5ECQ B;  3FMW A;  5CRW A;  4I97 A;  4MMM A;  1SU9 A;  4ECJ A;  2HLS A;  1M3I A;  2FWG A;  1GWC A;  1BX9 A;  2YWN A;  3C1S A;  4MH2 A;  1KNG A;  2LRN A;  4ML6 A;  3QAV A;  4TR4 A;  5D93 A;  4K7N A;  2D2Z A;  2H74 A;  1B9Y C;  3ISO A;  1YY7 A;  3F9U A;  4PQI A;  1WPI A;  5ECP B;  1QK8 A;  2L6D A;  4FH8 A;  1GSQ A;  2VD1 A;  3DXB A;  2C4J A;  3HA9 A;  4OO5 A;  1TK5 B;  3RAZ A;  3TJF A;  3P7X A;  1WOU A;  1FG4 A;  2MMA A;  2M46 A;  4XS6 A;  2FWH A;  2N5B A;  3DVX A;  4PQH A;  2ON7 A;  3GTU A;  4XIH A;  1I9D A;  2L4Q A;  1X5E A;  4POB A;  1XZO A;  4YKG A;  2A2R A;  1PD2 1;  2VLT A;  4F82 A;  4YKF A;  3H93 A;  2H72 A;  1XOB A;  2HI7 A;  3CTG A;  4G2E A;  1W89 A;  3BOA A;  5IPH A;  4KH7 A;  4ZXG A;  2IIY A;  1LJR A;  3I69 A;  2VUP A;  4EIQ A;  1F37 A;  4FO5 A;  3IC4 A;  5D8I A;  3IDV A;  4KUN A;  1F9M A;  1PL2 A;  1HYU A;  2HSH A;  2LUS A;  4IP6 A;  4TW5 A;  2JZR A;  3IV4 A;  1SJI A;  3PPU A;  2VCZ A;  3FZ9 A;  2FWF A;  2K8V A;  2CZ2 A;  3KMO A;  4L5O A;  1XG8 A;  2I4A A;  1QFN A;  4ID0 A;  3ME8 A;  4LA1 A;  1X9S B;  3DML A;  2VD0 A;  3KZQ A;  2I3Y A;  2GQM A;  5F07 A;  2M80 A;  4MH3 A;  1ERU A;  2C3Q A;  4MZC A;  5G1K A;  3EWL A;  5ELG A;  2AHE A;  4EKZ A;  2VCW A;  1YDK A;  1MD3 A;  12GS A;  3GSS A;  1DE1 A;  3GH6 A;  4CY6 A;  2H8L A;  2C80 A;  3LSZ A;  5LD0 A;  4J57 E;  2R0C A;  4WBJ A;  4MA9 A;  3HZ4 A;  2HZE B;  1YF1 A;  4HU7 A;  2G2Q A;  2HE3 A;  4PX1 A;  3ZRE A;  5ECH B;  1YEX A;  1TJD A;  3GKN A;  1SD8 A;  3DKS A;  1ZGN A;  1J9B A;  3FK8 A;  3RBT A;  1B4Q A;  1TU7 A;  1O81 A;  4H86 A;  3M9J A;  2XBQ A;  5IMA A;  3GV1 A;  4EL1 A;  2VCQ A;  4K7I A;  2H0H A;  1XBS A;  2K9F A;  1SK1 A;  2DJ1 A;  1TOF A;  2OBK A;  4ZL7 A;  5IPG A;  5ID2 A;  2L5L A;  3G7J A;  3WT2 A;  4BVX A;  1VF2 A;  1GSF A;  1GTA A;  5F0G A;  3WGX A;  5GZZ B;  2GSQ A;  1VF4 A;  5A4W A;  2WRT A;  2XC2 A;  4K9Z A;  4ILF A;  2PGT A;  2PVO C;  2JZT A;  1THO A;  3GHA A;  3D4T A;  4L0U A;  3LGC A;  1GUL A;  2FLS A;  1WP0 A;  1X0R A;  7GSS A;  4MAB A;  4KW6 A;  3QDN A;  3S9F A;  1XWK A;  4IJ3 A;  5CAX A;  5DBQ A;  3ZMK A;  4NWY A;  4HJM A;  2WUL A;  4HQS A;  4IQA A;  2B1L A;  3LYK A;  5B7C A;  5IM9 A;  4YQM A;  2IPA A;  4IBP A;  3VPQ A;  4HJ2 A;  3F4R A;  4ECI A;  2NPB A;  1OC3 A;  1DE2 A;  3TKP A;  1KBN A;  2P5R A;  2ZUP A;  2PN8 A;  4CW9 A;  1ILO A;  2MMZ A;  5HR3 A;  3FZA A;  5J5N A;  2JL4 A;  5H5R A;  1DUG A;  2AJQ B;  1C72 A;  2I9H A;  4ACS A;  3IE3 A;  2DIZ A;  3EU4 A;  5CRE A;  1TU8 A;  1AW9 A;  3I6A A;  1R5P A;  2GVP A;  2HZF A;  2VO4 A;  1XFL A;  4N30 A;  1M2A A;  2J23 A;  2GQL A;  4XCS A;  1GSE A;  4KGI A;  4HZ2 A;  2QGV A;  3GN3 A;  2CV4 A;  4K8M A;  2H6Z A;  4OFN A;  5H5Q A;  3FEU A;  4LL4 B;  3VPT A;  1PN9 A;  22GS A;  2F3M A;  2HXK A;  3LW9 A;  3UJ1 A;  5IOX A;  1ZOF A;  2PU9 C;  14GS A;  2YJH A;  2R37 A;  2H70 A;  5KN1 A;  1O8W A;  5AN1 A;  3LJR A;  6GSU A;  1BYE A;  3EYT A;  2YWM A;  1U6T A;  1S3A A;  3KH7 A;  5F8B A;  2DC5 A;  4MJE A;  4NAX A;  2EIR A;  5L71 A;  1YJ6 A;  2GGT A;  3TRX A;  2AB6 A;  4JRR A;  3C73 A;  4OCE A;  1N8J A;  2IFQ A;  4RQX A;  1NW2 A;  1VF1 A;  1RQM A;  5JWO B;  3IC8 A;  3GMF A;  2B1K A;  3U5R E;  1WWJ A;  3A2W A;  3A5W A;  1Y25 A;  1X5C A;  2VLV A;  2L57 A;  1GTU A;  5B8B A;  4K5S A;  3GKK A;  2DIY A;  3LEF A;  4FYB A;  3M9K A;  4TR1 B;  1IYI A;  1AQW A;  2O87 A;  4G0I A;  1GSS A;  2YOI A;  3HVV A;  2Z9S A;  1HNC A;  2CVK A;  3CYN A;  1GNW A;  1EZK A;  4PGT A;  4EO3 A;  2GZZ A;  3O76 A;  4BL7 A;  2RM5 A;  4F9Z A;  1FW1 A;  1PSQ A;  2DJ3 A;  2CVB A;  2B5Y A;  4QL9 A;  3KM6 A;  1AC1 A;  3D22 A;  3VFI A;  4JZQ A;  2AUV A;  2DJJ A;  3FZ4 A;  3J7Y b;  2IME A;  4EDZ A;  3V1W A;  4V2N A;  2FNO A;  4TN8 A;  4GCI A;  1OE7 A;  3GIX A;  1GUM A;  5CNW A;  2H6X A;  2YWO A;  1SK0 A;  2V6K A;  5D9X A;  2H0G A;  2H1D A;  2RUE A;  3E9J B;  4RUV A;  2BMX A;  2B7J A;  2DLX A;  4G0L A;  2DBC A;  2V6O A;  3ZZX A;  4X0X A;  3CSJ A;  5ECN B;  3NOF A;  3FR3 A;  1A0R P;  2H30 A;  3HJM A;  4IEL A;  5IMV A;  3NZN A;  6GST A;  5ECI B;  3M0F A;  1KTE A;  3QD9 A;  1J0F A;  4JBB A;  1K0M A;  1M9B A;  2MZC A;  3UEM A;  5ECK B;  2HT9 A;  2H73 A;  2FUG 2;  3I43 A;  3UVT A;  4TR3 A;  3MDK A;  3RPN A;  5IMF A;  1A24 A;  1GNE A;  2GT5 A;  4X43 A;  1CQG A;  3GST A;  4ISD A;  5HR2 A;  1SD9 A;  5GAP D;  2EIO A;  1WIK A;  2NVL A;  4J56 E;  4GRF A;  5A4U A;  3LFL A;  2IN3 A;  1FAA A;  3PR8 A;  4TRX A;  1O73 A;  2V41 A;  4MJC A;  4O32 A;  1JHB A;  5COH A;  2VCT A;  1G7O A;  3GKX A;  1ML6 A;  2WS2 A;  1F6M C;  4V1A p;  5DAK B;  4L5L A;  5ABR A;  3ZML A;  2LNT A;  4ULX A;  2F8A A;  3APQ A;  2VCV A;  3LG6 A;  2YJ7 A;  1T4Z A;  1V9W A;  4EE0 A;  3GUS A;  4Q5Q A;  2VOC A;  1XW9 A;  1M7T A;  2GTU A;  3IHG A;  2YP6 A;  2JAC A;  2X8C A;  3NIV A;  2H6Y A;  5HQP A;  5CRD A;  4N10 A;  3KTB A;  3UAP A;  1GSD A;  3DD3 A;  5J4U A;  5INY A;  5DJL A;  2IL3 A;  2C0G A;  5D9T A;  2YZH A;  5KN3 A;  5IMD A;  3IK9 A;  2H1G A;  5AGY A;  2X99 A;  3KTL A;  3RHB A;  4WF4 A;  1F3B A;  1SL0 B;  3D0Z A;  3FKF A;  3IK7 A;  2X8G A;  2O85 A;  3GYK A;  1OC8 A;  2TRX A;  2LJK A;  2H75 A;  2JZS A;  5B8A A;  2MYG A;  1Z9H A;  2GLR A;  4D73 B;  3WD6 A;  3I9V 2;  10GS A;  4KF9 A;  3L9S A;  1U87 A;  3DRN A;  4MCU A;  1Z7P A;  3ZTL A;  1U3I A;  2X8H A;  3M3M A;  1GUK A;  2H76 A;  5G31 A;  3L4N A;  1FOH A;  4TVE A;  4XS1 A;  3C7M A;  4V1A g;  1ERV A;  4I5Q A;  3QCP A;  2R2J A;  3F8U A;  4MZB A;  1FB0 A;  4Z2T A;  3A3T A;  4OFM A;  2BTO T;  3E0U A;  1X9W B;  4N0Z A;  3ZIJ A;  3HHV A;  3ERW A;  5HR0 A;  4O5U A;  3A5I A;  4AGS A;  1WMJ A;  4JR6 A;  3WT1 A;  5DQS A;  5J9C A;  2WJU A;  2HZE A;  3TJG A;  4XS4 B;  3F3R A;  3PH9 A;  3RPP A;  4KDU A;  2F51 A;  3VI7 A;  3GRX A;  1HNB A;  3Q19 A;  4MF5 A;  1HQO A;  3EPT A;  1A2J A;  2JU5 A;  4MP4 A;  1NHO A;  4RI7 A;  3VWX A;  2UZ8 A;  4BVY A;  1SKW B;  5DAL A;  3P90 A;  2EIQ A;  3GUR A;  6GSX A;  1TXX A;  2R3X A;  1XWC A;  2NBS A;  4WKW A;  4WXT A;  2WCI A;  4K5R A;  4FYC A;  5ECM B;  1Y6E A;  3DYR A;  3ZYW A;  1YZX A;  2PER A;  4KCE A;  2DMM A;  4F2I A;  3FR6 A;  2CT6 A;  5DVB A;  3UIW A;  3TJJ A;  4MNN A;  4O5R A;  5A5K A;  3TOU A;  2OAC A;  5B6N A;  3UVH A;  2LRC A;  5FT3 A;  2PMT A;  1FOV A;  2VL9 A;  2GQK A;  4E8H A;  4IVF A;  3DEX A;  4JU5 A;  4PUR A;  1R5A A;  5CYY A;  4XRD A;  1V98 A;  3UAR A;  3TUE A;  3QFA C;  2CZ3 A;  1T4Y A;  1E2Y A;  4G19 A;  1FHE A;  3OR5 A;  2GS3 A;  3CQF A;  2REM A;  4POM A;  5HFI A;  4NHZ A;  3IAS 2;  2KP2 A;  4DSR A;  1Z3E A;  1MDK A;  3K8N A;  1UN2 A;  1TP9 A;  4ML1 A;  4QQ7 A;  4BIK A;  1M2D A;  2QKE A;  3J7Y k;  2MMO A;  2VL2 C;  2B5E A;  3H79 A;  1QGV A;  3GTU B;  4CHS A;  3MAK A;  4GQF A;  2C0E A;  3N5O A;  3IR4 A;  3HVS A;  2YN1 A;  1R7H A;  2PUK C;  3SWL A;  5J3R A;  2EC4 A;  2E2G A;  2J9H A;  1GUH A;  1GTB A;  3TDG A;  4GTU A;  4IW9 A;  5CRG A;  3IBH A;  4V2L A;  1QMV A;  5B6M A;  2VL3 A;  4I2U A;  1XW6 A;  3IOS A;  2RII A;  3FYG A;  4F03 A;  1UC7 A;  1A8Y A;  1XOA A;  4TR1 A;  4IJI A;  1K0A A;  2R4V A;  2P5Q A;  5E59 A;  2HNL A;  4O92 A;  1QXH A;  3WYW A;  4KDX A;  3U6V A;  4KSO A;  3US3 A;  3ZFB A;  2PWJ A;  4JED A;  4HSC X;  3CRU A;  3FHK A;  1EOG A;  4ZBA A;  1K0C A;  3A2V A;  4K0G A;  3VLN A;  3W8J A;  3QFB C;  3HY2 A;  5KN2 A;  2E2M A;  4K7O A;  4OCF A;  3Q18 A;  1G0T A;  3L9U A;  5E4W A;  1FVK A;  3TKS C;  3BJ5 A;  2GDR A;  5DDL A;  4MF6 A;  2PVQ A;  4WBR D;  4HEA 2;  3AY8 A;  3PGT A;  1F3A A;  2ZNM A;  4K1F A;  1JZD A;  2O8V B;  1XW5 A;  2MMN A;  1EEJ A;  1XVQ A;  2KOK A;  1TK0 B;  4KCA A;  3PIN A;  1VF3 A;  3LOR A;  1PKW A;  3MIX A;  1Z6M A;  1K3O A;  1TI1 A;  1X5D A;  1U3A A;  4FYU A;  1BED A;  1BJX A;  1GLP A;  3IHQ A;  4BA7 A;  2LRT A;  4IKH A;  1ERT A;  5HR1 A;  3W6G A;  2H1A A;  4XRA A;  5G5F A;  17GS A;  3KXO A;  1R26 A;  3DGQ A;  4MJA A;  2H19 A;  4J2F A;  4GST A;  1AQV A;  5JCW A;  5ELA A;  4QL7 A;  2IMD A;  2QA2 A;  3QR6 A;  2LV3 A;  4HUA A;  3ZLP A;  5IQY A;  1PQN A;  1CQH A;  1DBY A;  1SKR B;  4HDE A;  4AJ7 A;  5ID2 B;  4BVX B;  2OE3 A;  2C0F A;  2YCD A;  3EE2 A;  3BBY A;  5G5E A;  1GL8 A;  1NHY A;  2I81 A;  1XXU A;  1YKA A;  1XWG A;  2O89 A;  1EEM A;  3Q74 A;  4GXZ A;  5ENU A;  5KOW A;  5CP1 A;  3FRC A;  3TKQ A;  2WZ9 A;  3EMX A;  1B48 A;  4RI6 A;  2V1M A;  20GS A;  3GNJ A;  2LEG A;  5DAK A;  2KUC A;  2OE0 A;  1Q98 A;  4XTS A;  5D9W A;  3E3E A;  2KHP A;  5ECS A;  1GRX A;  2I1U A;  4HS1 A;  4NHW A;  1SJ6 A;  2DJ0 A;  3W8S A;  1YEP A;  1UVZ A;  5FHI A;  1MDI A;  2DKH A;  5G30 A;  4TXV A;  4AJ6 A;  1TW9 A;  1A8L A;  4MZW A;  2TRC P;  4PQ1 A;  2LQO A;  1HD2 A;  1SYX A;  2FWE A;  4WR4 A;  5LNK e;  2F8F A;  5CO3 A;  3CTF A;  4HOJ A;  4AF2 A;  2QA1 A;  1FB6 A;  4POK A;  1G6Y A;  1SEN A;  4K0N A;  4PUA A;  1M99 A;  1G7E A;  4HI7 A;  2OAD A;  2B5X A;  3HXS A;  3GKM A;  1ZYE A;  2OA7 A;  1K0N A;  3L0H A;  2P0G A;  1V57 A;  3DIE A;  3HDC A;  4D73 A;  3VUR A;  3WGE A;  1T1V A;  1A23 A;  5DCH A;  5F05 A;  1A0F A;  4POL A;  4FQU A;  1O8X A;  4N11 A;  2HRK A;  2N5A A;  4IP1 A;  2R5G A;  1V2A A;  4L8E A;  3VK9 A;  2DJ2 A;  2A2S A;  2LJA A;  4LLR A;  4EC0 A;  3M1G A;  5CRH A;  3ZVJ D;  6GSS A;  18GS A;  3LQ7 A;  3C1R A;  4EXJ A;  1B4P A;  2LJR A;  4DSS B;  3CMI A;  1JFU A;  1GTI A;  1JZW A;  2ON5 A;  1GP1 A;  2C8U A;  3LXT A;  5ECR B;  3BCK A;  3H8Q A;  1A2L A;  3CXG A;  4GSS A;  4OO4 A;  2ES7 A;  3VWV A;  1OYJ A;  3HZ8 A;  1R4W A;  2VLU A;  3IAM 2;  4BL7 B;  4KX4 A;  5G1L A;  2GSR A;  1FO5 A;  2HRN A;  3GX8 A;  4HZ4 A;  2L6C A;  4Q5N A;  1XIY A;  2VIM A;  1K3L A;  2WDU A;  3P2A A;  1XWA A;  3VWW A;  4MK3 A;  4AJ8 A;  4BPY A;  1T00 A;  3A2X A;  5AIX A;  3D21 A;  3BD2 A;  4TKY A;  4IHU A;  1ON4 A;  1LBK A;  4CDO A;  1EV4 A;  1XPV A;  1AXD A;  1U88 A;  3ZL5 A;  5JWR B;  4GWR A;  1J08 A;  3GL5 A;  4I8B A;  1QUW A;  5KEJ A;  2LQQ A;  1VGL A;  3P8W A;  3L78 A;  1BG5 A;  1PFO A;  4XHM A;  4Q5F A;  3F4T A;  3IXR A;  1YQ1 A;  2V32 A;  5IMZ A;  2HSM A;  2LKU A;  3KEB A;  4NXI A;  1V58 A;  2R0P A;  2VCX A;  2GST A;  3EU3 A;  2O7K A;  3FY7 A;  1TKD B;  1ERW A;  1SL2 B;  3QMX A;  3TOT A;  1NSW A;  3TJK A;  4ZB6 A;  3UL3 A;  2X49 A;  1THX A;  2ZCT A;  4YQV A;  2L59 A;  1PMT A;  1LU4 A;  3HJP A;  4WEY A;  3KP8 A;  1TRV A;  1OC9 B;  4ZIL A;  2A4V A;  2H71 A;  1TRU A;  1AUC A;  1WJK A;  6GSW A;  2DSA A;  4FIW A;  3F0I A;  4MPF A;  4ZBD A;  1H4O A;  2CAI A;  4ZBB A;  5GST A;  1T3B A;  1E6B A;  1ZCP A;  1GLQ A;  3GFK A;  2XPE A;  3HKR A;  1V40 A;  1YKC A;  5IIZ A;  3EMP A;  3LWA A;  4A5P A;  2AYT A;  2NTO A;  2C0D A;  1USB A;  1FVJ A;  2K8S A;  1ABA A;  2BJX A;  3EVI A;  5EVO A;  2GZY A;  5A4V A;  2YWI A;  2B6M A;  4K6X A;  2HRA A;  2LNS A;  4MPG A;  4X4J A;  2K18 A;  3R3E A;  3Q6O A;  1JZO A;  3EUR A;  1Z6N A;  5JCG A;  1ZL9 A;  2IMK A;  1UA5 A;  3IPZ A;  5AIV A;  3TB2 A;  2R0G A;  4ECB A;  4KA0 A;  5C04 A;  1RK4 A;  3KMN A;  3F6D A;  2VAF A;  5H5S A;  1G6W A;  3D6I A;  4TXO B;  2X4A A;  4EF0 A;  2IJY A;  2E7P A;  3CRT A;  4WET A;  1T8E B;  5AIS A;  4EVM A;  1KEB A;  2WB9 A;  3APO A;  3FR9 A;  2OBI A;  5IOW A;  2CX3 A;  2HYX A;  1XVW A;  3HVX A;  1ZMA A;  4I2T A;  4KSM A;  3F6F A;  1AQX A;  3TCO A;  4BWQ A;  3G7Y A;  4WF5 A;  4ICY A;  4LMV A;  2M72 A;  4V2M A;  3CSI A;  4PNG A;  3UBL A;  1AIU A;  2L5O A;  3KCM A;  2FA8 A;  4OD7 A;  5GAN D;  4RQR A;  4L0W A;  1N2A A;  3EC3 A;  3R2Q A;  3M8N A;  3KP9 A;  4NV5 A;  4YH2 A;  3L9V A;  4LL1 B;  2B7K A;  1EP8 A;  5IMC A;  2JSY A;  4F0C A;  3VI5 A;  5HFK A;  1SYR A;  1O85 A;  4Z7X A;  4BWS A;  4N0V A;  3MSZ A;  13GS A;  2CQ9 A;  1OKT A;  4YAV A;  4MDC A;  1PGT A;  5EPF A;  1M0U A;  1EOH A;  5D96 A;  1JLW A;  1SKS B;  4G10 A;  4BVY B;  3ED3 A;  5DAL B;  1XWB A;  4KAE A;  4IGJ A;  1TDI A;  4JR4 A;  2PBJ A;  4ZB8 A;  2FA4 A;  2FD3 A;  4IQ1 A;  6GSV A;  2GT6 A;  1Q4J A;  5BMU A;  4YAP A;  3IRA A;  5DJM A;  4E8E A;  2RM6 A;  1K0O A;  2CAQ A;  4G0K A;  1A2M A;  3IA1 A;  1EV9 A;  2HSY A;  1OAZ A;  1S3R A;  1ACV A;  2IMF A;  4EIP A;  4EUY A;  2FCH A;  3ZRD A;  2FGX A;  3H1N A;  16GS A;  3GL3 A;  1PN0 A;  3BCI A;  3RHC A;  2ALB A;  2FY6 A;  1GH2 A;  1S3C A;  1EP7 A;  1URM A;  4MF7 A;  3O6T A;  1EGO A;  1JZR A;  4MLY A;  1MD4 A;  4HU9 A;  4USS A;  5DCG A;  2B3S A;  2X64 A;  2MBT A;  1Z5Y E;  1VRS D;  1ZYP A;  4LMW A;  4TR0 A;  3TGZ A;  5FWG A;  3QAG A;  4ZB9 A;  2H0I A;  4OFT A;  2IWT A;  1ZYQ B;  1I5G A;  4JE1 A;  2XHF A;  4KDY A;  4DEJ A;  1OKD A;  2DJK A;  1MDJ A;  1GSY A;  3TRP A;  3FW2 A;  2JSZ A;  3RDW A;  1TRS A;  2G0F A;  4WR5 A;  3UMA A;  1K3Y A;  3ZFL A;  2GSS A;  1M2B A;  4Q5R A;  1TI3 A;  3F63 A;  2OE1 A;  4G9H A;  3WGD A;  3UBK A;  3HCZ A;  4PNF A;  5D9V A;  3CSH A;  3TKS E;  1EGR A;  3ERF A;  5DQY A;  1T7P B;  5J9B A;  3F3Q A;  3TKR A;  3VWU A;  1JLV A;  2P31 A;  5EL8 A;  4DSS A;  3D5J A;  4NV2 A;  1SK2 A;  4GQC A;  2DML A;  2RUF A;  2KP1 A;  2PPT A;  2DKI A;  2H01 A;  3TRQ A;  2VM1 A;  5KOX A;  2OKA A;  6GSY A;  5IO2 A;  3N9J A;  4OWY A;  4IN0 A;  1EWX A;  5GSS A;  1Z7R A;  3JCM L;  1F2E A;  1GSU A;  4TOP A;  3GH9 A;  9GSS A;  4MJB A;  1O7U A;  2CA8 A;  1IYH A;  2HFD A;  1PX7 A;  4KB3 A;  2CX4 A;  4HQZ A; 
#chains in the Genus database with same CATH homology
 2VL2 A;  2K6V A;  2JAD A;  3DVW A;  2TIR A;  4EDY A;  2L4C A;  2H66 A;  2VM2 A;  2A4H A;  4CY8 A;  4IS0 A;  3DWV A;  4ZIJ A;  5G2Z A;  3KD0 A;  4NMU A;  2LTK A;  5C00 A;  2GZP A;  2CVD A;  4O7H A;  2AAW A;  4GSN A;  1W4V A;  2E0Q A;  2R6K A;  1YF0 A;  2F9S A;  3CBU A;  2WGR A;  1DSB A;  5ECO B;  5KN0 A;  5ECL B;  1B8X A;  4KE3 A;  3TJB A;  4I6X A;  3LYP A;  1RW1 A;  2KLX A;  1ZYN A;  2LS5 A;  4X1U A;  3QOU A;  1TTZ A;  4Z2R A;  4ECC A;  3F4S A;  2C3T A;  3KIJ A;  3O3T A;  3ZVJ A;  4PTS A;  5JWQ B;  2IFQ B;  2YPM A;  1MTC A;  2YV7 A;  3HD5 A;  3HJO A;  1S3D A;  3GA4 A;  1NM3 A;  2N5F A;  1OC9 A;  2C1Y A;  1SJZ A;  2YAN A;  3APS A;  2WFC A;  5D73 A;  2V2G A;  4OMV A;  1WRY A;  1TK8 B;  4ZL8 A;  3TKS A;  1PX6 A;  4O5Q A;  1OVN A;  4YQU A;  4KND A;  3ZIV A;  4XS4 A;  1PA3 A;  3KH9 A;  3FZ5 A;  2MBS A;  3H4K A;  3G7I A;  1WE0 A;  3MNG A;  3KGK A;  1PRX A;  3ERG A;  3UOM A;  4GLT A;  4DSQ A;  2A2P A;  3G9B A;  5HFG A;  4Z2U A;  1OE8 A;  1BQ7 A;  2HRF A;  5JCU A;  5J41 A;  3ZIT A;  2XPD A;  1ST9 A;  4K2X A;  1XCC A;  5IO0 A;  5LCZ A;  2YZU A;  2RLI A;  1PKZ A;  1K0B A;  1H75 A;  3MYD A;  4GF0 A;  3ME7 A;  1B9X C;  2IMI A;  2QSI A;  11GS A;  4DVC A;  5EY6 A;  5BRT A;  4K2D A;  4PXO A;  1HNA A;  3QPM A;  3QAW A;  1QQ2 A;  2NDO A;  2OJL A;  19GS A;  1PL1 A;  1ZZY A;  2YNX A;  4NPB A;  3HYP A;  1TRW A;  2H1B A;  2LST A;  4P3Y B;  1O6J A;  2YV9 A;  4PUF C;  2FHE A;  3SBC A;  2QC7 A;  1M9A A;  1K0D A;  2C3N A;  5F06 A;  3LXZ A;  3C8E A;  2AV4 A;  3GX0 A;  1X9M B;  3D4M A;  4TXO A;  1BAY A;  2XBI A;  1MEK A;  4ZL9 A;  1SL1 B;  3MWH A;  1AAZ A;  8GSS A;  4F0B A;  3KJY A;  3EIN A;  3C71 A;  5ECQ B;  3FMW A;  5CRW A;  4I97 A;  4MMM A;  1SU9 A;  4ECJ A;  2HLS A;  2FWG A;  1GWC A;  1BX9 A;  2YWN A;  3C1S A;  4MH2 A;  1KNG A;  2LRN A;  4ML6 A;  3QAV A;  4TR4 A;  5D93 A;  4K7N A;  2D2Z A;  2H74 A;  1B9Y C;  3ISO A;  1YY7 A;  3F9U A;  4PQI A;  1WPI A;  5ECP B;  1QK8 A;  2L6D A;  4FH8 A;  1GSQ A;  2VD1 A;  3DXB A;  2C4J A;  3HA9 A;  4OO5 A;  1TK5 B;  3RAZ A;  3TJF A;  3P7X A;  1WOU A;  1FG4 A;  2MMA A;  2M46 A;  4XS6 A;  2FWH A;  2N5B A;  3DVX A;  4PQH A;  2ON7 A;  3GTU A;  4XIH A;  1I9D A;  2L4Q A;  1X5E A;  4POB A;  1XZO A;  4YKG A;  2A2R A;  1PD2 1;  2VLT A;  4F82 A;  4YKF A;  3H93 A;  2H72 A;  1XOB A;  2HI7 A;  3CTG A;  4G2E A;  1W89 A;  3BOA A;  5IPH A;  4KH7 A;  4ZXG A;  2IIY A;  1LJR A;  3I69 A;  2VUP A;  4EIQ A;  1F37 A;  4FO5 A;  3IC4 A;  5D8I A;  3IDV A;  4KUN A;  1F9M A;  1PL2 A;  1HYU A;  2HSH A;  2LUS A;  4IP6 A;  4TW5 A;  2JZR A;  3IV4 A;  1SJI A;  3PPU A;  2VCZ A;  3FZ9 A;  2FWF A;  2K8V A;  2CZ2 A;  3KMO A;  4L5O A;  2I4A A;  1QFN A;  4ID0 A;  3ME8 A;  4LA1 A;  1X9S B;  3DML A;  2VD0 A;  3KZQ A;  2I3Y A;  2GQM A;  5F07 A;  2M80 A;  4MH3 A;  1ERU A;  2C3Q A;  4MZC A;  5G1K A;  3EWL A;  5ELG A;  2AHE A;  4EKZ A;  2VCW A;  1YDK A;  1MD3 A;  12GS A;  3GSS A;  1DE1 A;  3GH6 A;  4CY6 A;  2H8L A;  2C80 A;  3LSZ A;  5LD0 A;  4J57 E;  2R0C A;  4WBJ A;  4MA9 A;  3HZ4 A;  2HZE B;  1YF1 A;  4HU7 A;  2G2Q A;  2HE3 A;  4PX1 A;  3ZRE A;  5ECH B;  1YEX A;  1TJD A;  3GKN A;  1SD8 A;  3DKS A;  1ZGN A;  1J9B A;  3FK8 A;  3RBT A;  1B4Q A;  1TU7 A;  1O81 A;  4H86 A;  3M9J A;  2XBQ A;  5IMA A;  3GV1 A;  4EL1 A;  2VCQ A;  4K7I A;  2H0H A;  1XBS A;  2K9F A;  1SK1 A;  2DJ1 A;  1TOF A;  2OBK A;  4ZL7 A;  5IPG A;  5ID2 A;  2L5L A;  3G7J A;  3WT2 A;  4BVX A;  1VF2 A;  1GSF A;  1GTA A;  5F0G A;  3WGX A;  5GZZ B;  2GSQ A;  1VF4 A;  5A4W A;  2WRT A;  2XC2 A;  4K9Z A;  4ILF A;  2PGT A;  2PVO C;  2JZT A;  1THO A;  3GHA A;  3D4T A;  4L0U A;  3LGC A;  1GUL A;  2FLS A;  1WP0 A;  1X0R A;  7GSS A;  4MAB A;  4KW6 A;  3QDN A;  3S9F A;  1XWK A;  4IJ3 A;  5CAX A;  5DBQ A;  3ZMK A;  4NWY A;  4HJM A;  2WUL A;  4HQS A;  4IQA A;  2B1L A;  3LYK A;  5B7C A;  5IM9 A;  4YQM A;  2IPA A;  4IBP A;  3VPQ A;  4HJ2 A;  3F4R A;  4ECI A;  2NPB A;  1OC3 A;  1DE2 A;  3TKP A;  1KBN A;  2P5R A;  2ZUP A;  2PN8 A;  4CW9 A;  1ILO A;  2MMZ A;  5HR3 A;  3FZA A;  5J5N A;  2JL4 A;  5H5R A;  1DUG A;  2AJQ B;  1C72 A;  2I9H A;  4ACS A;  3IE3 A;  2DIZ A;  3EU4 A;  5CRE A;  1TU8 A;  1AW9 A;  3I6A A;  1R5P A;  2GVP A;  2HZF A;  2VO4 A;  1XFL A;  4N30 A;  1M2A A;  2J23 A;  2GQL A;  4XCS A;  1GSE A;  4KGI A;  4HZ2 A;  2QGV A;  3GN3 A;  2CV4 A;  4K8M A;  2H6Z A;  4OFN A;  5H5Q A;  3FEU A;  4LL4 B;  3VPT A;  1PN9 A;  22GS A;  2F3M A;  2HXK A;  3LW9 A;  3UJ1 A;  5IOX A;  1ZOF A;  2PU9 C;  14GS A;  2YJH A;  2R37 A;  2H70 A;  5KN1 A;  1O8W A;  5AN1 A;  3LJR A;  6GSU A;  1BYE A;  3EYT A;  2YWM A;  1U6T A;  1S3A A;  3KH7 A;  5F8B A;  2DC5 A;  4MJE A;  4NAX A;  2EIR A;  5L71 A;  1YJ6 A;  2GGT A;  3TRX A;  2AB6 A;  4JRR A;  3C73 A;  4OCE A;  1N8J A;  2IFQ A;  4RQX A;  1NW2 A;  1VF1 A;  1RQM A;  5JWO B;  3IC8 A;  3GMF A;  2B1K A;  3U5R E;  1WWJ A;  3A2W A;  3A5W A;  1Y25 A;  1X5C A;  2VLV A;  2L57 A;  1GTU A;  5B8B A;  4K5S A;  3GKK A;  2DIY A;  3LEF A;  4FYB A;  3M9K A;  4TR1 B;  1IYI A;  1AQW A;  2O87 A;  4G0I A;  1GSS A;  2YOI A;  3HVV A;  2Z9S A;  1HNC A;  2CVK A;  3CYN A;  1GNW A;  1EZK A;  4PGT A;  4EO3 A;  2GZZ A;  3O76 A;  4BL7 A;  2RM5 A;  4F9Z A;  1FW1 A;  1PSQ A;  2DJ3 A;  2CVB A;  2B5Y A;  4QL9 A;  3KM6 A;  1AC1 A;  3D22 A;  3VFI A;  4JZQ A;  2AUV A;  2DJJ A;  3FZ4 A;  3J7Y b;  2IME A;  4EDZ A;  3V1W A;  4V2N A;  2FNO A;  4TN8 A;  4GCI A;  1OE7 A;  3GIX A;  1GUM A;  5CNW A;  2H6X A;  2YWO A;  1SK0 A;  2V6K A;  5D9X A;  2H0G A;  2H1D A;  2RUE A;  3E9J B;  4RUV A;  2BMX A;  2B7J A;  2DLX A;  4G0L A;  2DBC A;  2V6O A;  3ZZX A;  4X0X A;  3CSJ A;  5ECN B;  3NOF A;  3FR3 A;  1A0R P;  2H30 A;  3HJM A;  4IEL A;  5IMV A;  3NZN A;  6GST A;  5ECI B;  3M0F A;  1KTE A;  3QD9 A;  1J0F A;  4JBB A;  1K0M A;  1M9B A;  2MZC A;  3UEM A;  5ECK B;  2HT9 A;  2H73 A;  2FUG 2;  3I43 A;  3UVT A;  4TR3 A;  3MDK A;  3RPN A;  5IMF A;  1A24 A;  1GNE A;  2GT5 A;  4X43 A;  1CQG A;  3GST A;  4ISD A;  5HR2 A;  1SD9 A;  5GAP D;  2EIO A;  1WIK A;  2NVL A;  4J56 E;  4GRF A;  5A4U A;  3LFL A;  2IN3 A;  1FAA A;  3PR8 A;  4TRX A;  1O73 A;  2V41 A;  4MJC A;  4O32 A;  1JHB A;  5COH A;  2VCT A;  1G7O A;  3GKX A;  1ML6 A;  2WS2 A;  1F6M C;  4V1A p;  5DAK B;  4L5L A;  5ABR A;  3ZML A;  2LNT A;  4ULX A;  2F8A A;  3APQ A;  2VCV A;  3LG6 A;  2YJ7 A;  1T4Z A;  1V9W A;  4EE0 A;  3GUS A;  4Q5Q A;  2VOC A;  1XW9 A;  1M7T A;  2GTU A;  3IHG A;  2YP6 A;  2JAC A;  2X8C A;  3NIV A;  2H6Y A;  5HQP A;  5CRD A;  4N10 A;  3KTB A;  3UAP A;  1GSD A;  3DD3 A;  5J4U A;  5INY A;  5DJL A;  2IL3 A;  2C0G A;  5D9T A;  2YZH A;  5KN3 A;  5IMD A;  3IK9 A;  2H1G A;  5AGY A;  2X99 A;  3KTL A;  3RHB A;  4WF4 A;  1F3B A;  1SL0 B;  3D0Z A;  3FKF A;  3IK7 A;  2X8G A;  2O85 A;  3GYK A;  1OC8 A;  2TRX A;  2LJK A;  2H75 A;  2JZS A;  5B8A A;  2MYG A;  1Z9H A;  2GLR A;  4D73 B;  3WD6 A;  3I9V 2;  10GS A;  4KF9 A;  3L9S A;  1U87 A;  3DRN A;  4MCU A;  1Z7P A;  3ZTL A;  1U3I A;  2X8H A;  3M3M A;  1GUK A;  2H76 A;  5G31 A;  3L4N A;  1FOH A;  4TVE A;  4XS1 A;  3C7M A;  4V1A g;  1ERV A;  4I5Q A;  3QCP A;  2R2J A;  3F8U A;  4MZB A;  1FB0 A;  4Z2T A;  3A3T A;  4OFM A;  2BTO T;  3E0U A;  1X9W B;  4N0Z A;  3ZIJ A;  3HHV A;  3ERW A;  5HR0 A;  4O5U A;  3A5I A;  4AGS A;  1WMJ A;  4JR6 A;  3WT1 A;  5DQS A;  5J9C A;  2WJU A;  2HZE A;  3TJG A;  4XS4 B;  3F3R A;  3PH9 A;  3RPP A;  4KDU A;  2F51 A;  3VI7 A;  3GRX A;  1HNB A;  3Q19 A;  4MF5 A;  1HQO A;  3EPT A;  1A2J A;  2JU5 A;  4MP4 A;  1NHO A;  4RI7 A;  3VWX A;  2UZ8 A;  4BVY A;  1SKW B;  5DAL A;  3P90 A;  2EIQ A;  3GUR A;  6GSX A;  1TXX A;  2R3X A;  1XWC A;  2NBS A;  4WKW A;  4WXT A;  2WCI A;  4K5R A;  4FYC A;  5ECM B;  1Y6E A;  3DYR A;  3ZYW A;  1YZX A;  2PER A;  4KCE A;  2DMM A;  4F2I A;  3FR6 A;  2CT6 A;  5DVB A;  3UIW A;  3TJJ A;  4MNN A;  4O5R A;  5A5K A;  3TOU A;  2OAC A;  5B6N A;  3UVH A;  2LRC A;  5FT3 A;  2PMT A;  1FOV A;  2VL9 A;  2GQK A;  4E8H A;  4IVF A;  3DEX A;  4JU5 A;  4PUR A;  1R5A A;  5CYY A;  4XRD A;  1V98 A;  3UAR A;  3TUE A;  3QFA C;  2CZ3 A;  1T4Y A;  1E2Y A;  4G19 A;  1FHE A;  3OR5 A;  2GS3 A;  2REM A;  4POM A;  5HFI A;  4NHZ A;  3IAS 2;  2KP2 A;  4DSR A;  1Z3E A;  1MDK A;  3K8N A;  1UN2 A;  1TP9 A;  4ML1 A;  4QQ7 A;  1M2D A;  2QKE A;  3J7Y k;  2MMO A;  2VL2 C;  2B5E A;  3H79 A;  1QGV A;  3GTU B;  4CHS A;  3MAK A;  4GQF A;  2C0E A;  3N5O A;  3IR4 A;  3HVS A;  2YN1 A;  1R7H A;  2PUK C;  3SWL A;  5J3R A;  2EC4 A;  2E2G A;  2J9H A;  1GUH A;  1GTB A;  3TDG A;  4GTU A;  4IW9 A;  5CRG A;  3IBH A;  4V2L A;  1QMV A;  5B6M A;  2VL3 A;  4I2U A;  1XW6 A;  3IOS A;  2RII A;  3FYG A;  4F03 A;  1UC7 A;  1A8Y A;  1XOA A;  4TR1 A;  4IJI A;  1K0A A;  2R4V A;  2P5Q A;  5E59 A;  2HNL A;  4O92 A;  1QXH A;  3WYW A;  4KDX A;  3U6V A;  4KSO A;  3US3 A;  3ZFB A;  2PWJ A;  4JED A;  3CRU A;  3FHK A;  1EOG A;  4ZBA A;  1K0C A;  3A2V A;  4K0G A;  3VLN A;  3W8J A;  3QFB C;  3HY2 A;  5KN2 A;  2E2M A;  4K7O A;  4OCF A;  3Q18 A;  1G0T A;  3L9U A;  5E4W A;  1FVK A;  3TKS C;  3BJ5 A;  2GDR A;  5DDL A;  4MF6 A;  2PVQ A;  4WBR D;  4HEA 2;  3AY8 A;  3PGT A;  1F3A A;  2ZNM A;  4K1F A;  1JZD A;  2O8V B;  1XW5 A;  2MMN A;  1EEJ A;  1XVQ A;  2KOK A;  1TK0 B;  4KCA A;  3PIN A;  1VF3 A;  3LOR A;  1PKW A;  3MIX A;  1Z6M A;  1K3O A;  1TI1 A;  1X5D A;  1U3A A;  4FYU A;  1BED A;  1BJX A;  1GLP A;  3IHQ A;  4BA7 A;  2LRT A;  4IKH A;  1ERT A;  5HR1 A;  3W6G A;  2H1A A;  4XRA A;  5G5F A;  17GS A;  3KXO A;  1R26 A;  3DGQ A;  4MJA A;  2H19 A;  4J2F A;  4GST A;  1AQV A;  5JCW A;  5ELA A;  4QL7 A;  2IMD A;  2QA2 A;  3QR6 A;  2LV3 A;  4HUA A;  3ZLP A;  5IQY A;  1PQN A;  1CQH A;  1DBY A;  1SKR B;  4HDE A;  4AJ7 A;  5ID2 B;  4BVX B;  2OE3 A;  2C0F A;  2YCD A;  3EE2 A;  3BBY A;  5G5E A;  1GL8 A;  1NHY A;  2I81 A;  1XXU A;  1YKA A;  1XWG A;  2O89 A;  1EEM A;  3Q74 A;  4GXZ A;  5ENU A;  5KOW A;  5CP1 A;  3FRC A;  3TKQ A;  2WZ9 A;  3EMX A;  1B48 A;  4RI6 A;  2V1M A;  20GS A;  3GNJ A;  2LEG A;  5DAK A;  2KUC A;  2OE0 A;  1Q98 A;  4XTS A;  5D9W A;  3E3E A;  2KHP A;  5ECS A;  1GRX A;  2I1U A;  4HS1 A;  4NHW A;  1SJ6 A;  2DJ0 A;  3W8S A;  1YEP A;  1UVZ A;  5FHI A;  1MDI A;  2DKH A;  5G30 A;  4TXV A;  4AJ6 A;  1TW9 A;  1A8L A;  4MZW A;  2TRC P;  4PQ1 A;  2LQO A;  1HD2 A;  1SYX A;  2FWE A;  4WR4 A;  5LNK e;  2F8F A;  5CO3 A;  3CTF A;  4HOJ A;  4AF2 A;  2QA1 A;  1FB6 A;  4POK A;  1G6Y A;  1SEN A;  4K0N A;  4PUA A;  1M99 A;  1G7E A;  4HI7 A;  2OAD A;  2B5X A;  3HXS A;  3GKM A;  1ZYE A;  2OA7 A;  1K0N A;  3L0H A;  2P0G A;  1V57 A;  3DIE A;  3HDC A;  4D73 A;  3VUR A;  3WGE A;  1T1V A;  1A23 A;  5DCH A;  5F05 A;  1A0F A;  4POL A;  4FQU A;  1O8X A;  4N11 A;  2HRK A;  2N5A A;  4IP1 A;  2R5G A;  1V2A A;  4L8E A;  3VK9 A;  2DJ2 A;  2A2S A;  2LJA A;  4LLR A;  4EC0 A;  3M1G A;  5CRH A;  3ZVJ D;  6GSS A;  18GS A;  3LQ7 A;  3C1R A;  4EXJ A;  1B4P A;  2LJR A;  4DSS B;  3CMI A;  1JFU A;  1GTI A;  1JZW A;  2ON5 A;  1GP1 A;  2C8U A;  3LXT A;  5ECR B;  3BCK A;  3H8Q A;  1A2L A;  3CXG A;  4GSS A;  4OO4 A;  2ES7 A;  3VWV A;  1OYJ A;  3HZ8 A;  1R4W A;  2VLU A;  3IAM 2;  4BL7 B;  4KX4 A;  5G1L A;  2GSR A;  1FO5 A;  2HRN A;  3GX8 A;  4HZ4 A;  2L6C A;  4Q5N A;  1XIY A;  2VIM A;  1K3L A;  2WDU A;  3P2A A;  1XWA A;  3VWW A;  4MK3 A;  4AJ8 A;  4BPY A;  1T00 A;  3A2X A;  5AIX A;  3D21 A;  3BD2 A;  4TKY A;  4IHU A;  1ON4 A;  1LBK A;  4CDO A;  1EV4 A;  1XPV A;  1AXD A;  1U88 A;  3ZL5 A;  5JWR B;  4GWR A;  1J08 A;  3GL5 A;  4I8B A;  1QUW A;  5KEJ A;  2LQQ A;  1VGL A;  3P8W A;  3L78 A;  1BG5 A;  4XHM A;  4Q5F A;  3F4T A;  3IXR A;  1YQ1 A;  2V32 A;  5IMZ A;  2HSM A;  2LKU A;  3KEB A;  4NXI A;  1V58 A;  2R0P A;  2VCX A;  2GST A;  3EU3 A;  2O7K A;  3FY7 A;  1TKD B;  1ERW A;  1SL2 B;  3QMX A;  3TOT A;  1NSW A;  3TJK A;  4ZB6 A;  3UL3 A;  2X49 A;  1THX A;  2ZCT A;  4YQV A;  2L59 A;  1PMT A;  1LU4 A;  3HJP A;  4WEY A;  3KP8 A;  1TRV A;  1OC9 B;  4ZIL A;  2A4V A;  2H71 A;  1TRU A;  1AUC A;  1WJK A;  6GSW A;  2DSA A;  4FIW A;  3F0I A;  4MPF A;  4ZBD A;  1H4O A;  2CAI A;  4ZBB A;  5GST A;  1T3B A;  1E6B A;  1ZCP A;  1GLQ A;  3GFK A;  2XPE A;  3HKR A;  1V40 A;  1YKC A;  5IIZ A;  3EMP A;  3LWA A;  4A5P A;  2AYT A;  2NTO A;  2C0D A;  1USB A;  1FVJ A;  2K8S A;  1ABA A;  2BJX A;  3EVI A;  5EVO A;  2GZY A;  5A4V A;  2YWI A;  2B6M A;  4K6X A;  2HRA A;  2LNS A;  4MPG A;  4X4J A;  2K18 A;  3R3E A;  3Q6O A;  1JZO A;  3EUR A;  1Z6N A;  5JCG A;  1ZL9 A;  2IMK A;  1UA5 A;  3IPZ A;  5AIV A;  3TB2 A;  2R0G A;  4ECB A;  4KA0 A;  5C04 A;  1RK4 A;  3KMN A;  3F6D A;  2VAF A;  5H5S A;  1G6W A;  3D6I A;  4TXO B;  2X4A A;  4EF0 A;  2IJY A;  2E7P A;  3CRT A;  4WET A;  1T8E B;  5AIS A;  4EVM A;  1KEB A;  2WB9 A;  3APO A;  3FR9 A;  2OBI A;  5IOW A;  2CX3 A;  2HYX A;  1XVW A;  3HVX A;  1ZMA A;  4I2T A;  4KSM A;  3F6F A;  1AQX A;  3TCO A;  4BWQ A;  3G7Y A;  4WF5 A;  4ICY A;  4LMV A;  2M72 A;  4V2M A;  3CSI A;  4PNG A;  3UBL A;  1AIU A;  2L5O A;  3KCM A;  2FA8 A;  4OD7 A;  5GAN D;  4RQR A;  4L0W A;  1N2A A;  3EC3 A;  3R2Q A;  3M8N A;  3KP9 A;  4NV5 A;  4YH2 A;  3L9V A;  4LL1 B;  2B7K A;  1EP8 A;  5IMC A;  2JSY A;  4F0C A;  3VI5 A;  5HFK A;  1SYR A;  1O85 A;  4Z7X A;  4BWS A;  4N0V A;  3MSZ A;  13GS A;  2CQ9 A;  1OKT A;  4YAV A;  4MDC A;  1PGT A;  5EPF A;  1M0U A;  1EOH A;  5D96 A;  1JLW A;  1SKS B;  4G10 A;  4BVY B;  3ED3 A;  5DAL B;  1XWB A;  4KAE A;  4IGJ A;  1TDI A;  4JR4 A;  2PBJ A;  4ZB8 A;  2FA4 A;  2FD3 A;  4IQ1 A;  6GSV A;  2GT6 A;  1Q4J A;  5BMU A;  4YAP A;  3IRA A;  5DJM A;  4E8E A;  2RM6 A;  1K0O A;  2CAQ A;  4G0K A;  1A2M A;  3IA1 A;  1EV9 A;  2HSY A;  1OAZ A;  1ACV A;  2IMF A;  4EIP A;  4EUY A;  2FCH A;  3ZRD A;  2FGX A;  3H1N A;  16GS A;  3GL3 A;  1PN0 A;  3BCI A;  3RHC A;  2ALB A;  2FY6 A;  1GH2 A;  1S3C A;  1EP7 A;  1URM A;  4MF7 A;  3O6T A;  1EGO A;  1JZR A;  4MLY A;  1MD4 A;  4HU9 A;  4USS A;  5DCG A;  2B3S A;  2X64 A;  2MBT A;  1Z5Y E;  1VRS D;  1ZYP A;  4LMW A;  4TR0 A;  3TGZ A;  5FWG A;  3QAG A;  4ZB9 A;  2H0I A;  4OFT A;  2IWT A;  1ZYQ B;  1I5G A;  4JE1 A;  2XHF A;  4KDY A;  4DEJ A;  1OKD A;  2DJK A;  1MDJ A;  1GSY A;  3TRP A;  3FW2 A;  2JSZ A;  3RDW A;  1TRS A;  2G0F A;  4WR5 A;  3UMA A;  1K3Y A;  3ZFL A;  2GSS A;  1M2B A;  4Q5R A;  1TI3 A;  3F63 A;  2OE1 A;  4G9H A;  3WGD A;  3UBK A;  3HCZ A;  4PNF A;  5D9V A;  3CSH A;  3TKS E;  1EGR A;  3ERF A;  5DQY A;  1T7P B;  5J9B A;  3F3Q A;  3TKR A;  3VWU A;  1JLV A;  2P31 A;  5EL8 A;  4DSS A;  3D5J A;  4NV2 A;  1SK2 A;  4GQC A;  2DML A;  2RUF A;  2KP1 A;  2PPT A;  2DKI A;  2H01 A;  3TRQ A;  2VM1 A;  5KOX A;  2OKA A;  6GSY A;  5IO2 A;  3N9J A;  4OWY A;  4IN0 A;  1EWX A;  5GSS A;  1Z7R A;  3JCM L;  1F2E A;  1GSU A;  4TOP A;  3GH9 A;  9GSS A;  4MJB A;  1O7U A;  2CA8 A;  1IYH A;  2HFD A;  1PX7 A;  4KB3 A;  2CX4 A;  4HQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...