3HX3A

Crystal structure of cralbp mutant r234w
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
ETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPAWFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKAVAEQLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bothnia dystrophy is caused by domino-like rearrangements in cellular retinaldehyde-binding protein mutant R234W.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Retinaldehyde-binding protein 1
total genus 91
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2009-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3hx3A01
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3hx3A02
3B7QA 4CJ6A 4J7PA 1OLME 4FMMA 2D4QA 3B7NA 3W68A 1O6UA 3PG7A 4M8ZA 1OIPA 3HY5A 4TLGA 3W67A 1OLMA 2E2XA 3B7ZA 3PEGA 1OIZA 1AUAA 4OMJA 3B74A 4J7QA 3HX3A 4CIZA 3P7ZA 4OMKA 4UYBA 3Q8GA 1R5LA
chains in the Genus database with same CATH superfamily
2OOAA 1WR1B 2QZ4A 3K9PA 1G59A 4K0KM 2F5QA 2G8LA 5ITQA 5KPTA 2DAKA 3WHLA 1IBKM 5DNYA 2Z3XA 2XSZD 4D80A 3AJIB 3FTDA 4R71A 3GRUA 3AKZA 2CRUA 7CATA 2QNJA 2XF3A 4FWGA 3GLGE 3L2AA 1NNUC 3J27B 3TWMA 1XNQM 1KFVA 2FOIC 3DOAA 2DI0A 4PT5A 3NWLA 4R7GA 1JR3A 4IJFA 2F5NA 5KQDA 3HKPA 3PNVA 3CGWA 4P17A 3EIEA 1XB2B 2DENA 3IG5A 1F4IA 2BJVA 2F5SA 1QAQA 5FTJA 2O25A 2QQ8A 2FNAA 2KW0A 2R18A 1OAIA 4IBJA 1I4WA 2V1CA 2EKFA 5EP2A 2OQ4A 2CP8A 4BBAA 4RF0A 1XMOM 3U6CA 1XXHA 2KDLA 4FD2A 2UU9M 2LHGA 3V76A 3FTFA 3LQQA 1SXJD 3FTCA 3PNYA 4ANRA 2VQFM 4QHSA 2R45A 3FUXA 2DKLA 2CHGA 5KO3A 2KRKA 2F5PA 2GNOA 3U6PA 1L2CA 3KSXA 1Q39A 1D0MA 3SFZA 2F5OA 1JR3D 1G3IA 1LV7A 1IN5A 2JXNA 4FVMA 2CE7A 2FFJA 2N35A 4DV2M 1OFIA 3NBXX 1HT1E 3I4YA 2BWEA 3M7GA 1C1KA 3Q8GA 4JI0M 3VLFB 3B9PA 2I7NA 4JI8M 1WGLA 2MH8A 3THGA 2YQZA 3SAWA 3R8FA 1Z5AA 4LF4M 5E6JA 4RKUF 2FE8A 3K9OA 1HQCA 2OOBA 1PJIA 1L8QA 3UGJA 2LVPC 2OO9A 5IWAM 1IY0A 1OQYA 3T6PA 5C1BA 4DR4M 1R2YA 2QPAA 1N77A 1IBLM 2LVQD 3FYCA 4QHTA 3GPUA 1N32M 2JY7A 4D81A 1OJLA 1ZMUA 2CFOA 1DO2A 4LY6A 3GLIE 5FTLA 2LHCA 4J7QA 4A3VB 2D7HA 3U6SA 4OMKA 1MN3A 2RGOA 4G3OA 4B3RM 2DZLA 1R4GA 1QAMA 3I4VA 3ZQJA 4YHHM 4JI1M 3W0LB 4AKIA 4GKJM 4CISA 2BNKA 3KOYE 2XLJA 3JR5A 5EXTA 2M60A 3R9XB 4XK8F 3VKHA 1SXJB 2Z4RA 2XFTA 1IXRC 2QP9X 4GMQA 2E2XA 3SC3A 2UUCM 1TDHA 1WGNA 3GPYA 4NSRA 4G4QA 3SATA 2WSEF 4QOSA 4KLNA 4DV5M 2MGWA 1XXHB 1Q3BA 1G4AE 1HR0M 2C99A 4II7A 5BR8M 4Z8XA 4RNAA 3GLGA 3L27A 4B3MM 4PD2A 4JI5M 3KOZE 2LNHC 1JR3E 1NY6A 3J7BA 1QYRA 1ZV1A 4UN2B 4GC5A 4M9XA 3CF2A 3C3DA 5LMUM 4DR1M 1WHCA 3FTEA 3K92A 1NHGC 3KS4A 4R3DA 1QAOA 1XMQM 1R2ZA 3D8BA 2DWNA 4CHTB 1XNRM 4GIPA 1V33A 1DGHB 1KSFX 5FTMA 4G4OA 2DAIA 4LRTA 2X49A 4G6ZA 3FYDA 4IBEA 2L7HA 3TWLA 2LTUA 2P5TA 1Q3CA 3E46A 1TH2A 4FWHA 4MB7A 2R46A 4GHAA 2CHVA 1GLNA 4LJ8A 1XWIA 3SARA 2LVAA 3JR4A 2ZAMA 2B3TA 3DA1A 3C3EA 4F2LA 1OKSA 1MX0A 4DV4M 1OLME 4MGIE 1D2NA 3GLGB 4AKGA 1IQPA 4AZFA 1NJGA 2VIIA 3QAUA 3SHGB 1L1TA 4B3TM 2R62A 1R7RA 2JY5A 5ITTA 3DZDA 3GLHB 3HU2A 2R0IA 1Z6TA 5IZ7D 4GH9A 4Q7JA 2G5GX 4LRSA 4MGHA 2DVWB 2VDBB 2C5RA 2KNZA 1WJ7A 1DGHA 4NOOB 2W82A 3TPZA 4DUYM 2YR0A 2VF7A 1HNXM 2Y21A 4LJ7A 1JB0F 1TGUA 3K2LA 4PCZA 3FD9A 4JYAM 2NQ8C 4DR2M 4XGIA 4JN6A 2CUZA 2LVNC 4FCWA 3U61B 4UYBA 4LGYA 4AG6A 1R6BX 2CV1A 1D0LA 5DYIA 3HHZA 1AIPC 2X4AA 3GLFB 5ITRA 1VEGA 3HU3A 3SMPA 2L09A 3HJQA 3W68A 5ITXE 1O6UA 3QWLA 3GQ4A 1EFUB 3U60A 4M8ZA 4IBCA 3I51A 4GHLA 2ZBKB 4BB9A 4B7GA 4I4LA 3SBJA 3CTWB 3H4JA 1NNJA 2R65A 2GQFA 4LJ6A 1EE8A 2Z4SA 5KPZA 1T6OA 2BWBA 3U5ZA 1J5EM 2D7EA 2CV2A 3B74A 3W0FA 1L2DA 1Y8GA 2WSCF 3ZCBB 4IBDA 2R4EA 3FUVA 5JI3E 4AKHA 5EXSA 5FSWA 4LFBM 1N75A 4YY3M 4IBGA 3UJNA 3GP1A 1CUKA 1QVRA 3GLFA 1QUSA 1L1ZA 3KP1E 1ZMWA 1Q02A 3GLIA 1QDTA 2DAGA 2Z8YM 4LGMA 1TH3A 2KXEA 3NBIA 3AOEC 2R6FA 2C98A 4KHPM 3FUTA 4FWDA 2K0BX 4NC6A 2ZAOA 1VG5A 3FKEA 3K1JA 1E9SA 4MGYE 4QNRA 4MM3B 3SHFA 3H4MA 2Z7JA 1TH4A 1AUAA 3L29A 3U5ZB 2Q2EB 1G41A 2K6BA 4PDIA 3J7AS 1NJFA 1X37A 3T1YM 4GKKM 3SAUA 1E94E 1TTEA 1PJSA 1YLAA 8CATA 4L8RC 3LVVA 1VDDA 1VQ1A 1NV8A 2ZTCA 1NV9A 3B7QA 3BOSA 3IECA 3PFIA 2ZM6M 1IN4A 4W5WA 3KW6A 2UXDM 3GQ3A 4D82A 3I01M 4XBOA 1IN7A 1GL7A 4M0WA 3HHYA 1NO1A 2JY8A 1IBMM 3MJ5A 4MH0E 2VQEM 3CF0A 3RFWA 4F1IA 1IXSA 1PM5A 2AHMA 3KXEC 2ERCA 2MROB 1ZAEA 1IM2A 2QENA 3VK8A 2KRUA 4LF6M 3FRIA 2L4EA 3WHKA 2HWJA 3HHXA 4X62M 1G8PA 2V1UA 1WXQA 2JNHA 1T3TA 1IN6A 4X65M 3AL0C 2DZOB 2UUBM 4TLGA 2J7NA 1IY2A 2JZ0A 2KZUA 3CF6E 4OVZA 4J7PA 2ZANA 4DUZM 3VDPA 2DWMA 1VEJA 4GITA 1E32A 2K47A 3A45A 1DGGA 1H6UA 4S12A 3ILKA 3JAMS 2Y20A 3GLHE 3A46A 1XC8A 3F92A 1ZQ9A 3GPPA 4FCVA 5L8RF 4PDGA 3BBZA 1GABA 2L7IA 2C9CA 4JI3M 3J80S 1PJTA 3U6EA 1OLMA 3PXGA 3E9SA 3GPXA 3VDUA 2KA6B 1SXJA 3MMPA 4HLQA 1DGFA 2DHRA 2EA0A 4I5SA 1OFHA 3HZJA 3U6QA 1YUBA 4LCBA 2O5RA 1IFYA 3TQSA 1IY1A 1NSFA 4IBKA 2M5ZA 3E21A 1OTRA 1OAOC 3AV0A 2DAMA 3GO8A 4IBBA 4LZJA 1RU3A 4NSOB 2XSZA 1ORYB 3GRYA 4OVZB 1BVSA 1K3XA 4LF9M 3UK6A 3KOXE 3E4RA 3L28A 4DV0M 4DR5M 3LVWA 1JQJC 4DV1M 1HQYE 4LZZA 4WP2A 4GC9A 3SASA 5EP1A 3SMSA 3W67A 3ZH9B 5IREB 3K8ZA 2KNAA 1J7KA 4IBIA 1PGYA 5EXPA 4DBGB 4M9SA 4LJAA 1GVNA 3Q8XA 3PEGA 5ITXA 4REZA 3GLFE 1K3WA 2A5YB 1GO5A 1QQWA 4ZPXA 1MU5A 3HHWA 1KYIA 2WZJA 1HJPA 3PVSA 4RF1A 3FUWA 3ZC7B 1NHWC 3LMMA 4CJ6A 3GLIB 2G3QA 1NY5A 1FNNA 1QDRA 4DR3M 3HWSA 2UUAM 1DV0A 1XHBA 1SXJC 4NRWA 3SYKA 4B7FA 1GJSA 3MK6A 3PG7A 1IN8A 1Z5CA 4AG5A 3L26A 5IT9S 3HJSA 4L6V6 3KDSE 3C58A 4X66M 3U6LA 2JZ1A 5BPVA 3LQRA 5A2QS 3LCVB 5F3WA 4AI6A 2LH0A 3T15A 3KOWE 4LJ5A 2F4VM 5GKNA 1GKIA 4M0DA 1HNWM 1LTMA 3VKGA 4LJ9A 3RGPA 3B89A 3P7ZA 1UM8A 3IHPA 2RKOA 4DV3M 1W5SA 3UMMA 2HCBA 2JY6B 4G4RA 3KVWA 2R44A 3LW5F 5EP3A 2DWZB 5JI2E 3A98B 3M0EA 4JI7M 2JP7A 2KZSA 4MGKE 5EJCA 4HL4A 4QOZC 1UFZA 2KHHA 3KFUG 3AOGA 4OW0A 4Z6YA 2Y0TA 1SG9A 2EUCA 2Y0QA 3T38A 2L6OA 4JI2M 2EJSA 5ITYA 1WIVA 1HT2E 4I81A 4LFAM 4LFCM 5ITUA 1Z5BA 4FW9A 2BJWA 2APLA 2QSFX 5FTNA 1YE9A 3UZUA 4OU7A 3EIHA 3U6OA 2DHYA 2C9OA 2E5LM 2DXIA 2J7OA 3C9PA 3MHVC 1OIZA 4Y28F 3IG8A 1EIJA 1QZMA 3AFHA 3GLHA 1S3SA 4DV6M 4B08A 1FJGM 5C18A 2LBCA 4IIWA 3OTOM 2KEBA 5EQTA 2LVOC 4OX9M 2EKKA 1E9RA 4FCTA 4KT0F 1V92A 2D4QA 1N34M 4LG2A 2QBYB 2KNVA 3AOEA 1QUTA 2DZNB 4CGYB 4P16A 3SAVA 2MR9A 2FH0A 2YNMD 2ZTDA 1TDZA 1HNZM 4LF8M 4DR6M 2H5XA 3U6DA 1VDLA 3LCUA 3U61A 1P3QQ 3FUUA 4IJEA 2HL7A 4L78A 4NRVA 4GEWA 3D8LA 4JV5M 2QCUA 3GRVA 4GRIA 4NXMM 4KODA 2WSFF 2XH9A 2XFSA 3FE3A 3HU1A 5E26A 3VFDA 4LF7M 4WURA 2L4FA 2UXBM 1DGBA 1GL6A 2I7PA 2LWXA 1A5TA 3J81S 3TWKA 3TL4X 1N36M 2JWSA 1QANA 2X8AA 3HX3A 2JA2A 2OPFA 3U60B 5DYGA 1N78A 2CHQA 1R5LA 4QNMA 3T1HM 2QHOB 3FRHA 2CEAA 3KP0E 1PRBA 1V34A 2DAEA 4L16A 1YSYA 3RE8A 1L2BA 2DWLA 4FMMA 1DO0A 2QBYA 1I94M 2XEPA 2HKJA 2JUJA 4I8OA 1OIPA 1D0KA 2EO2A 3L25A 1Z59A 4G4NA 1MJGM 1J09A 3GRRA 4DR7M 2XGNA 4JI4M 2DNAA 3RGSA 3B7ZA 3KSJA 3J2PB 5EXXA 1IXSB 4MGZE 4NXNM 3KS8A 2C96A 2MJ5B 1TR8A 3VK7A 1GJTA 3HJ8A 3I04M 4CIZA 2D7GA 2J5YA 4JXJA 4AW4A 1K82A 1N33M 1T43A 3HGIA 4X64M 3U6MA 2CV0A 3M6AA 1NVMA 2CWBA 4WW0A 4LF5M 4JI6M 2RGHA 3QYEA 4NL4H 5KQ8A 4DV7M 2H1RA 4HEOA 3B7NA 1QZEA 4L15A 2UXCM 2R4JA 1XXHE 4EIWA 1W5TA 4L4UA 2K9DA 1G71A 3QYBA 4ITQA 2V6ZM 3HY5A 4B3SM 4BLCA 4B7HA 4IBFA 3A42A 2HHHM 2VF8A 4TUWA 2RRUA 2YFQA 1C7YA 1PJJA 1SXJE 5DFLA 5LMNM 1IXZA 2XZFA 3SYLA 1VEKA 2O01F 2XZUA 5KPRA 4LJ4A 2L2DA 3DFZA 4KO8A 4OMJA 1TF0B 4M9ZA 5EP4A 1ZMVA 3BXWA 3TE6A 5FLXS 3GQ5A 2LXEA 5H37D 5FTKA 2FS1A 2HAKA 1PJQA 4AQYM
chains in the Genus database with same CATH topology
3B7QA 4CJ6A 4J7PA 1OLME 4FMMA 2D4QA 3B7NA 3W68A 1O6UA 3PG7A 4M8ZA 1OIPA 3HY5A 4TLGA 3W67A 1OLMA 2E2XA 3B7ZA 3PEGA 1OIZA 1AUAA 4OMJA 3B74A 4J7QA 3HX3A 4CIZA 3P7ZA 4OMKA 4UYBA 3Q8GA 1R5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B7Q A;  4CJ6 A;  4J7P A;  1OLM E;  4FMM A;  2D4Q A;  3B7N A;  3W68 A;  1O6U A;  3PG7 A;  4M8Z A;  1OIP A;  3HY5 A;  4TLG A;  3W67 A;  1OLM A;  2E2X A;  3B7Z A;  3PEG A;  1OIZ A;  1AUA A;  4OMJ A;  3B74 A;  4J7Q A;  3HX3 A;  4CIZ A;  3P7Z A;  4OMK A;  4UYB A;  3Q8G A;  1R5L A; 
#chains in the Genus database with same CATH topology
 2OOA A;  1WR1 B;  2QZ4 A;  3K9P A;  1G59 A;  4K0K M;  2F5Q A;  2G8L A;  5ITQ A;  5KPT A;  2DAK A;  3WHL A;  1IBK M;  5DNY A;  2Z3X A;  2XSZ D;  4D80 A;  3AJI B;  3FTD A;  4R71 A;  3GRU A;  3AKZ A;  2CRU A;  7CAT A;  2QNJ A;  2XF3 A;  4FWG A;  3GLG E;  3L2A A;  1NNU C;  3J27 B;  3TWM A;  1XNQ M;  1KFV A;  2FOI C;  3DOA A;  2DI0 A;  4PT5 A;  3NWL A;  4R7G A;  1JR3 A;  4IJF A;  2F5N A;  5KQD A;  3HKP A;  3PNV A;  3CGW A;  4P17 A;  3EIE A;  1XB2 B;  2DEN A;  3IG5 A;  1F4I A;  2BJV A;  2F5S A;  1QAQ A;  5FTJ A;  2O25 A;  2QQ8 A;  2FNA A;  2KW0 A;  2R18 A;  1OAI A;  4IBJ A;  1I4W A;  2V1C A;  2EKF A;  5EP2 A;  2OQ4 A;  2CP8 A;  4BBA A;  4RF0 A;  1XMO M;  3U6C A;  1XXH A;  2KDL A;  4FD2 A;  2UU9 M;  2LHG A;  3V76 A;  3FTF A;  3LQQ A;  1SXJ D;  3FTC A;  3PNY A;  4ANR A;  2VQF M;  4QHS A;  2R45 A;  3FUX A;  2DKL A;  2CHG A;  5KO3 A;  2KRK A;  2F5P A;  2GNO A;  3U6P A;  1L2C A;  3KSX A;  1Q39 A;  1D0M A;  3SFZ A;  2F5O A;  1JR3 D;  1G3I A;  1LV7 A;  1IN5 A;  2JXN A;  4FVM A;  2CE7 A;  2FFJ A;  2N35 A;  4DV2 M;  1OFI A;  3NBX X;  1HT1 E;  3I4Y A;  2BWE A;  3M7G A;  1C1K A;  3Q8G A;  4JI0 M;  3VLF B;  3B9P A;  2I7N A;  4JI8 M;  1WGL A;  2MH8 A;  3THG A;  2YQZ A;  3SAW A;  3R8F A;  1Z5A A;  4LF4 M;  5E6J A;  4RKU F;  2FE8 A;  3K9O A;  1HQC A;  2OOB A;  1PJI A;  1L8Q A;  3UGJ A;  2LVP C;  2OO9 A;  5IWA M;  1IY0 A;  1OQY A;  3T6P A;  5C1B A;  4DR4 M;  1R2Y A;  2QPA A;  1N77 A;  1IBL M;  2LVQ D;  3FYC A;  4QHT A;  3GPU A;  1N32 M;  2JY7 A;  4D81 A;  1OJL A;  1ZMU A;  2CFO A;  1DO2 A;  4LY6 A;  3GLI E;  5FTL A;  2LHC A;  4J7Q A;  4A3V B;  2D7H A;  3U6S A;  4OMK A;  1MN3 A;  2RGO A;  4G3O A;  4B3R M;  2DZL A;  1R4G A;  1QAM A;  3I4V A;  3ZQJ A;  4YHH M;  4JI1 M;  3W0L B;  4AKI A;  4GKJ M;  4CIS A;  2BNK A;  3KOY E;  2XLJ A;  3JR5 A;  5EXT A;  2M60 A;  3R9X B;  4XK8 F;  3VKH A;  1SXJ B;  2Z4R A;  2XFT A;  1IXR C;  2QP9 X;  4GMQ A;  2E2X A;  3SC3 A;  2UUC M;  1TDH A;  1WGN A;  3GPY A;  4NSR A;  4G4Q A;  3SAT A;  2WSE F;  4QOS A;  4KLN A;  4DV5 M;  2MGW A;  1XXH B;  1Q3B A;  1G4A E;  1HR0 M;  2C99 A;  4II7 A;  5BR8 M;  4Z8X A;  4RNA A;  3GLG A;  3L27 A;  4B3M M;  4PD2 A;  4JI5 M;  3KOZ E;  2LNH C;  1JR3 E;  1NY6 A;  3J7B A;  1QYR A;  1ZV1 A;  4UN2 B;  4GC5 A;  4M9X A;  3CF2 A;  3C3D A;  5LMU M;  4DR1 M;  1WHC A;  3FTE A;  3K92 A;  1NHG C;  3KS4 A;  4R3D A;  1QAO A;  1XMQ M;  1R2Z A;  3D8B A;  2DWN A;  4CHT B;  1XNR M;  4GIP A;  1V33 A;  1DGH B;  1KSF X;  5FTM A;  4G4O A;  2DAI A;  4LRT A;  2X49 A;  4G6Z A;  3FYD A;  4IBE A;  2L7H A;  3TWL A;  2LTU A;  2P5T A;  1Q3C A;  3E46 A;  1TH2 A;  4FWH A;  4MB7 A;  2R46 A;  4GHA A;  2CHV A;  1GLN A;  4LJ8 A;  1XWI A;  3SAR A;  2LVA A;  3JR4 A;  2ZAM A;  2B3T A;  3DA1 A;  3C3E A;  4F2L A;  1OKS A;  1MX0 A;  4DV4 M;  1OLM E;  4MGI E;  1D2N A;  3GLG B;  4AKG A;  1IQP A;  4AZF A;  1NJG A;  2VII A;  3QAU A;  3SHG B;  1L1T A;  4B3T M;  2R62 A;  1R7R A;  2JY5 A;  5ITT A;  3DZD A;  3GLH B;  3HU2 A;  2R0I A;  1Z6T A;  5IZ7 D;  4GH9 A;  4Q7J A;  2G5G X;  4LRS A;  4MGH A;  2DVW B;  2VDB B;  2C5R A;  2KNZ A;  1WJ7 A;  1DGH A;  4NOO B;  2W82 A;  3TPZ A;  4DUY M;  2YR0 A;  2VF7 A;  1HNX M;  2Y21 A;  4LJ7 A;  1JB0 F;  1TGU A;  3K2L A;  4PCZ A;  3FD9 A;  4JYA M;  2NQ8 C;  4DR2 M;  4XGI A;  4JN6 A;  2CUZ A;  2LVN C;  4FCW A;  3U61 B;  4UYB A;  4LGY A;  4AG6 A;  1R6B X;  2CV1 A;  1D0L A;  5DYI A;  3HHZ A;  1AIP C;  2X4A A;  3GLF B;  5ITR A;  1VEG A;  3HU3 A;  3SMP A;  2L09 A;  3HJQ A;  3W68 A;  5ITX E;  1O6U A;  3QWL A;  3GQ4 A;  1EFU B;  3U60 A;  4M8Z A;  4IBC A;  3I51 A;  4GHL A;  2ZBK B;  4BB9 A;  4B7G A;  4I4L A;  3SBJ A;  3CTW B;  3H4J A;  1NNJ A;  2R65 A;  2GQF A;  4LJ6 A;  1EE8 A;  2Z4S A;  5KPZ A;  1T6O A;  2BWB A;  3U5Z A;  1J5E M;  2D7E A;  2CV2 A;  3B74 A;  3W0F A;  1L2D A;  1Y8G A;  2WSC F;  3ZCB B;  4IBD A;  2R4E A;  3FUV A;  5JI3 E;  4AKH A;  5EXS A;  5FSW A;  4LFB M;  1N75 A;  4YY3 M;  4IBG A;  3UJN A;  3GP1 A;  1CUK A;  1QVR A;  3GLF A;  1QUS A;  1L1Z A;  3KP1 E;  1ZMW A;  1Q02 A;  3GLI A;  1QDT A;  2DAG A;  2Z8Y M;  4LGM A;  1TH3 A;  2KXE A;  3NBI A;  3AOE C;  2R6F A;  2C98 A;  4KHP M;  3FUT A;  4FWD A;  2K0B X;  4NC6 A;  2ZAO A;  1VG5 A;  3FKE A;  3K1J A;  1E9S A;  4MGY E;  4QNR A;  4MM3 B;  3SHF A;  3H4M A;  2Z7J A;  1TH4 A;  1AUA A;  3L29 A;  3U5Z B;  2Q2E B;  1G41 A;  2K6B A;  4PDI A;  3J7A S;  1NJF A;  1X37 A;  3T1Y M;  4GKK M;  3SAU A;  1E94 E;  1TTE A;  1PJS A;  1YLA A;  8CAT A;  4L8R C;  3LVV A;  1VDD A;  1VQ1 A;  1NV8 A;  2ZTC A;  1NV9 A;  3B7Q A;  3BOS A;  3IEC A;  3PFI A;  2ZM6 M;  1IN4 A;  4W5W A;  3KW6 A;  2UXD M;  3GQ3 A;  4D82 A;  3I01 M;  4XBO A;  1IN7 A;  1GL7 A;  4M0W A;  3HHY A;  1NO1 A;  2JY8 A;  1IBM M;  3MJ5 A;  4MH0 E;  2VQE M;  3CF0 A;  3RFW A;  4F1I A;  1IXS A;  1PM5 A;  2AHM A;  3KXE C;  2ERC A;  2MRO B;  1ZAE A;  1IM2 A;  2QEN A;  3VK8 A;  2KRU A;  4LF6 M;  3FRI A;  2L4E A;  3WHK A;  2HWJ A;  3HHX A;  4X62 M;  1G8P A;  2V1U A;  1WXQ A;  2JNH A;  1T3T A;  1IN6 A;  4X65 M;  3AL0 C;  2DZO B;  2UUB M;  4TLG A;  2J7N A;  1IY2 A;  2JZ0 A;  2KZU A;  3CF6 E;  4OVZ A;  4J7P A;  2ZAN A;  4DUZ M;  3VDP A;  2DWM A;  1VEJ A;  4GIT A;  1E32 A;  2K47 A;  3A45 A;  1DGG A;  1H6U A;  4S12 A;  3ILK A;  3JAM S;  2Y20 A;  3GLH E;  3A46 A;  1XC8 A;  3F92 A;  1ZQ9 A;  3GPP A;  4FCV A;  5L8R F;  4PDG A;  3BBZ A;  1GAB A;  2L7I A;  2C9C A;  4JI3 M;  3J80 S;  1PJT A;  3U6E A;  1OLM A;  3PXG A;  3E9S A;  3GPX A;  3VDU A;  2KA6 B;  1SXJ A;  3MMP A;  4HLQ A;  1DGF A;  2DHR A;  2EA0 A;  4I5S A;  1OFH A;  3HZJ A;  3U6Q A;  1YUB A;  4LCB A;  2O5R A;  1IFY A;  3TQS A;  1IY1 A;  1NSF A;  4IBK A;  2M5Z A;  3E21 A;  1OTR A;  1OAO C;  3AV0 A;  2DAM A;  3GO8 A;  4IBB A;  4LZJ A;  1RU3 A;  4NSO B;  2XSZ A;  1ORY B;  3GRY A;  4OVZ B;  1BVS A;  1K3X A;  4LF9 M;  3UK6 A;  3KOX E;  3E4R A;  3L28 A;  4DV0 M;  4DR5 M;  3LVW A;  1JQJ C;  4DV1 M;  1HQY E;  4LZZ A;  4WP2 A;  4GC9 A;  3SAS A;  5EP1 A;  3SMS A;  3W67 A;  3ZH9 B;  5IRE B;  3K8Z A;  2KNA A;  1J7K A;  4IBI A;  1PGY A;  5EXP A;  4DBG B;  4M9S A;  4LJA A;  1GVN A;  3Q8X A;  3PEG A;  5ITX A;  4REZ A;  3GLF E;  1K3W A;  2A5Y B;  1GO5 A;  1QQW A;  4ZPX A;  1MU5 A;  3HHW A;  1KYI A;  2WZJ A;  1HJP A;  3PVS A;  4RF1 A;  3FUW A;  3ZC7 B;  1NHW C;  3LMM A;  4CJ6 A;  3GLI B;  2G3Q A;  1NY5 A;  1FNN A;  1QDR A;  4DR3 M;  3HWS A;  2UUA M;  1DV0 A;  1XHB A;  1SXJ C;  4NRW A;  3SYK A;  4B7F A;  1GJS A;  3MK6 A;  3PG7 A;  1IN8 A;  1Z5C A;  4AG5 A;  3L26 A;  5IT9 S;  3HJS A;  4L6V 6;  3KDS E;  3C58 A;  4X66 M;  3U6L A;  2JZ1 A;  5BPV A;  3LQR A;  5A2Q S;  3LCV B;  5F3W A;  4AI6 A;  2LH0 A;  3T15 A;  3KOW E;  4LJ5 A;  2F4V M;  5GKN A;  1GKI A;  4M0D A;  1HNW M;  1LTM A;  3VKG A;  4LJ9 A;  3RGP A;  3B89 A;  3P7Z A;  1UM8 A;  3IHP A;  2RKO A;  4DV3 M;  1W5S A;  3UMM A;  2HCB A;  2JY6 B;  4G4R A;  3KVW A;  2R44 A;  3LW5 F;  5EP3 A;  2DWZ B;  5JI2 E;  3A98 B;  3M0E A;  4JI7 M;  2JP7 A;  2KZS A;  4MGK E;  5EJC A;  4HL4 A;  4QOZ C;  1UFZ A;  2KHH A;  3KFU G;  3AOG A;  4OW0 A;  4Z6Y A;  2Y0T A;  1SG9 A;  2EUC A;  2Y0Q A;  3T38 A;  2L6O A;  4JI2 M;  2EJS A;  5ITY A;  1WIV A;  1HT2 E;  4I81 A;  4LFA M;  4LFC M;  5ITU A;  1Z5B A;  4FW9 A;  2BJW A;  2APL A;  2QSF X;  5FTN A;  1YE9 A;  3UZU A;  4OU7 A;  3EIH A;  3U6O A;  2DHY A;  2C9O A;  2E5L M;  2DXI A;  2J7O A;  3C9P A;  3MHV C;  1OIZ A;  4Y28 F;  3IG8 A;  1EIJ A;  1QZM A;  3AFH A;  3GLH A;  1S3S A;  4DV6 M;  4B08 A;  1FJG M;  5C18 A;  2LBC A;  4IIW A;  3OTO M;  2KEB A;  5EQT A;  2LVO C;  4OX9 M;  2EKK A;  1E9R A;  4FCT A;  4KT0 F;  1V92 A;  2D4Q A;  1N34 M;  4LG2 A;  2QBY B;  2KNV A;  3AOE A;  1QUT A;  2DZN B;  4CGY B;  4P16 A;  3SAV A;  2MR9 A;  2FH0 A;  2YNM D;  2ZTD A;  1TDZ A;  1HNZ M;  4LF8 M;  4DR6 M;  2H5X A;  3U6D A;  1VDL A;  3LCU A;  3U61 A;  1P3Q Q;  3FUU A;  4IJE A;  2HL7 A;  4L78 A;  4NRV A;  4GEW A;  3D8L A;  4JV5 M;  2QCU A;  3GRV A;  4GRI A;  4NXM M;  4KOD A;  2WSF F;  2XH9 A;  2XFS A;  3FE3 A;  3HU1 A;  5E26 A;  3VFD A;  4LF7 M;  4WUR A;  2L4F A;  2UXB M;  1DGB A;  1GL6 A;  2I7P A;  2LWX A;  1A5T A;  3J81 S;  3TWK A;  3TL4 X;  1N36 M;  2JWS A;  1QAN A;  2X8A A;  3HX3 A;  2JA2 A;  2OPF A;  3U60 B;  5DYG A;  1N78 A;  2CHQ A;  1R5L A;  4QNM A;  3T1H M;  2QHO B;  3FRH A;  2CEA A;  3KP0 E;  1PRB A;  1V34 A;  2DAE A;  4L16 A;  1YSY A;  3RE8 A;  1L2B A;  2DWL A;  4FMM A;  1DO0 A;  2QBY A;  1I94 M;  2XEP A;  2HKJ A;  2JUJ A;  4I8O A;  1OIP A;  1D0K A;  2EO2 A;  3L25 A;  1Z59 A;  4G4N A;  1MJG M;  1J09 A;  3GRR A;  4DR7 M;  2XGN A;  4JI4 M;  2DNA A;  3RGS A;  3B7Z A;  3KSJ A;  3J2P B;  5EXX A;  1IXS B;  4MGZ E;  4NXN M;  3KS8 A;  2C96 A;  2MJ5 B;  1TR8 A;  3VK7 A;  1GJT A;  3HJ8 A;  3I04 M;  4CIZ A;  2D7G A;  2J5Y A;  4JXJ A;  4AW4 A;  1K82 A;  1N33 M;  1T43 A;  3HGI A;  4X64 M;  3U6M A;  2CV0 A;  3M6A A;  1NVM A;  2CWB A;  4WW0 A;  4LF5 M;  4JI6 M;  2RGH A;  3QYE A;  4NL4 H;  5KQ8 A;  4DV7 M;  2H1R A;  4HEO A;  3B7N A;  1QZE A;  4L15 A;  2UXC M;  2R4J A;  1XXH E;  4EIW A;  1W5T A;  4L4U A;  2K9D A;  1G71 A;  3QYB A;  4ITQ A;  2V6Z M;  3HY5 A;  4B3S M;  4BLC A;  4B7H A;  4IBF A;  3A42 A;  2HHH M;  2VF8 A;  4TUW A;  2RRU A;  2YFQ A;  1C7Y A;  1PJJ A;  1SXJ E;  5DFL A;  5LMN M;  1IXZ A;  2XZF A;  3SYL A;  1VEK A;  2O01 F;  2XZU A;  5KPR A;  4LJ4 A;  2L2D A;  3DFZ A;  4KO8 A;  4OMJ A;  1TF0 B;  4M9Z A;  5EP4 A;  1ZMV A;  3BXW A;  3TE6 A;  5FLX S;  3GQ5 A;  2LXE A;  5H37 D;  5FTK A;  2FS1 A;  2HAK A;  1PJQ A;  4AQY M; 
#chains in the Genus database with same CATH homology
 3B7Q A;  4CJ6 A;  4J7P A;  1OLM E;  4FMM A;  2D4Q A;  3B7N A;  3W68 A;  1O6U A;  3PG7 A;  4M8Z A;  1OIP A;  3HY5 A;  4TLG A;  3W67 A;  1OLM A;  2E2X A;  3B7Z A;  3PEG A;  1OIZ A;  1AUA A;  4OMJ A;  3B74 A;  4J7Q A;  3HX3 A;  4CIZ A;  3P7Z A;  4OMK A;  4UYB A;  3Q8G A;  1R5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...