3HWJA

Crystal structure of the second phr domain of mouse myc-binding protein 2 (mycbp-2)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
161
structure length
149
Chain Sequence
LNRFTKTSQGRSWNTGNGSPDAICFAVDKPGIVVVGFAVYGGGGIHEYELEVLVDRWTSLELVKGTYTTDDSPSDIAEIRLDKVVPLKENVKYAVRLRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTRGQIPQILYYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of PHR domains from Mus musculus Phr1 (Mycbp2) explain the loss-of-function mutation (Gly1092-->Glu) of the C. elegans ortholog RPM-1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase MYCBP2
total genus 34
structure length 149
sequence length 161
chains with identical sequence B
ec nomenclature ec 6.3.2.-:
pdb deposition date 2009-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.820 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3hwjA00
3GBWA 3NO8A 3HWJA
chains in the Genus database with same CATH superfamily
5IYYA 1R083 2RDRA 1SDWA 4QQPA 2X05A 3TRSB 2MEV2 3WD5A 5KC5A 3BPZA 4R9BA 5BNNA 5T54A 2JG8A 3WF1A 2LALA 3OUIA 3WR0A 4N8MA 4GAZA 2XONA 3TB0A 3ZYGA 3QACA 1QOOA 3BU0A 4FP3A 1PZ7A 2A70A 5LZ6A 4ZZ8A 3VBUA 4CCMA 4E4ZA 1MEC2 4GH4A 3ZDVA 4HVQA 3THCA 1LAJA 3D82A 3HN1A 1JYIA 2ZBJA 1F5FA 4M4RA 4BJ0A 4UFMA 1SCSA 2W68A 4QB1A 4CDQC 1AJKA 2MEV3 2WNVA 4K20A 5FJHA 4U36A 3HQRA 4LPLA 3P5BA 4ZONA 3WQBA 2JG9B 1PO12 4YYOA 5AC92 1QXPA 1RHI2 1YQ5A 4URTA 3O1PA 2E26A 2XKOA 3M70A 1ZBA3 3WHUA 3LF7A 1DQ5A 1V6MA 2V73A 4LOSA 3I2GA 5A3TA 2WL1A 4XUNA 1GNHA 2XQRA 5C3RA 4FSJA 3UKVA 1QJY3 1T2XA 4FPKA 4LKDA 1BXHA 3AL5A 4OI0A 2D93A 1O59A 2Q5TA 2OZ6A 4Y22B 1QEXA 1ZX5A 2FDJA 4YW5A 3I49A 4GMP3 1HKDA 2V5YA 1O3RA 3TOJA 1VAVA 4MXWB 1B35C 4XF4A 3WCRA 4JDNA 4RYDA 5T55A 2BDRA 2BWAA 1PMIA 2WDBA 3K2OA 5IK7A 5I0TA 2QQVA 3FN9A 5LA0A 3IDCB 1VAMA 3N7LA 3OUHA 4UOJA 1Q5OA 2PLV2 4PLOA 5F5IA 1CIYA 3IIAA 3W20A 3WSOA 4MG2A 3PVBB 4UF0B 1CAVA 1NCQB 3FFQA 5K7PA 1Q8PA 5M0TA 3HR9A 5FZ3A 5FZOA 4AHYA 4LKEA 2BBVA 1H6YA 3LEIA 1K3IA 1LU1A 3IM0A 5C6CA 1GOFA 1V9U1 3CF6E 4CP0A 1VBB2 4CA9A 2RG4A 3SCHA 4DS0A 3JD71 1GANA 3P6BA 1LR5A 4Q4Y3 3C2UA 2I74A 1FNZA 2QQIA 3POEA 3PVNA 5I8SA 3DKQA 2X8KA 2L9LA 2BGOA 5K9YA 3PUQA 4B7KA 3JD72 1PM7A 5FZHA 3PUSA 2WLPA 5FUIA 1CAXA 3FHIB 1SLTA 1AR81 4NAMA 1DGWA 1Q8SA 1ENXA 2O8QA 4RHV2 5BNNC 1H6XA 5KHIA 1W8TA 2JD4A 1OBNA 3FMGA 2DUPA 2WZR1 3S7IA 4QPIC 4Q4X1 5F2SA 5FOJB 1HN1A 3RZMA 2Z42A 5KHKA 3AZWA 2ZMNA 1AR63 3ZYBA 2VOXA 1RUG1 4FVVA 1PMJX 3OB8A 4ORFA 5FZFA 1OD5A 2WT1A 4QPWA 5AVAA 3PUHA 2ZZQA 2MHFA 3AYAA 3PMSA 4RR3B 3ZXEA 2HWB1 2OKXA 1K12A 1ULCA 3BYWA 5DPNA 5IVFA 4LQRA 5LK7B 3W5NA 1RUI3 2BGPA 1GU3A 2BGCA 4CP1A 4FTBA 1CJPA 1LEDA 2NN8A 1N1YA 1OVSA 2H0BA 1JU4A 3AK0A 4BQ1A 1X8EA 1VBE3 1RMU2 4MSVA 4I01A 4PI0A 4HKWA 5I0DA 1VALA 2EIDA 2W87A 2YV8A 5A1AA 3NJXA 5GJ6A 1ASJ1 4Q0SA 5C7GA 4AXOA 4CP9A 4XF1A 5E88A 3HMYA 4XMAA 5DZFA 1DGLA 2VTXJ 2XHNA 2D6NA 4K1ZA 2P3IA 5DXDA 4LBKA 4Q4V2 2VZVA 3BALA 3MIGA 1DU3D 2D43A 2Y6LA 3M7AA 1SQ4A 1RINA 2HWB2 3LA3A 4P9XA 3CKHA 4X6QB 4BK5A 2X29A 4XF0A 1FMD1 2AEZA 1K42A 1R1A2 3SH4A 2OW4A 5LA2A 2D6LX 1UU5A 3MFAA 4BE3A 4ASLA 2R073 1HW5A 4L97A 4XPVA 3WP4A 5CG8A 1O4YA 2P17A 2VBPA 3OBRA 2O14A 1AR91 3WLUA 1XE8A 1ZYBA 1HV0A 3NSTA 3DYMA 4L11A 1H8VA 2YDEA 2VMDA 4IV1A 3WDUA 5ABJC 4QQHA 4KGQA 4AVTA 4YARA 2ZZJA 4WVVA 3SC7X 2BU9A 3R05A 4WM7C 5F3IA 2QQWA 5FWJA 4HG6B 1BKZA 2DTYA 5H9RA 3T2TA 3UGHA 3LKJA 2R1DA 2XVKA 2ZHMA 4I0BA 4CE8A 2X5IC 5LA1A 4OHYA 5FXVA 1ZZBA 3GNEA 2V72A 1OKOA 1U5ZA 1X36A 4BZ4A 1JODA 2VXRA 3WP3A 2JG9A 1UOFA 5A3WA 5BNOB 2D3SA 2A1XA 1W05A 4XAAA 4OHZA 1U5YA 2MNGA 5FUPA 3U4SA 1K45A 2Y6JA 1OOPB 1PO13 4DUWA 3KT1A 3ROUA 1PMHX 1RHI3 4F83A 1SLAA 4HBNA 3ATGA 1Q8QA 2A7AA 1ZBA1 4UT5A 3A22A 2D6OX 3DGTA 3FBMA 5JSPA 1JTZX 1L7QA 4XFHA 2D44A 2OUHA 4NROA 1V6LA 2ZACA 5DUVA 1QJY1 1Y3TA 2GP3A 3ILRA 1RUD2 3KD4A 3L2YA 3M1HA 2ZEXA 4MZUA 1H2LA 5JR2A 5IFPA 3IN9A 2O1QA 1MVQA 3TYJA 1W99A 1AYM1 3WEZA 4CDUC 4I02A 4ITCA 2B46X 3O1VA 1A34A 2LRPA 5JCTA 3AFGA 1AL23 1CPNA 3AYCA 3POWA 4NHLA 3K51A 2Q0AA 1W6PA 4HKLA 3K75B 4XF3A 2QQMA 2QBXA 4HN0A 4FFFA 4IQPA 4OHWA 4H2AA 4JC1A 2BP6A 2LTNA 3SNMA 3MGUA 1IS6A 3RSJA 2Q8OA 3UT0A 5LEJA 1XNKA 3WT3A 4BQXA 3RS6A 1HQNA 1XSQA 2AYHA 4BM8A 1ND3B 4HK8A 4QPYA 3PLQA 3N9MA 3VLBB 5J37A 1UOJA 1AJOA 3Q8EA 2GU9A 3H1WA 4EJRA 2W52A 4YSFA 5GLWA 1RUD1 1HB4A 3F2ZA 1W0NA 3AMQA 5CNAA 1UYPA 2BUKA 4ARYA 4YVWC 1LOCA 2UWCA 2CL2A 1DYKA 5HV0A 3C7OA 3LEMA 5K0UA 3BI3A 1FNYA 1WW5A 3H7YA 4OYUA 3KSCA 4G9SB 1G9DA 3OG2A 4Y4RA 1B09A 4MADA 1JS9A 1S0JA 3PUIA 2HWE3 2E9QA 2WS92 4ZS3A 2OQ7A 5IW0A 1BEV2 3KZ4C 4L8QA 1LOAA 2VOVA 2JDYA 1KS5A 4IV3C 3MUY1 3APBA 4Y1XA 1MZEA 2OPKA 1AVBA 3Q8BA 3G6JB 5C4WB 5J1XA 2YUEA 1MVEA 3ME2A 3ZFFA 3TBDA 2WO1A 4XBLA 4CU6A 1XYNA 3OJBA 1TME3 4LOTA 5FMCA 2A6ZA 2HWE2 2HWC1 4KWJA 2P34A 2KM2A 3ACHA 1SG3A 3RWNA 4PDWC 4AEMA 4AOCA 5A3PA 5CEHA 5FP4A 3A0NA 4N7IA 1XBFA 4UFLA 4WZFA 2IXLA 1RUE2 4AGVA 4UFIA 4BLIA 3LD8A 4O7XA 4OCTA 3LA2A 3DF0A 2JDPA 2K0GA 3VZOA 2QQOA 1NXD1 1MACA 2VQUA 1UAIA 5KXEA 2ATFA 4DIQA 4AQSA 1YFUA 1GQPA 4UXAA 3NJVA 5JIAA 4AR2A 1K5JA 2C26A 1UU6A 1APNA 1X8MA 2RDNA 2W92A 2Y8KA 3N7JA 2P1BA 3Q8FA 4GJYA 4YLZA 4ZHNA 1UYYA 4YZ3A 4AI1A 4Y3OA 3OY8A 1RUH1 3VD9A 2CAUA 3VZNA 1NLQA 1X9PA 3KGZA 4MGQA 1QXJA 3ZFEA 5FPAA 2JB4A 1NUKA 1PO23 4I3GA 2ARAA 1W0OA 3RMYA 1HB3A 1OHFA 5FZ4A 1YQ2A 3MBWA 5FYUA 1ZBE3 3VBHB 1PK6B 3GCWA 4XUPA 2RJ2A 4QX2A 3WW3A 4BH9A 2D3RA 2ZGQA 3K48A 5DDJ3 1KGYA 3JU9A 4COWA 4M3CB 2OQ6A 1RVF3 1YFXA 1CAWA 3GJBA 4E4HA 2F6BA 1I6XA 3I2IA 1LOFC 3AP9A 4UI9L 4YW7A 1H9PA 5C71A 4AI2A 2PELA 2PXJA 2VQ0A 2R49A 2IXJA 5FY9A 1TMF1 1IKQA 2D97A 3HPNA 2RHPA 1QJX1 1XNBA 3J9SA 3VUOA 4DO0A 1ENRA 3I3QA 3T2QA 4IE6A 5JR7B 2PFWA 3T09A 4BLJA 1AX0A 1S0EA 3DKWA 3M3OA 2G1MA 3OBAA 2R32A 3VKMA 3ON7A 4LHLA 2Q8DA 3MO4A 5FMOL 3O1OA 1ALYA 3NV2A 1COV3 3UV9A 5ABJA 2JX9A 1ZA7A 5KXCA 4PCRA 1AYM2 4HSJA 1E57A 3JBG1 2PAEA 2A3WA 1BK1A 4HPKB 4KBZA 1N47A 4XIOA 2CU5A 3DYOA 5FRAA 5BYNA 4JVAA 4X8NA 5CU1A 4Y26A 2GNDA 1OPMA 1PIV3 2Y38A 1DZTA 5GZDA 3BGAA 1NCRC 1SEFA 4DFSA 4OQ8A 3N9QA 5CG9A 2W3JA 1CAUA 2Y6GA 5JXIA 1GOGA 4OULA 1AXKA 3M3IA 4CUBA 3I2OA 1JYWA 2W1SA 1BHGA 4P5HA 5K4LA 1AR82 1WCSA 4DEVA 2WS91 1VLNA 5FREA 3CJXA 3EBRA 4C90A 3T4HB 1A3KA 5AFBA 2H6CA 4QKBA 4Y1VA 4RD7A 1MS3A 4HZFA 4TZDA 3SHRA 3OGSA 2VD7A 1LENA 5A33B 3BUCA 5JXGA 5LCWL 2VNOA 4YW6A 5C70A 4WBBA 2B8MA 4GB31 3N9PA 2HH9A 4ISRA 4HVOA 1MS8A 2NMOA 1TVGA 2A75A 2DCZA 3LCPA 4V1PA 5JPNB 1H30A 3WUCA 3B3QE 4N90A 2BOJA 4CU7A 5F37A 3ZN6A 3M3EA 1JXNA 5F7UA 4LEJA 4BQ4A 4D6RA 2TUNA 4UF0A 4W6YA 3VBRB 2AEYA 1VMJA 4KWUA 3VDBA 3R4UA 1ZRCA 4XE9A 4XJ8A 1XPWA 2ARBA 5L7OA 4QM8A 5BNPB 2VW2A 2ZGUA 2ZABA 2XLFA 2H6BA 4NIAA 5A80A 4D69A 1BLZA 1WUVA 5EHDA 1JUIA 4GKXA 3FLTA 3NNFA 4YGBA 2DVDA 1NY72 2BBAA 4R52A 5DAWA 4B29A 4NJ4A 1UZ0A 2GMMA 3X29B 2BERA 4IEQA 3N9OA 4XZUG 1E5SA 2P3YA 2HEWF 1W6MA 1RUF3 5HCFA 1F9KA 3C8XA 5HBAA 5SV5A 1S2BA 2HWC2 4FPFA 3WQ0A 4QHOA 3VDDC 3E6DA 4TSVA 1I3HA 1YQCA 4KWLA 1JUHA 2P5BA 4AGRA 2GC1A 1BMV2 2PLV3 5CFDC 4IGPA 1NYWA 1Y7BA 3FX3A 4B8EA 5LW9A 1OT5A 5C4WA 1JZ6A 5C9AC 1F31A 4A3XA 3MZHA 5HCHA 4LIUA 1UX7A 4IE7A 5FY8A 3U78A 2DVAA 2GMPA 2Q1FA 1CWPA 2A3XA 1MR5A 1WMDA 2FZ1A 3SLIA 4XC9A 1W8FA 3C7GA 4A6SA 5BY5A 2DVBA 2YC2A 1PZ8A 4XJWA 5H9QA 2D40A 2D7FA 1GZTA 4UW6A 1BEV1 1AR92 1EYBA 2QQLA 3WF4A 4CZSA 5BV6A 2WABA 1ACCA 3D6EA 4Q2FA 4X8PA 4ATFA 3N4MA 4GWMA 3ZXKA 5JWPA 4CRQA 3WW2A 3MF9A 4J1XA 4MYEA 4QPGB 3NQHA 2C5DA 3ZR5A 1LHWA 2ZX2A 4EN6B 1EAH3 4LMFA 2A5ZA 4P02B 2ZGNA 1WW6A 5FZKA 1VMHA 2R061 2XWJB 1XSRA 3GBWA 5BXXA 5A3NA 4MOAA 2OT7A 2QDRA 4QPIB 1G9BA 1W04A 4IW3A 4GQ7A 4IEXA 2WUHA 1W2NA 2VTXA 1QH6A 3VGIA 1YCIA 4CCJA 3MICA 1YFYA 1GYKA 3NAPB 4BQ3A 1F5JA 4JZRA 5IFTA 1BVVA 4IXLA 3MIBA 5JMCA 3IMNA 1JYXA 1Z7S2 1MQTB 5CKNA 4CEWA 4CTEA 2ERFA 2R041 2GN7A 1WW4A 2IXKA 2VBBA 1RUNA 3ILFA 2FCUA 2VVEA 3U11A 5IJRA 2VW1A 3UL2A 4IDZA 3WVJA 2RDQA 1MS5A 2VJXA 5I8YA 4K8RB 5J3UA 2UWBA 1JI6A 1OH4A 1YI9A 3CHXA 4FPOB 2B5HA 5DN2A 1BZWA 5FZ6A 1C1FA 3J7MA 1H8TC 1YRZA 2CY6A 1UIJA 1RUJ2 3LWCA 5FZBA 4U2AA 1RMU3 1TMF3 2BJSA 1W6NB 3J7NA 3WHTA 2JICA 3CO2A 2Q30A 3HNBM 1NE4A 5FLJA 3V0AA 4QDRA 1UMZA 4CXYA 4SBVA 2A6YA 2TEPA 5ACA3 1AX1A 1C8M3 3KV5A 4GWNA 4FO9A 4KI5M 2Y0OA 4LBMA 1SHWB 2C9KA 1QF3A 2X10A 3AKRA 3VB9A 1FPN1 1B35A 4W6WA 2JG8C 3F95A 1COV2 5D21A 4Y5SA 2ZA9A 2BPA2 1LGNA 1W06A 2FBEA 2W39A 3OUJA 2VUCA 4FAHA 1WMFA 1FX5A 2WNOA 4JX0A 1AZDA 3UJOA 1FXZA 2W08A 3ENRA 5A32B 5FZCA 3DPRB 4Q4W1 4YVWA 2OIIA 3DECA 4KU8A 2CSGA 1QMJA 1RB8G 1C8M2 4YG6A 1MEC3 1JYNA 4FFIA 1PIV1 2XJTA 5FZ7A 5FLHA 1J59A 1QQP1 3T1MA 2IWGB 3KQRA 3MV11 4FFHA 1G9CA 4XFFA 3BIEA 1V6IA 5FXWA 1HRV2 5GLZA 1W2UA 2HYKA 2XUEA 4S2HA 4EYUA 1AL0G 3TN93 5CFCB 5KXDA 1ZZ6A 3PVOA 3GM8A 5E89A 4H3WA 3A21A 1OUSA 2HWD1 1HB1A 2JDKA 2CGPA 3AM2A 1ZZCA 3VBUB 1W3XA 1WW7A 1EY2A 1PX3A 3UYJA 2BVBA 4AI0A 4OI4A 3T0DA 3J4UH 1Q56A 4AQ2A 3I2KA 2XL9A 1SLBA 2HWD2 4O61A 1VBC1 1GP4A 2VNGA 1HRV3 2W95A 2OUJA 1V6JA 1OC1A 1QH7A 1PNGA 1R1A3 4R8HA 1LOEA 5CYYA 5GLTA 4RQPC 3AP7A 3WOGA 4GMP1 1VBA2 3LSDA 3GF6A 4IEVA 4ET7A 5A6YA 1G86A 1LU2A 3WQ1A 4AEKA 2YPDA 4GJZA 2XPJA 5D1IA 2HWF1 2CTVA 2UYAA 5CIRA 1O8SA 1CAXB 2I2SA 3O0XA 1SPPA 4KWKA 4PLMA 1RUE1 3DUIA 1XYOA 4NPMA 4Y5TA 5DAVA 3NJZA 5F8PA 3T4VA 3T08A 4LNVA 2WWUA 1HXS3 3MEPA 2FDHA 1LOBA 1PVC3 2WO3A 4MGZE 2A3YA 4QD2A 3D0JA 2E51A 2XKPA 4CDWB 4E8DA 4MHUA 5C8WA 2PQSA 4WM8C 4LBNA 4P9YA 3RJ2X 3USSA 3WCSA 4W8JA 1UN1A 2XL7A 2V4AA 5L9VA 3GBGA 2YBPA 1DQ0A 4CCLA 2EXKA 2PLV1 2I07B 3U07A 2E33A 5IVYA 3MFCA 4JTNA 1NA1B 2XUMA 1HRI2 1OF3A 4QDSA 1PGW2 4Q0VA 1UXZA 1VRH3 3IIIA 4CPBA 3LFMA 4NMIA 5KWRA 5ERLA 4MGTA 2PHDA 1CVNA 4BHPA 4Q0PA 4ES8A 3LDBA 4LUMA 1YEWA 2RS33 4GH4C 3BTZA 4C0HA 4RS5A 3GYDA 3AP6A 3J8F1 1UY3A 5TSWA 5CFDB 5JOZA 1RYYA 4Y33A 3PU3A 1DQ2A 4D3WA 1HIXA 1D2QA 1LHNA 1WBFA 2CWSA 2HWC3 3B01A 1I1EA 2DBNA 3H8RA 1FOD2 5L9BA 1OQDA 4YZ2A 2GNBA 2Y60A 4YFZA 1FPN2 1J1LA 1OFSA 4AVAA 2ETEA 1ZRIA 3SCGA 4CUAA 1NLSA 1KJLA 4JRLA 3LFIA 2VR4A 2PHWA 2GMEA 3O1UA 3WUDA 3CZJA 1ULGA 1LKNA 2VMIA 4PBPA 4GULA 2WFPA 2KA3A 2HKXA 2ZPXA 3BB6A 1UWWA 1XU2A 2ORZA 1SBFA 3KF5A 2R16A 1ND2C 1UQXA 4JV4A 4QX8A 5FPZA 5FZ8A 2JDNA 3O7OA 3M3CA 3U37A 1XRUA 1YO8A 4HMZA 5IWFA 2E31A 2ADDA 2FCTA 2WNVC 2ZOEB 3GBFA 4UAPA 4ASKA 4M3CE 5FYHA 4EROA 1PO21 2K2SA 2WA4A 2RR12 1ZBA2 1LESA 3DXTA 3NNJA 1NOVA 3H0OA 5F9TA 4NPLA 4M4PA 3O5SA 1I5ZA 4LHNA 2DCJA 4BCUA 1FYUA 3LGRA 4B3NA 4TWTA 2D98A 4XFGA 1KDKA 5L7OC 1POQA 1PX4A 2EXHA 2WFF2 1W6NA 3AVRA 3WNOA 3WNMA 1H4GA 4QQLA 1PGL2 4OZOA 2R042 1GWKA 3MIDA 3PU8A 5FYMA 1RMU1 2K9ZA 2RS51 4XCAA 1F4HA 4GB32 3OGJA 4GWIA 4AI8A 4PQ9A 3B69A 1XNCA 4HFSA 2WFF1 1JYVA 2RR13 3IZOA 2GNMA 2R0HA 4YFWA 1H8TA 2VMHA 4BYYA 4DXSA 5KBFA 5FIXA 2PQQA 1H0BA 3AJZA 2W91A 1GICA 1XJAA 1C5IA 2UURA 1LTEA 3WG1A 3WG2A 3N7KA 1V9U2 5J96B 1GWLA 2WKKA 2XG3A 1RUC1 3RFRA 1UY2A 4ONUA 4RHV3 2IVJA 3PUAA 2Z2SB 2PHUA 4NRQA 2ARXA 3MYXA 1Z78A 2DFCA 4ZU4A 4AGGA 1O8PA 1JMUB 4W4ZA 3MV01 5DZGA 4Q5OA 1M06G 5A3UA 5FZIA 5HCAA 3T3YA 2JKXA 3WP6A 1D2SA 2GN3A 3D4KA 5A3OA 1RJ7A 2VUJA 3M3QA 2VUAA 1W8NA 5C8CC 4AE2A 3ZMNA 1NQDA 4RFT0 2HEYF 2FMDA 4A42A 1K5MB 4Q26A 4YZ1A 4QB6A 3B00A 1OSGA 1CIWA 1ULPA 3LZZA 2XWBB 3H3LA 4QHZA 3BU7A 3POGA 3ZYFA 5JXHA 3ZFGB 1POV1 5ABJB 4AI3A 3B9CA 3ZXDA 1O91A 2G9GA 1PGSA 3HT2A 2VO5A 2FDIA 3H9AA 1HB2A 5CZKA 5IVVA 2YBKA 4FP2A 4KGGA 3EMRA 4FFGA 1IQDC 1U0AA 4XFIA 1OMIA 3VV1A 3RZJA 1UF2C 1D4M3 4FPYA 4K21A 3AZVA 5FP3A 3UESA 4DRRA 1C28A 1AR83 1QIQA 2DDUA 1AXZA 1US2A 1GZ9A 5FZLA 1XE7A 3N36A 3FHQA 2D6KA 3O1TA 4RS5C 3ILNA 2RVAA 1AL21 5FQ0B 1GZCA 4LKSA 4DXZA 3GCXA 1R64A 2VZQA 2X5IA 4AQ6A 2FMYA 1C1LA 1AXYA 2WIIB 5FMOS 2PHXA 2E7QA 4R4XA 3EQEA 2HBTA 2R062 2EVXA 2YGMA 2ZGLA 3PVEA 2BWCA 2O8OA 5EP9A 2W0XA 2YC0A 5FZOB 3ZX7A 2WWSA 4XVHA 4CCOA 4XYXA 2JEMA 4IE5A 3FUOA 1S2EA 2QFEA 2O0OA 3OPTA 2JKBA 3PIJA 4ISQA 3I97A 2ENRA 2RS13 4RQPB 2EXIA 1N1SA 4UWDA 4Q0QA 3QH7A 3ACIA 3UETA 2GDFA 2IFRA 1GOHA 1OQ1A 4N43B 5FY0A 3K4ZA 1CD3G 2B7YA 2CWMA 3MW3A 5I0UA 4YW3A 3UGGA 1URXA 1NQJA 2AC1A 1UOGA 4HSLA 4CEWC 4AVCA 4KMQA 5DAPA 1ZREA 2Q8CA 5JUVA 1CAUB 1FOD1 5LBCA 3AKPA 4XJ9A 4QXCA 1HX6A 1VBA3 4ASMB 4BPZA 4XJUA 4D6SA 1VBD2 1KDMA 2C24A 3W21A 2DCTA 5BNPC 1DCSA 2HLEA 1V70A 2VZRA 2H0VA 1QNWA 4QX0A 1YQ8A 1UOBA 4V2WA 3VL9A 3AC0A 5F3CA 1KRIA 2YGLA 3O0WA 2XJRA 1LHVA 1PGL1 1K5MA 5GZFA 2EAKA 4AAXA 2PN5A 3D5OA 3J8F3 2RS52 2D5FA 1W8UA 2XBO1 2WJSA 4AHXA 1HRI1 3ALQA 4P9GA 1KJRA 5CISA 3PTYA 2ZKNA 1QJEA 2WZR3 1RJ8A 2GALA 2YY1A 3I2HA 1TE1B 1AR73 5FY5A 4MGYE 1ZRRA 2WYSA 3IBMA 3S0MA 2JD9A 2JDUA 1AR93 4PF1A 2YMZA 4A7ZA 5BNOC 1NKGA 1QDCA 5ANNA 2ZX3A 2VL4A 1US3A 1H4HA 3VBSB 2BZDA 5FPUA 4N53C 5C4WC 2VY0A 5C5UA 3NWKA 2J1AA 4QDQA 1BBT2 4J6GA 4XF9A 4DRVA 2CAVA 1W6PB 4FTEA 4QWNA 1XOYA 3A4UA 4AW7A 1SFPA 3SXWA 1UY1A 3H42B 3R6SA 1G9FA 3POSA 1J3QA 3I59B 4AEDB 4IERA 2WRAA 1VBE1 4XTPA 4B7EA 1REDA 2AREA 2YZ4A 1W0PA 3HNMA 3VL8A 5F6LB 2WBKA 2PTMA 4NIIA 1AUYA 4KH9A 1CAVB 2VULA 4MXVA 1NE6A 3EYPA 1HQLA 3HWJA 5IVEA 2P6CA 4EWEA 4FPEA 4Q4V1 3U1XA 1RIRA 3E5UA 1C8NA 5T5PA 3WXPA 4EWAA 2RS53 4D6QA 4C91A 3H8OA 2OZJA 4W50A 4D7TA 3BIWE 2EICA 5GZEA 3NV1A 4AL9A 2Y0IA 2YBSA 4YVSC 3IDBB 1NT0A 4TLGA 5K0UB 1H1IA 3I3DA 1FMD3 4AFAA 4D0QA 1Z7S3 3H3UA 5FZAA 1D0GA 1PK6A 1W2OA 1MS4A 1X7NA 3C7FA 1R092 4AVVA 1LEMA 2HWF2 2A6WA 2XHKA 1WCQA 3LAGA 4JQTA 5FYIA 1HJGA 4BMEA 1JOPA 2YB7A 5FYVA 1IS4A 2VMEA 1OD3A 2OVUA 3KCYA 3WG3A 4I2OA 1OLRA 3WG4A 2JDAA 3ZFEC 2Z4FA 3ZXFA 1F15A 4FQ4A 2NM1A 5AFEA 1QGLA 2IUWA 2CGNA 2QQJA 2R7EB 3ZXGA 5LASA 2FDFA 1ENQA 1N1VA 2IVIB 1YJLA 3E6BA 3LA7A 3KM5A 3LSEA 4Q4W3 5GLVA 4XDPA 1A6CA 3CEWA 3OGVA 4IGOA 3VD5A 1BQPA 1MEC1 1YFWA 1XB9A 4BQWA 1SFNA 3MPBA 4XJZA 4CYDA 1Q43A 5A7WA 1Z0HA 4XXAA 5CFCA 5LB6A 3BODA 1V9U3 4B4RA 4P9IA 4PBOA 2WAAA 4BQ2A 1BMV1 4RR3A 2C9AA 5FYSA 5FYYA 5G04L 4QXKA 5FO9B 4PF5A 1R091 4QM9A 4FPGA 2X09A 1O6UA 4YM0A 5I0RA 1ZM1A 2GC3A 1ASJ2 3AP4A 3DPRC 4K40A 2VNRA 3WF2A 4YPJA 1KXGA 1VP6A 5EYXA 4C8DA 4CUGA 1DZQA 4CXXA 2ZX1A 4EZHA 3USUB 3V65A 2XBO2 1VBC3 3KGLA 2P4EA 2PAKA 2OA2A 4KL1A 5FMBA 5DUXA 5JZGB 1WCDJ 3VBSA 3VKLA 2ZGSA 1ZZ9A 2XB6C 1XC6A 2VCMA 4ATEA 1UXXX 1POV0 1UYZA 1STMA 3ABZA 4HL0A 1W9WA 4TYSA 3VZLA 2R0FA 2YFZA 4FPJA 1C5HA 2IXCA 4MHRA 4XEZA 3ZSKA 4H55A 3BVCA 3LB9A 4K8FA 4DQAA 3WDTA 4ZXKA 2B45X 4LK6A 5A32A 1W28A 4RS5B 3WW4A 3WP5A 1UPSA 1WGPA 4RN5A 1EP0A 2A71A 3VBHC 1UX6A 1BBT1 1QOTA 1WMEA 3DV8A 1CGPA 1QNYA 2ZHLA 1IQAA 4LO8A 3DL3A 5F5AA 3ZSJA 2ZGMA 4Y4YA 1PO22 3WZ1A 5FCCA 4QX5A 4DNYA 1W8OA 2GH8A 3PURA 4Y5Z0 1H2KA 4AFDA 4ZKTB 3H8UA 1WBLA 4IETA 2W2IA 2Q4SA 1WLWA 1GLHA 3K77A 2WO7A 1RUD3 5EQUA 1VMFA 1LHUA 2ID4A 4JKKA 1V0AA 5A7QA 4P14A 3I2DA 1OVPA 2XBO3 3N9LA 2JDHA 4LIVA 2IFWA 2VMCA 1RUJ1 1VB2A 4MH0E 3CJIA 1UU4A 3DEMA 3CZUA 4Q29A 1LECA 1WD3A 1WLTA 4QXHA 3VZMA 3ZYPA 4A2UA 4C0BA 3JQWA 4DEQA 5J7MA 2EIGA 2JXAA 3ZSMA 2ZX0A 4XFCA 3GZUC 5J98B 1NX9A 4JDMA 5FPXA 2DUQA 2IXIA 1RUF2 3HOBA 3DCQA 3WNNA 1G7YA 2WN3A 4AVBA 2QQPA 2G9FA 1GWMA 4TXWA 1EAH1 2LS6A 4H7LA 4PIYA 4ZPIA 4XBNA 5T3NA 4LE4A 5FK7A 4Z82A 3PJQA 5IT6A 4ZZ5A 1PVC2 2FCVA 4RGKA 3CLPA 4PJYA 1GNYA 1QWRA 2IZWA 2JG9C 5BNQA 3CMGA 1OFNA 1U5IA 4LBQA 4CU8A 3HT1A 1CX1A 4CDXC 3I54A 2EIBA 3BPSA 3RVHA 1YLLA 2ZHKA 2QQKA 3RZLA 1TG7A 3HBKA 2QDNA 2UY8A 5AVPA 2VE1A 1RUH3 4Y20B 1AF9A 2YU1A 4O9GA 3W5MA 4NHXA 3DXUA 5IVJA 1ND3A 5F3EA 2J1EA 4RQPA 3ETPA 3EJKA 1V6KA 1NZCA 1VIWB 2MEV1 3ZN4A 3QLQA 2VQAA 4LHSA 5HCBA 2WWJA 2R6QA 4HONA 3V0BB 2Y64A 1MS1A 3LIHA 1ND2B 3QH6A 3HD8B 4O65A 1TNRA 5FJKA 4AEDC 4E2GA 3QCWA 1ODMA 3NAPC 1X82A 1W8ZA 4HKOA 1GR3A 3GHMA 1Z7S1 5A70A 2N7GA 1N1TA 2VZTA 3J26N 4Q4Y2 1CN1A 5DUWA 5IAVA 4EN0A 1WMXA 3H1YA 5FZGA 5KR7A 1W2AX 3BKZA 1CX4A 4K6BA 2Y33A 3MI8A 3JQXA 4F3JA 2VOTA 1JHJA 3SH3A 1KITA 5L7OB 5FK8A 5I93A 4BISA 3T30A 5E16A 1H1MA 3AJYA 3I3EA 5D2AA 2ILMA 5FP7A 3ZKUA 4N9IA 1EPWA 2BRTA 1PGW1 5A7PA 1OF4A 2HJIA 3UKTA 5J36A 3H8XA 3IKWA 3J7LA 4UBHA 2BTVC 1W6MB 4BIOA 3S5AA 4WVZA 1QJX3 3VHOA 4MO3M 4P5YA 1HJFA 2IXHA 3ZFFB 3O0VA 2J1VA 1JH5A 2W46A 4EZ4A 2VMFA 4QPGA 4AF9A 5FYTA 2W5FA 2WNUB 3VZJA 4AAPA 3I2FA 5A3LA 5C5TA 3POIA 2SBAA 5GKAC 4INDA 1R093 2ARCA 1W90A 4KU7A 1UYXA 4K7JA 5CADA 1VBD1 4N9HA 1L3JA 2JE9A 3I2JA 3S57A 3USUA 2BEOA 1RVF2 3HJRA 5C8CB 4MV2A 1JZ3A 4N43A 4HT1T 5F5QA 1F4AA 4P00B 5IUQA 4D94A 2VZSA 5HV4A 3VD4A 1NCQA 2Q1ZB 3ZFGA 5FQ0A 4XXPA 4ZU7A 1CR7A 5JPMB 3KCCA 5JXJA 5A6ZA 1DGWX 3CJIC 1D4M2 1OI6A 5FXXA 2DCYA 4EN9B 3ELNA 4JGZC 2ZAHA 4NIDA 3OEBA 4FBFA 1LULA 2JE8A 5T5LA 3VBRA 2E53A 2VPVA 3NNGA 3WDXA 1OURA 2E6VA 3FUQA 5L36A 5FP9A 2YG0A 3KVAA 3RZGA 1O7FA 1L7RA 2GH2A 2XLAA 2RMU2 1RL3A 1QY4A 4LITA 4BIFA 1HXS2 3SKVA 3AL6A 1WCUA 1PVC1 2ZGTA 4OUMA 4WVMA 1H2MA 2VCBA 4LR4A 3B7MA 3CDZB 2DWRA 3AXEA 4Z2WA 4YNIA 3LOIA 1WLDA 2QVSB 3JCIA 4CSWA 4KG8A 1J1TA 4HANA 3D0SA 3RPQA 4D7YA 5CAZA 1N3PA 1EPZA 1J3RA 1RUF1 5A1LA 3TNQA 3ZXLA 3O1RA 1J84A 1HN0A 3L9JT 3PTRB 3RGBA 1BCXA 4QGLA 2ET1A 4R9CA 4YZ4A 3EO6A 3E5QA 1JYCA 2BNOA 2UYBA 3BOPA 4PT6A 3W58A 3I7DA 4BDVB 1NLRA 4NUBA 3LEGA 2DV9A 1QOSA 2WYFA 4YW4A 1RUJ3 2DTWA 3KMHA 5LWBA 1YYNA 3POBA 4YGDA 3ZO0B 4B4PA 4AK3A 3N9NA 4IEOA 3VBRC 2ZGPA 4QKDA 2AUYA 2NYYA 3KV9A 5F2WA 1Q8OA 1ND3C 1VJ2A 2J42A 3AZXA 1TZOA 1UO9A 1UPIA 1DFQA 3KT4A 4IEUA 4WM7B 4XFAA 1W6OB 3VBOA 4MGSA 1NCQC 5JLVA 1MS0A 5D8AC 4AHZA 3ACGA 4QPIA 5FZ9A 3K46A 1QJU3 1V6NA 4RGAA 2XOMA 4P08A 2P37A 4TTGA 1CPMA 1LOGA 3BN6A 2RJKA 3OYWB 1ULDA 3MUZ1 3SCFA 3PHMA 4P9WA 4QKNA 4GD4A 4QX7A 3NRUA 2VZ3A 3VDAA 1UMIA 4ZXEA 1VRH2 2KR2A 1EAH2 4N7UA 3ZSLA 1J58A 1RC6A 3HIFA 3OD4A 3VBUC 3JZVA 3WINE 2BOIA 4XILA 4COUA 2ZHNA 2B42B 3LEKA 5ANQA 4BQYA 3TN92 1X9TA 5JI9A 3A23A 1AX2A 4I09A 1T6BX 4NAOA 3KCXA 4CDQB 2VZPA 5L73A 3TWIA 2DYCA 3AMHA 4QT6A 1GZWB 2W1WA 3RDIA 4CCEA 1YJKA 4XHBA 1RUI1 3IPVA 1OA3A 1PO11 3TEWA 1ZVFA 1OLME 4DINB 3R0RA 4YZ5A 5J09A 3U10A 4XZPA 5FKCA 2WZPP 3NMBA 4GMP0 3THTA 3WNKA 4JKLA 3WNXA 4ES9A 4OLLA 4JRAA 1Q8VA 1XNDA 3VBFA 1TNFA 4FOYA 1LB2A 2YPJA 4YGCA 5EIYB 3RYKA 4M00A 3AKTA 4RL7A 1GFF2 5GZGA 1O5LA 1IS5A 5FKBA 2WQZC 2NLRA 1JYTA 3O14A 1SPPB 4FCAA 4CDWC 1QXRA 2WC2A 3IT8A 3VHRA 1NG0A 2DCKA 2W1QA 2W47A 3ZSEA 1ZRDA 1RVF1 2QCSB 2Q8EA 2B4KA 3FC0A 2AZ5A 4Q0UA 4QU1A 3QOPA 3NNMA 4YVWB 1RUI2 1DZRA 3NV4A 1H8TB 3Q8CA 5JOXA 1DP0A 5EV7A 1W6OA 2UWAA 4BU2A 3P3PA 3UKNA 3WDWA 2JE7A 2R071 3BTXA 5C9AB 4CDXA 3PL0A 1FPN3 1WLCA 3TNPB 1UKRA 3AFKA 3OF1A 5IHRA 2DURA 3BTYA 3OYWA 3KQ4B 5IK4A 1FATA 3INAA 5F1RA 1E5RA 4JGYC 4LUKA 1GP5A 2E7AA 3LOBA 3CU7A 2D5HA 5LEKA 1R082 2RS32 3WX5A 3ZIWA 4CU9A 5SV8A 2PHRA 2RV9A 2ZGKA 4IEYA 4XUTA 4XOGA 3Q8AA 2JG8B 4HLTA 4IV1C 3RMXA 3ZDSA 4AWDA 1HQWA 5HPOA 3JD73 2WSVA 1GZWA 3OBTA 3OEAA 4JQRA 5EJZB 5ACA2 3MF6A 3KVBA 1GKBA 1DQ1A 4RR3C 3SISA 1VBE2 3N7MA 1LRHA 4LO5B 4PIZA 2ES3A 5CFCC 1S0CA 1WKYA 5CB7A 1UY4A 2C6SA 1GNZA 2ZEWA 5FY7A 4JGYA 4E2SA 4I0AA 4NWWA 1WD4A 4YM3A 4IGQA 3ACLA 4KQ7A 5BNPA 3VD7A 2OX0A 2XMLA 1AYN1 3K4DA 4XHXA 1AR61 2LUWA 3CJIB 5FTTC 4AVSA 2R1BA 2WT0A 5EPAA 1R1A1 4Y1UA 1NCRB 4CDWA 1OA4A 4M0HA 4WM8A 1C57A 1VBC2 2DVGA 2EXJA 3NL1A 4S2DA 2B9VA 2RS11 3FZ3A 2AENA 4YG0A 4CCNA 4FXKB 4D7SA 3E6CC 1NY71 3H7JA 3PIGA 1NXMA 4YM2A 5FZ0A 5B4XA 3N3HA 1YNAA 4HK9A 5FV3A 3ACFA 3FE5A 3GDBA 2VCCA 3MLJA 3S7EA 1RUG3 4AFBA 1LJ7A 2J7MA 1OKQA 1UW8A 1IKPA 1KEXA 1KFUL 2P2KA 1W6QB 2BNMA 4XFBA 4YW1A 4LBOA 4PDWA 1N3OA 5FY1A 1E5HA 1SLLA 2VMGA 4FI9A 1W9FA 1PHMA 1DQ6A 2VH9A 1PIV2 3GJAA 4QMAA 5D8AA 5E6HA 3RI8A 1JZ8A 1RUC2 1W9TA 1CONA 2ZGOA 3LPGA 4BB3A 5GM0A 4DMIA 3TEYA 1NAEA 3VKNA 1RUOA 3BCWA 2EIEA 2Y6KA 4NO4A 2CYFA 4YVSA 4Z1VA 2XJPA 1QU0A 5GZCA 4COVA 2B39A 3JB8A 3WNLA 2QQUA 3AKSA 1H9WA 5FZMA 3RRDA 3KHBA 1NZIA 1I9RA 4E4DX 4Q1PA 5DG1A 4BWOA 1DBNA 1LNSA 1KS4A 4NRPA 5A1FA 5C3SA 3J8F2 3EB7A 3B9IA 1VRBA 1CZTA 1HRI3 1O4ZA 1C4RA 2NQYA 1O3QA 4EWDA 1YQ6A 4NR1A 4NOTA 2FDKA 4LO7A 4Z92B 3J7HA 2XVLA 1QKQA 3V56A 3U75A 4RGGA 1QJU1 3KV4A 3R4SA 1UMHA 1VBB3 4BQ5A 4E27A 2DBIA 1VB4A 1ND2A 4COZA 5EXOA 4J25A 4S2FA 3K3OA 2WN2A 4DB5A 3OTFA 2Y26A 3L2HA 4HN1A 4CP9B 5FO8B 5DZEA 2DF7A 1JOBA 5JI7A 5HI0A 4TN7A 1A8MA 3G7DA 4NWVA 3AYDA 2ORXA 3DN7A 1S0BA 4GALA 4OVEA 1RGSA 1TME1 5KC6A 3VDCA 2QJVA 3FLPA 3NO8A 1W39A 1CESA 5EJ1B 1A8DA 1GV9A 3D8CA 2WAOA 2X53S 3MIFA 5A7OA 3ASIA 4WV8A 2Z69A 3RYPA 4MXWA 3EXUA 4GH4B 1IPJA 1WA4A 1NCRA 1ULFA 3M4FA 4YW2A 3FJSA 2G4IA 3EHKA 2RDSA 3V0BA 2GNTA 3RYRA 4ZS2A 1SDDB 4CVUA 1QJU2 3NV3A 4KNCA 1E5IA 4N53B 1ULEA 5LBBA 4E9KA 5C3OA 4CDUB 1YIFA 4XIKA 3TN91 1UZZA 2QZ3A 3SEPA 1RXGA 4MLOA 5JAXA 1RHI1 1KFXL 4XQDA 1A78A 3JXSA 4WZCA 5LRRA 4CXWA 3UGFA 2ZCWA 1GP6A 3ES1A 4PDWB 2QKDA 3R4DB 2NZ9A 4Y24A 2CDOA 1WA6X 5FY4A 5FZEA 3WF3A 1OQEA 4LLOA 2Q1MA 2WFF3 5L9RA 5C3PA 1U12A 1MZ6A 2I45A 1SZBA 2ZMKA 1DDLA 1NA1A 2GAUA 4Q8LA 1B35B 1UKGA 4NRMA 4PIXA 1LCLA 1S0DA 5LBEA 3WV6A 3WQ7A 1SACA 5FFOC 2AGSA 3C7EA 1AYN2 2ZX4A 1FV3A 5FDBA 1ZRFA 2WZR2 3GZAA 4LKFA 4IUGA 1QJY2 1Y9QA 1IPSA 3U14A 3VHNA 3IB3A 3K4AA 1DF0A 1AR72 2Y6HA 1SCRA 5FWEA 4MUVA 5CFDA 3RZHA 1EUTA 1SBEA 2TBVA 4WM7A 4Q4W2 5B4NA 1W8WA 4IEZA 5A33A 5ACA1 4Z8BA 1F2NA 2B9UA 3IDAA 5A6QA 2ZEYA 3VKFC 1RXFA 4V2VA 3VBOC 1J3PA 3RZZA 2WO2A 3OY8B 4B4QA 2R072 3S30A 4NHKA 4IV3B 1S0FA 3AXDA 5FPVA 3RG0A 3TEXA 2F4PA 5FYBA 4OI2A 2ADEA 2RM23 2WSUA 2XGXA 5GLUA 3ZYHA 1DYOA 4XQWA 2Y34A 4Q27A 4AYUA 1GQGA 2WT2A 3HQUA 3MPPG 3A7QA 1DLLA 4LO4B 1MS9A 3PJYA 3OCPA 3I59A 4QPGC 4A44A 4AEDA 5T5OA 5JOYA 1JW6A 2QE3A 1SMVA 4LBQD 4QX1A 3WW1A 5BNNB 3O1SA 1FI2A 3ST7A 2BQPA 2BW8A 2GC0A 2RS31 4JCKA 2NMNA 3BTAA 4JGYB 5EYYA 4DOUA 3RZKA 1X33A 4RFRB 2ZGRA 4Q4X2 1DLCA 2XLGA 4CDUA 4L0PA 3I3BA 4OHVA 1SBDA 4K3UA 3ZPOA 1S4CA 2VXJA 2PHTA 3WY6A 1DIWA 1K5MC 2HWE1 3KS7A 1BYHA 4L2NA 5FZDA 4NVPA 4M0NA 2WNVB 1D4VB 1JZ2A 2ZTNA 4OUEA 5JZGA 5F5CA 2CNAA 1JHNA 5FAXA 1TMF2 5DAXA 4JHZA 4NIHA 1MQTC 1AYM3 2UY9A 4Q4X3 5DDJ2 2VGDA 1OOPC 3ZMOA 2DU1A 2WNUA 5A7SA 3I8TA 3JB4C 2QUOA 5A7WB 4JHTA 4W65A 3VBFC 3H50A 4HPKA 1HDKA 1GSLA 3KB5A 2G9ZA 3LPFA 2RS12 4XDOA 3NNLA 4JGZA 4YVSB 4PLNA 1O3TA 3V64A 1CZVA 2RMU3 4MX3A 3LDRA 1W3VA 4H14A 2RM22 5E1RA 3RJRA 3O1MA 2JIGA 5E8AA 2HWB3 5LATA 3AMPA 1RITA 4MGKE 3KWVA 1OUXA 4OHXA 2VCAA 3RQ0A 4Q8KA 2FDGA 5FP8A 3ZR6A 4QKFA 1XNAA 4LBQB 1BJQA 2VVDA 4FPCA 3B5LB 1ST8A 2PMWB 3OOXA 4IV3A 5EFUA 5DDJ1 1D0HA 2WQ4A 4GIQA 1MPXA 1Y9MA 4LHKA 2DVFA 2HYXA 1OH3A 2YU2A 1OA2A 3ZOIA 3AB0A 5BPXA 1ZBE1 2EALA 2PA7A 3AZYA 1I5PA 2VAUA 1PNFA 2V09A 1MQTA 2YFUA 5FZ1A 3SEEA 4EV0A 1AL22 2VBDA 3U4XA 2XXZA 3ZN6B 2ZS6B 3HN3A 1RUC3 4CCCA 3NKTA 1R1ZA 3VDDA 4XBQA 4FAGA 2OPWA 2WZEA 4JKMA 4BMBA 1ENSA 1KQRA 3ECQA 1BEV3 4XURA 4GWJA 5EWSA 3ZIXA 4CPBD 5C3QA 5JIUA 4XMIA 2X5IB 5B2GB 2QQNA 3CBNA 2YROA 2W1UA 3CIHA 2CHHA 1RTVA 3HVDA 5C8CA 4Y1ZA 3JBG3 2E63A 1ODNA 5BNOA 3FFZA 1TME2 5DABA 4NPRA 5L19A 1XNTA 3M8LA 4OMCA 1R081 4JAAA 2Z79A 4XDQA 1XE0A 4URAA 5K8SA 5C9AA 4R4ZA 1W9YA 1W03A 2HWD3 1ZNPA 1D4M1 2KD7A 2WS93 3N35A 1REEA 2ZXQA 4Y20A 1CJDA 1WZXA 5I0SA 4IEWA 2A6VA 5AC93 3MW4A 3OGRA 1XQNA 3MIEA 3Q9OA 4L99A 4NN0A 5JVVA 1YC61 1AHSA 2PHFA 1HRV1 2D6MA 2WR9A 1MZFA 1IS3A 2FQPA 3T0BA 2YXSA 2CDPA 4Y22A 3K3NA 2PAMA 5FBJA 2QZ2A 2JJ6A 2V4VA 1S55A 5G05L 4LORA 5JZGC 3POYA 3ZKYA 1G9AA 1YI7A 2HWF3 1WWYA 3PNAA 4Y1YA 2R30A 4EE2A 3NVCA 2RE9A 4UW3A 5F32A 4LBLA 3VKOA 4GB33 2D6PA 5DG2A 1DYPA 1YWKA 2F4LA 2KXLA 1QHDA 1HV1A 3IAQA 4OUSA 4QXBA 5K0UC 3FL7A 1CAWB 5DUUA 4QU2A 2JECA 3WNPA 2VECA 3SKJE 3GALA 3OGGA 3SMHA 1IPKA 4BXFA 1LODA 3HAGA 2VG9A 4DXTA 3IAPA 3IPVB 3VDDB 2XQXA 4FOWA 4AQTA 4MGIE 2RM21 4FT8A 2EAAA 5IK8A 5LY1A 5I91A 4D8MA 3ZFEB 2C1FA 1LGCA 2FHRA 3T2PA 4AZZA 4FOVA 2C4XA 4XABA 4WVMB 3GZTB 3ZFFC 3ZXJA 4E4SA 3KHCA 1EV13 3HEIA 4OFGA 3SQOA 3HNYM 1IOAA 1RUH2 2ET7A 3ETQA 3OBZA 2LROA 2WNUC 2D3PA 1DHKB 2XVGA 2VZOA 1LOFA 1POV3 4LULA 4F7ZA 3JUUA 5CVRA 1JU3A 3ZYRA 1ZZ7A 5A3MA 4KBBA 4QHBA 1Q3EA 4NIGA 4Q4Y1 4DY5A 4FOQA 3GHNA 5DMYA 4XACA 3D3AA 3U0ZA 1TQ5A 3CNAA 3FWEA 3NJYA 2FZ2A 3M2MA 4GA9A 4XTMA 2K46A 2VUDA 2ZEZA 3KT7A 1DG6A 4UFJA 4AG4A 2WINB 3VBHA 1CZSA 5IATA 2P6HA 2QTWB 3GXUA 1SLCA 3VD3A 4CP2A 4HVRA 3ITQA 4HOOA 2CGOA 4DUXA 3AYEA 4QQOA 4XUOA 3T0AA 3DYPA 3RWKX 4E8CA 1BVP1 2BFUL 5A6XA 4FTSA 5APAA 1TEIA 3ZYIB 4H7MA 3FLRA 3KV6A 3NKGA 1JZ7A 4LA3A 3ZXAC 5CA6A 3OSDA 4AEJA 1ZBE2 1UIKA 2WQ8A 1EUUA 1YHFA 1IHMA 1MZ5A 3LDKA 4W6XA 1J83A 4GZ9A 4HXCA 5A7NA 4F8AA 2R063 4Q1RA 3URFA 3ZLIA 5FYCA 1ONAA 2VVFA 4DXRA 3MIHA 1N3QA 3VHPA 1GUIA 5JDBA 4QB2A 4KG0A 1JZ4A 1O5UA 2AACA 5IAXA 3VBFB 1PK6C 2ZAAA 3ES4A 1W2TA 3IWZA 3RNSA 1IG3A 2WA3A 3LQCA 4Q4V3 4C1WA 2AH2A 4YM1A 1S1AA 1S0IA 5FMDA 2LW8A 3PDQA 3MHZA 4BXSV 4NE9A 2XH6A 5FR3A 1W8HA 1KD7A 2VOKA 4LE3A 5GALA 1P8JA 1ULOA 3A0KA 2VOWA 1XU1A 1XYPA 4XCBA 5LBFA 3AX4A 1VBB1 2XJUA 2RR11 4CEYC 2JDZA 4ZU5A 3RI9A 1JZ5A 1OOPA 4A45A 1VPHA 1OXCA 4FQZA 4IESA 4A4AA 3ZYJB 2OS2A 3AMMA 2SLIA 4L92A 4LO6B 4QGNA 4A41A 5JSOA 5FXZA 3WDYA 5KXBA 5KHGA 4GXLA 1L7LA 2VQTA 4SLIA 3MLKA 5F6KA 1AR71 1PVXA 1QDOA 2W94A 2DUOA 4Z07A 1FT9A 3P3NA 4EN8B 1UZYA 4YRDA 5HXVA 1V6OA 1W6QA 4XQ4A 5JMOA 2JB8A 4R9AA 2VZ1A 2W9XA 4M3CF 3JBG2 4IEPA 1OPOA 3I3MA 1C8M1 2VM9A 5HXMA 2DFBA 3GGLA 4G3YC 5FLIA 2BYVE 4EN7B 4C1XA 5KHJA 3CL1A 1QQP2 1WCKA 3NW4A 3B94A 1Y9GA 3IDEA 1G8WA 1VR3A 2TNFA 2GP5A 3AMNA 4UW4A 4LK7A 1UD1A 1VBD3 1UY0A 4I30A 3TEZA 2BNNA 2VNVA 4AHWA 4A7YA 4CCKA 1COV1 5CKQA 3S5QA 4AI9A 2A6XA 3ZPYA 1UL9A 2V5DA 3S6PA 1JN2P 2OXBA 2J1SA 4CDXB 5DAQA 4YG3A 4PHZA 3SITA 3P1IA 5AC91 1QQP3 4MVTA 4UBGA 1IGOA 1CQ9A 1D7PM 3DPRA 5F39A 1SLIA 3QD6A 3ZM8A 1UCXA 4LT5A 5LRSA 1T6GC 2XJQA 5JOWA 4N43C 5IVCA 2HEVF 1DGRN 4QQ2A 4LXLA 3ZN5A 1UNBA 4RA0A 1LGBA 4UW5A 4E2QA 2JIJA 5LA9A 4CEWB 4CUCA 5FBZA 2JENA 1OLQA 4XETA 4DPNA 4META 2LM3A 3T2OA 4FPLA 2PYTA 5DQ0A 3AKQA 3LE0A 3POJA 2VU9A 3KLSA 3O12A 2ZKLA 3HQXA 4DZGA 5CKMA 4JTOA 1BBT3 1UZWA 2E7TA 1NA1C 2WNEA 3C3VA 1FMD2 1X50A 3FBYA 4O9EA 1S0GA 1ZZ8A 4B1MA 2P3JA 4YWAA 2YHJA 3ZVXA 4BA6A 1JOJA 4ZY9A 4QAWA 1QJX2 4UFKA 1REFA 2Z5WA 4NHMA 2HBUA 2UU8A 3PMEA 3AVSA 4K1YA 1RUE3 3WF0A 1F8VA 3OPZA 3E97A 3OD0A 1FOD3 5T52A 5FYZA 2WLQA 1GBGA 1DQ4A 1QJZA 3MLLA 4M01A 2QNKA 4J1WA 5C33A 1Y43B 1EV11 2ZJCA 3IMMA 1V00A 2F17A 2AR6A 2WZ8A 4JDOA 4BK4A 1VE0A 4LTAA 2A73B 4P9LA 4PI2A 3C7HA 3VBOB 2XDVA 1JBCA 4NHYA 1PM4A 4DUVA 1O4TA 2MPFA 5FOBB 1VRH1 5CBLA 3FHAA 2NPIA 3VBSC 3NAPA 2YC4A 1UZVA 3SH5A 4QX3A 1HLCA 2IC1A 4IE4A 3E5XA 3E1F1 4IL7A 3THDA 4XAEA 3WDVA 4CEYA 3B02A 2GC2A 3QBQA 2DU0A 1M4WA 3TAYA 5T5JA 4HETA 1FV2A 2CV6A 1O3SA 3H3ZA 2J22A 3MDPA 1AYN3 4A7KA 3OPWA 4I0WB 4XJAA 4K9SA 4IV1B 3THPA 4ARXA 4DY3A 1YUDA 1EV12 4G4FA 2EF6A 3UJQA 4CCDA 5IK5A 5H9SA 4GKYA 4COYA 2J1UA 4JGZB 5IVBA 4RSUA 5H9PA 4L9BA 4CDQA 1W9SA 5F3GA 1F35A 3I4IA 3UNPA 3GZEA 5EZWA 2VW0A 4FPHA 4X6RB 1U5XA 1C3HA 4EQVA 2C0ZA 2BFUS 3BOWA 1G6NA 2RJLA 2XR4A 1AR62 4OI1A 2RMU1 2P3KA 1OLMA 2E32A 1GMMA 4IE0A 1Y4WA 4B1LA 1HXS1 3H1MA 3AP5A 2XJVA 5T50A 3ORJA 5LK5A 4AFMA 3T1LA 5LY2A 4LBJA 3MW2A 5FO7B 4YGEA 4R9DA 1H1AA 1YIPA 4S2GA 2J1RA 4TLFA 1YXWA 2YYOA 3LIGA 3KF3A 4OMDA 2VZUA 1VBA1 1VAKA 2VTFA 2ZMLA 3B93A 1QJFA 5FPLA 4LLFA 3W59A 4FXGB 2NP0A 1SFYA 4I3PA 1IG0A 2R043 2JDMA 5FPBA 1RUG2 4N53A 2Y6FA 3CQOA 1ASJ3 4PQQA 4AFCA 2GSYA 4UYBA 4OQ9A 3V0AB 2BVVA 2GZWA 4WVWA 3W9AA 5EJ3A 5ISLA 4WM8B 1GQHA 2OYZA 3POFA 2J1TA 1H2NA 4XUQA 5FUNA 5I8TA 3AZZA 4LJHA 4RHV1 4XW3A 1DGRA 2JWPA 4P9JA 1LHOA 2PHLA 1FAYA 4CEYB 4M3CA 4UFHA 2FD8A 5KHHA 2VC9A 2XJSA 1XXNA 4A6OA 1PZ9A 2G19A 4LA2A 4QGMA 3UK9A 2BV4A 1S2KA 3VN4A 2EA7A 4A3ZA 5J48A 4BOWA 5D8AB 3VZKA 4Z2AA 3HBZA 4OZXA 5BUVA 1ZA4A 1IZ3A 3ZFGC 5JSRA 1BK0A
chains in the Genus database with same CATH topology
1R083 1SDWA 4QQPA 3TRSB 2MEV2 3WD5A 5KC5A 3BPZA 4R9BA 5BNNA 5T54A 2JG8A 2LALA 3WR0A 3TB0A 3ZYGA 3QACA 1QOOA 4FP3A 1PZ7A 2A70A 3VBUA 4E4ZA 4HVQA 1MEC2 4GH4A 1JYIA 3D82A 3HN1A 2ZBJA 1F5FA 1SCSA 2W68A 4CDQC 1AJKA 2MEV3 2WNVA 4K20A 4U36A 2JG9B 1PO12 4YYOA 5AC92 1QXPA 1RHI2 4URTA 2XKOA 3M70A 1ZBA3 1DQ5A 1V6MA 2V73A 2WL1A 1GNHA 4FSJA 3UKVA 1QJY3 4FPKA 1BXHA 4OI0A 2D93A 2Q5TA 2OZ6A 4Y22B 1ZX5A 4YW5A 4GMP3 1HKDA 2V5YA 1O3RA 3TOJA 1VAVA 4MXWB 1B35C 4XF4A 3WCRA 4JDNA 5T55A 2BWAA 1PMIA 5IK7A 5I0TA 3IDCB 1VAMA 3N7LA 1Q5OA 2PLV2 4PLOA 3IIAA 3PVBB 1CAVA 1NCQB 3FFQA 5K7PA 1Q8PA 3HR9A 4AHYA 2BBVA 1LU1A 3IM0A 5C6CA 3CF6E 1V9U1 4CP0A 1VBB2 4DS0A 3JD71 1GANA 1LR5A 4Q4Y3 3C2UA 2I74A 1FNZA 3PVNA 5I8SA 2X8KA 5K9YA 4B7KA 3JD72 1PM7A 2WLPA 1CAXA 3FHIB 1SLTA 1AR81 1DGWA 1Q8SA 1ENXA 2O8QA 4RHV2 5BNNC 5KHIA 2JD4A 3FMGA 2DUPA 2WZR1 3S7IA 4QPIC 4Q4X1 5FOJB 2Z42A 5KHKA 3AZWA 2ZMNA 1AR63 2VOXA 1RUG1 4FVVA 4ORFA 1OD5A 2WT1A 5AVAA 2ZZQA 2MHFA 3AYAA 3PMSA 4RR3B 3ZXEA 2HWB1 5LK7B 1ULCA 1RUI3 2BGCA 4CP1A 4FTBA 1CJPA 1LEDA 2NN8A 1N1YA 2H0BA 3AK0A 4BQ1A 1X8EA 1VBE3 1RMU2 4MSVA 4I01A 4HKWA 1VALA 2YV8A 5GJ6A 1ASJ1 4Q0SA 4AXOA 4XF1A 5E88A 3HMYA 4XMAA 5DZFA 1DGLA 2D6NA 4K1ZA 2P3IA 5DXDA 4LBKA 4Q4V2 3BALA 3MIGA 1DU3D 2D43A 3M7AA 1SQ4A 1RINA 2HWB2 3LA3A 4P9XA 4X6QB 2X29A 4XF0A 1FMD1 1R1A2 3SH4A 2OW4A 2D6LX 1UU5A 3MFAA 4BE3A 4ASLA 2R073 1HW5A 4L97A 4XPVA 3WP4A 5CG8A 1O4YA 2P17A 3OBRA 1AR91 3WLUA 1XE8A 1ZYBA 1HV0A 3NSTA 4L11A 1H8VA 2YDEA 4IV1A 3WDUA 5ABJC 4QQHA 4KGQA 4AVTA 4YARA 2ZZJA 4WVVA 3R05A 4WM7C 1BKZA 2DTYA 5H9RA 3T2TA 3LKJA 2R1DA 2XVKA 2ZHMA 4I0BA 4OHYA 2X5IC 1ZZBA 3GNEA 1U5ZA 4BZ4A 1X36A 2VXRA 3WP3A 2JG9A 5BNOB 2D3SA 4OHZA 1U5YA 2MNGA 1OOPB 1PO13 3KT1A 3ROUA 1RHI3 4F83A 1SLAA 4HBNA 3ATGA 1Q8QA 2A7AA 1ZBA1 3DGTA 2D6OX 3FBMA 5JSPA 1JTZX 4XFHA 2D44A 2OUHA 1V6LA 2ZACA 5DUVA 1QJY1 1Y3TA 3M1HA 3ILRA 1RUD2 3KD4A 3L2YA 4MZUA 1H2LA 3IN9A 2O1QA 1MVQA 3TYJA 1AYM1 4CDUC 4I02A 4ITCA 2B46X 5JCTA 3AFGA 1AL23 1CPNA 3AYCA 3POWA 4NHLA 3K51A 2Q0AA 1W6PA 4HKLA 4XF3A 4HN0A 4IQPA 4OHWA 4JC1A 2LTNA 3SNMA 3MGUA 1IS6A 3RSJA 2Q8OA 5LEJA 1XNKA 3WT3A 3RS6A 1HQNA 2AYHA 4BM8A 1ND3B 4HK8A 4QPYA 3PLQA 3VLBB 5J37A 1AJOA 2GU9A 3H1WA 4EJRA 2W52A 4YSFA 5GLWA 1RUD1 3AMQA 5CNAA 2BUKA 4YVWC 1LOCA 2UWCA 2CL2A 1DYKA 5K0UA 1FNYA 1WW5A 3H7YA 1G9DA 3KSCA 4G9SB 1B09A 1S0JA 2HWE3 2E9QA 2WS92 1BEV2 3KZ4C 4L8QA 1LOAA 2VOVA 4IV3C 1KS5A 3APBA 4Y1XA 1MZEA 2OPKA 1AVBA 5C4WB 3G6JB 2YUEA 1MVEA 3ME2A 3ZFFA 3TBDA 4XBLA 1XYNA 3OJBA 1TME3 2A6ZA 2HWE2 2HWC1 4KWJA 2P34A 2KM2A 3RWNA 4PDWC 4AEMA 3A0NA 4N7IA 4WZFA 2IXLA 1RUE2 4BLIA 3LA2A 3DF0A 2K0GA 3VZOA 1NXD1 1MACA 1UAIA 5KXEA 2ATFA 4AQSA 1YFUA 4UXAA 5JIAA 1UU6A 1APNA 1X8MA 3N7JA 4YLZA 4YZ3A 4AI1A 3OY8A 1RUH1 2CAUA 3VZNA 3KGZA 1QXJA 3ZFEA 1PO23 4I3GA 1W0OA 3RMYA 1OHFA 1ZBE3 3VBHB 1PK6B 3WW3A 4BH9A 2D3RA 2ZGQA 3K48A 5DDJ3 3JU9A 4COWA 4M3CB 1RVF3 1YFXA 1CAWA 2F6BA 1I6XA 1LOFC 3AP9A 1H9PA 4AI2A 2PELA 2VQ0A 2R49A 2IXJA 1TMF1 1IKQA 2D97A 2RHPA 1QJX1 1XNBA 3J9SA 3VUOA 1ENRA 5JR7B 2PFWA 4BLJA 1AX0A 1S0EA 3DKWA 3M3OA 2R32A 3VKMA 4LHLA 5FMOL 1ALYA 3NV2A 1COV3 3UV9A 5ABJA 2JX9A 5KXCA 4PCRA 1AYM2 4HSJA 1E57A 3JBG1 2PAEA 2A3WA 1BK1A 4HPKB 1N47A 4XIOA 5FRAA 5BYNA 4JVAA 4X8NA 5CU1A 4Y26A 2GNDA 2Y38A 1OPMA 1PIV3 1DZTA 5GZDA 4DFSA 1NCRC 1SEFA 5CG9A 1CAUA 4OULA 1AXKA 3M3IA 4P5HA 1AR82 1WCSA 2WS91 1VLNA 5FREA 3CJXA 3EBRA 4C90A 5AFBA 1A3KA 2H6CA 4Y1VA 4RD7A 1MS3A 4HZFA 4TZDA 3SHRA 5A33B 1LENA 2VNOA 4WBBA 2B8MA 4GB31 4ISRA 4HVOA 1MS8A 2NMOA 2A75A 2DCZA 3LCPA 4V1PA 5JPNB 1H30A 3WUCA 3B3QE 4N90A 3ZN6A 3M3EA 1JXNA 4LEJA 2TUNA 4W6YA 3VBRB 1ZRCA 3R4UA 4XE9A 4XJ8A 2ARBA 5L7OA 4QM8A 5BNPB 2VW2A 2ZGUA 2ZABA 2XLFA 2H6BA 4D69A 1WUVA 1JUIA 4GKXA 3FLTA 4YGBA 2DVDA 1NY72 4R52A 4B29A 2GMMA 3X29B 4IEQA 2HEWF 1W6MA 1RUF3 5HCFA 1F9KA 5HBAA 5SV5A 1S2BA 2HWC2 4FPFA 3WQ0A 3VDDC 3E6DA 4TSVA 1I3HA 4KWLA 1JUHA 4AGRA 2GC1A 1BMV2 2PLV3 5CFDC 1NYWA 1Y7BA 3FX3A 4B8EA 5C4WA 5C9AC 1F31A 4A3XA 3MZHA 2DVAA 2GMPA 2A3XA 1MR5A 1WMDA 2FZ1A 3SLIA 5BY5A 2DVBA 1PZ8A 4XJWA 5H9QA 2D40A 2D7FA 4UW6A 1BEV1 1AR92 1EYBA 4CZSA 5BV6A 3D6EA 4Q2FA 4X8PA 4ATFA 3N4MA 4GWMA 3ZXKA 5JWPA 4CRQA 3WW2A 3MF9A 4J1XA 4MYEA 4QPGB 2C5DA 1LHWA 2ZX2A 4EN6B 1EAH3 2A5ZA 2ZGNA 1WW6A 2R061 2XWJB 3GBWA 5BXXA 2QDRA 1G9BA 4QPIB 4GQ7A 4IEXA 1QH6A 3VGIA 1YCIA 3MICA 1YFYA 1GYKA 3NAPB 1F5JA 1BVVA 4IXLA 3MIBA 5JMCA 3IMNA 1Z7S2 1MQTB 4CEWA 4CTEA 2ERFA 2R041 2GN7A 1WW4A 2IXKA 1RUNA 3ILFA 2VVEA 3U11A 2VW1A 3UL2A 3WVJA 1MS5A 5I8YA 5J3UA 2UWBA 1YI9A 4FPOB 2B5HA 1BZWA 1C1FA 3LWCA 1H8TC 1YRZA 2CY6A 1UIJA 1RUJ2 4U2AA 1RMU3 1TMF3 1W6NB 3WHTA 2JICA 3CO2A 2Q30A 1NE4A 5FLJA 3V0AA 1UMZA 4SBVA 2A6YA 2TEPA 5ACA3 1AX1A 1C8M3 4GWNA 4FO9A 4LBMA 2Y0OA 1QF3A 3AKRA 1FPN1 1B35A 4W6WA 2JG8C 1COV2 2ZA9A 2BPA2 1LGNA 2FBEA 2W39A 4FAHA 1WMFA 1FX5A 1AZDA 3UJOA 1FXZA 2W08A 3ENRA 5A32B 3DPRB 4Q4W1 4YVWA 2OIIA 4KU8A 1QMJA 1RB8G 1C8M2 4YG6A 1MEC3 1PIV1 2XJTA 5FLHA 1J59A 1QQP1 3T1MA 2IWGB 3KQRA 1G9CA 4XFFA 1V6IA 1HRV2 5GLZA 1W2UA 2HYKA 4S2HA 1AL0G 3TN93 5CFCB 5KXDA 1ZZ6A 3PVOA 5E89A 4H3WA 2HWD1 2CGPA 3AM2A 1ZZCA 3VBUB 1WW7A 1EY2A 2BVBA 4AI0A 4OI4A 3J4UH 1Q56A 4AQ2A 2XL9A 1SLBA 2HWD2 1VBC1 2VNGA 1HRV3 2OUJA 1V6JA 1QH7A 1PNGA 1R1A3 4R8HA 1LOEA 5GLTA 4RQPC 3AP7A 3WOGA 4GMP1 1VBA2 3LSDA 3GF6A 4IEVA 1G86A 1LU2A 3WQ1A 4AEKA 2XPJA 5D1IA 2HWF1 2CTVA 2UYAA 5CIRA 1CAXB 2I2SA 3O0XA 4KWKA 4PLMA 5KHGA 1RUE1 3DUIA 1XYOA 3NJZA 4LNVA 1HXS3 3MEPA 1LOBA 1PVC3 4MGZE 2A3YA 4QD2A 3D0JA 2E51A 2XKPA 4CDWB 5C8WA 4WM8C 4LBNA 4P9YA 3RJ2X 3USSA 3WCSA 1UN1A 2XL7A 3GBGA 1DQ0A 2EXKA 2PLV1 2I07B 3U07A 3MFCA 4JTNA 1NA1B 2XUMA 1HRI2 1PGW2 4Q0VA 1VRH3 5KWRA 2PHDA 1CVNA 4BHPA 4Q0PA 4ES8A 4LUMA 2RS33 4GH4C 4C0HA 4RS5A 3GYDA 3AP6A 3J8F1 5TSWA 5CFDB 5JOZA 1DQ2A 4D3WA 1HIXA 1D2QA 1LHNA 1WBFA 2CWSA 2HWC3 3B01A 1I1EA 1FOD2 1OQDA 4YZ2A 2GNBA 4YFZA 1FPN2 1J1LA 1OFSA 4AVAA 2ETEA 3SCGA 1NLSA 1KJLA 4JRLA 2PHWA 2GMEA 3WUDA 1ULGA 1LKNA 2VMIA 4PBPA 4GULA 2WFPA 2KA3A 2HKXA 2ZPXA 3BB6A 5T5LA 1XU2A 5FPZA 1SBFA 2R16A 1ND2C 4JV4A 3O7OA 3M3CA 1XRUA 1YO8A 4HMZA 2WNVC 2ZOEB 3GBFA 4M3CE 4EROA 1PO21 2K2SA 2WA4A 2RR12 1ZBA2 1LESA 1NOVA 3H0OA 5F9TA 3O5SA 1I5ZA 4LHNA 2DCJA 4BCUA 1FYUA 3LGRA 4B3NA 4TWTA 2D98A 4XFGA 1KDKA 5L7OC 2EXHA 2WFF2 1PGL2 1W6NA 1H4GA 4QQLA 2R042 3MIDA 1RMU1 2K9ZA 2RS51 4GB32 3OGJA 4AI8A 4PQ9A 3B69A 1XNCA 4HFSA 2WFF1 2RR13 2GNMA 2R0HA 4YFWA 1H8TA 2VMHA 4BYYA 5KBFA 2PQQA 1H0BA 3AJZA 1GICA 2UURA 1C5IA 1LTEA 3WG1A 3WG2A 3N7KA 1V9U2 5J96B 2WKKA 2XG3A 1RUC1 4ONUA 4RHV3 2Z2SB 2PHUA 2ARXA 3MYXA 1Z78A 2DFCA 4ZU4A 4AGGA 1M06G 5DZGA 5HCAA 3WP6A 1D2SA 2GN3A 3D4KA 1RJ7A 2VUJA 3M3QA 2VUAA 5C8CC 4AE2A 3ZMNA 1NQDA 4RFT0 2HEYF 2FMDA 1K5MB 4Q26A 4YZ1A 3B00A 1OSGA 1CIWA 3LZZA 2XWBB 3BU7A 3ZFGB 1POV1 5ABJB 4AI3A 3B9CA 3ZXDA 1O91A 2G9GA 1PGSA 3HT2A 3H9AA 4FP2A 4KGGA 1U0AA 4XFIA 1OMIA 3VV1A 1UF2C 1D4M3 4FPYA 4K21A 3AZVA 4DRRA 1C28A 1AR83 1AXZA 1GZ9A 1XE7A 3N36A 2D6KA 4RS5C 3ILNA 1AL21 5FQ0B 1GZCA 4DXZA 4AQ6A 2X5IA 2FMYA 1C1LA 1AXYA 2WIIB 5FMOS 2PHXA 2E7QA 4R4XA 3EQEA 2R062 2EVXA 2YGMA 2ZGLA 3PVEA 2BWCA 2O8OA 2W0XA 2YC0A 3ZX7A 2WWSA 4XYXA 2JEMA 3FUOA 2QFEA 4ISQA 2O0OA 2JKBA 2ENRA 2RS13 4RQPB 2EXIA 1N1SA 4Q0QA 3QH7A 2GDFA 2IFRA 1OQ1A 4N43B 1CD3G 2B7YA 2CWMA 3MW3A 5I0UA 4YW3A 1URXA 1NQJA 4HSLA 4CEWC 4AVCA 1ZREA 1CAUB 1FOD1 3AKPA 4XJ9A 1HX6A 1VBA3 4ASMB 4BPZA 4XJUA 1VBD2 1KDMA 2DCTA 5BNPC 1V70A 2H0VA 1QNWA 1KRIA 3VL9A 2YGLA 3O0WA 2XJRA 1LHVA 1PGL1 1K5MA 5GZFA 2EAKA 2PN5A 3D5OA 3J8F3 2RS52 2D5FA 2XBO1 2WJSA 4AHXA 1HRI1 3ALQA 4P9GA 1KJRA 3PTYA 2ZKNA 2WZR3 1RJ8A 2GALA 2YY1A 1TE1B 1AR73 4MGYE 1ZRRA 3IBMA 3S0MA 1AR93 2YMZA 4A7ZA 5BNOC 1QDCA 2ZX3A 1H4HA 3VBSB 4N53C 5C4WC 2VY0A 3NWKA 4XF9A 1BBT2 4J6GA 4DRVA 2CAVA 1W6PB 4FTEA 3A4UA 4AW7A 3SXWA 3R6SA 1G9FA 3POSA 1J3QA 3I59B 4AEDB 4IERA 1VBE1 4XTPA 4B7EA 1REDA 2AREA 2YZ4A 1W0PA 3VL8A 5F6LB 2PTMA 1AUYA 4KH9A 1CAVB 2VULA 4MXVA 1NE6A 1HQLA 3HWJA 4EWEA 4FPEA 4Q4V1 1RIRA 3E5UA 1C8NA 5T5PA 3WXPA 4EWAA 2RS53 4C91A 2OZJA 4D7TA 3BIWE 5GZEA 3NV1A 2Y0IA 4YVSC 3IDBB 5K0UB 1H1IA 1FMD3 4AFAA 1Z7S3 3H3UA 1D0GA 1PK6A 1X7NA 1MS4A 4AVVA 1R092 1LEMA 2HWF2 2A6WA 2XHKA 3LAGA 4BMEA 1IS4A 2OVUA 3KCYA 3WG3A 4I2OA 1OLRA 3WG4A 3ZFEC 3ZXFA 4FQ4A 2NM1A 5AFEA 1QGLA 2CGNA 3ZXGA 1ENQA 1N1VA 3LA7A 1YJLA 3E6BA 3LSEA 3KM5A 4Q4W3 5GLVA 3SCHA 1A6CA 3CEWA 1BQPA 1MEC1 1YFWA 1SFNA 3MPBA 4XJZA 4CYDA 1Q43A 1Z0HA 4XXAA 5CFCA 3BODA 1V9U3 4B4RA 4P9IA 4PBOA 1BMV1 4RR3A 2C9AA 5FO9B 4QXKA 4PF5A 1R091 4QM9A 4FPGA 4YM0A 5I0RA 1ZM1A 2GC3A 1ASJ2 3AP4A 3DPRC 4K40A 2VNRA 1KXGA 1VP6A 5EYXA 1DZQA 2ZX1A 3USUB 3V65A 2XBO2 1VBC3 3KGLA 2OA2A 2PAKA 4KL1A 5DUXA 5JZGB 1WCDJ 3VKLA 2ZGSA 1ZZ9A 2XB6C 4ATEA 1POV0 4TYSA 4HL0A 3VZLA 2R0FA 4FPJA 1C5HA 2IXCA 4XEZA 3ZSKA 4H55A 3LB9A 4K8FA 4DQAA 3WDTA 4ZXKA 2B45X 5A32A 4RS5B 3WW4A 3WP5A 1UPSA 1WGPA 1EP0A 2A71A 3VBHC 1UX6A 1BBT1 1QOTA 1WMEA 3DV8A 1CGPA 2ZHLA 1QNYA 1IQAA 4LO8A 3DL3A 3ZSJA 2ZGMA 4Y4YA 1PO22 3WZ1A 5FCCA 4QX5A 4DNYA 2GH8A 4Y5Z0 1H2KA 4AFDA 4ZKTB 3H8UA 1WBLA 4IETA 2Q4SA 1WLWA 1GLHA 1RUD3 1LHUA 4P14A 3I2DA 2XBO3 2IFWA 1RUJ1 1VB2A 4MH0E 3CJIA 1UU4A 3ZYPA 4Q29A 1LECA 1WD3A 1WLTA 3VZMA 4A2UA 4C0BA 3JQWA 5J7MA 2EIGA 2JXAA 3ZSMA 2ZX0A 4XFCA 3GZUC 5J98B 4JDMA 5FPXA 2DUQA 2IXIA 1RUF2 4AVBA 1G7YA 2QQPA 2G9FA 1EAH1 4H7LA 4PIYA 4XBNA 5T3NA 4LE4A 4Z82A 3PJQA 5IT6A 1PVC2 3CLPA 4PJYA 1QWRA 2IZWA 2JG9C 5BNQA 1OFNA 1U5IA 4LBQA 3HT1A 4CDXC 3I54A 1YLLA 2ZHKA 2QDNA 2UY8A 5AVPA 1RUH3 4Y20B 1AF9A 4O9GA 1ND3A 4RQPA 3EJKA 1V6KA 1NZCA 1VIWB 2MEV1 3ZN4A 3QLQA 2VQAA 5HCBA 2R6QA 3V0BB 1MS1A 1ND2B 3QH6A 3HD8B 4AEDC 1TNRA 4E2GA 3QCWA 3NAPC 1X82A 4HKOA 1GR3A 3GHMA 1Z7S1 2N7GA 1N1TA 4Q4Y2 3J26N 4EN0A 1CN1A 5DUWA 3H1YA 1CX4A 4K6BA 3MI8A 3JQXA 4F3JA 3SH3A 5L7OB 1KITA 5I93A 5E16A 1H1MA 3AJYA 2ILMA 4N9IA 1EPWA 1PGW1 2HJIA 3UKTA 5J36A 3IKWA 4UBHA 4BIOA 2BTVC 1W6MB 4WVZA 1QJX3 3VHOA 3ZFFB 2IXHA 3O0VA 1JH5A 4QPGA 4AF9A 2WNUB 3VZJA 5A3LA 2SBAA 5GKAC 4INDA 1R093 4KU7A 4K7JA 5CADA 1VBD1 4N9HA 1L3JA 2JE9A 3USUA 2BEOA 1RVF2 5C8CB 4MV2A 4N43A 4HT1T 5F5QA 5IUQA 4D94A 1NCQA 2Q1ZB 3ZFGA 5FQ0A 4XXPA 4ZU7A 1CR7A 5JPMB 3KCCA 1DGWX 3CJIC 1D4M2 1OI6A 2DCYA 4EN9B 3ELNA 4JGZC 2ZAHA 4FBFA 1LULA 3VBRA 2E53A 2VPVA 3WDXA 2E6VA 3FUQA 5L36A 1O7FA 2GH2A 2XLAA 2RMU2 1RL3A 1QY4A 4BIFA 1HXS2 1PVC1 2ZGTA 4OUMA 4WVMA 1H2MA 4LR4A 3B7MA 2DWRA 3AXEA 4Z2WA 4YNIA 3LOIA 1WLDA 2QVSB 3JCIA 4KG8A 1J1TA 4HANA 3D0SA 3RPQA 4D7YA 5CAZA 1N3PA 1EPZA 1J3RA 1RUF1 3TNQA 3ZXLA 3L9JT 1BCXA 4QGLA 2ET1A 4R9CA 4YZ4A 3EO6A 3E5QA 1JYCA 2BNOA 2UYBA 3BOPA 3W58A 3I7DA 1NLRA 2DV9A 1QOSA 4YW4A 1RUJ3 2DTWA 3KMHA 1YYNA 4YGDA 3ZO0B 4B4PA 4AK3A 4IEOA 3VBRC 2ZGPA 2AUYA 2NYYA 1Q8OA 1ND3C 1VJ2A 3AZXA 1UPIA 4IEUA 1DFQA 3KT4A 4XFAA 4WM7B 3VBOA 1W6OB 1NCQC 5JLVA 1MS0A 5D8AC 4AHZA 4QPIA 1QJU3 1V6NA 4RGAA 2P37A 1CPMA 1LOGA 3SCFA 2RJKA 3OYWB 1ULDA 3PHMA 4P9WA 1VRH2 4N7UA 1EAH2 3ZSLA 1J58A 1RC6A 3HIFA 3OD4A 3VBUC 3JZVA 3WINE 4XILA 4COUA 2ZHNA 2B42B 3TN92 5JI9A 1AX2A 4I09A 3KCXA 4CDQB 5L73A 3TWIA 2DYCA 3AMHA 4QT6A 1GZWB 3RDIA 1YJKA 4XHBA 1RUI1 3IPVA 1OA3A 1PO11 1ZVFA 4DINB 4YZ5A 3R0RA 5J09A 3U10A 4XZPA 2WZPP 4GMP0 3THTA 3WNXA 4ES9A 4OLLA 4JRAA 1Q8VA 1XNDA 3VBFA 1TNFA 4FOYA 1LB2A 2YPJA 4YGCA 3RYKA 4M00A 3AKTA 4RL7A 1GFF2 5GZGA 1O5LA 1IS5A 2WQZC 2NLRA 3O14A 4FCAA 4CDWC 1QXRA 2WC2A 3IT8A 3VHRA 1NG0A 2DCKA 3ZSEA 1ZRDA 1RVF1 2QCSB 3FC0A 2AZ5A 4Q0UA 3QOPA 4YVWB 1RUI2 1DZRA 3NV4A 1H8TB 5JOXA 5EV7A 1W6OA 2UWAA 3P3PA 3UKNA 3WDWA 2JE7A 2R071 5C9AB 4CDXA 1FPN3 1WLCA 3TNPB 1UKRA 3AFKA 3OF1A 2DURA 3OYWA 5IK4A 1FATA 3INAA 5F1RA 4JGYC 4LUKA 2E7AA 3LOBA 3CU7A 2D5HA 5LEKA 1R082 2RS32 3WX5A 3ZIWA 5SV8A 2PHRA 2ZGKA 4IEYA 4XOGA 2JG8B 4HLTA 4IV1C 3RMXA 3ZDSA 4AWDA 1HQWA 3JD73 2WSVA 1GZWA 3OBTA 4JQRA 5ACA2 3MF6A 1GKBA 1DQ1A 4RR3C 3SISA 1VBE2 3N7MA 1LRHA 4LO5B 4PIZA 2ES3A 5CFCC 1S0CA 5CB7A 1GNZA 4JGYA 4E2SA 4I0AA 4NWWA 1WD4A 4YM3A 4KQ7A 3ACLA 5BNPA 1AYN1 4XHXA 5FTTC 1AR61 2LUWA 3CJIB 4AVSA 2R1BA 2WT0A 1R1A1 4Y1UA 1NCRB 4CDWA 1OA4A 4M0HA 4WM8A 1C57A 1VBC2 2DVGA 2EXJA 3NL1A 4S2DA 2RS11 5JZGC 3FZ3A 2AENA 4YG0A 3E6CC 4FXKB 4D7SA 1NY71 3H7JA 1NXMA 4YM2A 3N3HA 1YNAA 4HK9A 3FE5A 3MLJA 3S7EA 1RUG3 4AFBA 1LJ7A 1OKQA 1UW8A 1IKPA 1W6QB 1KFUL 2BNMA 2P2KA 4XFBA 4YW1A 4LBOA 4PDWA 1N3OA 1SLLA 2VMGA 4QMAA 5D8AA 1PHMA 1DQ6A 2VH9A 1PIV2 3RI8A 1RUC2 1CONA 2ZGOA 4DMIA 5GM0A 1RUOA 3VKNA 3BCWA 5GZCA 4NO4A 2CYFA 4YVSA 4Z1VA 2XJPA 1QU0A 4COVA 2B39A 3JB8A 3AKSA 1H9WA 3RRDA 1I9RA 4E4DX 4Q1PA 5DG1A 4BWOA 1DBNA 1KS4A 3J8F2 3B9IA 1HRI3 1O4ZA 1C4RA 2NQYA 1O3QA 4EWDA 4NR1A 4NOTA 4LO7A 4Z92B 2XVLA 1QKQA 3V56A 4RGGA 1QJU1 3R4SA 4E27A 1VBB3 1VB4A 1ND2A 4COZA 5EXOA 4S2FA 4DB5A 3OTFA 2Y26A 3L2HA 4HN1A 5FO8B 5DZEA 2DF7A 5JI7A 5HI0A 1A8MA 3G7DA 4NWVA 3AYDA 4OVEA 3DN7A 1S0BA 4GALA 1RGSA 1TME1 5KC6A 2QJVA 3FLPA 3NO8A 1W39A 1CESA 1A8DA 1GV9A 3D8CA 2X53S 3MIFA 3ASIA 4WV8A 2Z69A 3RYPA 4MXWA 3EXUA 4GH4B 1IPJA 1WA4A 1NCRA 1ULFA 3M4FA 4YW2A 3FJSA 2G4IA 3EHKA 3V0BA 2GNTA 3RYRA 1QJU2 3NV3A 4KNCA 4N53B 4E9KA 1ULEA 4CDUB 1YIFA 4XIKA 3TN91 1UZZA 2QZ3A 4MLOA 5JAXA 1RHI1 1KFXL 4XQDA 1A78A 4WZCA 5LRRA 2ZCWA 3ES1A 4PDWB 2QKDA 3R4DB 2NZ9A 4Y24A 1OQEA 4LLOA 2Q1MA 2WFF3 1U12A 1MZ6A 2I45A 2ZMKA 1DDLA 1NA1A 2GAUA 4Q8LA 1B35B 1UKGA 4PIXA 1LCLA 1S0DA 3WV6A 3WQ7A 1SACA 5FFOC 2AGSA 1AYN2 2ZX4A 1FV3A 5FDBA 1ZRFA 2WZR2 3GZAA 1QJY2 1Y9QA 3VHNA 1DF0A 1AR72 1SCRA 4MUVA 5CFDA 1SBEA 2TBVA 4WM7A 4Q4W2 5A33A 4IEZA 5ACA1 4Z8BA 1F2NA 2B9UA 3VKFC 3VBOC 1J3PA 3RZZA 3OY8B 4B4QA 2R072 3S30A 4NHKA 4IV3B 1S0FA 3AXDA 3RG0A 2F4PA 4OI2A 2RM23 2WSUA 2XGXA 5GLUA 4XQWA 4Q27A 4AYUA 1GQGA 2WT2A 3MPPG 4LO4B 1DLLA 1MS9A 3PJYA 3OCPA 3I59A 4QPGC 4AEDA 5JOYA 5T5OA 1JW6A 2QE3A 1SMVA 4LBQD 3WW1A 5BNNB 1FI2A 3ST7A 2BQPA 2BW8A 2GC0A 2RS31 4JCKA 2NMNA 3BTAA 4JGYB 5EYYA 4DOUA 1X33A 2ZGRA 4Q4X2 2XLGA 4CDUA 4OHVA 1SBDA 4K3UA 3WY6A 2PHTA 1DIWA 1K5MC 2HWE1 3KS7A 1BYHA 4L2NA 4NVPA 4M0NA 2WNVB 1D4VB 2ZTNA 5JZGA 2CNAA 1JHNA 5FAXA 1TMF2 1MQTC 1AYM3 2UY9A 4Q4X3 5DDJ2 2VGDA 1OOPC 3ZMOA 2DU1A 2WNUA 3I8TA</