3HWJA

Crystal structure of the second phr domain of mouse myc-binding protein 2 (mycbp-2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
161
structure length
149
Chain Sequence
b'LNRFTKTSQGRSWNTGNGSPDAICFAVDKPGIVVVGFAVYGGGGIHEYELEVLVDRWTSLELVKGTYTTDDSPSDIAEIRLDKVVPLKENVKYAVRLRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTRGQIPQILYYRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords E3 ubiquitin-protein ligase MYCBP2
publication title Structures of PHR domains from Mus musculus Phr1 (Mycbp2) explain the loss-of-function mutation (Gly1092-->Glu) of the C. elegans ortholog RPM-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
total genus 34
structure length 149
sequence length 161
chains with identical sequence B
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.820 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hwjA00
3GBWA 3HWJA 3NO8A
chains in the Genus database with same CATH superfamily
5A7QA 2RJLA 5EHDA 5FZLA 3QLQA 2W1UA 4JKLA 4Q8KA 1HRI1 2RM21 5BY5A 2WRAA 3PLQA 4DY5A 2VCAA 2BEOA 4NHLA 4Y26A 3C2UA 4JGZA 3BTZA 3URFA 3GBGA 2IXIA 4FPKA 1HXS3 1UL9A 1VALA 1DQ4A 2JG9B 3JBG2 4J6GA 5A32B 5FREA 1V00A 3NNMA 2V73A 2A70A 4Q0VA 1DGWX 1N47A 4CDQB 2Y6FA 5K0UA 2UYAA 1MZEA 4UI9L 5EP9A 1C5IA 1LODA 2XWJB 1K5JA 4IE5A 2WZR1 2F4PA 5FZ8A 4I30A 4RQPA 4TLFA 4E8CA 3OUJA 3WF1A 3ZM8A 4XQ4A 3E6BA 3ABZA 1CONA 1MPXA 2PHLA 1HB1A 1N3QA 2VVFA 4K20A 1ULPA 2BNMA 2JIGA 4PQQA 4RFT0 1SLBA 4AEMA 2VUJA 4D94A 5KXDA 1HN0A 2QDRA 1JU4A 2ZTNA 1RUH3 2YFZA 4CUCA 4QM8A 3I2IA 3ZPOA 1U5ZA 2R043 3USSA 2VCCA 1NZCA 3RWNA 4UF0B 4CU6A 2UU8A 1O3QA 2GU9A 2DCZA 2VAUA 3Q8AA 1QXPA 1WLWA 2CY6A 1E5IA 2AR6A 1NT0A 5FZGA 1SFPA 1GU3A 3UYJA 1S0FA 3RZHA 2WN3A 1RHI2 3BOPA 3GGLA 4CDXA 4ES9A 4MHUA 3H8RA 2P1BA 1K3IA 3FUQA 1AXYA 2NLRA 4PF1A 1BBT1 5FP3A 5I0RA 4ATEA 3WF2A 3KCCA 1O3TA 1FX5A 1VAKA 1OFNA 2GNDA 5C8CA 1S1AA 4NO4A 4HXCA 1F8VA 1JW6A 1FPN3 1VRH2 5GZGA 2FDGA 2PHRA 5KXCA 4C0BA 2XJTA 1AF9A 3WNNA 1EY2A 4ASLA 1QJEA 1W06A 1S0EA 4Q1RA 4YW7A 1OVSA 1WA6X 3W21A 1QNYA 5JXGA 1VJ2A 2YUEA 4YW6A 4UBHA 5FZAA 1DYKA 3ZSMA 3UGGA 4QPYA 1CJPA 4M00A 4YVWB 2WWSA 1W9SA 3C8XA 1RTVA 4P00B 1L7LA 3MGUA 4XAAA 3DEMA 1VMJA 2X29A 1DZRA 1F35A 3GZEA 1TMF1 1V9U2 3LF7A 1ASJ1 1BLZA 4I01A 1H1IA 2AC1A 1PHMA 3IN9A 4XVHA 3WW2A 2AZ5A 2ZGLA 5EJ3A 3M3CA 4AGGA 4LIUA 4CUGA 3MLKA 5FWEA 1YNAA 3M2MA 1H30A 3POGA 4D6RA 1GZWA 4GJYA 2H6BA 3H0OA 4CDUA 1KGYA 3HBKA 1FATA 1YQ6A 5GKAC 3BN6A 1OQDA 2XJRA 4FOYA 5GZFA 3RWKX 3VL9A 1V0AA 1CAVB 2J1UA 1PVC2 5JOWA 1RUF1 1EV13 1XBFA 4YM3A 3KV6A 4ISRA 3ILFA 1I1EA 1H9PA 3NV3A 1LGBA 2JE8A 3ZYPA 5M0TA 1PMJX 5T5JA 4MGIE 1ZYBA 4L8QA 4DXSA 4ZKTB 3BU0A 4HBNA 4IE6A 4XILA 4QPGB 3A23A 3IAPA 2OT7A 1AR61 2PXJA 4QT6A 4AE2A 4RYDA 1JHNA 3B69A 1IS6A 4GQ7A 2CWSA 2J1AA 2WNUB 4AQ2A 1LNSA 2VMEA 1AJKA 1AYM2 4G4FA 4H55A 4SBVA 4CCKA 1WW4A 2JICA 3A0KA 5LBBA 1LKNA 2DFBA 2FCTA 3IWZA 4LO8A 3AX4A 4Y5Z0 3VLBB 1W2OA 2RS32 4QPIB 3ZO0B 1MQTA 2PFWA 3QD6A 4KWKA 5KHJA 4QMAA 3A0NA 1IPJA 3I8TA 4Y3OA 5BV6A 3ZXJA 1NCRB 1OC1A 2ENRA 2VTFA 1W6QB 2HWD2 2PLV2 1GP4A 1NX9A 2YU1A 1C5HA 5JMCA 1T6BX 3RI8A 1OFSA 2HWB2 3B3QE 4HSJA 1BJQA 3WW1A 1ZVFA 5FZBA 1GQPA 2Y38A 3UETA 2FDFA 4YRDA 1DCSA 4IEQA 1W0NA 3NKGA 3S7EA 2MEV1 2Y6LA 5FZKA 3USUA 1FMD2 2JKXA 3ELNA 1LENA 4ZU4A 1RL3A 2OVUA 1RUE1 4CEYC 1ZBA3 3AYAA 3FL7A 1QKQA 4LBLA 1SACA 1PIV3 2CTVA 2XHKA 2CHHA 4HKOA 4FVVA 5FY9A 3VBUC 1PO22 4AFAA 4BMBA 3VBHB 2WT1A 4OVEA 1WGPA 1RIRA 1TQ5A 2DVBA 5FTTC 1MS3A 4PF5A 2DURA 4QXHA 2Q0AA 4GMP3 4RGAA 1VBB3 3SNMA 4RFRB 1CZVA 4PBPA 4XUOA 3AYEA 4K8RB 4XJWA 1AR91 1Q56A 2WN2A 3AYCA 1LOAA 3H8UA 1RXFA 4MADA 4XF4A 5I91A 2Y8KA 2XKOA 3ZFGC 2B39A 3QOPA 3EBRA 1HB3A 5BNPC 5HV0A 3AP6A 3E5UA 5LRRA 2W0XA 3ZR5A 2R1DA 2WUHA 3T1LA 1WLCA 2Y0OA 4D0QA 4YGCA 1Y3TA 5T5PA 3WLUA 4YFWA 4AI0A 3TN93 4AQ6A 2EIGA 1Z7S3 4XBQA 1QH7A 3HOBA 3T2QA 1ULCA 4YZ2A 1L7RA 1Y9GA 3CKHA 4XF9A 4ITCA 5L7OB 5C33A 3OEBA 2QJVA 2XQRA 3D8CA 3GM8A 4YVSB 1YLLA 3H1WA 4Q4V2 1JTZX 3POSA 2VZTA 2HLEA 2PQSA 3UL2A 1GR3A 2YMZA 3HBZA 4OUMA 3AP5A 2VZRA 4OFGA 3RZGA 4O9GA 1DU3D 1BEV3 1COV3 1XNTA 3WQ7A 4BCUA 4Q4W1 3OPZA 4W6YA 4K6BA 4Y1UA 4S2HA 5A7SA 4K3UA 3VBRB 4QPGC 3G6JB 2VE1A 3AKTA 3FLPA 3GCWA 3K4ZA 2YV8A 3BU7A 4JKMA 2RS11 2WNUC 4SLIA 2WZPP 2RS51 2D3PA 4N7UA 3ZFFA 4GAZA 4V1PA 5LBEA 3SITA 1NLRA 4LBQD 1IHMA 5C5TA 3H50A 5JDBA 4LEJA 4RGGA 1G9DA 4CCLA 1TNRA 4QPIC 3TAYA 2HKXA 1Q8VA 2VBPA 1J3RA 2BVBA 2E9QA 2K0GA 3BVCA 3G7DA 3VKFC 2ETEA 4FI9A 4OHZA 2BWAA 1NCRC 4UFKA 1OOPA 2DVDA 3S7IA 3IMMA 3V0BB 2WWUA 4AEDB 2C0ZA 5GALA 4YZ5A 3O1TA 2XR4A 1GZ9A 4E2QA 1VBD1 3W5NA 5DMYA 2RM23 2LRPA 3I2HA 1RUD2 1UIJA 2ERFA 2P34A 2R6QA 2BNOA 2ZGPA 3J26N 4Z8BA 4HPKA 1AX1A 2CDPA 3FLRA 1REFA 3WP3A 3CLPA 5FRAA 3ZSLA 1UN1A 1K5MB 2CV6A 5A80A 1HXS2 2ZX3A 4LK6A 1QU0A 3BODA 4UAPA 2X5IC 1R1A1 2CSGA 4RGKA 1KD7A 3D5OA 1JOJA 1RUC2 1W3XA 2HWE3 2EXJA 4KGGA 1B35B 5DUUA 2JG8B 4LO5B 1AYM1 4YW3A 3I2KA 2D6MA 1D7PM 2JJ6A 4P5YA 1IZ3A 1CAWA 2QE3A 4NPMA 1DHKB 2ES3A 2QUOA 1UY4A 2J1TA 4OMCA 1XE8A 1YXWA 3ACFA 4CTEA 1LHOA 2VQUA 2BUKA 2WLQA 2X53S 3HD8B 3ILNA 3SEEA 5CA6A 5FZOA 1JH5A 4LA3A 3OB8A 4AW7A 4CRQA 2PLV1 4FFHA 4A42A 3IPVA 2ZHNA 1GWMA 2G1MA 3SMHA 1W8FA 2DCKA 4AL9A 1H8TB 4GB31 3WW3A 5CFCB 3AP9A 5JUVA 4EE2A 3ROUA 3DPRB 1FOD1 2W5FA 5DZFA 2BFUS 4QDRA 5FYTA 2BRTA 4ZZ8A 4P9LA 5A1LA 1S2KA 2V5YA 3D82A 2DUPA 4FPCA 5F32A 3W58A 3D4KA 4KBZA 3VDBA 1GV9A 2BYVE 2G9GA 1Q8QA 1ND3A 5CIRA 5DXDA 4YVSC 5CFDA 4QQPA 1OQ1A 1G9CA 2IXLA 3C7OA 3DXTA 5DQ0A 1V6IA 4AVTA 3QH6A 1FPN2 4JHTA 1XYOA 5HV4A 1NG0A 1VP6A 2X10A 5IVBA 2BV4A 4KNCA 1ZRRA 4HANA 5DAXA 5FPUA 1ACCA 4EN8B 2YPDA 4D6SA 3AM2A 1SFNA 4AQSA 4KI5M 1NA1B 1W8NA 1NYWA 2VQAA 3AMQA 2VZSA 2GDFA 1NKGA 4CVUA 1PNFA 3ENRA 5CAZA 5IVYA 3WDWA 4BIFA 2LTNA 2WQZC 2I07B 3RZZA 1D0HA 1W6PB 3FBMA 1DQ2A 3HNBM 1YQ5A 1TMF3 5FK7A 1GYKA 3LEMA 4NVPA 4IEWA 1AL22 2DUQA 4D69A 1LESA 4AAXA 1V6LA 1UF2C 2HYXA 2WKKA 2R1BA 4L92A 3MUZ1 4XCAA 2D93A 4E9KA 2RE9A 1D0GA 1GQGA 5IK4A 1OSGA 4DPNA 5CG8A 3VZJA 3H3LA 1O4ZA 2XVLA 5C3RA 5DUXA 2DVAA 4Q29A 1X9TA 2YYOA 5JR7B 4OI0A 1MR5A 3P1IA 1FI2A 1PM7A 2YC2A 2ZACA 3Q8CA 3U07A 4NIHA 2GH2A 2YBKA 5LA2A 3EHKA 4AF9A 1MS1A 1K5MC 3OF1A 1TG7A 1AR63 2DV9A 3IKWA 3KSCA 1RUJ2 1QQP1 5C70A 2ZAHA 3I49A 1KS4A 4BU2A 3O1MA 4LHLA 3WUDA 4DOUA 5E89A 1I5ZA 2JG8C 4MSVA 4CPBA 1O3RA 2WLPA 2P6CA 3OBAA 4IE0A 3OTFA 4V2WA 2A75A 1W03A 4BDVB 2LW8A 3TEZA 1HQLA 2OZ6A 1NAEA 1CD3G 1CPNA 2XH6A 3AJYA 4QAWA 2WIIB 3WP4A 4CCOA 2YC0A 2FDHA 4M3CA 2RMU2 4NRQA 2P2KA 4QU1A 3V64A 1MEC1 2WNEA 2WZ8A 2VMCA 1XNCA 2D40A 3IIAA 1RUD1 2CGNA 4LHKA 2MEV3 2ZGNA 4PLNA 4E8DA 5JOZA 4CYDA 4P9JA 2FCUA 4DUWA 1ZRFA 2F6BA 2JXAA 3JBG3 3WNPA 2FBEA 3ES4A 3VBFB 1RUE3 2QZ2A 5A3MA 2XJSA 5IVEA 3RFRA 3OY8A 4DXZA 4K1YA 1ZBA2 1LOGA 1W2UA 2DU1A 4N90A 3AMMA 1K12A 2WS91 2O0OA 4M4PA 5LBCA 1AYN2 2UWCA 3B94A 4KWUA 1AR72 4YZ1A 1SLAA 4LHSA 2R16A 5C6CA 1Z0HA 2R0FA 5B4XA 1WCQA 2JDHA 4AVSA 4I2OA 3W5MA 3HQXA 3QCWA 1U5IA 2W47A 3IDBB 2WSVA 1NA1C 5EJ1B 1V70A 4QGNA 3FHAA 1SHWB 1UOBA 1XSQA 4CEWC 1QDOA 5C8WA 1JMUB 4RHV2 1VLNA 2JD9A 2QQPA 3K3NA 4GA9A 4XTPA 4Q8LA 4BQ5A 1OQEA 1RHI3 4EROA 1QOSA 4PBOA 5FJHA 3F95A 1R092 4GH4B 1NXD1 4XZUG 4FTSA 5LBFA 5JMOA 2QDNA 1YYNA 1QJZA 3WF3A 1XPWA 5G05L 5ABJB 2QQMA 2W52A 4DXRA 2B9VA 1JZ2A 5J7MA 4YYOA 2WFF2 5L9BA 1VRH3 4RA0A 1WCSA 2WDBA 5A32A 3FHQA 4HK8A 3ZXDA 4LR4A 2UWBA 4Q27A 2PTMA 2NQYA 4ZXKA 3RNSA 2HWF1 4Q4W3 3U11A 5LA9A 4CXXA 5JXIA 3WG2A 3BPZA 1BEV2 1CAXB 1COV2 1JU3A 3CDZB 3M8LA 3UKVA 4CP1A 3NV4A 4GULA 5FY0A 4BMEA 3I3EA 4Q0QA 4ZS2A 3PUSA 3H3ZA 1BCXA 4OQ9A 3KGZA 5IFPA 1DFQA 3I7DA 4XFBA 1CIWA 1CZSA 2Z5WA 3VD9A 1U0AA 4QKBA 1YFWA 2BNNA 3MEPA 5GLWA 2D5HA 1W9WA 3LDKA 4N53B 1NE4A 1I6XA 1RINA 4UW3A 5C5UA 2VOWA 2W46A 1ULDA 2R071 3AC0A 3OPWA 1U12A 4H7MA 2FCVA 1JZ7A 2I45A 4UF0A 4ZONA 4AFMA 3U78A 2BPA2 5FP7A 3AKRA 2Z4FA 4NIIA 4CP9B 1BQPA 3PUQA 1SLIA 2HYKA 3O1RA 4X6RB 4F3JA 3BI3A 1HRI2 2RM22 3ZN6B 2D6LX 5ERLA 2UYBA 3K4DA 4CEYA 4HLTA 1JZ8A 1QWRA 1WD4A 2ET7A 1UW8A 3B9CA 4Y20B 1ND2B 5FMOS 2IVIB 3VBUA 1LAJA 1BYHA 1RUJ1 1A3KA 2RJ2A 5H9PA 3T0AA 5LRSA 1Q3EA 2DWRA 4LITA 1AYM3 2D3SA 4XAEA 1UU5A 3HIFA 1SCRA 3FWEA 1RXGA 4NIDA 5FPLA 2WZR2 4FPGA 4GKXA 2RS33 1IKPA 5EV7A 3NNLA 1SG3A 4KBBA 4QKFA 3ZFGA 5BNPA 2X8KA 2B5HA 3ZLIA 1CQ9A 1NLQA 3N9QA 2PLV3 4XDPA 5DAWA 4YW1A 4DUXA 3BIWE 3ZXLA 1W90A 3JD71 3TEXA 3PJQA 4CU7A 2HWB3 5C9AB 4DS0A 1RITA 3BOWA 3LCPA 3ZN5A 1LHUA 3N36A 3T2PA 4QX7A 1FMD3 2BJSA 4Z07A 1OKOA 1UMZA 3W9AA 3NAPB 3BTXA 4GH4C 5CU1A 2RVAA 4XDOA 3JXSA 1NCQC 1PO11 1BBT2 1LEMA 1UZVA 4MHRA 4QD2A 4IV1B 4JX0A 5DZEA 5I8SA 2A6ZA 2DCJA 2ET1A 1LR5A 2Y6GA 3DCQA 1CAVA 4PIXA 5FZ1A 3MPBA 2ZBJA 5AVAA 5I0TA 1F5JA 1OVPA 1PO23 3ZPYA 3OD0A 1S2EA 2ADDA 2C6SA 5E88A 4QX3A 4XDQA 5JIUA 4I02A 4MGTA 2YROA 4YZ4A 4UFMA 3AZZA 5F5IA 1UY1A 4MXWB 1DGRN 4QPGA 1UCXA 2E7QA 4XJ8A 5F3IA 3H7YA 1OLMA 1VAVA 3AB0A 2PHFA 3WDXA 4MGQA 3E5XA 1ZRIA 2XWBB 2PAEA 2WNUA 3I3MA 1FT9A 4AXOA 1HRV2 1OUXA 4XABA 4A7KA 1XNBA 2D43A 2DBNA 4HZFA 2R061 5A70A 4CU8A 2PHTA 1S4CA 4GWIA 4RHV1 5T5OA 1WMEA 4QPIA 4A6SA 4AI9A 1RUG1 5FXWA 4K9SA 3LD8A 2P5BA 2D3RA 3CF6E 4GMP0 4N53C 1LB2A 1OHFA 3CJIB 1NCRA 2WO2A 4JV4A 1TMF2 3MLLA 3I3DA 1ASJ2 4LBQA 2YY1A 5JXHA 1W6QA 4NUBA 5CISA 2DBIA 2DCTA 2EIBA 3ZOIA 3N7KA 4YGEA 3AMHA 1CJDA 4FQZA 4CXWA 1W0OA 4URAA 1UY3A 1UQXA 1CGPA 3U10A 4LO4B 1E57A 2OPKA 2Z42A 3IDAA 4FO9A 1BZWA 4D7SA 2VULA 3WQBA 1LOCA 1CN1A 5T5LA 2QQWA 1RUF2 4BH9A 3VD4A 4L99A 4ZPIA 3RI9A 1YFXA 2X5IA 5FOBB 2WO7A 5DDJ1 5E16A 5K8SA 4LOTA 1RC6A 5JZGC 1LECA 1ND2C 4B4QA 3C7FA 5A3UA 4H7LA 3VL8A 3POYA 1AR62 3C7GA 5D2AA 1GOFA 4AGVA 3IZOA 5FZCA 4LO6B 4EJRA 3ECQA 1EUUA 2RDRA 2WINB 3I3BA 1W9TA 4YM1A 2BGPA 1UWWA 2JECA 4QGLA 2PQQA 4ARYA 5A3TA 2P6HA 5EWSA 1QJX1 5J09A 5FMBA 3I97A 1XOYA 2PYTA 4XUNA 1SBFA 2G4IA 1CAUB 1OKQA 3LOIA 3F2ZA 4DEQA 2PMWB 1E5SA 3J9SA 4AEKA 1EYBA 1RUD3 4A7ZA 3PNAA 3QBQA 1QOTA 1V6KA 1QDCA 3R4DB 3R05A 2UY8A 3ZYJB 4Q5OA 5D8AA 2QQNA 1RMU1 2MEV2 3MV01 1NLSA 3WP5A 2WAOA 5C4WC 3NAPC 1SBEA 3UKTA 5HCAA 1W8OA 2GAUA 4YVSA 1I3HA 1BMV1 2DUOA 4FXKB 2G9FA 1QY4A 1RUE2 4WZFA 5EFUA 4M3CE 2H6CA 3RMXA 1RUC3 1DG6A 3DN7A 3FN9A 3ACLA 4IV1C 5FZMA 3RZMA 2Y6HA 4CPBD 2LALA 2WS93 2OW4A 1JYWA 1AUYA 1K45A 5FCCA 4L9BA 3ZXGA 4OHWA 4DO0A 5A7PA 4FFIA 5GLTA 4AVCA 3TOJA 5T55A 1TZOA 3RVHA 1BK1A 1AR92 5ACA1 1HV0A 2Y64A 4KU7A 4TLGA 1HX6A 5IVFA 5GLVA 2WR9A 1UY2A 3VBSB 1H1AA 1KITA 3ZKYA 2DCYA 2XUEA 4I0AA 1W6MA 1SDWA 3MIBA 1PMIA 4AAPA 3WV6A 2WNVB 3SKVA 3CJIC 3E1F1 4J25A 4EQVA 3V0BA 3DYPA 4M0NA 1ZRCA 1JOBA 4QX2A 2VUCA 2GZWA 5JXJA 3BKZA 1JYNA 4F8AA 1W99A 2BGOA 5KWRA 2MHFA 2Q1FA 2W95A 1CESA 5FY4A 2QNKA 5AC91 3POFA 3GJBA 4XPVA 5FO7B 5APAA 1UX6A 3TEWA 1K5MA 2HBTA 4IESA 4GKYA 2EIEA 4QQLA 1BXHA 3HAGA 5I8YA 3UNPA 4YM2A 4CUAA 1FV2A 2K9ZA 1OF3A 4Q4W2 3RGBA 4QWNA 2Q5TA 3V0AB 2JG8A 3ZYGA 1HRV1 2LROA 1DLLA 3Q9OA 1UXZA 2NM1A 2RS12 3GZTB 4FCAA 4XFGA 1GBGA 4WVVA 2RS52 2BZDA 4IW3A 3U75A 4OULA 3FFZA 3MHZA 3ATGA 1AL23 4JDOA 2A6WA 4S2FA 4DIQA 1JODA 2OQ6A 4QXCA 4BHPA 4OZOA 3ME2A 1GICA 2O1QA 1A78A 5JAXA 1V6OA 1W2AX 3CQOA 1PMHX 3I59B 1VBD2 4X8NA 3WNOA 5FMDA 5IK8A 3LE0A 3R0RA 4V2VA 5HBAA 1YIPA 4Y1ZA 1O91A 5ANQA 3KVAA 5EXOA 4UW4A 4EZ4A 3MF6A 2ADEA 4JRLA 2VPVA 3THCA 4AG4A 4QDSA 3IT8A 5IWFA 3VZOA 4B4RA 5I0SA 2JG9C 1D4M1 1RUJ3 1MS4A 1X36A 2KR2A 4YM0A 2QQIA 2XOMA 3SCGA 3IBMA 1C57A 3HT1A 3VBOB 1R1A2 1LGNA 3IAQA 3RS6A 4CDQC 2OXBA 2XLAA 4WVMB 3MI8A 2XJQA 4OI1A 4I0WB 3NV2A 5JR2A 3ACHA 1LU2A 3ZYFA 3BPSA 3AZVA 4Y1YA 4WM8B 2ZKLA 1ZZ6A 4META 3NW4A 4B8EA 5LZ6A 1CIYA 1H6YA 4CEWA 5FDBA 2IUWA 5LK5A 2RMU3 1OA4A 1R1ZA 3JD73 4P9YA 1DQ1A 3RMYA 2VG9A 1W6PA 5LW9A 2GC1A 2H0BA 3PMEA 3VBSC 2Y6JA 1A8DA 5JIAA 2VNVA 4GB32 3SISA 4LIVA 2VC9A 1FOD2 3Q8FA 4QHOA 4A41A 5IVJA 3T0BA 5FO8B 5LCWL 2W87A 3DL3A 2ZGMA 3RYKA 1PO13 2D6KA 3J7NA 4L97A 4XUQA 5A7WB 4QU2A 5FUNA 1RVF1 3IB3A 4IDZA 4UT5A 5J1XA 5JSRA 2AENA 1ZREA 4Y22A 3FZ3A 4EN7B 2GN3A 3KV5A 1W05A 5DPNA 2E53A 1AYN3 2Z79A 1AR73 4Q4Y1 2VQ0A 2O8QA 3VHOA 2WQ4A 1FAYA 3DGTA 5DZGA 2B9UA 3IDCB 3LQCA 3ZN4A 4AFBA 1W8TA 3V0AA 3TNQA 5HXMA 3H1YA 1UMHA 4NJ4A 3HJRA 4XW3A 2VCMA 3RJRA 2EIDA 4IV3B 3HVDA 4RHV3 5IAXA 5L19A 2D7FA 1PGW1 4YVWC 5JI7A 3H3UA 1LOFC 1T2XA 3UGHA 4AFCA 2R32A 4BLJA 3R6SA 5FZ7A 2SBAA 4XMAA 4BYYA 4XF1A 1E5RA 1R093 3SKJE 2J1EA 1OLME 3J7HA 4LBOA 4OUEA 3ZSKA 4YARA 2JDKA 4LT5A 3OYWB 2J1SA 2VXRA 5DN2A 4I3GA 5FZEA 1N1TA 2JWPA 2JDZA 5JPNB 2AYHA 2BQPA 4QQ2A 1POQA 1YC61 2WFF3 1EUTA 4OHVA 4P14A 4XC9A 5FYHA 3WDYA 3WP6A 1OF4A 3A4UA 1WCDJ 2B7YA 5DG2A 5A33B 4YGBA 4EWDA 3U4SA 2WT2A 2ZX2A 1FXZA 4QDQA 3GDBA 2ZMKA 2CAUA 2VGDA 1N1YA 2XL7A 5DDJ3 4IEXA 2XVGA 3AKQA 3GCXA 1UKRA 1UZWA 1O6UA 1E5HA 1QQP2 1UPSA 2AACA 5DAPA 1KS5A 1O4YA 3I2GA 3VBOC 3ZIXA 4KH9A 4JGZB 4HG6B 1W39A 1W6OA 4FOQA 4R52A 2AEYA 2VMFA 2WJSA 2XLGA 3J7LA 3LB9A 4NAMA 5HXVA 3LEIA 4QQHA 1XYNA 2ZA9A 5CKQA 4FOWA 4WM8C 1ZA4A 2XDVA 2UY9A 5I0UA 4YG6A 4CXYA 4BLIA 1UMIA 1IS5A 1QGLA 1S2BA 2JDMA 2JKBA 2V5DA 2TUNA 2OIIA 4UFHA 1Q8PA 4FT8A 3MDPA 4RQPB 2BGCA 2P3JA 2VQTA 4FQ4A 4MOAA 1DYPA 2VMDA 3FX3A 5J98B 3KGLA 2Y26A 1MEC2 1VAMA 3MIGA 1HRI3 1FYUA 1RJ7A 2D6OX 1YQ2A 4JHZA 5HCFA 3ZYHA 1XE0A 2D5FA 2EALA 3IIIA 4GH4A 4J1WA 2V09A 1RMU3 1SMVA 1NCQA 2NYYA 5EJZB 4ATFA 1S0GA 2FMDA 5H9QA 3UT0A 2PA7A 4IEVA 4RSUA 1QXJA 3E5QA 5IT6A 3S57A 3LSDA 1RUI1 2C24A 1ENRA 2XHNA 3BTAA 1YIFA 1X8EA 2WWJA 1W6NA 1AR81 2ORXA 2BWCA 2WS92 2WZR3 3SCFA 2ZX0A 3VBHC 4CCEA 1KRIA 4UW6A 4MZUA 3D0JA 2AH2A 3GYDA 1DDLA 1X50A 4FBFA 5C8CB 3POEA 1AX0A 1NY72 1KJLA 3VD3A 5FYCA 2VVDA 4BQ1A 1C1FA 4XJAA 2NMNA 4H2AA 4BISA 1KJRA 4IV3C 1M4WA 4MYEA 3C3VA 4LTAA 4XHXA 1YQ8A 4N53A 5KHGA 3UJOA 1LCLA 5BNNB 1HKDA 4EN6B 1ZM1A 4NRPA 3RYPA 4BPZA 2EXKA 4LUKA 1J1LA 2EXIA 2VVEA 1MZFA 5F9TA 4AR2A 5B2GB 1BBT3 4XXPA 4QKNA 1XU1A 2A6XA 4R4XA 4BJ0A 3JUUA 3WUCA 4CP9A 4AYUA 4CCCA 5L7OC 4FTBA 3J4UH 3RZKA 5AC93 2Y6KA 3SH4A 3T2TA 1S0BA 4COYA 1C8NA 1OUSA 3WD5A 4JDMA 4YPJA 3RYRA 5JZGA 3PIGA 1ND2A 1F31A 2HWF2 4QB2A 3OBRA 3NSTA 1POV0 4E27A 4IQPA 2PN5A 4CDUB 2CL2A 4BXFA 4MXVA 2CU5A 1HRV3 3VBRC 5J37A 2BP6A 2HJIA 3AP4A 1UOFA 4JGZC 2OKXA 4S2DA 4YG3A 2PHWA 5F5AA 4NWVA 2ZZJA 5KHIA 2VTXA 2IC1A 1RGSA 3NJYA 4FP3A 1UYZA 3GXUA 2QCSB 3VDDB 2ZGOA 2BOIA 4FXGB 4AHXA 2ZABA 1ASJ3 3JQXA 2ARAA 3H8OA 1JYTA 4JKKA 2R072 3P3NA 3WHTA 4MGZE 2E33A 4PHZA 4A45A 3PHMA 5FYUA 1AXKA 4AEDC 4XCBA 3OGJA 1MS0A 4NPLA 2F4LA 1JYXA 1VRBA 3PVOA 3U14A 1JZ5A 4R9AA 1RUF3 5C4WA 4E2GA 1JN2P 2BBAA 2YGLA 3NAPA 1GNHA 3KT7A 1VMFA 3N3HA 5F2SA 1IQAA 5FK8A 4UFIA 4YFZA 4XIOA 3HQUA 2HEWF 1H8VA 3L2HA 3LA3A 3KWVA 4W8JA 4TTGA 2TNFA 1ZNPA 4GJZA 1X82A 1U5XA 2VH9A 3USUB 1I5PA 2E63A 1B35C 2YZ4A 4MXWA 4AI8A 5LY1A 2GNMA 4R8HA 4XUTA 1KEXA 1UZYA 4OQ8A 4XIKA 1MZ5A 4KWLA 2W1WA 2ZEWA 1X7NA 3O1OA 2W1SA 4JAAA 5F37A 4COZA 1OBNA 1ZZ7A 1MVQA 1PX4A 3CL1A 4K40A 1UU6A 1W8ZA 3HR9A 4KQ7A 5H9SA 4RS5B 2W9XA 1OH4A 1J3PA 3JD72 4IE7A 2G19A 4COWA 2O14A 5JI9A 5JLVA 1Y9QA 3CJIA 1C3HA 3U37A 3RZLA 1H8TC 1QH6A 5BNNC 2WAAA 1WKYA 2XLFA 5CFCC 1JI6A 5C3OA 2YFUA 4OI4A 3ALQA 4Y5TA 3B00A 3DPRC 4W4ZA 1D4VB 4OHYA 5IAVA 4QPWA 3VGIA 2VNGA 1LOEA 1PO12 4OLLA 2TEPA 2WSUA 2YPJA 3C7EA 2HWC1 3LWCA 4XZPA 5FXXA 2CWMA 2J7MA 5HPOA 3MIEA 2WO1A 3WX5A 1NQDA 1MS9A 1H4GA 3VKMA 4C0HA 3S5AA 4NRMA 4QHBA 1UZZA 1ZBE1 5FY1A 2VCBA 3ZYIB 4EN0A 3DUIA 5AVPA 3MYXA 2V72A 5HI0A 4DXTA 3JB8A 1NY71 4YWAA 2BTVC 3K3OA 1AR93 3VKLA 1IG3A 2XJUA 1YI9A 3ES1A 1QJU2 5IYYA 1HLCA 3WXPA 2DVFA 2R062 2RDSA 3A22A 4AI1A 1O8PA 1ODNA 1GP5A 3OSDA 3JB4C 1TVGA 3VDDC 1RUG2 2JDYA 1SPPA 4OMDA 4B29A 5CZKA 4A6OA 4AZZA 3WZ1A 2YBPA 4BQXA 5FQ0B 2Y0IA 2A3YA 1LULA 1JZ3A 1PGL1 1WW7A 3NJZA 3AZYA 1B09A 2DVGA 3MW2A 1H2LA 2VOTA 3N7LA 4AI3A 4B4PA 4LO7A 3WCSA 2B4KA 4WVWA 3N9NA 2KA3A 5L36A 4LOSA 1RUH1 4JTOA 2JG9A 2PAKA 5LEKA 1OOPB 4LPLA 1OURA 2R041 3HN3A 4FPFA 2Q8DA 1UO9A 2VJXA 3SLIA 1W2TA 3LDRA 3NNFA 3AVSA 4ZXEA 5DDJ2 4NHXA 3RPQA 4BQWA 4CDQA 5BNQA 5I93A 5FYSA 1H1MA 5FP8A 4PLMA 1C1LA 2ZGKA 2IXCA 1LHWA 4HN0A 3B9IA 2RS13 4DINB 5DUVA 5A1AA 5GZCA 1GLHA 2RS53 1DYOA 4AWDA 2ZS6B 4LBMA 1US2A 5GLUA 2I2SA 4MX3A 3LFIA 4BOWA 3RG0A 2GP3A 2JDAA 1QJY1 5KC5A 3H42B 2ZKNA 3CIHA 1N1SA 2VUAA 3NMBA 2JDNA 1QJX2 1XQNA 3OCPA 2XONA 4GWNA 3AL6A 4GZ9A 3OBZA 4FPLA 4K1ZA 3VBSA 3N9PA 1XRUA 3AJZA 4RS5C 1CAWB 2RR11 1VBD3 3CEWA 1S55A 3AFGA 4AEJA 5AFBA 1ULEA 4UYBA 2ZEZA 4S2GA 3LAGA 3SC7X 4QGMA 2LM3A 2D97A 4Q0PA 4HVOA 1O4TA 4XOGA 3GBFA 1RMU2 1YHFA 3OUIA 3IPVB 2WO3A 5L9VA 4WZCA 2EAAA 1ZRDA 3THPA 3SCHA 3VBFC 2B42B 1BMV2 2VW2A 1R1A3 5GZDA 5EQUA 1OPOA 1VIWB 2XG3A 2Q8OA 4GWMA 1AX2A 1YJKA 2A3WA 2BW8A 5F5QA 2OA2A 2J1VA 3AYDA 1SZBA 2L9LA 2ZJCA 3TNPB 4W6XA 3T1MA 2ZGQA 1W0PA 5FIXA 4UBGA 1ND3B 3M3EA 1ULGA 5G04L 5H9RA 4EWEA 2JDUA 2WA3A 3ZX7A 2JD4A 4QHZA 2FQPA 5CFDB 3OJBA 4HKLA 3FLTA 3VKOA 3KQ4B 1EAH1 5ACA2 1DGLA 1I9RA 3IMNA 4YVWA 3LA2A 1LOFA 2VOVA 3RZJA 1J58A 1OH3A 4ARXA 2VUDA 2B45X 4GB33 1UY0A 3W59A 4EWAA 1TME1 3PTYA 4IETA 1FOD3 4Y4YA 1A8MA 3LKJA 3MBWA 5ANNA 2H0VA 3AMPA 4LMFA 2VMHA 2VZUA 4RN5A 1OXCA 2C26A 4OYUA 4FPHA 3J8F2 2JB4A 4Y1XA 1WD3A 1G9AA 1PZ9A 2VM9A 3DYOA 3JQWA 5ABJC 1UAIA 3M3OA 3TB0A 3K75B 4DRVA 2BFUL 5A6ZA 3ASIA 4Z82A 5AC92 3J7MA 1GNYA 3PU8A 1FV3A 3P6BA 1AXZA 4NR1A 5LA1A 4TN7A 4AVAA 4COUA 1OMIA 1Y43B 2XL9A 1VE0A 4AVBA 5BNOB 3WDTA 1MZ6A 3ETPA 4AHZA 3OBTA 2XJPA 1ST8A 4XJUA 2D6NA 1QJU1 1YFYA 2ILMA 3Q8BA 4EZHA 3DYMA 4LBNA 4B7KA 5FLIA 1D2QA 3ZYRA 3AP7A 4WM8A 4I0BA 1WWYA 1H4HA 2QQUA 1GANA 5DUWA 1PIV1 4F83A 1GNZA 1SCSA 2JB8A 1M06G 4M0HA 3I4IA 3NRUA 3KQRA 5FXZA 2FZ2A 1NUKA 2Y33A 3D6EA 2IFRA 5IJRA 2E6VA 1XYPA 3B01A 4BB3A 4OI2A 1H0BA 1UXXX 1ULFA 1N1VA 1X8MA 1X9PA 2YU2A 3MLJA 3V65A 1VMHA 3EMRA 3POIA 5A3OA 3N35A 4PT6A 5J96B 5JOXA 2PAMA 3P3PA 2XQXA 2Q1MA 2VU9A 3C7HA 4CP2A 4DMIA 4NHMA 4Z92B 1LRHA 2BERA 2ZAAA 5A7WA 3KCXA 5EPAA 4M3CB 4Q26A 1G9BA 4DEVA 3WOGA 4JQRA 4CUBA 1RUNA 2XMLA 3I2JA 5FP9A 3WNMA 1D4M2 1QQP3 1YQCA 1ZZ9A 3ACGA 3TN91 2GMEA 3N7JA 4JTNA 2YHJA 3TWIA 2C4XA 3VBHA 2XXZA 5J48A 1LEDA 4XEZA 1MS5A 4OUSA 3ZXAC 1WLDA 3U4XA 1J59A 2PHDA 1UZ0A 1KFUL 4CZSA 3INAA 5JSPA 3OD4A 4XBNA 1W9FA 4Q4X1 3HQRA 3TBDA 4JZRA 2GMPA 1WBLA 4L11A 1QJFA 2VXJA 4FP2A 4FAHA 1MACA 5BPXA 1W8UA 2A5ZA 1HQNA 1MEC3 2A73B 4YGDA 4CP0A 3SH5A 3M3QA 5LWBA 4CCJA 4BWOA 5C9AC 2ARBA 4QB6A 3NQHA 3K51A 4MGKE 4FPOB 3OYWA 4FFFA 5DABA 2GC3A 3BIEA 3AKPA 1J83A 1IPSA 5L7OA 1OD5A 3NNGA 2ZHMA 4LA2A 1ZA7A 5C3PA 3FJSA 4LE3A 2GSYA 1RVF2 5CNAA 1U5YA 2VZQA 2VW1A 4URTA 1VB4A 3PUHA 4IEOA 4NWWA 4Q2FA 4XF3A 2ATFA 5A33A 5FPXA 4D7YA 1NZIA 2DF7A 3FC0A 3ORJA 3T4HB 4AI2A 4RR3B 2RJKA 4YG0A 2C9KA 4G9SB 4PCRA 4Q4Y2 1A6CA 3T09A 4FAGA 5FZ4A 5FFOC 4L2NA 4Y5SA 1Y7BA 3OOXA 3AVRA 3VBRA 2ORZA 3BTYA 2ZOEB 3VHPA 5CG9A 3AXEA 3P5BA 5FYZA 3ST7A 1XSRA 4N7IA 5BNOC 4ZZ5A 2AEZA 4B1MA 3R4UA 2WFPA 3I2DA 3X29B 4P9XA 4D7TA 2ZX4A 5CBLA 2JEMA 5A3WA 1PGW2 2MPFA 3AL5A 3FE5A 1IG0A 2HWE1 5FY8A 3KZ4C 3GHNA 4KG0A 1GKBA 2VBDA 5FMCA 5F5CA 3AXDA 1AHSA 5FYVA 5FZDA 3LOBA 3OGVA 4JVAA 4AEDA 1Q8SA 3KF5A 3J8F1 5FXVA 1PZ7A 3VUOA 3EQEA 3O12A 5FO9B 4Y24A 3WVJA 3M3IA 5C71A 4ZS3A 2XBO1 1QMJA 1H9WA 5FBJA 1UYXA 1Y4WA 4H3WA 4M4RA 2HWF3 4N9IA 4CDWB 1IQDC 3LPGA 1URXA 1W04A 2QQJA 2I74A 5FY7A 2GALA 4D8MA 1CWPA 1B35A 1REEA 1ZZ8A 3NWKA 5TSWA 1V6NA 1WUVA 1PK6B 3LDBA 3IDEA 4XETA 5E6HA 3VN4A 4CEYB 3B93A 3TYJA 2IXJA 5FYBA 2J22A 5C3QA 3N7MA 3O0WA 3VBUB 1QJY3 3EYPA 4LXLA 3AFKA 2QQLA 3GZUC 3NV1A 3PL0A 2R073 4HK9A 1QXRA 3L9JT 5ISLA 3HNYM 4C1WA 4O65A 5HCBA 1GUIA 1TNFA 4MLOA 3O1UA 4QM9A 2W3JA 2RR13 1C8M2 3LGRA 4HT1T 2V4AA 3VHNA 3ZDVA 1H8TA 5BNNA 2FZ1A 5CFCA 2DTWA 1WMXA 3DPRA 3ZFGB 1JXNA 3POBA 2A6YA 5BNPB 4FPJA 1O8SA 4W65A 1WMDA 2A7AA 3PIJA 5CKMA 3DKWA 2JE9A 3O1PA 4YLZA 5IW0A 4JRAA 4CCMA 2XPJA 1SBDA 3MZHA 1RB8G 4R9BA 3MPPG 3M4FA 1RUI2 3HNMA 1WW6A 1YEWA 4E4HA 3A21A 2E32A 2CGPA 1TEIA 4BQYA 5A3NA 1F2NA 1AR82 2OQ7A 2R0HA 4HMZA 3POJA 3MO4A 1IKQA 4RR3C 4UFJA 3CZJA 3E6CC 5FMOL 4IGQA 5FKCA 5FAXA 3WG3A 5T54A 3GNEA 1NA1A 3VD7A 4N43B 1VBE1 1G86A 4J1XA 4QX5A 3O0VA 1EAH3 5A3PA 4WM7B 5EIYB 2GP5A 3ZFEB 1IGOA 1ULOA 2VY0A 3T2OA 2V4VA 5BXXA 4ONUA 2ZGSA 4P9IA 1GQHA 1KXGA 4A3XA 4A44A 5GLZA 2EF6A 3CNAA 3VDDA 1Q43A 3LPFA 5LK7B 1TME3 2P4EA 4LKSA 1JYVA 4C90A 1P8JA 1UU4A 3E97A 5K7PA 2C5DA 3W20A 1GZCA 2E26A 4WVZA 5F8PA 5FPBA 1BKZA 1BVVA 1QF3A 2WNVC 2WZEA 1VBC1 1OT5A 4LNVA 5AFEA 5KXEA 1STMA 2OS2A 2QQVA 4IEPA 3VDAA 4QX0A 1KDMA 1HDKA 3O14A 4KWJA 1VPHA 3KT1A 2WQ8A 3KV9A 2ARCA 4XE9A 5FOJB 1LGCA 5GZEA 2FDIA 1N3PA 1NQJA 4LBQB 2PHUA 5CYYA 3K2OA 1VBA1 3LIHA 1H2NA 3OUHA 4QXBA 1O3SA 3JZVA 4CE8A 4DY3A 4CDWC 3EJKA 5BUVA 2JIJA 4XF0A 5KXBA 1DLCA 3KHCA 3SQOA 2W94A 2BBVA 5LY2A 4Q0SA 1BVP1 3PU3A 2PELA 1QJU3 2YGMA 2TBVA 4PJYA 4HETA 1NOVA 2GC2A 3JBG1 2R063 2LS6A 4X6QB 1PK6C 4AHYA 1CZTA 2IWGB 1CX4A 3I2FA 4BA6A 4R9CA 1LHVA 2LUWA 2X5IB 1XU2A 2WYSA 3RSJA 3VB9A 1RUG3 2P3KA 4XUPA 5LB6A 3ZYBA 1ENSA 4JGYB 4BE3A 4E4DX 2E31A 2C9AA 4KMQA 4N9HA 4UFLA 5I0DA 5F2WA 1F9KA 2WABA 4WV8A 4RS5A 5FPAA 4PIZA 1R082 1PM4A 1UIKA 1K42A 2HBUA 1R64A 5FY5A 4PDWB 1F4HA 1T6GC 1UYYA 4FFGA 1JOPA 3M7AA 3PDQA 3ZXFA 1PVXA 5IK7A 5DAQA 1FNYA 2IXHA 2VO5A 3VBFA 3WEZA 4MV2A 4C8DA 4F7ZA 5IK5A 1PGSA 2EXHA 4LHNA 4W50A 2W68A 2IXKA 1JYIA 1W8WA 1DF0A 2JENA 3APBA 1RHI1 2K2SA 5KHHA 2P17A 2FD8A 2QKDA 3NNJA 4BZ4A 5D8AB 1YCIA 4DUVA 4UWDA 2VBBA 4C1XA 4IL7A 3RRDA 1JZ6A 4GD4A 2RHPA 3KF3A 1DQ5A 3JU9A 1PX3A 2VNRA 1O5LA 1XJAA 5FWJA 2VZPA 1LJ7A 2Q1ZB 1O7FA 1VRH1 1QJX3 1UYPA 3MFCA 1KQRA 3EO6A 4N43C 2DYCA 3GF6A 4Q4X3 5K0UB 3O1SA 2GNBA 1AVBA 3N4MA 4JDNA 2RV9A 4WM7C 3WHUA 3ZFEC 3WR0A 1ZX5A 4JQTA 1Q8OA 1QOOA 4KL1A 1C8M1 1OA2A 4LBJA 4RD7A 2D98A 3LA7A 2OUHA 5SV5A 5EZWA 4FPYA 4M01A 4QB1A 3THTA 3ZSEA 3PJYA 4GIQA 1YO8A 2K46A 3CBNA 4W6WA 5F6KA 3THDA 2CDOA 3OPTA 1GFF2 4GWJA 1ZZBA 3S6PA 1NE6A 5FQ0A 2O8OA 3UKNA 3PURA 3N9LA 3CZUA 1L7QA 2F17A 5ABJA 2VMIA 3U1XA 3M70A 5JVVA 3VV1A 3WT3A 1W6MB 1ENXA 1RYYA 1V9U1 3VHRA 2B46X 3D3AA 2HWC2 4HVQA 4TYSA 2BU9A 5F3EA 5A6XA 1XXNA 4QX8A 5L73A 5F7UA 4PI0A 4CDXB 3VZKA 2OYZA 5D21A 1S0IA 4Q0UA 5A6QA 2VNOA 1ZBE2 5F1RA 1CAXA 3VZLA 1EPZA 2JX9A 4FSJA 3ZDSA 2VOXA 4IEZA 4MVTA 2YC4A 4XHBA 1OLRA 4EYUA 2D6PA 1PVC1 4BQ2A 1XNAA 4LQRA 5FUIA 2X05A 3KM5A 5ACA3 5FJKA 3OGSA 2OUJA 5A7NA 1QIQA 2HH9A 5IVVA 1S0CA 3K46A 4NAOA 4XYXA 3GBWA 2YXSA 5FBZA 5B4NA 3KHBA 4Y1VA 1H2KA 5C3SA 1APNA 4JGYC 4MGSA 1HQWA 5K9YA 4ASKA 2ZHLA 2BVVA 3SH3A 4IXLA 3HEIA 3J8F3 5JCTA 1PGL2 2RS31 2NN8A 4YSFA 3HT2A 1YWKA 3K4AA 1JS9A 4FOVA 4PDWC 3WCRA 3OGGA 2VZ1A 1PZ8A 4ZU7A 3T3YA 1N3OA 2Y60A 3ZN6A 1LHNA 2XBO3 3IM0A 2HWD1 3DKQA 1WW5A 4HL0A 2CAVA 4LE4A 5GM0A 1RUH2 3CJXA 3GZAA 3LSEA 4QQOA 4Y20A 3MICA 2RDNA 2R042 3AKSA 2HWB1 3OG2A 4IGPA 1HIXA 5FYIA 2YDEA 1GZWB 1Q5OA 2J1RA 2P3IA 2VZOA 5LEJA 1W2NA 1OI6A 4KG8A 5F3CA 5JPMB 4B3NA 1C4RA 1FMD1 1GOGA 3HWJA 4M3CF 4IGOA 4NIGA 4XFFA 1S0DA 5J36A 3BB6A 4JCKA 2AUYA 4NHKA 1POV1 4HOOA 2VZVA 5D8AC 1GP6A 3ETQA 1KFXL 5CKNA 5FZIA 4CCDA 3MIDA 3BUCA 1ENQA 3O7OA 1WMFA 1PO21 1QJY2 4GXLA 5FKBA 5FZ6A 3PTRB 1QEXA 5K0UC 1F4AA 3FUOA 3WNXA 1VR3A 1R081 1LTEA 2D44A 3GHMA 3UGFA 3VZNA 5C9AA 1QHDA 1UOJA 2QZ3A 2A6VA 4NROA 4RQPC 2RR12 1ZZCA 1ONAA 1MQTB 3KT4A 2QFEA 3B02A 3KVBA 4Z2AA 5EYXA 4CEWB 4TZDA 1REDA 3BCWA 5T52A 3KS7A 3CMGA 4UXAA 2VW0A 4XBLA 3KMHA 4E4ZA 2ZEYA 3VDCA 1G9FA 3HPNA 4U36A 2P3YA 3FFQA 4IV1A 1D4M3 1SQ4A 4DNYA 5KR7A 4L0PA 4XFCA 2BDRA 2P37A 3TRSB 1WZXA 2QQKA 1SFYA 3CO2A 2E7TA 4XFIA 4DB5A 3BYWA 1BK0A 4QXKA 1DQ6A 4CDXC 1FNZA 4EV0A 2GMMA 3ZSJA 3PVNA 1Z78A 1PNGA 4Q4V1 2DFCA 4ORFA 4BK5A 5BNOA 1SLLA 4Y22B 1VBE3 4LBKA 1DQ0A 5FZFA 5L9RA 1SEFA 1YI7A 2W08A 3WQ1A 4AFDA 5C8CC 4KU8A 4A4AA 1EV12 2JDPA 4P9WA 1EAH2 4P08A 4YW2A 4P02B 4INDA 3RJ2X 4AVVA 1X33A 5A6YA 1XNKA 2XUMA 5FZ3A 4BM8A 1IOAA 3LIGA 4BIOA 1NXMA 2ID4A 3QH7A 4LORA 5T50A 1TME2 1OPMA 4MGYE 5GJ6A 2FDKA 3DV8A 1VBC3 1UOGA 3MFAA 1GOHA 2W39A 5IVCA 2DU0A 4LJHA 3U0ZA 1RVF3 3DECA 1HW5A 4DRRA 4MG2A 3NO8A 2KD7A 2FMYA 2EICA 3LEKA 1VBA3 1WLTA 2J42A 5A1FA 5A3LA 4HSLA 2ZGUA 5I8TA 4Q4Y3 4NIAA 5E8AA 2EA7A 3PUAA 4IE4A 1HN1A 4NOTA 3QACA 5FUPA 4YZ3A 2ARXA 4PIYA 2AGSA 3FMGA 3ACIA 4CDUC 3PVEA 2ZMNA 3H8XA 2VL4A 4AHWA 1HB2A 1H6XA 1OA3A 1XC6A 1JUIA 2QVSB 2R30A 3GALA 4XXAA 3SEPA 3MUY1 3PMSA 2N7GA 2ZCWA 1HXS1 4LKEA 5D1IA 4BQ3A 1RUOA 5C7GA 4D3WA 1DZTA 3UJQA 3MW3A 4ZY9A 3I3QA 4HN1A 2IFWA 1WCUA 3UV9A 1RUC1 2W2IA 2IVJA 2ZPXA 1JHJA 2ZEXA 3BALA 4E2SA 3I54A 3WW4A 5F39A 4TWTA 1DP0A 1PIV2 2HEYF 2WT0A 3NJVA 4UW5A 4PI2A 1KDKA 1RJ8A 4IERA 3KLSA 4A2UA 3O0XA 1G6NA 1W6OB 1CAUA 2QTWB 2CNAA 3ZFFB 1US3A 1D2SA 2CYFA 4EN9B 4UOJA 5KBFA 3RQ0A 2W91A 1HB4A 3OGRA 1YUDA 4R4ZA 3AMNA 3Q8EA 1VBB2 4LKFA 1MQTC 4B1LA 1AL0G 3EB7A 1HJFA 2E51A 3V56A 1SLTA 2RG4A 3D0SA 3H1MA 5EYYA 4COVA 2R7EB 1W28A 2WNOA 3S0MA 2NMOA 4DFSA 3ZXEA 1G8WA 3I2OA 2VOKA 4CSWA 5FYMA 3WF4A 4DZGA 3VD5A 5SV8A 3TN92 2QQOA 1V6JA 2Z2SB 1Z7S2 4HPKB 4Q1PA 4RR3A 3S5QA 4AQTA 1NCQB 5FPVA 2HEVF 4R9DA 2W1QA 4XTMA 1XE7A 2YB7A 3KB5A 1AJOA 4I3PA 2DDUA 2VD7A 3ZIWA 1EPWA 3HMYA 3K48A 2FHRA 4MO3M 1FPN1 4LK7A 4YW4A 1W8HA 1W6NB 5J3UA 4Q4X2 3SXWA 1UNBA 2VECA 3T30A 4OCTA 3T08A 3VZMA 3EXUA 1C8M3 3WSOA 4PLOA 3VKNA 4NPRA 3O5SA 5KC6A 3T0DA 3GJAA 3ZXKA 4A3ZA 5DG1A 2Q4SA 2OX0A 2WNVA 2VZ3A 4PQ9A 1OD3A 1UPIA 1JZ4A 2Q30A 2WL1A 3NJXA 5FZOB 3FBYA 2GN7A 4Z1VA 1EP0A 4XQDA 5F6LB 2AREA 2WA4A 5E1RA 2XGXA 3N9MA 3R4SA 1V9U3 1AL21 3PUIA 5LASA 1RUI3 1HV1A 2WYFA 3ILRA 5FV3A 3T4VA 3N9OA 3SHRA 4BQ4A 4A7YA 3OEAA 1LOBA 1AR83 2NZ9A 1WA4A 1UKGA 4CDWA 1CX1A 3KD4A 5HCHA 2QBXA 1J3QA 1DBNA 1GSLA 2A71A 2GC0A 3AK0A 2OZJA 1PVC3 2YBSA 4XMIA 1IS3A 1PK6A 5FR3A 3DXUA 1EV11 4JC1A 3ZMNA 3ZR6A 1WBFA 1DIWA 2XVKA 2ZGTA 4BXSV 4RL7A 3L2YA 3NL1A 5JZGB 1GZTA 4MH0E 2G9ZA 5FYYA 4HFSA 4LUMA 1XNDA 2C1FA 4NHYA 3WQ0A 4LLFA 2VTXJ 1JBCA 3FHIB 2GH8A 2HWE2 4O9EA 4K21A 1WCKA 5FZHA 1JYCA 1MVEA 3LFMA 4K7JA 4WBBA 4YW5A 5IHRA 3HN1A 4CU9A 4C91A 3WG1A 3CHXA 1A34A 5JOYA 1O59A 2PHXA 4QX1A 3ZFFC 3WNKA 3I59A 2XKPA 4I09A 4Z2WA 1F15A 3POWA 3ZKUA 4LLOA 4IUGA 3ITQA 2Y34A 2ZXQA 4HONA 1ODMA 1S0JA 1DZQA 2HWD3 5K4LA 5T3NA 4ISQA 2DTYA 2RMU1 2XBO2 2ZMLA 5LATA 1AZDA 2VR4A 5KHKA 3MW4A 2MNGA 3CU7A 3H9AA 4NMIA 4P5HA 3WINE 1OOPC 3PVBB 2WC2A 1SLCA 4NN0A 2GNTA 2KXLA 1OLQA 4XACA 4NE9A 3VBOA 4OHXA 4DQAA 5JWPA 1UD1A 3KV4A 3MIFA 1MS8A 1V6MA 4WVMA 5C4WB 4HKWA 3AZWA 5CADA 3A7QA 4H14A 1W3VA 1XB9A 4XURA 2Q8EA 1POV3 1TE1B 2BOJA 1SDDB 1CVNA 2EVXA 4E4SA 2E7AA 1ZBA1 2OPWA 4KGQA 2X09A 5FZ9A 2A1XA 4N43A 2B8MA 5CEHA 4WM7A 3ZFEA 4O7XA 4TXWA 5IATA 1GWLA 1C28A 1AYN1 1YJLA 4AK3A 4GALA 1R083 1AR71 4LULA 4N8MA 1GWKA 1CPMA 2W92A 3JCIA 2Z69A 4U2AA 5FLHA 4X8PA 4YNIA 1HJGA 5BYNA 3ON7A 4GMP1 5CVRA 1DGWA 1VBB1 3B5LB 4IEUA 4BK4A 2VMGA 5IUQA 4B7EA 2Q8CA 4ZU5A 1CR7A 2SLIA 4XQWA 3NKTA 4D6QA 1UX7A 2WBKA 1YRZA 1JUHA 3E6DA 2ZX1A 2FDJA 3WDUA 4G3YC 5FPZA 1QNWA 3MIHA 3UESA 4HVRA 1IPKA 4MUVA 1YFUA 2ZHKA 5FP4A 3BGAA 2EAKA 2RDQA 3RDIA 4CCNA 4P9GA 4FTEA 3M1HA 4Y33A 2JE7A 4FPEA 1O5UA 1R091 1Z7S1 3AZXA 5FZ0A 3ZVXA 2A3XA 3WF0A 2XB6C 2IZWA 1J84A 3MV11 3UK9A 4IEYA 4Q4V3 3H7JA 5IFTA 3WDVA 4ES8A 4XFAA 4AOCA 3WY6A 4ET7A 1W9YA 2KM2A 2WFF1 1VB2A 1H2MA 1LU1A 3OY8B 3O1VA 1ND3C 3LZZA 3TEYA 5A7OA 4AGRA 5CFDC 1ALYA 2NPIA 1VBE2 3LEGA 4IV3A 4XJ9A 4XJZA 4ASMB 1BEV1 1COV1 1GMMA 1L3JA 2YG0A 2UURA 2R49A 4JGYA 1BHGA 4ZHNA 4K8FA 3B7MA 2NP0A 4LKDA 3KCYA 3K77A 5CB7A 3DF0A 3WG4A 1IS4A 4Y4RA 2ZGRA 1VBC2 4PDWA 2XJVA 2ZZQA 1G7YA 4QKDA 4TSVA 5F3GA 2UWAA 5LA0A 4CA9A 4O61A 2HWC3 1DGRA 1F5FA 3WNLA 3ZMOA 2CGOA 1SPPB 4OZXA 3S30A 1J1TA 5FLJA 1VBA2 3MF9A 3NVCA 1Y9MA 1ZBE3 5JSOA 4XFHA 5DAVA
chains in the Genus database with same CATH topology
2RJLA 3QLQA 1HRI1 2RM21 5BY5A 3PLQA 4DY5A 2BEOA 4NHLA 4Y26A 3C2UA 4JGZA 3URFA 3GBGA 2IXIA 4FPKA 1HXS3 1UL9A 1VALA 1DQ4A 2JG9B 3JBG2 4J6GA 5A32B 5FREA 1V00A 2V73A 2A70A 4Q0VA 1DGWX 1N47A 4CDQB 5K0UA 2UYAA 1MZEA 1C5IA 1LODA 2XWJB 2WZR1 2F4PA 4I30A 4RQPA 4TLFA 4XQ4A 3E6BA 1CONA 2PHLA 1N3QA 2VVFA 4K20A 2BNMA 4RFT0 4D94A 5KXDA 1SLBA 4AEMA 2VUJA 2QDRA 2ZTNA 1RUH3 4QM8A 1U5ZA 2R043 3USSA 1NZCA 3RWNA 2UU8A 1O3QA 2GU9A 2DCZA 1QXPA 1WLWA 2CY6A 2AR6A 1S0FA 1RHI2 3BOPA 4CDXA 4ES9A 3FUQA 1AXYA 2NLRA 5I0RA 1BBT1 4ATEA 3KCCA 1O3TA 1FX5A 1VAKA 1OFNA 2GNDA 5C8CA 1S1AA 4NO4A 1F8VA 1JW6A 1FPN3 1VRH2 5GZGA 2PHRA 5KXCA 4C0BA 2XJTA 1AF9A 1EY2A 4ASLA 1S0EA 4Q1RA 1QNYA 1VJ2A 2YUEA 4UBHA 1DYKA 3ZSMA 4QPYA 1CJPA 4M00A 4YVWB 2WWSA 1RTVA 3MGUA 2X29A 1DZRA 1TMF1 1V9U2 4I01A 1ASJ1 3WW2A 1H1IA 1PHMA 3IN9A 2AZ5A 2ZGLA 5EJ3A 3M3CA 4AGGA 3MLKA 1YNAA 3M2MA 1H30A 1GZWA 2H6BA 3H0OA 4CDUA 1FATA 5GKAC 4FOYA 1OQDA 2XJRA 5GZFA 3VL9A 1CAVB 1PVC2 5JOWA 1RUF1 1EV13 4YM3A 4ISRA 3ILFA 1I1EA 1H9PA 3NV3A 1LGBA 3ZYPA 5T5JA 4MGIE 1ZYBA 4L8QA 4ZKTB 4HBNA 4XILA 4QPGB 1AR61 4AE2A 4QT6A 1JHNA 3B69A 1IS6A 4GQ7A 2CWSA 2WNUB 4AQ2A 4H55A 1AJKA 1AYM2 4G4FA 4SBVA 1WW4A 2JICA 3A0KA 1LKNA 2DFBA 3IWZA 4LO8A 3AX4A 4Y5Z0 3VLBB 2RS32 4QPIB 3ZO0B 1MQTA 2PFWA 3QD6A 4KWKA 5KHJA 4QMAA 3A0NA 1IPJA 3I8TA 5BV6A 3ZXJA 1NCRB 2ENRA 1W6QB 2HWD2 2PLV2 1C5HA 3RI8A 1OFSA 2HWB2 3B3QE 4HSJA 1BJQA 3WW1A 1ZVFA 2Y38A 4YRDA 4IEQA 3NKGA 3S7EA 2MEV1 3USUA 1FMD2 3ELNA 1LENA 4ZU4A 1RL3A 2OVUA 1RUE1 4CEYC 1ZBA3 3AYAA 1QKQA 4LBLA 1SACA 1PIV3 2CTVA 2XHKA 3VBUC 4HKOA 4FVVA 1PO22 4AFAA 4BMBA 3VBHB 2WT1A 4OVEA 1WGPA 1RIRA 1TQ5A 2DVBA 5FTTC 1MS3A 4PF5A 2DURA 2Q0AA 4GMP3 4RGAA 1VBB3 4PBPA 3AYEA 4XJWA 1AR91 1Q56A 3H8UA 3AYCA 1LOAA 4XF4A 5I91A 2XKOA 3ZFGC 2B39A 3QOPA 3EBRA 5BNPC 3AP6A 3E5UA 5LRRA 2W0XA 2R1DA 3T1LA 1WLCA 2Y0OA 4YGCA 1Y3TA 5T5PA 3WLUA 4YFWA 4AI0A 3TN93 4AQ6A 2EIGA 1Z7S3 4XBQA 1QH7A 1ULCA 4YZ2A 4XF9A 4ITCA 5L7OB 5C33A 2QJVA 3D8CA 4YVSB 1YLLA 3H1WA 4Q4V2 1JTZX 3POSA 3UL2A 1GR3A 2YMZA 3HBZA 4OUMA 3AP5A 4OFGA 4O9GA 1DU3D 1BEV3 1COV3 3WQ7A 4BCUA 4Q4W1 3OPZA 4W6YA 4K6BA 4Y1UA 4S2HA 4K3UA 3VBRB 4QPGC 3G6JB 3AKTA 3FLPA 2YV8A 3BU7A 2RS11 2WNUC 4SLIA 2WZPP 2RS51 2D3PA 4N7UA 3ZFFA 4V1PA 3SITA 1NLRA 4LBQD 1IHMA 3H50A 5JDBA 4LEJA 4RGGA 1G9DA 1TNRA 4QPIC 3TAYA 2HKXA 1Q8VA 3G7DA 1J3RA 2BVBA 2E9QA 2K0GA 3VKFC 5AFBA 2ETEA 4OHZA 2BWAA 1NCRC 1OOPA 2DVDA 3S7IA 3V0BB 4AEDB 2C0ZA 5GALA 4YZ5A 1GZ9A 4E2QA 1VBD1 2RM23 1RUD2 1UIJA 2ERFA 2R6QA 2P34A 2BNOA 2ZGPA 3J26N 4Z8BA 4HPKA 1AX1A 3FLRA 1REFA 3WP3A 3CLPA 5FRAA 3ZSLA 1UN1A 1K5MB 2CV6A 1HXS2 2ZX3A 1QU0A 3BODA 2X5IC 1R1A1 1KD7A 3D5OA 1JOJA 1RUC2 2HWE3 2EXJA 4KGGA 1B35B 5DUUA 2JG8B 4LO5B 1AYM1 4YW3A 2D6MA 2JJ6A 1IZ3A 1CAWA 2QE3A 1DHKB 2ES3A 2QUOA 1XE8A 1YXWA 4CTEA 1LHOA 2WLQA 2BUKA 2X53S 3HD8B 3ILNA 5CA6A 1JH5A 4LA3A 4AW7A 4CRQA 2PLV1 3IPVA 2ZHNA 3SMHA 2DCKA 1H8TB 4GB31 3WW3A 5CFCB 3AP9A 3ROUA 3DPRB 1FOD1 5DZFA 2BFUS 4P9LA 1S2KA 2V5YA 3D82A 2DUPA 4FPCA 3W58A 3D4KA 1GV9A 2BYVE 2G9GA 1Q8QA 1ND3A 5CIRA 5DXDA 4YVSC 5CFDA 4QQPA 1OQ1A 1G9CA 2IXLA 1V6IA 4AVTA 3QH6A 1FPN2 1XYOA 1NG0A 1VP6A 4KNCA 1ZRRA 4HANA 4EN8B 3AM2A 1SFNA 4AQSA 1NA1B 1NYWA 2VQAA 3AMQA 2GDFA 1PNFA 3ENRA 5CAZA 3WDWA 4BIFA 2LTNA 2WQZC 2I07B 3RZZA 1D0HA 1W6PB 3FBMA 1DQ2A 1TMF3 1GYKA 4NVPA 4IEWA 1AL22 2DUQA 4D69A 1LESA 1V6LA 1UF2C 2WKKA 2R1BA 4L92A 2D93A 4E9KA 2RE9A 1D0GA 1GQGA 5IK4A 1OSGA 4DPNA 5CG8A 3VZJA 1O4ZA 2XVLA 5DUXA 2DVAA 4Q29A 2YYOA 5JR7B 4OI0A 1MR5A 1FI2A 1PM7A 2ZACA 3U07A 2GH2A 4AF9A 3EHKA 1MS1A 1K5MC 3OF1A 1AR63 2DV9A 3IKWA 3KSCA 1RUJ2 1QQP1 2ZAHA 1KS4A 4LHLA 3WUDA 4DOUA 5E89A 1I5ZA 2JG8C 4MSVA 1O3RA 2WLPA 3OTFA 2A75A 1HQLA 2OZ6A 1CD3G 1CPNA 2XH6A 3AJYA 2WIIB 3WP4A 2YC0A 4M3CA 2RMU2 3V64A 2P2KA 1MEC1 2WNEA 1XNCA 2D40A 3IIAA 1RUD1 2CGNA 4LHKA 2MEV3 2ZGNA 4PLNA 5JOZA 4CYDA 4P9JA 1ZRFA 2F6BA 2JXAA 3JBG3 2FBEA 3ES4A 3VBFB 1RUE3 2QZ2A 5A3MA 2XJSA 3OY8A 4DXZA 4K1YA 1ZBA2 1LOGA 1W2UA 2DU1A 4N90A 3AMMA 2WS91 2O0OA 1AYN2 2UWCA 3B94A 1AR72 4YZ1A 1SLAA 2R16A 5C6CA 1Z0HA 2R0FA 4AVSA 4I2OA 3HQXA 3QCWA 1U5IA 3IDBB 2WSVA 1NA1C 1V70A 4QGNA 4CEWC 1QDOA 5C8WA 4RHV2 1VLNA 2QQPA 4GA9A 4Q8LA 1OQEA 1RHI3 4EROA 1QOSA 4PBOA 1R092 4GH4B 1NXD1 4FTSA 2QDNA 1YYNA 1QJZA 5ABJB 2W52A 5J7MA 4YYOA 2WFF2 1VRH3 4RA0A 1WCSA 5A32A 4HK8A 3ZXDA 4LR4A 2UWBA 4Q27A 2PTMA 2NQYA 4ZXKA 3RNSA 2HWF1 4Q4W3 3U11A 3WG2A 3BPZA 1BEV2 1CAXB 1COV2 3UKVA 4CP1A 3M8LA 3NV4A 4GULA 4BMEA 4Q0QA 3H3ZA 1BCXA 3KGZA 1DFQA 3I7DA 4XFBA 1CIWA 2Z5WA 1U0AA 1YFWA 2BNNA 3MEPA 5GLWA 2D5HA 4N53B 1NE4A 1I6XA 1RINA 4UW3A 2VOWA 1ULDA 2R071 4H7MA 1U12A 2I45A 4AFMA 2BPA2 3AKRA 1BQPA 1SLIA 2HYKA 4X6RB 4F3JA 1HRI2 2RM22 3ZN6B 2D6LX 2UYBA 4CEYA 4HLTA 1QWRA 1WD4A 2ET7A 1UW8A 3B9CA 4Y20B 1ND2B 5FMOS 3VBUA 1BYHA 1RUJ1 1A3KA 5H9PA 5LRSA 1Q3EA 2DWRA 1AYM3 2D3SA 1UU5A 3HIFA 1SCRA 3FWEA 2WZR2 4FPGA 4GKXA 2RS33 1IKPA 5EV7A 4KBBA 3ZFGA 5BNPA 2X8KA 2B5HA 1CQ9A 2PLV3 4YW1A 3BIWE 3ZXLA 3JD71 3PJQA 2HWB3 5C9AB 4DS0A 1RITA 3BOWA 3LCPA 3ZN5A 1LHUA 3N36A 1FMD3 4Z07A 3W9AA 1UMZA 3NAPB 4GH4C 5CU1A 1NCQC 1PO11 1BBT2 1LEMA 4QD2A 4IV1B 5DZEA 5I8SA 2A6ZA 2DCJA 2ET1A 1LR5A 4PIXA 3SNMA 1CAVA 5JSPA 3MPBA 2ZBJA 5AVAA 5I0TA 1F5JA 1PO23 3ZPYA 3OD0A 5E88A 4XDQA 5JIUA 4I02A 2YROA 4YZ4A 3AZZA 4MXWB 1DGRN 4QPGA 1UCXA 2E7QA 4XJ8A 3H7YA 1VAVA 3AB0A 2PHFA 3WDXA 3E5XA 2XWBB 2PAEA 2WNUA 1FT9A 4AXOA 1HRV2 4A7KA 1XNBA 2D43A 4HZFA 2R061 2PHTA 4RHV1 5T5OA 1WMEA 4QPIA 1RUG1 4K9SA 2D3RA 3CF6E 4GMP0 4N53C 1LB2A 1OHFA 3CJIB 1NCRA 4JV4A 4LBQA 1TMF2 3MLLA 1ASJ2 2YY1A 1W6QA 2DCTA 3N7KA 4YGEA 3AMHA 1CJDA 4FQZA 1W0OA 1CGPA 3U10A 4LO4B 1E57A 2OPKA 2Z42A 4FO9A 1BZWA 4D7SA 2VULA 1LOCA 1CN1A 5T5LA 1RUF2 4BH9A 4L99A 5FOBB 3RI9A 1YFXA 2X5IA 5DDJ1 5E16A 5K8SA 5JZGC 1RC6A 1LECA 1ND2C 4B4QA 4H7LA 3VL8A 3POYA 1AR62 4AGVA 4LO6B 4EJRA 3ECQA 2WINB 4YM1A 2JECA 4QGLA 2PQQA 5EWSA 1QJX1 5J09A 2PYTA 1SBFA 2G4IA 1CAUB 1OKQA 3LOIA 3J9SA 4AEKA 1EYBA 1RUD3 4A7ZA 3PNAA 3QBQA 1QOTA 1V6KA 1QDCA 3R4DB 3R05A 2UY8A 3ZYJB 5D8AA 1RMU1 2MEV2 3WP5A 1NLSA 5C4WC 3NAPC 1SBEA 3UKTA 5HCAA 2GAUA 4YVSA 1I3HA 1BMV1 2DUOA 4FXKB 2G9FA 1QY4A 1RUE2 4WZFA 5EFUA 4M3CE 2H6CA 3RMXA 1RUC3 1DG6A 3DN7A 4IV1C 3ACLA 2LALA 2WS93 2OW4A 1AUYA 5FCCA 4L9BA 3ZXGA 4OHWA 5GLTA 4AVCA 3TOJA 5T55A 1BK1A 1AR92 5ACA1 1HV0A 4KU7A 1HX6A 5GLVA 3VBSB 1H1AA 1KITA 2DCYA 4I0AA 1W6MA 1SDWA 3MIBA 1PMIA 3WV6A 2WNVB 3CJIC 3V0BA 4M0NA 1ZRCA 2GZWA 4F8AA 5KWRA 2MHFA 5AC91 1CESA 2QNKA 4XPVA 5FO7B 1UX6A 1K5MA 4IESA 4GKYA 4QQLA 5I8YA 1BXHA 3HAGA 4YM2A 1FV2A 2K9ZA 4Q4W2 2Q5TA 3V0AB 2JG8A 3ZYGA 1HRV1 1DLLA 3Q9OA 2NM1A 2RS12 3GZTB 4FCAA 4XFGA 1GBGA 4WVVA 2RS52 4OULA 3FFZA 3ATGA 1AL23 4JDOA 2A6WA 4S2FA 4BHPA 3ME2A 1GICA 2O1QA 1A78A 5JAXA 1V6OA 3I59B 1VBD2 4X8NA 5IK8A 3R0RA 5HBAA 1YIPA 4Y1ZA 1O91A 5EXOA 4UW4A 3MF6A 4JRLA 2VPVA 4AG4A 3IT8A 3VZOA 4B4RA 2JG9C 1D4M1 1RUJ3 1MS4A 1X36A 4YM0A 3SCGA 3IBMA 1C57A 3HT1A 3VBOB 1R1A2 1LGNA 3RS6A 4CDQC 2XLAA 4WVMB 3MI8A 2XJQA 4OI1A 4I0WB 3NV2A 1LU2A 3AZVA 4Y1YA 4WM8B 2ZKLA 1ZZ6A 4META 3NW4A 4B8EA 4CEWA 5FDBA 5LK5A 2RMU3 1OA4A 1R1ZA 3JD73 4P9YA 1DQ1A 3RMYA 2VG9A 1W6PA 2GC1A 2H0BA 3PMEA 3VBSC 1A8DA 5JIAA 4GB32 3SISA 1FOD2 5FO8B 3DL3A 3RYKA 2ZGMA 1PO13 2D6KA 4L97A 4QU2A 1RVF1 5JSRA 2AENA 1ZREA 4Y22A 3FZ3A 4EN7B 2GN3A 2E53A 1AYN3 2Z79A 1AR73 4Q4Y1 2VQ0A 2O8QA 3VHOA 2WQ4A 1FAYA 3DGTA 5DZGA 2B9UA 3IDCB 3ZN4A 4AFBA 3TNQA 3H1YA 4XW3A 3RJRA 4IV3B 4RHV3 5L19A 2D7FA 1PGW1 4YVWC 5JI7A 3H3UA 1LOFC 4AFCA 2R32A 4BLJA 3R6SA 2SBAA 4XMAA 4BYYA 4XF1A 1R093 4YARA 4LBOA 3ZSKA 4LT5A 3OYWB 2VXRA 4I3GA 1N1TA 2JDZA 5JPNB 2AYHA 2BQPA 4QQ2A 3WDYA 2WFF3 4OHVA 4P14A 3WP6A 3A4UA 1WCDJ 2B7YA 5DG2A 5A33B 4YGBA 4EWDA 2WT2A 2ZX2A 1FXZA 2ZMKA 2CAUA 2VGDA 1N1YA 2XL7A 5DDJ3 4IEXA 2XVGA 3AKQA 1UKRA 1QQP2 1UPSA 3VBOC 1KS5A 1O4YA 3ZIXA 4KH9A 4JGZB 1W39A 1W6OA 4FOQA 4R52A 2WJSA 2XLGA 3LB9A 5HXVA 4QQHA 1XYNA 2ZA9A 4FOWA 4WM8C 1ZA4A 2UY9A 5I0UA 4YG6A 4BLIA 1IS5A 1QGLA 1S2BA 2JKBA 2TUNA 2OIIA 1Q8PA 4FT8A 3MDPA 4RQPB 2BGCA 2P3JA 4FQ4A 5J98B 1DYPA 3FX3A 3KGLA 2Y26A 1MEC2 1VAMA 3MIGA 1HRI3 1FYUA 1RJ7A 2D6OX 5HCFA 2D5FA 2EALA 4GH4A 4J1WA 2V09A 1RMU3 1SMVA 1NCQA 2NYYA 4ATFA 1S0GA 2FMDA 5H9QA 2PA7A 4IEVA 4RSUA 1QXJA 3E5QA 5IT6A 3LSDA 1RUI1 1ENRA 3BTAA 1YIFA 1X8EA 1W6NA 1AR81 2BWCA 2WS92 2WZR3 3SCFA 2ZX0A 3VBHC 1KRIA 4UW6A 4MZUA 3D0JA 2AH2A 3GYDA 1DDLA 1X50A 4FBFA 5C8CB 1AX0A 1NY72 1KJLA 2VVDA 4BQ1A 1C1FA 4XJAA 2NMNA 1KJRA 4IV3C 1M4WA 4MYEA 3C3VA 4LTAA 4XHXA 4N53A 5KHGA 3UJOA 1LCLA 5BNNB 1HKDA 4EN6B 1ZM1A 4BPZA 3RYPA 2EXKA 4LUKA 1J1LA 2EXIA 2VVEA 1MZFA 5F9TA 5B2GB 1BBT3 4XXPA 1XU1A 2A6XA 4R4XA 3JUUA 3WUCA 5L7OC 4AYUA 4FTBA 3J4UH 5AC93 3SH4A 3T2TA 1S0BA 4COYA 1C8NA 3WD5A 4JDMA 3RYRA 5JZGA 1ND2A 1F31A 2HWF2 3OBRA 3NSTA 1POV0 4E27A 4IQPA 2PN5A 4CDUB 2CL2A 4MXVA 1HRV3 3VBRC 5J37A 2HJIA 3AP4A 4JGZC 4S2DA 4YG3A 2PHWA 4NWVA 2ZZJA 5KHIA 2IC1A 1RGSA 4FP3A 2QCSB 3VDDB 2ZGOA 4FXGB 4AHXA 2ZABA 1ASJ3 3JQXA 2R072 3P3NA 3WHTA 4MGZE 3PHMA 1AXKA 4AEDC 3OGJA 1MS0A 3PVOA 4R9AA 1RUF3 5C4WA 4E2GA 1JN2P 3NAPA 2YGLA 5JMCA 1GNHA 3KT7A 3N3HA 1IQAA 4YFZA 4XIOA 2HEWF 1H8VA 3L2HA 3LA3A 2TNFA 1ZNPA 1X82A 1U5XA 2VH9A 3USUB 2E63A 1B35C 2YZ4A 4MXWA 4AI8A 2GNMA 4R8HA 1UZYA 4XIKA 1MZ5A 4KWLA 1X7NA 4JAAA 4COZA 1ZZ7A 1MVQA 3CL1A 4K40A 1UU6A 3HR9A 4KQ7A 5H9SA 4RS5B 1J3PA 3JD72 4COWA 5JI9A 5JLVA 1Y9QA 3CJIA 1C3HA 1H8TC 1QH6A 5BNNC 2XLFA 5CFCC 4OI4A 3ALQA 3B00A 3DPRC 1D4VB 4OHYA 3VGIA 2VNGA 1LOEA 1PO12 4OLLA 2TEPA 2WSUA 2YPJA 3LWCA 2HWC1 4XZPA 2CWMA 3MIEA 3WX5A 1NQDA 1MS9A 1H4GA 3VKMA 4C0HA 4QHBA 1UZZA 1ZBE1 3ZYIB 4EN0A 3DUIA 5AVPA 3MYXA 5HI0A 3JB8A 1NY71 2BTVC 3VKLA 1AR93 2XJUA 1YI9A 3ES1A 1QJU2 1HLCA 3WXPA 2DVFA 2R062 4AI1A 3JB4C 3VDDC 1RUG2 4B29A 3WZ1A 5FQ0B 2Y0IA 2A3YA 1LULA 1PGL1 1WW7A 3NJZA 3AZYA 1B09A 2DVGA 3MW2A 1H2LA 3N7LA 4AI3A 4B4PA 4LO7A 3WCSA 4WVWA 2KA3A 5L36A 1RUH1 4JTOA 2JG9A 2PAKA 5LEKA 1OOPB 4FPFA 2R041 3SLIA 3RPQA 5BNQA 5DDJ2 5I93A 4CDQA 1H1MA 4PLMA 1C1LA 2ZGKA 2IXCA 1LHWA 4HN0A 3B9IA 2RS13 4DINB 5DUVA 5GZCA 1GLHA 2RS53 4AWDA 2ZS6B 4LBMA 5GLUA 2I2SA 4MX3A 4BOWA 3RG0A 1QJY1 5KC5A 2ZKNA 1N1SA 2VUAA 1QJX2 1XQNA 3OCPA 4GWNA 3VBSA 4FPLA 4K1ZA 1XRUA 3AJZA 4RS5C 1CAWB 2RR11 1VBD3 3CEWA 1S55A 3AFGA 4AEJA 1ULEA 4S2GA 3LAGA 4QGMA 2LM3A 2D97A 4Q0PA 4HVOA 1O4TA 4XOGA 1RMU2 1YHFA 3IPVB 4WZCA 2EAAA 1ZRDA 3THPA 3SCHA 3VBFC 2B42B 1BMV2 2VW2A 1R1A3 5GZDA 1OPOA 1VIWB 2XG3A 2Q8OA 4GWMA 1AX2A 1YJKA 2A3WA 2BW8A 5F5QA 2OA2A 3AYDA 2ZJCA 3TNPB 4W6XA 3T1MA 2ZGQA 1W0PA 4UBGA 1ND3B 3M3EA 1ULGA 5H9RA 3V0AA 4EWEA 5CFDB 2WA3A 3ZX7A 2JD4A 2FQPA 3OJBA 4HKLA 3FLTA 3VKOA 1EAH1 5ACA2 1DGLA 1I9RA 3IMNA 4YVWA 3LA2A 1LOFA 2VOVA 1J58A 2B45X 4GB33 3W59A 4EWAA 1TME1 3PTYA 4IETA 1FOD3 4Y4YA 1A8MA 3LKJA 2H0VA 3AMPA 2VMHA 4FPHA 3J8F2 4Y1XA 1WD3A 1G9AA 1PZ9A 3JQWA 5ABJC 1UAIA 3M3OA 3TB0A 4DRVA 2BFUL 3ASIA 4Z82A 5AC92 1FV3A 1AXZA 4NR1A 4AVAA 4COUA 1OMIA 1Y43B 2XL9A 4AVBA 5BNOB 3WDTA 1MZ6A 4AHZA 3OBTA 2XJPA 4XJUA 2D6NA 1QJU1 1YFYA 2ILMA 4LBNA 4B7KA 5FLIA 1D2QA 3ZYRA 3AP7A 4WM8A 4I0BA 1H4HA 1GANA 5DUWA 1PIV1 4F83A 1GNZA 1SCSA 1M06G 4M0HA 3I4IA 3KQRA 2FZ2A 3D6EA 2IFRA 2E6VA 1XYPA 3B01A 4OI2A 1H0BA 1ULFA 1N1VA 1X8MA 3MLJA 3V65A 5J96B 3N35A 5JOXA 2PAMA 3P3PA 2Q1MA 2VU9A 4CP2A 4DMIA 4NHMA 4Z92B 1LRHA 2ZAAA 1G9BA 3KCXA 4M3CB 4Q26A 3WOGA 4JQRA 1RUNA 1D4M2 1QQP3 1ZZ9A 3TN91 2GMEA 3N7JA 4JTNA 2YHJA 3TWIA 3VBHA 5J48A 1LEDA 4XEZA 1MS5A 4OUSA 3ZXAC 1WLDA 3U4XA 1J59A 2PHDA 1KFUL 4CZSA 3INAA 3OD4A 4XBNA 4Q4X1 3TBDA 2GMPA 1WBLA 4L11A 4FP2A 4FAHA 1MACA 5BPXA 2A5ZA 2A73B 1HQNA 1MEC3 4YGDA 4CP0A 3SH5A 3M3QA 4BWOA 5C9AC 2ARBA 3K51A 4MGKE 4FPOB 3OYWA 2GC3A 3AKPA 5L7OA 1OD5A 2ZHMA 4LA2A 3FJSA 4LE3A 2GSYA 1RVF2 5CNAA 1U5YA 4URTA 2VW1A 4XTPA 1VB4A 4IEOA 4Q2FA 4NWWA 4XF3A 2ATFA 5A33A 5FPXA 4D7YA 2DF7A 3FC0A 4AI2A 4RR3B 2RJKA 4YG0A 4G9SB 4PCRA 4Q4Y2 1A6CA 4FAGA 5FFOC 4L2NA 1Y7BA 3VBRA 5CG9A 2ZOEB 3VHPA 3AXEA 3ST7A 4N7IA 5BNOC 3R4UA 2WFPA 3I2DA 3X29B 4P9XA 4D7TA 2ZX4A 5CBLA 2JEMA 1PGW2 2MPFA 3FE5A 2HWE1 3KZ4C 3GHNA 4KG0A 1GKBA 3AXDA 1AHSA 3LOBA 4JVAA 4AEDA 1Q8SA 3J8F1 1PZ7A 3VUOA 3EQEA 3O12A 5FO9B 4Y24A 3WVJA 3M3IA 2XBO1 1QMJA 1H9WA 4H3WA 2HWF3 4N9IA 4CDWB 1URXA 2I74A 2GALA 1B35A 1REEA 1ZZ8A 3NWKA 5TSWA 1V6NA 1WUVA 1PK6B 3IDEA 4XETA 3VN4A 4CEYB 3B93A 3TYJA 2IXJA 3N7MA 3O0WA 3VBUB 1QJY3 3AFKA 3GZUC 3NV1A 2R073 4HK9A 1QXRA 3L9JT 4C1WA 5HCBA 1TNFA 4MLOA 4QM9A 3VHNA 2RR13 1C8M2 3LGRA 4HT1T 1H8TA 5BNNA 2FZ1A 5CFCA 2DTWA 3DPRA 3ZFGB 1JXNA 2A6YA 5BNPB 4FPJA 4W65A 1WMDA 2A7AA 3DKWA 2JE9A 4YLZA 4JRAA 2XPJA 1SBDA 3MZHA 1RB8G 4R9BA 3MPPG 3M4FA 1RUI2 1WW6A 2CGPA 1TEIA 1F2NA 1AR82 2R0HA 4HMZA 4RR3C 1IKQA 3E6CC 5FMOL 5FAXA 3WG3A 5T54A 3GNEA 1NA1A 4N43B 1VBE1 1G86A 4J1XA 4QX5A 3O0VA 1EAH3 4WM7B 3ZFEB 1IGOA 2VY0A 5BXXA 4ONUA 2ZGSA 4P9IA 1GQHA 1KXGA 4A3XA 5GLZA 2EF6A 3CNAA 3VDDA 1Q43A 5LK7B 1TME3 4C90A 1UU4A 3E97A 5K7PA 2C5DA 1GZCA 4WVZA 1BKZA 1BVVA 1QF3A 2WNVC 1VBC1 4LNVA 5AFEA 5KXEA 4IEPA 1KDMA 1HDKA 3O14A 4KWJA 3KT1A 4XE9A 5FOJB 1LGCA 5GZEA 1N3PA 1NQJA 4LBQB 2PHUA 1VBA1 1H2NA 1O3SA 3JZVA 4DY3A 5BUVA 4CDWC 3EJKA 5KXBA 4XF0A 2BBVA 4Q0SA 1BVP1 2PELA 1QJU3 2YGMA 2TBVA 4PJYA 4HETA 1NOVA 2GC2A 3JBG1 2R063 4X6QB 4AHYA 1PK6C 2IWGB 4BA6A 1CX4A 4R9CA 1LHVA 2LUWA 2X5IB 1XU2A 3RSJA 1RUG3 2P3KA 1ENSA 4JGYB 4BE3A 4E4DX 2C9AA 4N9HA 1F9KA 4WV8A 4RS5A 4PIZA 1R082 1UIKA 4PDWB 1T6GC 3M7AA 3ZXFA 1PVXA 5IK7A 1FNYA 2IXHA 3VBFA 4F7ZA 5IK5A 4MV2A 1PGSA 2EXHA 4LHNA 2W68A 2IXKA 1JYIA 1DF0A 2JENA 3APBA 1RHI1 2K2SA 5KHHA 2P17A 2QKDA 4BZ4A 5D8AB 1YCIA 4C1XA 4IL7A 3RRDA 2RHPA 1DQ5A 3JU9A 2VNRA 1O5LA 1LJ7A 2Q1ZB 1O7FA 1VRH1 1QJX3 3MFCA 4Q4X3 1KQRA 3EO6A 4N43C 2DYCA 3GF6A 5K0UB 2GNBA 1AVBA 3N4MA 4JDNA 4WM7C 3WHUA 3ZFEC 3WR0A 1ZX5A 1Q8OA 1QOOA 4KL1A 1C8M1 1OA2A 4LBJA 4RD7A 2D98A 3LA7A 2OUHA 5SV5A 5EZWA 4FPYA 4M01A 3ZSEA 3THTA 3PJYA 4GIQA 1YO8A 4W6WA 5F6KA 1GFF2 5FQ0A 1ZZBA 3S6PA 1NE6A 2O8OA 3UKNA 5ABJA 2VMIA 3VV1A 3M70A 5JVVA 3WT3A 1W6MB 1ENXA 1V9U1 3VHRA 2B46X 2HWC2 4HVQA 4TYSA 1XXNA 5L73A 4CDXB 3VZKA 2OYZA