3HX3A

Crystal structure of cralbp mutant r234w
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
250
structure length
250
Chain Sequence
b'ETREEAVRELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKFNVGRAYELLRGYVNFRLQYPELFDSLSPEAVRCTIEAGYPGVLSSRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPAWFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGGTLPKYDGKAVAEQLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinaldehyde-binding protein 1
publication title Bothnia dystrophy is caused by domino-like rearrangements in cellular retinaldehyde-binding protein mutant R234W.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 91
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2009-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00650 CRAL_TRIO CRAL/TRIO domain
A PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.20 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 N-terminal domain of phosphatidylinositol transfer protein sec14p 3hx3A01
3.40.525.10 Alpha Beta 3-Layer(aba) Sandwich Phosphatidylinositol Transfer Protein Sec14p CRAL-TRIO lipid binding domain 3hx3A02
4CIZA 1OIZA 3Q8GA 2E2XA 3PG7A 4J7QA 3B74A 2D4QA 3W68A 3P7ZA 4TLGA 4CJ6A 1O6UA 3HY5A 4UYBA 3PEGA 3W67A 1OLME 3B7NA 1OIPA 3B7ZA 4OMKA 3HX3A 1R5LA 3B7QA 1OLMA 4M8ZA 4OMJA 1AUAA 4FMMA 4J7PA
chains in the Genus database with same CATH superfamily
1I4WA 1N32M 1ORYB 2LHCA 3GO8A 1XMQM 1NHWC 3R9XB 1NY6A 4WP2A 3HZJA 1HJPA 4GC9A 3FTCA 2GNOA 3TWKA 3L27A 3HGIA 1PJSA 3GLHB 3GQ3A 4LF7M 3A42A 1JR3A 1NJFA 4MGZE 1TGUA 1Z59A 3HY5A 4QNMA 3E21A 2YR0A 1OJLA 3FUTA 4JI8M 2JZ0A 2Y21A 3R8FA 2J5YA 4EIWA 5C1BA 3U6QA 2D7HA 4GH9A 3LMMA 3AOEA 4YHHM 5ITXE 2VF7A 3KOZE 4B08A 4NXNM 2DHYA 4DR4M 3HU3A 1J7KA 1MN3A 4DV1M 3KVWA 5KO3A 2R6FA 2CV2A 4J7PA 4M0WA 5C18A 3M0EA 3U5ZB 1OFHA 4AKHA 1QDTA 2MH8A 3I4YA 3UJNA 3T15A 3GRUA 3K92A 4R7GA 3W68A 2C9CA 1SXJD 2G5GX 3FRIA 1XMOM 2CWBA 4PD2A 4AG6A 4CJ6A 2Y0QA 1XXHE 4DR7M 3GLGB 2QPAA 5EP1A 1V34A 2WSCF 3MMPA 4DR2M 4KODA 2W82A 3W67A 4JI4M 4G4OA 3U61A 3RGSA 1SXJC 1IBMM 2CE7A 4JV5M 3LVVA 4Z8XA 3DZDA 1OAIA 1OFIA 3T1HM 4Z6YA 3SAUA 4DR6M 1QAOA 4REZA 4IBJA 1HT2E 3IHPA 3UMMA 3DA1A 4FMMA 3HU2A 2XF3A 2KDLA 3BOSA 3KXEC 4LJ6A 3TPZA 2KHHA 2QHOB 1IM2A 4ZPXA 2LVOC 1E9SA 1EFUB 2EUCA 2LXEA 2Z4SA 3LVWA 4FW9A 3H4JA 4X66M 3GPPA 2DAMA 1IBKM 3AL0C 1K3XA 3A45A 3A98B 4LF6M 2L7HA 3GLFB 1IFYA 2Z8YM 2DWMA 1OLME 3QYEA 4KHPM 4L6V6 1QAQA 2K47A 5EXPA 1XC8A 2MR9A 4QOSA 1DGGA 1WJ7A 4LJ4A 3TL4X 1ZAEA 3JAMS 4JI2M 3GRVA 5FSWA 1WIVA 1CUKA 1N77A 3DFZA 1QUTA 5DYIA 2K0BX 2EJSA 1VQ1A 2XEPA 4LF5M 1OLMA 4B7HA 3KFUG 3GPUA 1ZMUA 1GABA 3GQ5A 1WXQA 3TQSA 4AKIA 3E9SA 4LG2A 4B3SM 2LVPC 2DKLA 2KEBA 4XBOA 4BB9A 4RF1A 4QOZC 2QNJA 3ZQJA 1R2ZA 2F5NA 2DXIA 2XH9A 2H5XA 3W0LB 3CF6E 3U6MA 3P7ZA 2XSZA 2WSEF 3M7GA 4FWDA 4MGHA 1VDLA 3FUXA 4DUYM 4RNAA 2R0IA 4DBGB 4NRWA 2N35A 2FFJA 2RGOA 4NRVA 3J80S 1OIPA 4D80A 4NL4H 3U60B 7CATA 3SFZA 4IBKA 2F5SA 2R18A 1R6BX 2M60A 1TH2A 2QCUA 4M9SA 4M8ZA 2BJVA 3KS8A 2O5RA 1K3WA 4MGIE 2EA0A 3T38A 3FTEA 2CFOA 4F1IA 5FLXS 1A5TA 1VEGA 1C7YA 3FTFA 3I04M 4MM3B 3DOAA 2L4EA 1NJGA 3RE8A 2RRUA 1OKSA 2C9OA 3GLHA 1IY0A 1Z5CA 4ANRA 2CHVA 4FWHA 4RF0A 3I01M 2R4EA 2UXBM 3VK7A 2XLJA 1G8PA 4JN6A 3ZC7B 2F5QA 5FTJA 1R4GA 3L29A 4AG5A 1DGHA 5KPZA 1KFVA 1GL7A 4M0DA 4OVZB 1G3IA 3FUWA 3KOWE 2YFQA 3KOXE 3EIEA 2WSFF 1QANA 1XNQM 2LTUA 1JR3D 4BBAA 1Z5BA 4R3DA 2FNAA 1XXHB 1NO1A 3U5ZA 1NHGC 3FUVA 5EQTA 4LJ9A 4WW0A 1V33A 4DV6M 1L1TA 3T1YM 4LJ7A 3RFWA 3Q8GA 3LQRA 4ITQA 2F5PA 2V6ZM 2QSFX 5IWAM 3GLGA 4IBCA 3AOEC 3B9PA 4YY3M 5BPVA 4JXJA 1HNXM 3C9PA 4UYBA 2ZTCA 3HWSA 2ZAMA 4L4UA 2KW0A 4DV0M 4AZFA 5IT9S 2UU9M 2DWZB 4NSOB 3CTWB 1SXJE 1HQCA 1DGHB 4G6ZA 1VDDA 2LHGA 2MJ5B 1G59A 4X65M 2V1UA 3I4VA 4NC6A 3SAWA 2QBYB 4QNRA 1N36M 3HHYA 3I51A 3CGWA 3U6LA 2FH0A 1G4AE 4GHLA 4LJ8A 4XK8F 4KLNA 3TE6A 1XNRM 2R65A 1GKIA 4HLQA 4Y28F 4OU7A 3GLFA 1DGFA 4J7QA 2BNKA 2ERCA 4LRTA 2ZM6M 1C1KA 3FYCA 1D0LA 4IJEA 4PCZA 4TLGA 1IY1A 2HCBA 5KQ8A 4G4QA 5BR8M 5KPRA 4LF9M 2E5LM 4WURA 3B7ZA 1V92A 2VF8A 3HHWA 3HJQA 3HX3A 1BVSA 4D81A 4NSRA 1FNNA 5IZ7D 1D0KA 1UFZA 4KO8A 4B7FA 1Q02A 4X64M 4OW0A 3SAVA 1E94E 1E9RA 3OTOM 4CISA 4TUWA 5E6JA 4GKJM 4LF8M 1L2CA 4AQYM 5EXTA 4G3OA 5E26A 1YLAA 4MGYE 1G41A 3NWLA 2CV0A 2OOAA 1MJGM 5F3WA 4R71A 1N33M 2Z7JA 4FCWA 3PXGA 4B3MM 3C3EA 4FVMA 3U60A 3QYBA 2KRKA 3HU1A 3JR5A 1IN5A 2QQ8A 4IBFA 1JB0F 1YSYA 3Q8XA 5ITTA 3L26A 2X49A 3K9OA 1R5LA 2XSZD 1XHBA 2DVWB 4LJAA 4IBBA 2LVQD 1S3SA 2QENA 2I7NA 2CP8A 2LBCA 1AUAA 1NV8A 5IREB 5ITXA 4DUZM 2L09A 1QVRA 3LCVB 2JP7A 1NNUC 1DV0A 4P17A 4AI6A 1OIZA 4IIWA 2E2XA 1PRBA 3K1JA 1P3QQ 1D0MA 4DV7M 2MROB 5ITYA 3FUUA 2GQFA 2LWXA 3FTDA 4I8OA 3V76A 4OVZA 2FOIC 1PJQA 2EKKA 3KSXA 3AKZA 3GQ4A 3GLIE 2C5RA 2NQ8C 3VKGA 3EIHA 1HQYE 3L28A 2DAKA 2FE8A 3SARA 5ITRA 2JY7A 2LVAA 4OMKA 1XXHA 4DV5M 1J5EM 2UUAM 5FTNA 3U6OA 5FTMA 3T6PA 4HEOA 2EO2A 2HWJA 2I7PA 1YE9A 2WZJA 4F2LA 2G3QA 1TR8A 4GC5A 3NBXX 2UXDM 3SC3A 3GPXA 3KP0E 3KDSE 3CF0A 1PGYA 3GPYA 4BLCA 4MB7A 1SXJB 1K82A 1IN4A 1YUBA 1JR3E 3HJSA 4GIPA 1OAOC 1Q39A 1QDRA 1VEKA 3PNVA 3QWLA 2HL7A 1HNWM 4DV2M 3TWMA 2J7NA 2L4FA 2V1CA 3VFDA 5KPTA 1XB2B 4RKUF 5EP3A 4PDGA 4GITA 3VLFB 3AV0A 4PDIA 2R45A 3L2AA 5H37D 3KSJA 2DAIA 1IN8A 1T6OA 2BWEA 2QBYA 3KP1E 2K9DA 1NNJA 8CATA 1F4IA 3RGPA 1IXRC 2LVNC 4LFBM 3FRHA 2OOBA 2Y0TA 1GO5A 3J2PB 1ZV1A 3F92A 5DYGA 4M9ZA 2JUJA 3PG7A 1IN7A 1L8QA 3D8LA 4L15A 3HHXA 2QZ4A 3U6SA 3B74A 4I5SA 4B3RM 4NOOB 1IXZA 4Q7JA 4LFCM 2CRUA 1XWIA 2CUZA 4PT5A 1IY2A 2DI0A 3UK6A 3SASA 2D4QA 4MGKE 3SATA 3B89A 1TDHA 3HHZA 2XZFA 3FE3A 1DO0A 4S12A 2OO9A 3AJIB 4NXMM 4QHTA 3ZCBB 2XFSA 3J81S 3SMPA 1TDZA 2R44A 2DNAA 2UUCM 2D7EA 3PNYA 2P5TA 3J7AS 4KT0F 2O25A 3QAUA 3U6PA 5DNYA 2MGWA 4LZZA 2XZUA 1GJTA 4XGIA 2DHRA 2KNAA 2EKFA 2K6BA 3BXWA 3U6CA 5FTKA 4FWGA 4GRIA 2Z4RA 3KW6A 4CIZA 4DR5M 4JYAM 2KNVA 2UUBM 2X8AA 1H6UA 1DO2A 1ZMWA 5LMUM 4P16A 5EXXA 1NVMA 2BJWA 1IXSB 1LV7A 2LNHC 1FJGM 1RU3A 2CEAA 2M5ZA 4UN2B 5EXSA 1GVNA 3GP1A 5LMNM 3PEGA 1X37A 2OPFA 1Z5AA 1ZQ9A 3AFHA 3KS4A 2JWSA 4I81A 4CGYB 5KQDA 2DWNA 1L2DA 4GKKM 2APLA 3CF2A 2YNMD 1N78A 3VDUA 4MH0E 3J27B 3IECA 2VDBB 4B3TM 1E32A 3W0FA 4L78A 1SG9A 3GLIB 3HKPA 1T3TA 2KA6B 3SMSA 2G8LA 1HT1E 2A5YB 4LFAM 4L8RC 3H4MA 4X62M 2C99A 1GJSA 1PM5A 3M6AA 2DENA 2KZUA 2X4AA 3K2LA 2CV1A 2O01F 5EP4A 4D82A 2HHHM 2JY6B 4IBDA 1R2YA 3LW5F 4IJFA 4QHSA 1O6UA 3UZUA 2JY8A 4M9XA 2D7GA 1W5SA 3B7NA 3SYLA 4B7GA 3VK8A 3L25A 3VKHA 5EP2A 1R7RA 2JA2A 1WGNA 4I4LA 2DAEA 2L7IA 3IG8A 3WHKA 2F5OA 2VQEM 1GLNA 1TF0B 2JNHA 3GLHE 5ITUA 2ZANA 4DV3M 1SXJA 1MU5A 2L6OA 2C98A 1I94M 1W5TA 2R4JA 3K9PA 3MK6A 4LGMA 3THGA 1WHCA 4JI3M 1GL6A 1Q3BA 2R46A 2JY5A 4JI7M 3LCUA 4LJ5A 2JXNA 1NSFA 4IBEA 1WGLA 1EIJA 4IBGA 4GMQA 3JR4A 1LTMA 3K8ZA 3BBZA 3SHGB 2R62A 3HJ8A 5L8RF 1T43A 2CHQA 2C96A 4JI6M 2KRUA 2ZBKB 3GRYA 5GKNA 4DR3M 3U61B 1D2NA 4OMJA 4LY6A 3C58A 2Q2EB 3J7BA 2ZAOA 3A46A 1J09A 2B3TA 3GLGE 4II7A 1OQYA 1N34M 2LH0A 1HR0M 4LGYA 1HNZM 3C3DA 3FKEA 3VDPA 2DAGA 5JI2E 2JZ1A 4LRSA 1L1ZA 4K0KM 1TH3A 1WR1B 4IBIA 5ITQA 4DR1M 2OQ4A 3IG5A 4AW4A 2DZLA 2AHMA 3UGJA 2DZNB 4JI5M 3PVSA 5FTLA 1Y8GA 2YQZA 2XFTA 1JQJC 1QZMA 3MJ5A 4FD2A 4G4RA 1MX0A 1Q3CA 4DV4M 1IN6A 3E46A 1QQWA 1QYRA 5EJCA 1IQPA 1QAMA 2F4VM 4GHAA 1L2BA 3GRRA 3FYDA 1OTRA 2UXCM 1AIPC 1NV9A 4G4NA 2KZSA 2H1RA 1VG5A 3D8BA 3SYKA 1VEJA 3WHLA 3GLFE 2VQFM 2HAKA 4LZJA 3MHVC 1Z6TA 2VIIA 2L2DA 2Y20A 3NBIA 3U6DA 2FS1A 1KSFX 2QP9X 3SHFA 1PJJA 1IXSA 2BWBA 1EE8A 3SBJA 5DFLA 1N75A 5A2QS 1PJIA 2KNZA 2DWLA 1NY5A 4FCVA 3E4RA 1TH4A 4GEWA 2RGHA 4JI0M 4LF4M 1KYIA 3AOGA 4LCBA 3ZH9B 1DGBA 2RKOA 4JI1M 4L16A 3U6EA 4AKGA 1PJTA 1UM8A 3GLIA 1QUSA 2KXEA 2XGNA 4OX9M 4A3VB 1ZMVA 2ZTDA 4CHTB 3PFIA 3B7QA 1IBLM 4FCTA 4HL4A 1TTEA 3ILKA 5JI3E 2HKJA 3FD9A 4W5WA 2J7OA 1G71A 2Z3XA 2DZOB 3LQQA 3KOYE 1QZEA 2CHGA 3TWLA
chains in the Genus database with same CATH topology
4CIZA 1OIZA 3Q8GA 2E2XA 3PG7A 4J7QA 3B74A 2D4QA 3W68A 3P7ZA 4TLGA 4CJ6A 1O6UA 3HY5A 4UYBA 3PEGA 3W67A 1OLME 3B7NA 1OIPA 3B7ZA 4OMKA 3HX3A 1R5LA 3B7QA 1OLMA 4M8ZA 4OMJA 1AUAA 4FMMA 4J7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CIZ A;  1OIZ A;  3Q8G A;  2E2X A;  3PG7 A;  4J7Q A;  3B74 A;  2D4Q A;  3W68 A;  3P7Z A;  4TLG A;  4CJ6 A;  1O6U A;  3HY5 A;  4UYB A;  3PEG A;  3W67 A;  1OLM E;  3B7N A;  1OIP A;  3B7Z A;  4OMK A;  3HX3 A;  1R5L A;  3B7Q A;  1OLM A;  4M8Z A;  4OMJ A;  1AUA A;  4FMM A;  4J7P A; 
#chains in the Genus database with same CATH topology
 1I4W A;  1N32 M;  1ORY B;  2LHC A;  3GO8 A;  1XMQ M;  1NHW C;  3R9X B;  1NY6 A;  4WP2 A;  3HZJ A;  1HJP A;  4GC9 A;  3FTC A;  2GNO A;  3TWK A;  3L27 A;  3HGI A;  1PJS A;  3GLH B;  3GQ3 A;  4LF7 M;  3A42 A;  1JR3 A;  1NJF A;  4MGZ E;  1TGU A;  1Z59 A;  3HY5 A;  4QNM A;  3E21 A;  2YR0 A;  1OJL A;  3FUT A;  4JI8 M;  2JZ0 A;  2Y21 A;  3R8F A;  2J5Y A;  4EIW A;  5C1B A;  3U6Q A;  2D7H A;  4GH9 A;  3LMM A;  3AOE A;  4YHH M;  5ITX E;  2VF7 A;  3KOZ E;  4B08 A;  4NXN M;  2DHY A;  4DR4 M;  3HU3 A;  1J7K A;  1MN3 A;  4DV1 M;  3KVW A;  5KO3 A;  2R6F A;  2CV2 A;  4J7P A;  4M0W A;  5C18 A;  3M0E A;  3U5Z B;  1OFH A;  4AKH A;  1QDT A;  2MH8 A;  3I4Y A;  3UJN A;  3T15 A;  3GRU A;  3K92 A;  4R7G A;  3W68 A;  2C9C A;  1SXJ D;  2G5G X;  3FRI A;  1XMO M;  2CWB A;  4PD2 A;  4AG6 A;  4CJ6 A;  2Y0Q A;  1XXH E;  4DR7 M;  3GLG B;  2QPA A;  5EP1 A;  1V34 A;  2WSC F;  3MMP A;  4DR2 M;  4KOD A;  2W82 A;  3W67 A;  4JI4 M;  4G4O A;  3U61 A;  3RGS A;  1SXJ C;  1IBM M;  2CE7 A;  4JV5 M;  3LVV A;  4Z8X A;  3DZD A;  1OAI A;  1OFI A;  3T1H M;  4Z6Y A;  3SAU A;  4DR6 M;  1QAO A;  4REZ A;  4IBJ A;  1HT2 E;  3IHP A;  3UMM A;  3DA1 A;  4FMM A;  3HU2 A;  2XF3 A;  2KDL A;  3BOS A;  3KXE C;  4LJ6 A;  3TPZ A;  2KHH A;  2QHO B;  1IM2 A;  4ZPX A;  2LVO C;  1E9S A;  1EFU B;  2EUC A;  2LXE A;  2Z4S A;  3LVW A;  4FW9 A;  3H4J A;  4X66 M;  3GPP A;  2DAM A;  1IBK M;  3AL0 C;  1K3X A;  3A45 A;  3A98 B;  4LF6 M;  2L7H A;  3GLF B;  1IFY A;  2Z8Y M;  2DWM A;  1OLM E;  3QYE A;  4KHP M;  4L6V 6;  1QAQ A;  2K47 A;  5EXP A;  1XC8 A;  2MR9 A;  4QOS A;  1DGG A;  1WJ7 A;  4LJ4 A;  3TL4 X;  1ZAE A;  3JAM S;  4JI2 M;  3GRV A;  5FSW A;  1WIV A;  1CUK A;  1N77 A;  3DFZ A;  1QUT A;  5DYI A;  2K0B X;  2EJS A;  1VQ1 A;  2XEP A;  4LF5 M;  1OLM A;  4B7H A;  3KFU G;  3GPU A;  1ZMU A;  1GAB A;  3GQ5 A;  1WXQ A;  3TQS A;  4AKI A;  3E9S A;  4LG2 A;  4B3S M;  2LVP C;  2DKL A;  2KEB A;  4XBO A;  4BB9 A;  4RF1 A;  4QOZ C;  2QNJ A;  3ZQJ A;  1R2Z A;  2F5N A;  2DXI A;  2XH9 A;  2H5X A;  3W0L B;  3CF6 E;  3U6M A;  3P7Z A;  2XSZ A;  2WSE F;  3M7G A;  4FWD A;  4MGH A;  1VDL A;  3FUX A;  4DUY M;  4RNA A;  2R0I A;  4DBG B;  4NRW A;  2N35 A;  2FFJ A;  2RGO A;  4NRV A;  3J80 S;  1OIP A;  4D80 A;  4NL4 H;  3U60 B;  7CAT A;  3SFZ A;  4IBK A;  2F5S A;  2R18 A;  1R6B X;  2M60 A;  1TH2 A;  2QCU A;  4M9S A;  4M8Z A;  2BJV A;  3KS8 A;  2O5R A;  1K3W A;  4MGI E;  2EA0 A;  3T38 A;  3FTE A;  2CFO A;  4F1I A;  5FLX S;  1A5T A;  1VEG A;  1C7Y A;  3FTF A;  3I04 M;  4MM3 B;  3DOA A;  2L4E A;  1NJG A;  3RE8 A;  2RRU A;  1OKS A;  2C9O A;  3GLH A;  1IY0 A;  1Z5C A;  4ANR A;  2CHV A;  4FWH A;  4RF0 A;  3I01 M;  2R4E A;  2UXB M;  3VK7 A;  2XLJ A;  1G8P A;  4JN6 A;  3ZC7 B;  2F5Q A;  5FTJ A;  1R4G A;  3L29 A;  4AG5 A;  1DGH A;  5KPZ A;  1KFV A;  1GL7 A;  4M0D A;  4OVZ B;  1G3I A;  3FUW A;  3KOW E;  2YFQ A;  3KOX E;  3EIE A;  2WSF F;  1QAN A;  1XNQ M;  2LTU A;  1JR3 D;  4BBA A;  1Z5B A;  4R3D A;  2FNA A;  1XXH B;  1NO1 A;  3U5Z A;  1NHG C;  3FUV A;  5EQT A;  4LJ9 A;  4WW0 A;  1V33 A;  4DV6 M;  1L1T A;  3T1Y M;  4LJ7 A;  3RFW A;  3Q8G A;  3LQR A;  4ITQ A;  2F5P A;  2V6Z M;  2QSF X;  5IWA M;  3GLG A;  4IBC A;  3AOE C;  3B9P A;  4YY3 M;  5BPV A;  4JXJ A;  1HNX M;  3C9P A;  4UYB A;  2ZTC A;  3HWS A;  2ZAM A;  4L4U A;  2KW0 A;  4DV0 M;  4AZF A;  5IT9 S;  2UU9 M;  2DWZ B;  4NSO B;  3CTW B;  1SXJ E;  1HQC A;  1DGH B;  4G6Z A;  1VDD A;  2LHG A;  2MJ5 B;  1G59 A;  4X65 M;  2V1U A;  3I4V A;  4NC6 A;  3SAW A;  2QBY B;  4QNR A;  1N36 M;  3HHY A;  3I51 A;  3CGW A;  3U6L A;  2FH0 A;  1G4A E;  4GHL A;  4LJ8 A;  4XK8 F;  4KLN A;  3TE6 A;  1XNR M;  2R65 A;  1GKI A;  4HLQ A;  4Y28 F;  4OU7 A;  3GLF A;  1DGF A;  4J7Q A;  2BNK A;  2ERC A;  4LRT A;  2ZM6 M;  1C1K A;  3FYC A;  1D0L A;  4IJE A;  4PCZ A;  4TLG A;  1IY1 A;  2HCB A;  5KQ8 A;  4G4Q A;  5BR8 M;  5KPR A;  4LF9 M;  2E5L M;  4WUR A;  3B7Z A;  1V92 A;  2VF8 A;  3HHW A;  3HJQ A;  3HX3 A;  1BVS A;  4D81 A;  4NSR A;  1FNN A;  5IZ7 D;  1D0K A;  1UFZ A;  4KO8 A;  4B7F A;  1Q02 A;  4X64 M;  4OW0 A;  3SAV A;  1E94 E;  1E9R A;  3OTO M;  4CIS A;  4TUW A;  5E6J A;  4GKJ M;  4LF8 M;  1L2C A;  4AQY M;  5EXT A;  4G3O A;  5E26 A;  1YLA A;  4MGY E;  1G41 A;  3NWL A;  2CV0 A;  2OOA A;  1MJG M;  5F3W A;  4R71 A;  1N33 M;  2Z7J A;  4FCW A;  3PXG A;  4B3M M;  3C3E A;  4FVM A;  3U60 A;  3QYB A;  2KRK A;  3HU1 A;  3JR5 A;  1IN5 A;  2QQ8 A;  4IBF A;  1JB0 F;  1YSY A;  3Q8X A;  5ITT A;  3L26 A;  2X49 A;  3K9O A;  1R5L A;  2XSZ D;  1XHB A;  2DVW B;  4LJA A;  4IBB A;  2LVQ D;  1S3S A;  2QEN A;  2I7N A;  2CP8 A;  2LBC A;  1AUA A;  1NV8 A;  5IRE B;  5ITX A;  4DUZ M;  2L09 A;  1QVR A;  3LCV B;  2JP7 A;  1NNU C;  1DV0 A;  4P17 A;  4AI6 A;  1OIZ A;  4IIW A;  2E2X A;  1PRB A;  3K1J A;  1P3Q Q;  1D0M A;  4DV7 M;  2MRO B;  5ITY A;  3FUU A;  2GQF A;  2LWX A;  3FTD A;  4I8O A;  3V76 A;  4OVZ A;  2FOI C;  1PJQ A;  2EKK A;  3KSX A;  3AKZ A;  3GQ4 A;  3GLI E;  2C5R A;  2NQ8 C;  3VKG A;  3EIH A;  1HQY E;  3L28 A;  2DAK A;  2FE8 A;  3SAR A;  5ITR A;  2JY7 A;  2LVA A;  4OMK A;  1XXH A;  4DV5 M;  1J5E M;  2UUA M;  5FTN A;  3U6O A;  5FTM A;  3T6P A;  4HEO A;  2EO2 A;  2HWJ A;  2I7P A;  1YE9 A;  2WZJ A;  4F2L A;  2G3Q A;  1TR8 A;  4GC5 A;  3NBX X;  2UXD M;  3SC3 A;  3GPX A;  3KP0 E;  3KDS E;  3CF0 A;  1PGY A;  3GPY A;  4BLC A;  4MB7 A;  1SXJ B;  1K82 A;  1IN4 A;  1YUB A;  1JR3 E;  3HJS A;  4GIP A;  1OAO C;  1Q39 A;  1QDR A;  1VEK A;  3PNV A;  3QWL A;  2HL7 A;  1HNW M;  4DV2 M;  3TWM A;  2J7N A;  2L4F A;  2V1C A;  3VFD A;  5KPT A;  1XB2 B;  4RKU F;  5EP3 A;  4PDG A;  4GIT A;  3VLF B;  3AV0 A;  4PDI A;  2R45 A;  3L2A A;  5H37 D;  3KSJ A;  2DAI A;  1IN8 A;  1T6O A;  2BWE A;  2QBY A;  3KP1 E;  2K9D A;  1NNJ A;  8CAT A;  1F4I A;  3RGP A;  1IXR C;  2LVN C;  4LFB M;  3FRH A;  2OOB A;  2Y0T A;  1GO5 A;  3J2P B;  1ZV1 A;  3F92 A;  5DYG A;  4M9Z A;  2JUJ A;  3PG7 A;  1IN7 A;  1L8Q A;  3D8L A;  4L15 A;  3HHX A;  2QZ4 A;  3U6S A;  3B74 A;  4I5S A;  4B3R M;  4NOO B;  1IXZ A;  4Q7J A;  4LFC M;  2CRU A;  1XWI A;  2CUZ A;  4PT5 A;  1IY2 A;  2DI0 A;  3UK6 A;  3SAS A;  2D4Q A;  4MGK E;  3SAT A;  3B89 A;  1TDH A;  3HHZ A;  2XZF A;  3FE3 A;  1DO0 A;  4S12 A;  2OO9 A;  3AJI B;  4NXM M;  4QHT A;  3ZCB B;  2XFS A;  3J81 S;  3SMP A;  1TDZ A;  2R44 A;  2DNA A;  2UUC M;  2D7E A;  3PNY A;  2P5T A;  3J7A S;  4KT0 F;  2O25 A;  3QAU A;  3U6P A;  5DNY A;  2MGW A;  4LZZ A;  2XZU A;  1GJT A;  4XGI A;  2DHR A;  2KNA A;  2EKF A;  2K6B A;  3BXW A;  3U6C A;  5FTK A;  4FWG A;  4GRI A;  2Z4R A;  3KW6 A;  4CIZ A;  4DR5 M;  4JYA M;  2KNV A;  2UUB M;  2X8A A;  1H6U A;  1DO2 A;  1ZMW A;  5LMU M;  4P16 A;  5EXX A;  1NVM A;  2BJW A;  1IXS B;  1LV7 A;  2LNH C;  1FJG M;  1RU3 A;  2CEA A;  2M5Z A;  4UN2 B;  5EXS A;  1GVN A;  3GP1 A;  5LMN M;  3PEG A;  1X37 A;  2OPF A;  1Z5A A;  1ZQ9 A;  3AFH A;  3KS4 A;  2JWS A;  4I81 A;  4CGY B;  5KQD A;  2DWN A;  1L2D A;  4GKK M;  2APL A;  3CF2 A;  2YNM D;  1N78 A;  3VDU A;  4MH0 E;  3J27 B;  3IEC A;  2VDB B;  4B3T M;  1E32 A;  3W0F A;  4L78 A;  1SG9 A;  3GLI B;  3HKP A;  1T3T A;  2KA6 B;  3SMS A;  2G8L A;  1HT1 E;  2A5Y B;  4LFA M;  4L8R C;  3H4M A;  4X62 M;  2C99 A;  1GJS A;  1PM5 A;  3M6A A;  2DEN A;  2KZU A;  2X4A A;  3K2L A;  2CV1 A;  2O01 F;  5EP4 A;  4D82 A;  2HHH M;  2JY6 B;  4IBD A;  1R2Y A;  3LW5 F;  4IJF A;  4QHS A;  1O6U A;  3UZU A;  2JY8 A;  4M9X A;  2D7G A;  1W5S A;  3B7N A;  3SYL A;  4B7G A;  3VK8 A;  3L25 A;  3VKH A;  5EP2 A;  1R7R A;  2JA2 A;  1WGN A;  4I4L A;  2DAE A;  2L7I A;  3IG8 A;  3WHK A;  2F5O A;  2VQE M;  1GLN A;  1TF0 B;  2JNH A;  3GLH E;  5ITU A;  2ZAN A;  4DV3 M;  1SXJ A;  1MU5 A;  2L6O A;  2C98 A;  1I94 M;  1W5T A;  2R4J A;  3K9P A;  3MK6 A;  4LGM A;  3THG A;  1WHC A;  4JI3 M;  1GL6 A;  1Q3B A;  2R46 A;  2JY5 A;  4JI7 M;  3LCU A;  4LJ5 A;  2JXN A;  1NSF A;  4IBE A;  1WGL A;  1EIJ A;  4IBG A;  4GMQ A;  3JR4 A;  1LTM A;  3K8Z A;  3BBZ A;  3SHG B;  2R62 A;  3HJ8 A;  5L8R F;  1T43 A;  2CHQ A;  2C96 A;  4JI6 M;  2KRU A;  2ZBK B;  3GRY A;  5GKN A;  4DR3 M;  3U61 B;  1D2N A;  4OMJ A;  4LY6 A;  3C58 A;  2Q2E B;  3J7B A;  2ZAO A;  3A46 A;  1J09 A;  2B3T A;  3GLG E;  4II7 A;  1OQY A;  1N34 M;  2LH0 A;  1HR0 M;  4LGY A;  1HNZ M;  3C3D A;  3FKE A;  3VDP A;  2DAG A;  5JI2 E;  2JZ1 A;  4LRS A;  1L1Z A;  4K0K M;  1TH3 A;  1WR1 B;  4IBI A;  5ITQ A;  4DR1 M;  2OQ4 A;  3IG5 A;  4AW4 A;  2DZL A;  2AHM A;  3UGJ A;  2DZN B;  4JI5 M;  3PVS A;  5FTL A;  1Y8G A;  2YQZ A;  2XFT A;  1JQJ C;  1QZM A;  3MJ5 A;  4FD2 A;  4G4R A;  1MX0 A;  1Q3C A;  4DV4 M;  1IN6 A;  3E46 A;  1QQW A;  1QYR A;  5EJC A;  1IQP A;  1QAM A;  2F4V M;  4GHA A;  1L2B A;  3GRR A;  3FYD A;  1OTR A;  2UXC M;  1AIP C;  1NV9 A;  4G4N A;  2KZS A;  2H1R A;  1VG5 A;  3D8B A;  3SYK A;  1VEJ A;  3WHL A;  3GLF E;  2VQF M;  2HAK A;  4LZJ A;  3MHV C;  1Z6T A;  2VII A;  2L2D A;  2Y20 A;  3NBI A;  3U6D A;  2FS1 A;  1KSF X;  2QP9 X;  3SHF A;  1PJJ A;  1IXS A;  2BWB A;  1EE8 A;  3SBJ A;  5DFL A;  1N75 A;  5A2Q S;  1PJI A;  2KNZ A;  2DWL A;  1NY5 A;  4FCV A;  3E4R A;  1TH4 A;  4GEW A;  2RGH A;  4JI0 M;  4LF4 M;  1KYI A;  3AOG A;  4LCB A;  3ZH9 B;  1DGB A;  2RKO A;  4JI1 M;  4L16 A;  3U6E A;  4AKG A;  1PJT A;  1UM8 A;  3GLI A;  1QUS A;  2KXE A;  2XGN A;  4OX9 M;  4A3V B;  1ZMV A;  2ZTD A;  4CHT B;  3PFI A;  3B7Q A;  1IBL M;  4FCT A;  4HL4 A;  1TTE A;  3ILK A;  5JI3 E;  2HKJ A;  3FD9 A;  4W5W A;  2J7O A;  1G71 A;  2Z3X A;  2DZO B;  3LQQ A;  3KOY E;  1QZE A;  2CHG A;  3TWL A; 
#chains in the Genus database with same CATH homology
 4CIZ A;  1OIZ A;  3Q8G A;  2E2X A;  3PG7 A;  4J7Q A;  3B74 A;  2D4Q A;  3W68 A;  3P7Z A;  4TLG A;  4CJ6 A;  1O6U A;  3HY5 A;  4UYB A;  3PEG A;  3W67 A;  1OLM E;  3B7N A;  1OIP A;  3B7Z A;  4OMK A;  3HX3 A;  1R5L A;  3B7Q A;  1OLM A;  4M8Z A;  4OMJ A;  1AUA A;  4FMM A;  4J7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...