3HX8A

Crystal structure of putative ketosteroid isomerase (np_103587.1) from mesorhizobium loti at 1.45 a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
128
structure length
128
Chain Sequence
GQSAKEAIEAANADFVKAYNSKDAAGVASKYMDDAAAFPPDMARVDGRQNIQKLWQGAMDMGISELKLTTLDVQESGDFAFESGSFSLKAPGKDSKLVDAAGKYVVVWRKGQDGGWKLYRDIWNSDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative ketosteroid isomerase
publication title Crystal structure of putative ketosteroid isomerase (NP_103587.1) from MESORHIZOBIUM LOTI at 1.45 A resolution
rcsb
source organism Mesorhizobium loti
molecule tags Isomerase
total genus 35
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14534 DUF4440 Domain of unknown function (DUF4440)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3hx8A00
3RGRA 1U5OA 2BMOB 2YFLB 1NWWA 4HM5B 5CF2A 3EN1B 3Q90A 3H3HA 2YFJB 3UNLA 4Q53A 4IIAA 2RGQA 8CHOA 1CQSA 5BXQA 1JN5A 3FF0A 5AIHA 3VGNA 1W02A 3LYGA 7STDA 5BVBA 1DMQA 3HX8A 3T8NA 1AR0A 3F8XA 5IF6A 2HMNB 1OHSA 2R4IA 3EC9A 3F40A 3MG1A 4LEHA 5FW5A 1Z1SA 2YFIB 4I4KA 2B24B 2JQ5A 2W2CA 4MJDA 1ULJB 3EX9A 4XDWA 3GZBA 4GB5A 5IG0A 2B1XB 5DREA 4L7KA 3K7CA 3IPTA 5G2GA 1JKGB 1OGXA 3KE7A 4HM8B 1W01A 3HZPA 4RZMA 3FF2A 4K1UA 1TP6A 3JUQA 2IMJA 1OHOA 4LGQA 2HMMB 2BMQB 1JB4A 3ER7A 3GZRA 3NV0B 3DM8A 3NUVA 1WQLB 5AIIA 1GY6A 3KSPA 4HM6B 5EVHA 1IDPA 4WYKA 3BLZA 4HVNA 2XSOB 5STDA 2Z77A 2F98A 3CU3A 1O7HB 1OF5A 2GEYA 1E97A 2INXA 1STDA 3E99A 3F8HA 3DXOA 3DUKA 1W00A 1OHPA 3EBTA 1O7PB 4OVMA 4WWUC 5JPPA 2PZVA 3MSOA 3NXJA 3STDA 3K0ZA 5IEOA 2XSHB 2I9WA 1JB2A 4L8PA 4STDA 4HM0B 1O7GB 3DMCA 3CPOA 2UX0A 1EA2A 3KKGA 2STDA 1QJGA 3CNMA 3JUNA 1A2KA 3BB9A 2BNGA 4N3VA 1JN5B 3F9SA 3A76A 2XR8B 3G16A 4PEJA 1OH0A 3GZXB 1GYBA 3B4PA 3WMDA 1ZX2A 3M8CA 1ASKA 3G0KA 4HM4B 2CHCA 5D82A 3SOYA 3FKAA 1S5AA 4U13A 1OPYA 3RGAA 3D9RA 3FZWA 3JUMA 3OV4A 5IG4A 1GS3A 1E3RA 4HM1B 1UUVB 1ISKA 4X2OA 3MG2A 3B4OA 3UJMA 3HK4A 3OWUA 3OXAA 2QGUA 5AI1A 5IERA 1O7NB 3H51A 3MG3A 3KZTA 1HKXA 4J9AA 1TUHA 2CKFB 5IG3A 1NDOB 3FH1A 4K1VA 5D81A 2QIYA 4R1KA 1EG9B 1Q40A 1W6YA 4XBXA 3SEDA 3CNXA 4WYKB 1BUQA 1DMMA 1OF5B 6STDA 3EQQB 3LZAA 5TGNA 4XDVA 4FCJA 2HMKB 3JUOA 1C7HA 3GZYB 2RCDA 2Z7AA 3FSDA 5IEPA 2XRXB 5HGRA 4XBTA 5KP1A 3NM2A 1QMAA 5JPUA 3EHCA 1UUWB 4LMIA 4R9LA 5AEWB 3NHXA 4FCMA 3JUPA 3S5CA 3MYTA 4HZ9B 1GY5A 3SOAA 1OCVA 5CF1A 2GBWB 3NBRA 4KVHA 2HMJB 2HMLB 3ROBA 3EN8A 2OWPA 1OGZA 5AIFA 1JB5A 3I0YA 5D83A 4CDLA 2A15A 4HZBB 3G8ZA 3OX9A 2K54A 1DMNA 2GBXB 4HM3B 1VZZA 3FLJA 5AEUB 4H3UA 1JKGA 4WP5A 5IG5A 3T8UA 3F7XA 1O7WB 1GY7A 4XB5A 2BMRB 3F7SA 3EJVA 3B7CA 3EF8A 4HJLB 5DRVA 4J8TA 4L8OA 3EBYA 5CLKA 4OUQA 1SJWA 1NU3A 1E3VA 5KP3A 3VSYA 1ZO2A 2RFRA 3GWRA 3DZLA 3NV0A 3GRDA 1Q40B 3B8LA 1K41A 3OWSA 2HMOB 4HM2B 4X2HA 1OUNA 5KP4A 5AIGA 4XM4A 5CXOA 2GXFA 3F14A 1Q42A 4HKVB 3MKIA 3ECFA 3FGYA 5CK6A 4R9KA 2F99A 1O7MB 1ULIB 5IENA 2GEXA 2Z76A 4ORLA 3MHEA 2F86B 4XBYA 4HM7B 3OWYA
chains in the Genus database with same CATH superfamily
3DGLA 3RGRA 1U5OA 3N54B 4O3VA 2XFTA 2W9QA 1M1K4 2BMOB 2W56A 1RHLA 3Q2PA 3AHSA 1VQL3 1X1UA 2YFLB 1NWWA 4HM5B 5CF2A 4QWTA 2C10A 3O8YA 3EN1B 3LTBA 3Q90A 1QVF2 2IYJA 3A5EA 4FCZA 1B27A 2UUGC 1K28A 3H3HA 2YFJB 3LTAA 1YIJ3 3TDGA 1N9EA 3UNLA 4HYZA 2C11A 4Q53A 1US1A 8RNTA 1K9M4 1BAOA 1BNSA 4NPBA 4G1MB 2OTJ3 1TRPA 5G1LA 4IIAA 1IQXA 2RGQA 1BRKA 8CHOA 3BIRA 2KF5A 3D3LA 1NB3I 3SYUA 1CQSA 1JZOA 1PY3A 3CC73 2BO9B 2Z6BA 1UI8A 1RGAA 3FG3A 5BXQA 1JN5A 4EC6A 3FF0A 1PYLA 5AIHA 2CX1A 4HM7B 2IUJA 1BSAA 1W02A 3LYGA 3NBBA 3VGNA 5BVBA 7STDA 4HOHA 1DYUA 1QALA 3CXC2 3D5GA 1DMQA 1UCLA 3HX8A 5HOHA 1IVWA 3T8NA 3K5TA 2FGTA 4R4KA 1AR0A 1CEWI 3F8XA 1BOXA 1I2GA 3LXUX 1I8VA 1W6GA 2HMNB 1OHSA 2KCDA 1L5GB 2R4IA 2CH9A 3EC9A 1Q9EA 1T3BA 1Q7HA 3F40A 1VQP3 3MG1A 4LEHA 1M1XB 3PCSA 1Z1SA 5FW5A 1VQ43 2OTL3 2YFIB 1LOWA 3Q1CA 4JF8A 5M19A 2H0HA 3FG1A 4OK0A 4I4KA 3DGOA 5JBSA 2B24B 2JQ5A 2W2CA 4RNYA 4MJDA 1ULJB 3EX9A 1B2UA 3GZBA 4XDWA 1YI23 5LC7A 1JBTA 4GB5A 5IG0A 1VQ93 2P0XA 1N8R4 1J2BA 2B1XB 5DREA 1JV2B 4L7KA 2CFGA 1LNHA 2CWUA 3K7CA 1KQS2 3IPTA 2CWTA 3BNDA 5G2GA 1JKGB 4MMZB 5BU4A 1OGXA 1RMSA 4MEIA 1RGGA 2KAAA 4AKZA 4K61A 4GSPA 3KE7A 2SARA 1BNIA 3OWYA 4EV2A 4HM8B 2CX0A 1OACA 1W01A 1BNJA 2L4VA 2P0MA 1JBRA 3HZPA 4KFEA 3QRDA 4RZMA 3FF2A 1IQYA 1EUIC 1BGSA 1UDII 1JZDA 2OQEC 4K1UA 3S29A 1TP6A 3JUQA 4O8SA 1RDSA 1RNBA 1FA3A 2IMJA 1OHOA 2AADA 4J5KA 4LGQA 2HMMB 2BMQB 2W6JH 1Q824 3NQYA 1JB4A 3ER7A 3GZRA 1AVKA 1FW7A 1GD4A 3NV0B 5G1KA 3GSPA 3DM8A 3CCE3 1W2B2 2CG0A 3KIIA 3NUVA 4TX4A 1FUTA 5LC6A 1WQLB 3GAXA 3SVAA 3CCR3 5AIIA 1GY6A 1UCJA 3KSPA 3T0UA 3WA3A 4HM6B 4CCVA 2P09A 2CG1A 1YNVX 1GOVA 1I2EA 5EVHA 1BRIA 3U97A 1UW1A 2KF3A 2E2VA 1IDPA 3LTCA 2CK3H 2K3DA 3BLZA 3LMLA 4K90B 1STFI 4HVNA 4WYKA 3BNCA 2XSOB 3NQZA 1VQ73 1S723 1VQ53 4RNZA 4GL6A 5STDA 2Z77A 4DKIA 2F98A 3CU3A 1RRLA 1O7HB 4I5QA 1OF5A 2CFDA 2IUKA 1VQN3 3DGMA 1CYUA 2GEYA 1E97A 1ROVA 2XGLA 2ZA4A 2INXA 1STDA 1GMRA 1V74A 3WODG 1JBSA 3E99A 1M9GA 4R80A 4HAAA 3ZFZA 3AMOB 4BTWA 3LT8A 1WNHA 3D79A 3F8HA 1YJW3 1RN4A 3CCM3 2MC8A 1AV4A 2L1SA 4RNTA 1I2FA 2GU1A 3DXOA 1BU4A 3DUKA 1F8NA 1W00A 1OHPA 2BU4A 3EBTA 4HBRA 1O7PB 3VF1A 4OVMA 4WWUC 5JPPA 2PZVA 2W56B 3MSOA 4FMBA 1EKMA 1DVDA 3NXJA 3STDA 1G02A 2P05A 3K0ZA 3D5IA 5IEOA 2XSHB 2J8XB 1VQK3 1DE3A 1BSBA 2I9WA 1JB2A 4LZIA 4L8PA 3LOYA 3NX0A 3PS8A 4STDA 1LRAA 1UGHI 4HM0B 3V99A 1O7GB 1RGCA 3ZG0A 3DMCA 2W04A 3CPOA 2UX0A 2BIRA 1EA2A 3AHWA 3KKGA 3X3XA 2STDA 1QJGA 3CNMA 3JUNA 1A2KA 2CC3A 3BB9A 3CMA3 1WMNA 2BNGA 4N3VA 1JN5B 3IJEB 3F9SA 1HU9A 2H0IA 2M7OA 3A76A 2XR8B 1LQMB 3G16A 4PEJA 2E2TA 1PFPA 1OH0A 3GZXB 3S27A 5IW9A 3WR2A 2WGOA 1QAFA 1BNGA 1GYBA 1GMPA 1T2IA 3B4PA 2OQEA 3WMDA 4BL2A 1ZX2A 3M8CA 1ASKA 3G0KA 2QA43 4N6LA 1RCLA 4GHOA 5ELUA 1MGRA 1DETA 1UCKA 1X1XA 1GOYA 4HM4B 2CHCA 5D82A 3SOYA 4EBGA 3FKAA 1S5AA 4U13A 1B2ZA 1OPYA 2E2UA 3D9RA 2Q07A 1FGQA 4JRFA 3FZWA 3RGAA 2H0GA 1BVIA 1YHQ3 3CC43 2WOFA 1IK3A 3CD63 3JUMA 4O02B 1R4YA 3OV4A 3SX1A 3UL6A 1A67A 1SIIA 3PYJA 4ZM8A 5IG4A 2IA7A 1WMOA 4FMDA 3G713 1BSCA 1GS3A 1E3RA 4HM1B 1UUVB 4N6UA 3UB1A 5GSPA 1VQ63 2RSXA 3CCV3 1ISKA 1B3SA 1RN7A 3PXMA 4X2OA 2MF7A 3UL5A 3MG2A 3B4OA 3UJMA 1N5HA 4IPBA 5A0OB 1VQO3 1RNTA 3BNEA 5I97A 3HK4A 3OWUA 3OXAA 3RNTA 1ZGXA 2QGUA 4CPKA 1LXEA 1T2HA 1UCIA 5AI1A 3CC23 1MWTA 1TTOA 2O3OA 3N9HA 1O7NB 2HOHA 5IERA 1YGWA 2CFWA 1N8QA 3U1WA 3HI7A 3WOEB 2JDIH 5AYSC 3H51A 3PZWA 1LOYA 3RDEA 2W0QA 2Y73A 1Q814 4LSOA 1C54A 3MG3A 5M1AA 3KZTA 3L0RA 1HKXA 1JRQA 2UGIA 2XH9A 1B2MA 1SQWA 1D6ZA 4J9AA 1IT8A 1TUHA 2CKFB 3CPW2 2RNTA 3I553 7GSPA 5IG3A 1NDOB 3J7Yd 1GSPA 1FYSA 1YIT3 1FGTA 3X3YA 1RGKA 3BU4A 3FH1A 4WFOA 4K1VA 4WHAA 1UGIA 1SIHA 1YGEA 1BNEA 1UUGB 1KWIA 2C4BA 5D81A 2QIYA 5EEOA 1IV7A 2D42A 2WGQA 4R1KA 2CFKA 1RJOA 1TFOA 2XFSA 1EG9B 1TU5A 3NBJA 4N6TA 1BRNL 3LT9A 1Q40A 3HIIA 1W6YA 1YVSA 4XBXA 3CCJ3 1RKYA 1FGRA 3OW22 1A2PA 2CFLA 2KF4A 1A2VA 4IT7A 3HIGA 1D6YA 3SEDA 1FUWA 1RLSA 2FXTA 2W9PA 3CNXA 2F56A 1HYFA 2V1LA 2XF3A 2K0MA 4WYKB 4BTYA 1X1YA 2O9UX 1BUQA 1IVXA 1B20A 1DMMA 4BL3A 4J5GA 1OF5B 4N6NB 4KZ1A 5ELJA 3URPA 1MGWA 1NJI4 3FG4A 6STDA 2CWVA 2IY2A 3ZG5A 1I0XA 3EQQB 3G4S3 2ML5A 4CJNA 1UI7A 3LZAA 1FUSA 2KRTA 3EB8A 3KCHA 5TGNA 4XDVA 3EE1A 4FCJA 4MMXB 3JVCA 2HMKB 1G96A 2P38A 1TIJA 1BRGA 3X42A 3JUOA 2ZL8A 1AVLA 1C7HA 2Y74A 1DVCA 2LQVA 2XEPA 4ILFA 3GZYB 2RCDA 2KXGA 2Z7AA 1JNQA 3FSDA 1KSIA 2XRXB 4AKYA 5IEPA 3N8BA 1YVBI 3DY5A 1RN1A 3DH2A 1B2XA 9RNTA 1IV9A 3ALAA 1ROAA 2KF6A 1W7CA 2AAEA 4BTXA 2FNQA 1RCKA 5FGOA 1BRSA 5HGRA 3KFQC 4N6MA 1D6UA 4XBTA 1IYYA 5KP1A 5RNTA 2OOVA 1RRHA 2F5WA 1IU7A 1A90A 4KFFA 1G0TA 3NM2A 1MWUA 1R4CA 3V98A 2WO0A 4EXRA 1BNFA 1PU4A 1FGOA 1QMAA 3MPHA 4MMYB 5JPUA 1MOLA 3AGNA 3D4AA 3EHCA 4N6V0 1UUWB 4LMIA 3LTDA 4R9LA 1RGFA 1X1WA 3SXXA 4BIRA 1Q7Y4 1K8A4 5AEWB 1EEJA 1QAKA 3NHXA 3JUPA 4FCMA 1W5ZA 1B2SA 3S5CA 4EV5A 3MYTA 1BSEA 4HZ9B 3WOFB 2F4YA 3G6E3 1B21A 2XGNA 1GY5A 3SOAA 3QK9A 1FGMA 1WTHA 4LYLB 1OCVA 1RGLA 2LYXA 3WHOA 5CF1A 2GBWB 3S67A 1YJ93 3NBRA 1WMPA 1I70A 4KVHA 1Q864 3WA2X 1BRHA 2HMLB 4KFDA 3ROBA 3EN8A 2CW9A 1CH0A 2D1WA 1RGHA 2OWPA 1BUJA 1LOXA 1OGZA 5AIFA 1TFKA 1TRQA 1SARA 2QEX3 1JB5A 3I0YA 4O2HA 5D83A 2GSPA 4CDLA 6RNTA 3CCU3 1M904 1NO3A 1ZS7A 1N5PA 3S28A 1SPUA 2A15A 4HZBB 5AYRB 3G8ZA 3OX9A 1LVNA 3IMAB 3X41A 2K54A 4N6OB 5BIRA 1LNIA 2OOVC 1VQ83 1DMNA 1V57A 1BNRA 2GBXB 1RTUA 4FMCA 4HM3B 3BNBA 1GMQA 1VZZA 1I3FA 3FLJA 1RSNA 5AEUB 4H3UA 3X3ZA 3AGOA 1AQZA 1W4NA 4NHFA 1JKGA 2YX9A 4WP5A 1V58A 4H61A 5IG5A 1YJN3 3T8UA 3F7XA 3K63A 1O7WB 1GY7A 2F5MA 4XB5A 3I563 1K734 1LQGC 2BMRB 3F7SA 1KD14 3CCL3 1BSDA 1LOVA 3KSED 2BHMA 1IT7A 3EJVA 6GSPA 7RNTA 3B7CA 1BRJA 3EF8A 1KC84 1MWRA 4HJLB 1MNLA 2SBLA 5DRVA 4J8TA 4L8OA 3CCS3 3EBYA 5CLKA 1I0VA 4OUQA 1NB5I 4KT3B 1U8CB 3DGNA 1SJWA 1NU3A 1Y4KA 5EQLA 1BIRA 1E3VA 5KP3A 3VSYA 1ZO2A 5IF6A 1I3IA 3PGBA 2RFRA 4FMAA 1GD3A 2R41A 3K9MC 2W03A 3MWZA 1FZUA 3GWRA 1VQM3 1W6CA 2ZDJA 3DZLA 3NV0A 3GRDA 3KN4A 1Q40B 4EW5A 3B8LA 1K41A 3OWSA 2HMOB 4HM2B 4BU4A 4X2HA 1OUNA 3SLUA 3HOHA 3Q3FA 1GOUA 1T5YA 1AY7A 4EYCA 3FCSB 5AIGA 5KP4A 4XM4A 3WDGB 2RBIA 2GU3A 1NNVA 2OCTA 2PNCA 3CCQ3 1RGEA 5M18A 1HZ1A 2BT3A 5CXOA 2GXFA 3F14A 3X40A 1IVVA 1MWSA 1Q42A 1VQQA 4HKVB 3MKIA 3PCRA 3ECFA 3FGYA 5CK6A 4R9KA 1N9JA 2F99A 1IVUA 1CYVA 1O7MB 4AEQA 1EQKA 2CIUA 3DGYA 1QVG2 1TJDA 3V92A 3NM7A 4RBNA 3AMOA 1ULIB 1W2ZA 5IENA 2GEXA 2Z76A 4NREA 4ORLA 1BANA 2ZHXB 3MHEA 2ML6A 1IQ8A 4FR9A 2F86B 3CME3 1JJ22 4XBYA 3LH4A 2HMJB 2WOHA
chains in the Genus database with same CATH topology
3DGLA 3RGRA 1U5OA 3N54B 4O3VA 2XFTA 2W9QA 1M1K4 2BMOB 2W56A 3Q2PA 1VQL3 2YFLB 1NWWA 4HM5B 5CF2A 4QWTA 2C10A 3O8YA 3EN1B 3LTBA 3Q90A 1QVF2 4FCZA 1K28A 3H3HA 2YFJB 3LTAA 1YIJ3 3TDGA 1N9EA 3UNLA 4HYZA 2C11A 4Q53A 1US1A 1K9M4 4G1MB 2OTJ3 4IIAA 1IQXA 2RGQA 8CHOA 3D3LA 1NB3I 1CQSA 3CC73 2BO9B 2Z6BA 1UI8A 3FG3A 5BXQA 1JN5A 4EC6A 3FF0A 5AIHA 4HM7B 2IUJA 1W02A 3LYGA 3VGNA 3NBBA 5BVBA 7STDA 1IK3A 3CXC2 1DYUA 1QALA 1DMQA 3HX8A 1IVWA 3T8NA 3K5TA 2FGTA 4R4KA 1AR0A 1CEWI 3F8XA 3LXUX 1L5GB 5IF6A 1W6GA 2HMNB 1OHSA 2KCDA 2R4IA 2CH9A 3EC9A 1VQP3 3F40A 3MG1A 4LEHA 1M1XB 3PCSA 1Z1SA 5FW5A 1VQ43 2OTL3 2YFIB 3Q1CA 4JF8A 3FG1A 4OK0A 4I4KA 3DGOA 5JBSA 2B24B 2JQ5A 2W2CA 4RNYA 4MJDA 1ULJB 3EX9A 3GZBA 4XDWA 1YI23 5LC7A 4GB5A 5IG0A 1VQ93 2P0XA 1N8R4 1J2BA 2B1XB 5DREA 1JV2B 4L7KA 2CFGA 1LNHA 2CWUA 3K7CA 1KQS2 3IPTA 2CWTA 3BNDA 5G2GA 1JKGB 4MMZB 1OGXA 4MEIA 4AKZA 4K61A 3KE7A 3OWYA 4EV2A 4HM8B 1OACA 1W01A 2L4VA 2P0MA 3HZPA 4KFEA 3QRDA 4RZMA 3FF2A 1IQYA 2OQEC 4K1UA 3S29A 1TP6A 3JUQA 4O8SA 1FA3A 2IMJA 1OHOA 4LGQA 2HMMB 2BMQB 2W6JH 1Q824 3NQYA 1JB4A 3ER7A 3GZRA 1AVKA 1GD4A 3NV0B 3CCE3 3DM8A 1W2B2 2CG0A 3KIIA 3NUVA 4TX4A 5LC6A 1WQLB 3GAXA 3SVAA 3CCR3 5AIIA 1GY6A 3KSPA 3T0UA 3WA3A 4HM6B 4CCVA 2P09A 2CG1A 5EVHA 3U97A 1UW1A 2E2VA 1IDPA 3LTCA 2CK3H 3BLZA 3LMLA 4K90B 4WYKA 1STFI 4HVNA 1VQ73 3BNCA 2XSOB 3NQZA 1S723 1VQ53 4RNZA 4GL6A 5STDA 2Z77A 2F98A 3CU3A 1RRLA 1O7HB 1OF5A 2CFDA 2IUKA 1VQN3 3DGMA 1CYUA 2GEYA 1E97A 1ROVA 2XGLA 2INXA 1STDA 1V74A 3WODG 3E99A 1M9GA 4R80A 4BTWA 3AMOB 3LT8A 1WNHA 3F8HA 1YJW3 3CCM3 2MC8A 1AV4A 2GU1A 3DXOA 3DUKA 1F8NA 1W00A 1OHPA 3EBTA 4HBRA 1O7PB 3VF1A 4OVMA 4WWUC 5JPPA 2PZVA 2W56B 3MSOA 4FMBA 1EKMA 1DVDA 3NXJA 3STDA 2P05A 3K0ZA 5IEOA 2XSHB 1VQK3 2I9WA 1JB2A 4LZIA 4L8PA 3LOYA 3NX0A 3PS8A 4STDA 3V99A 4HM0B 1O7GB 3DMCA 2W04A 3CPOA 2UX0A 1EA2A 3KKGA 3X3XA 2STDA 1QJGA 3CNMA 3JUNA 1A2KA 2CC3A 3BB9A 3CMA3 1WMNA 2BNGA 4N3VA 1JN5B 3IJEB 3F9SA 1HU9A 3A76A 2M7OA 2XR8B 3G16A 4PEJA 2E2TA 1PFPA 1OH0A 3GZXB 3S27A 5IW9A 2WGOA 1QAFA 1GYBA 2OQEA 3B4PA 3WMDA 1ZX2A 3M8CA 1ASKA 3G0KA 2QA43 4N6LA 5ELUA 4HM4B 2CHCA 5D82A 3SOYA 4EBGA 3FKAA 1S5AA 4U13A 1OPYA 3RGAA 2E2UA 3D9RA 2Q07A 1FGQA 4JRFA 3FZWA 1YHQ3 3CC43 2WOFA 3CD63 3JUMA 4O02B 3OV4A 3SX1A 3UL6A 1A67A 1SIIA 3PYJA 4ZM8A 5IG4A 2IA7A 1WMOA 4FMDA 3G713 1GS3A 1E3RA 4HM1B 1UUVB 4N6UA 3UB1A 1VQ63 2RSXA 3CCV3 1ISKA 1RN7A 4X2OA 3PXMA 2MF7A 3UL5A 3MG2A 3B4OA 3UJMA 1N5HA 4IPBA 5A0OB 1VQO3 3BNEA 5I97A 3HK4A 3OWUA 3OXAA 2QGUA 1LXEA 5AI1A 3CC23 2O3OA 3N9HA 1O7NB 5IERA 2CFWA 1N8QA 3U1WA 3HI7A 3WOEB 2JDIH 5AYSC 3H51A 3PZWA 3RDEA 2W0QA 2Y73A 1Q814 4LSOA 3MG3A 3KZTA 3L0RA 1HKXA 1JRQA 2XH9A 1SQWA 1D6ZA 4J9AA 1IT8A 1TUHA 2CKFB 3CPW2 3I553 5IG3A 1NDOB 3J7Yd 1YIT3 1FGTA 3X3YA 3FH1A 4WFOA 4K1VA 4WHAA 1SIHA 1YGEA 1KWIA 5D81A 2QIYA 5EEOA 1IV7A 2D42A 2WGQA 4R1KA 2CFKA 1RJOA 1TFOA 2XFSA 1EG9B 1TU5A 3NBJA 4N6TA 3LT9A 1Q40A 3HIIA 1W6YA 4XBXA 3CCJ3 1RKYA 1FGRA 3OW22 2CFLA 1A2VA 4IT7A 3HIGA 1D6YA 3SEDA 1FUWA 2FXTA 3CNXA 2W9PA 2V1LA 2XF3A 2K0MA 4WYKB 4BTYA 2O9UX 1BUQA 1IVXA 1DMMA 1OF5B 4N6NB 4KZ1A 5ELJA 1NJI4 3FG4A 6STDA 2CWVA 3EQQB 3G4S3 2ML5A 1UI7A 3LZAA 2KRTA 3EB8A 5TGNA 4XDVA 3EE1A 4FCJA 4MMXB 3JVCA 2HMKB 1G96A 2P38A 1TIJA 3X42A 3JUOA 2ZL8A 1AVLA 1C7HA 2Y74A 1DVCA 2LQVA 2XEPA 3GZYB 2RCDA 2KXGA 2Z7AA 1JNQA 3FSDA 1KSIA 2XRXB 4AKYA 5IEPA 3N8BA 1YVBI 3DY5A 1IV9A 3ALAA 1ROAA 1W7CA 4BTXA 2FNQA 5FGOA 5HGRA 3KFQC 4N6MA 1D6UA 4XBTA 5KP1A 2OOVA 1RRHA 1IU7A 1A90A 4KFFA 3NM2A 3V98A 1R4CA 2WO0A 4EXRA 1PU4A 1FGOA 1QMAA 3MPHA 4MMYB 5JPUA 1MOLA 4N6V0 3EHCA 1UUWB 4LMIA 3LTDA 4R9LA 3SXXA 1Q7Y4 1K8A4 5AEWB 1QAKA 3NHXA 3JUPA 4FCMA 1W5ZA 4EV5A 3S5CA 3MYTA 4HZ9B 3WOFB 3G6E3 2XGNA 1GY5A 3SOAA 3QK9A 1FGMA 1WTHA 1OCVA 2LYXA 5CF1A 1YJ93 2GBWB 3S67A 3NBRA 1WMPA 1Q864 4KVHA 3WA2X 2HMLB 4KFDA 3ROBA 3EN8A 2CW9A 2D1WA 2OWPA 1LOXA 1OGZA 5AIFA 1TFKA 2QEX3 1JB5A 3I0YA 4O2HA 5D83A 4CDLA 3CCU3 1M904 1NO3A 1N5PA 3S28A 1SPUA 2A15A 4HZBB 5AYRB 3G8ZA 3OX9A 1LVNA 3IMAB 3X41A 2K54A 4N6OB 2OOVC 1VQ83 1DMNA 2GBXB 4HM3B 4FMCA 3BNBA 1VZZA 3FLJA 5AEUB 4H3UA 3X3ZA 1W4NA 4NHFA 1JKGA 2YX9A 4WP5A 5IG5A 4H61A 1YJN3 3T8UA 3F7XA 3K63A 1O7WB 1GY7A 4XB5A 3I563 1K734 1KD14 2BMRB 3F7SA 3CCL3 3KSED 2BHMA 1IT7A 3EJVA 3B7CA 3EF8A 1KC84 4HJLB 5DRVA 1MNLA 2SBLA 4J8TA 4L8OA 3CCS3 3EBYA 5CLKA 4OUQA 1NB5I 1U8CB 3DGNA 1SJWA 1NU3A 1Y4KA 5EQLA 1E3VA 5KP3A 3VSYA 1ZO2A 3PGBA 4FMAA 2RFRA 1GD3A 3K9MC 2W03A 3MWZA 3GWRA 1VQM3 1W6CA 2ZDJA 3DZLA 3NV0A 3GRDA 3KN4A 1Q40B 3B8LA 1K41A 3OWSA 2HMOB 4HM2B 4X2HA 1OUNA 3SLUA 1T5YA 4EYCA 5KP4A 3FCSB 5AIGA 4XM4A 3WDGB 2GU3A 2OCTA 2PNCA 3CCQ3 5CXOA 2BT3A 2GXFA 3F14A 3X40A 1IVVA 1Q42A 4HKVB 3MKIA 3PCRA 3ECFA 3FGYA 5CK6A 4R9KA 1N9JA 2F99A 1IVUA 1CYVA 1O7MB 4AEQA 1EQKA 2CIUA 1QVG2 3V92A 3NM7A 4RBNA 3AMOA 1ULIB 1W2ZA 5IENA 2GEXA 2Z76A 4NREA 4ORLA 3MHEA 2ML6A 1IQ8A 4FR9A 2F86B 3CME3 1JJ22 4XBYA 3LH4A 2HMJB 2WOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RGR A;  1U5O A;  2BMO B;  2YFL B;  1NWW A;  4HM5 B;  5CF2 A;  3EN1 B;  3Q90 A;  3H3H A;  2YFJ B;  3UNL A;  4Q53 A;  4IIA A;  2RGQ A;  8CHO A;  1CQS A;  5BXQ A;  1JN5 A;  3FF0 A;  5AIH A;  3VGN A;  1W02 A;  3LYG A;  7STD A;  5BVB A;  1DMQ A;  3HX8 A;  3T8N A;  1AR0 A;  3F8X A;  5IF6 A;  2HMN B;  1OHS A;  2R4I A;  3EC9 A;  3F40 A;  3MG1 A;  4LEH A;  5FW5 A;  1Z1S A;  2YFI B;  4I4K A;  2B24 B;  2JQ5 A;  2W2C A;  4MJD A;  1ULJ B;  3EX9 A;  4XDW A;  3GZB A;  4GB5 A;  5IG0 A;  2B1X B;  5DRE A;  4L7K A;  3K7C A;  3IPT A;  5G2G A;  1JKG B;  1OGX A;  3KE7 A;  4HM8 B;  1W01 A;  3HZP A;  4RZM A;  3FF2 A;  4K1U A;  1TP6 A;  3JUQ A;  2IMJ A;  1OHO A;  4LGQ A;  2HMM B;  2BMQ B;  1JB4 A;  3ER7 A;  3GZR A;  3NV0 B;  3DM8 A;  3NUV A;  1WQL B;  5AII A;  1GY6 A;  3KSP A;  4HM6 B;  5EVH A;  1IDP A;  4WYK A;  3BLZ A;  4HVN A;  2XSO B;  5STD A;  2Z77 A;  2F98 A;  3CU3 A;  1O7H B;  1OF5 A;  2GEY A;  1E97 A;  2INX A;  1STD A;  3E99 A;  3F8H A;  3DXO A;  3DUK A;  1W00 A;  1OHP A;  3EBT A;  1O7P B;  4OVM A;  4WWU C;  5JPP A;  2PZV A;  3MSO A;  3NXJ A;  3STD A;  3K0Z A;  5IEO A;  2XSH B;  2I9W A;  1JB2 A;  4L8P A;  4STD A;  4HM0 B;  1O7G B;  3DMC A;  3CPO A;  2UX0 A;  1EA2 A;  3KKG A;  2STD A;  1QJG A;  3CNM A;  3JUN A;  1A2K A;  3BB9 A;  2BNG A;  4N3V A;  1JN5 B;  3F9S A;  3A76 A;  2XR8 B;  3G16 A;  4PEJ A;  1OH0 A;  3GZX B;  1GYB A;  3B4P A;  3WMD A;  1ZX2 A;  3M8C A;  1ASK A;  3G0K A;  4HM4 B;  2CHC A;  5D82 A;  3SOY A;  3FKA A;  1S5A A;  4U13 A;  1OPY A;  3RGA A;  3D9R A;  3FZW A;  3JUM A;  3OV4 A;  5IG4 A;  1GS3 A;  1E3R A;  4HM1 B;  1UUV B;  1ISK A;  4X2O A;  3MG2 A;  3B4O A;  3UJM A;  3HK4 A;  3OWU A;  3OXA A;  2QGU A;  5AI1 A;  5IER A;  1O7N B;  3H51 A;  3MG3 A;  3KZT A;  1HKX A;  4J9A A;  1TUH A;  2CKF B;  5IG3 A;  1NDO B;  3FH1 A;  4K1V A;  5D81 A;  2QIY A;  4R1K A;  1EG9 B;  1Q40 A;  1W6Y A;  4XBX A;  3SED A;  3CNX A;  4WYK B;  1BUQ A;  1DMM A;  1OF5 B;  6STD A;  3EQQ B;  3LZA A;  5TGN A;  4XDV A;  4FCJ A;  2HMK B;  3JUO A;  1C7H A;  3GZY B;  2RCD A;  2Z7A A;  3FSD A;  5IEP A;  2XRX B;  5HGR A;  4XBT A;  5KP1 A;  3NM2 A;  1QMA A;  5JPU A;  3EHC A;  1UUW B;  4LMI A;  4R9L A;  5AEW B;  3NHX A;  4FCM A;  3JUP A;  3S5C A;  3MYT A;  4HZ9 B;  1GY5 A;  3SOA A;  1OCV A;  5CF1 A;  2GBW B;  3NBR A;  4KVH A;  2HMJ B;  2HML B;  3ROB A;  3EN8 A;  2OWP A;  1OGZ A;  5AIF A;  1JB5 A;  3I0Y A;  5D83 A;  4CDL A;  2A15 A;  4HZB B;  3G8Z A;  3OX9 A;  2K54 A;  1DMN A;  2GBX B;  4HM3 B;  1VZZ A;  3FLJ A;  5AEU B;  4H3U A;  1JKG A;  4WP5 A;  5IG5 A;  3T8U A;  3F7X A;  1O7W B;  1GY7 A;  4XB5 A;  2BMR B;  3F7S A;  3EJV A;  3B7C A;  3EF8 A;  4HJL B;  5DRV A;  4J8T A;  4L8O A;  3EBY A;  5CLK A;  4OUQ A;  1SJW A;  1NU3 A;  1E3V A;  5KP3 A;  3VSY A;  1ZO2 A;  2RFR A;  3GWR A;  3DZL A;  3NV0 A;  3GRD A;  1Q40 B;  3B8L A;  1K41 A;  3OWS A;  2HMO B;  4HM2 B;  4X2H A;  1OUN A;  5KP4 A;  5AIG A;  4XM4 A;  5CXO A;  2GXF A;  3F14 A;  1Q42 A;  4HKV B;  3MKI A;  3ECF A;  3FGY A;  5CK6 A;  4R9K A;  2F99 A;  1O7M B;  1ULI B;  5IEN A;  2GEX A;  2Z76 A;  4ORL A;  3MHE A;  2F86 B;  4XBY A;  4HM7 B;  3OWY A; 
#chains in the Genus database with same CATH topology
 3DGL A;  3RGR A;  1U5O A;  3N54 B;  4O3V A;  2XFT A;  2W9Q A;  1M1K 4;  2BMO B;  2W56 A;  1RHL A;  3Q2P A;  3AHS A;  1VQL 3;  1X1U A;  2YFL B;  1NWW A;  4HM5 B;  5CF2 A;  4QWT A;  2C10 A;  3O8Y A;  3EN1 B;  3LTB A;  3Q90 A;  1QVF 2;  2IYJ A;  3A5E A;  4FCZ A;  1B27 A;  2UUG C;  1K28 A;  3H3H A;  2YFJ B;  3LTA A;  1YIJ 3;  3TDG A;  1N9E A;  3UNL A;  4HYZ A;  2C11 A;  4Q53 A;  1US1 A;  8RNT A;  1K9M 4;  1BAO A;  1BNS A;  4NPB A;  4G1M B;  2OTJ 3;  1TRP A;  5G1L A;  4IIA A;  1IQX A;  2RGQ A;  1BRK A;  8CHO A;  3BIR A;  2KF5 A;  3D3L A;  1NB3 I;  3SYU A;  1CQS A;  1JZO A;  1PY3 A;  3CC7 3;  2BO9 B;  2Z6B A;  1UI8 A;  1RGA A;  3FG3 A;  5BXQ A;  1JN5 A;  4EC6 A;  3FF0 A;  1PYL A;  5AIH A;  2CX1 A;  4HM7 B;  2IUJ A;  1BSA A;  1W02 A;  3LYG A;  3NBB A;  3VGN A;  5BVB A;  7STD A;  4HOH A;  1DYU A;  1QAL A;  3CXC 2;  3D5G A;  1DMQ A;  1UCL A;  3HX8 A;  5HOH A;  1IVW A;  3T8N A;  3K5T A;  2FGT A;  4R4K A;  1AR0 A;  1CEW I;  3F8X A;  1BOX A;  1I2G A;  3LXU X;  1I8V A;  1W6G A;  2HMN B;  1OHS A;  2KCD A;  1L5G B;  2R4I A;  2CH9 A;  3EC9 A;  1Q9E A;  1T3B A;  1Q7H A;  3F40 A;  1VQP 3;  3MG1 A;  4LEH A;  1M1X B;  3PCS A;  1Z1S A;  5FW5 A;  1VQ4 3;  2OTL 3;  2YFI B;  1LOW A;  3Q1C A;  4JF8 A;  5M19 A;  2H0H A;  3FG1 A;  4OK0 A;  4I4K A;  3DGO A;  5JBS A;  2B24 B;  2JQ5 A;  2W2C A;  4RNY A;  4MJD A;  1ULJ B;  3EX9 A;  1B2U A;  3GZB A;  4XDW A;  1YI2 3;  5LC7 A;  1JBT A;  4GB5 A;  5IG0 A;  1VQ9 3;  2P0X A;  1N8R 4;  1J2B A;  2B1X B;  5DRE A;  1JV2 B;  4L7K A;  2CFG A;  1LNH A;  2CWU A;  3K7C A;  1KQS 2;  3IPT A;  2CWT A;  3BND A;  5G2G A;  1JKG B;  4MMZ B;  5BU4 A;  1OGX A;  1RMS A;  4MEI A;  1RGG A;  2KAA A;  4AKZ A;  4K61 A;  4GSP A;  3KE7 A;  2SAR A;  1BNI A;  3OWY A;  4EV2 A;  4HM8 B;  2CX0 A;  1OAC A;  1W01 A;  1BNJ A;  2L4V A;  2P0M A;  1JBR A;  3HZP A;  4KFE A;  3QRD A;  4RZM A;  3FF2 A;  1IQY A;  1EUI C;  1BGS A;  1UDI I;  1JZD A;  2OQE C;  4K1U A;  3S29 A;  1TP6 A;  3JUQ A;  4O8S A;  1RDS A;  1RNB A;  1FA3 A;  2IMJ A;  1OHO A;  2AAD A;  4J5K A;  4LGQ A;  2HMM B;  2BMQ B;  2W6J H;  1Q82 4;  3NQY A;  1JB4 A;  3ER7 A;  3GZR A;  1AVK A;  1FW7 A;  1GD4 A;  3NV0 B;  5G1K A;  3GSP A;  3DM8 A;  3CCE 3;  1W2B 2;  2CG0 A;  3KII A;  3NUV A;  4TX4 A;  1FUT A;  5LC6 A;  1WQL B;  3GAX A;  3SVA A;  3CCR 3;  5AII A;  1GY6 A;  1UCJ A;  3KSP A;  3T0U A;  3WA3 A;  4HM6 B;  4CCV A;  2P09 A;  2CG1 A;  1YNV X;  1GOV A;  1I2E A;  5EVH A;  1BRI A;  3U97 A;  1UW1 A;  2KF3 A;  2E2V A;  1IDP A;  3LTC A;  2CK3 H;  2K3D A;  3BLZ A;  3LML A;  4K90 B;  1STF I;  4HVN A;  4WYK A;  3BNC A;  2XSO B;  3NQZ A;  1VQ7 3;  1S72 3;  1VQ5 3;  4RNZ A;  4GL6 A;  5STD A;  2Z77 A;  4DKI A;  2F98 A;  3CU3 A;  1RRL A;  1O7H B;  4I5Q A;  1OF5 A;  2CFD A;  2IUK A;  1VQN 3;  3DGM A;  1CYU A;  2GEY A;  1E97 A;  1ROV A;  2XGL A;  2ZA4 A;  2INX A;  1STD A;  1GMR A;  1V74 A;  3WOD G;  1JBS A;  3E99 A;  1M9G A;  4R80 A;  4HAA A;  3ZFZ A;  3AMO B;  4BTW A;  3LT8 A;  1WNH A;  3D79 A;  3F8H A;  1YJW 3;  1RN4 A;  3CCM 3;  2MC8 A;  1AV4 A;  2L1S A;  4RNT A;  1I2F A;  2GU1 A;  3DXO A;  1BU4 A;  3DUK A;  1F8N A;  1W00 A;  1OHP A;  2BU4 A;  3EBT A;  4HBR A;  1O7P B;  3VF1 A;  4OVM A;  4WWU C;  5JPP A;  2PZV A;  2W56 B;  3MSO A;  4FMB A;  1EKM A;  1DVD A;  3NXJ A;  3STD A;  1G02 A;  2P05 A;  3K0Z A;  3D5I A;  5IEO A;  2XSH B;  2J8X B;  1VQK 3;  1DE3 A;  1BSB A;  2I9W A;  1JB2 A;  4LZI A;  4L8P A;  3LOY A;  3NX0 A;  3PS8 A;  4STD A;  1LRA A;  1UGH I;  4HM0 B;  3V99 A;  1O7G B;  1RGC A;  3ZG0 A;  3DMC A;  2W04 A;  3CPO A;  2UX0 A;  2BIR A;  1EA2 A;  3AHW A;  3KKG A;  3X3X A;  2STD A;  1QJG A;  3CNM A;  3JUN A;  1A2K A;  2CC3 A;  3BB9 A;  3CMA 3;  1WMN A;  2BNG A;  4N3V A;  1JN5 B;  3IJE B;  3F9S A;  1HU9 A;  2H0I A;  2M7O A;  3A76 A;  2XR8 B;  1LQM B;  3G16 A;  4PEJ A;  2E2T A;  1PFP A;  1OH0 A;  3GZX B;  3S27 A;  5IW9 A;  3WR2 A;  2WGO A;  1QAF A;  1BNG A;  1GYB A;  1GMP A;  1T2I A;  3B4P A;  2OQE A;  3WMD A;  4BL2 A;  1ZX2 A;  3M8C A;  1ASK A;  3G0K A;  2QA4 3;  4N6L A;  1RCL A;  4GHO A;  5ELU A;  1MGR A;  1DET A;  1UCK A;  1X1X A;  1GOY A;  4HM4 B;  2CHC A;  5D82 A;  3SOY A;  4EBG A;  3FKA A;  1S5A A;  4U13 A;  1B2Z A;  1OPY A;  2E2U A;  3D9R A;  2Q07 A;  1FGQ A;  4JRF A;  3FZW A;  3RGA A;  2H0G A;  1BVI A;  1YHQ 3;  3CC4 3;  2WOF A;  1IK3 A;  3CD6 3;  3JUM A;  4O02 B;  1R4Y A;  3OV4 A;  3SX1 A;  3UL6 A;  1A67 A;  1SII A;  3PYJ A;  4ZM8 A;  5IG4 A;  2IA7 A;  1WMO A;  4FMD A;  3G71 3;  1BSC A;  1GS3 A;  1E3R A;  4HM1 B;  1UUV B;  4N6U A;  3UB1 A;  5GSP A;  1VQ6 3;  2RSX A;  3CCV 3;  1ISK A;  1B3S A;  1RN7 A;  3PXM A;  4X2O A;  2MF7 A;  3UL5 A;  3MG2 A;  3B4O A;  3UJM A;  1N5H A;  4IPB A;  5A0O B;  1VQO 3;  1RNT A;  3BNE A;  5I97 A;  3HK4 A;  3OWU A;  3OXA A;  3RNT A;  1ZGX A;  2QGU A;  4CPK A;  1LXE A;  1T2H A;  1UCI A;  5AI1 A;  3CC2 3;  1MWT A;  1TTO A;  2O3O A;  3N9H A;  1O7N B;  2HOH A;  5IER A;  1YGW A;  2CFW A;  1N8Q A;  3U1W A;  3HI7 A;  3WOE B;  2JDI H;  5AYS C;  3H51 A;  3PZW A;  1LOY A;  3RDE A;  2W0Q A;  2Y73 A;  1Q81 4;  4LSO A;  1C54 A;  3MG3 A;  5M1A A;  3KZT A;  3L0R A;  1HKX A;  1JRQ A;  2UGI A;  2XH9 A;  1B2M A;  1SQW A;  1D6Z A;  4J9A A;  1IT8 A;  1TUH A;  2CKF B;  3CPW 2;  2RNT A;  3I55 3;  7GSP A;  5IG3 A;  1NDO B;  3J7Y d;  1GSP A;  1FYS A;  1YIT 3;  1FGT A;  3X3Y A;  1RGK A;  3BU4 A;  3FH1 A;  4WFO A;  4K1V A;  4WHA A;  1UGI A;  1SIH A;  1YGE A;  1BNE A;  1UUG B;  1KWI A;  2C4B A;  5D81 A;  2QIY A;  5EEO A;  1IV7 A;  2D42 A;  2WGQ A;  4R1K A;  2CFK A;  1RJO A;  1TFO A;  2XFS A;  1EG9 B;  1TU5 A;  3NBJ A;  4N6T A;  1BRN L;  3LT9 A;  1Q40 A;  3HII A;  1W6Y A;  1YVS A;  4XBX A;  3CCJ 3;  1RKY A;  1FGR A;  3OW2 2;  1A2P A;  2CFL A;  2KF4 A;  1A2V A;  4IT7 A;  3HIG A;  1D6Y A;  3SED A;  1FUW A;  1RLS A;  2FXT A;  2W9P A;  3CNX A;  2F56 A;  1HYF A;  2V1L A;  2XF3 A;  2K0M A;  4WYK B;  4BTY A;  1X1Y A;  2O9U X;  1BUQ A;  1IVX A;  1B20 A;  1DMM A;  4BL3 A;  4J5G A;  1OF5 B;  4N6N B;  4KZ1 A;  5ELJ A;  3URP A;  1MGW A;  1NJI 4;  3FG4 A;  6STD A;  2CWV A;  2IY2 A;  3ZG5 A;  1I0X A;  3EQQ B;  3G4S 3;  2ML5 A;  4CJN A;  1UI7 A;  3LZA A;  1FUS A;  2KRT A;  3EB8 A;  3KCH A;  5TGN A;  4XDV A;  3EE1 A;  4FCJ A;  4MMX B;  3JVC A;  2HMK B;  1G96 A;  2P38 A;  1TIJ A;  1BRG A;  3X42 A;  3JUO A;  2ZL8 A;  1AVL A;  1C7H A;  2Y74 A;  1DVC A;  2LQV A;  2XEP A;  4ILF A;  3GZY B;  2RCD A;  2KXG A;  2Z7A A;  1JNQ A;  3FSD A;  1KSI A;  2XRX B;  4AKY A;  5IEP A;  3N8B A;  1YVB I;  3DY5 A;  1RN1 A;  3DH2 A;  1B2X A;  9RNT A;  1IV9 A;  3ALA A;  1ROA A;  2KF6 A;  1W7C A;  2AAE A;  4BTX A;  2FNQ A;  1RCK A;  5FGO A;  1BRS A;  5HGR A;  3KFQ C;  4N6M A;  1D6U A;  4XBT A;  1IYY A;  5KP1 A;  5RNT A;  2OOV A;  1RRH A;  2F5W A;  1IU7 A;  1A90 A;  4KFF A;  1G0T A;  3NM2 A;  1MWU A;  1R4C A;  3V98 A;  2WO0 A;  4EXR A;  1BNF A;  1PU4 A;  1FGO A;  1QMA A;  3MPH A;  4MMY B;  5JPU A;  1MOL A;  3AGN A;  3D4A A;  3EHC A;  4N6V 0;  1UUW B;  4LMI A;  3LTD A;  4R9L A;  1RGF A;  1X1W A;  3SXX A;  4BIR A;  1Q7Y 4;  1K8A 4;  5AEW B;  1EEJ A;  1QAK A;  3NHX A;  3JUP A;  4FCM A;  1W5Z A;  1B2S A;  3S5C A;  4EV5 A;  3MYT A;  1BSE A;  4HZ9 B;  3WOF B;  2F4Y A;  3G6E 3;  1B21 A;  2XGN A;  1GY5 A;  3SOA A;  3QK9 A;  1FGM A;  1WTH A;  4LYL B;  1OCV A;  1RGL A;  2LYX A;  3WHO A;  5CF1 A;  2GBW B;  3S67 A;  1YJ9 3;  3NBR A;  1WMP A;  1I70 A;  4KVH A;  1Q86 4;  3WA2 X;  1BRH A;  2HML B;  4KFD A;  3ROB A;  3EN8 A;  2CW9 A;  1CH0 A;  2D1W A;  1RGH A;  2OWP A;  1BUJ A;  1LOX A;  1OGZ A;  5AIF A;  1TFK A;  1TRQ A;  1SAR A;  2QEX 3;  1JB5 A;  3I0Y A;  4O2H A;  5D83 A;  2GSP A;  4CDL A;  6RNT A;  3CCU 3;  1M90 4;  1NO3 A;  1ZS7 A;  1N5P A;  3S28 A;  1SPU A;  2A15 A;  4HZB B;  5AYR B;  3G8Z A;  3OX9 A;  1LVN A;  3IMA B;  3X41 A;  2K54 A;  4N6O B;  5BIR A;  1LNI A;  2OOV C;  1VQ8 3;  1DMN A;  1V57 A;  1BNR A;  2GBX B;  1RTU A;  4FMC A;  4HM3 B;  3BNB A;  1GMQ A;  1VZZ A;  1I3F A;  3FLJ A;  1RSN A;  5AEU B;  4H3U A;  3X3Z A;  3AGO A;  1AQZ A;  1W4N A;  4NHF A;  1JKG A;  2YX9 A;  4WP5 A;  1V58 A;  4H61 A;  5IG5 A;  1YJN 3;  3T8U A;  3F7X A;  3K63 A;  1O7W B;  1GY7 A;  2F5M A;  4XB5 A;  3I56 3;  1K73 4;  1LQG C;  2BMR B;  3F7S A;  1KD1 4;  3CCL 3;  1BSD A;  1LOV A;  3KSE D;  2BHM A;  1IT7 A;  3EJV A;  6GSP A;  7RNT A;  3B7C A;  1BRJ A;  3EF8 A;  1KC8 4;  1MWR A;  4HJL B;  1MNL A;  2SBL A;  5DRV A;  4J8T A;  4L8O A;  3CCS 3;  3EBY A;  5CLK A;  1I0V A;  4OUQ A;  1NB5 I;  4KT3 B;  1U8C B;  3DGN A;  1SJW A;  1NU3 A;  1Y4K A;  5EQL A;  1BIR A;  1E3V A;  5KP3 A;  3VSY A;  1ZO2 A;  5IF6 A;  1I3I A;  3PGB A;  2RFR A;  4FMA A;  1GD3 A;  2R41 A;  3K9M C;  2W03 A;  3MWZ A;  1FZU A;  3GWR A;  1VQM 3;  1W6C A;  2ZDJ A;  3DZL A;  3NV0 A;  3GRD A;  3KN4 A;  1Q40 B;  4EW5 A;  3B8L A;  1K41 A;  3OWS A;  2HMO B;  4HM2 B;  4BU4 A;  4X2H A;  1OUN A;  3SLU A;  3HOH A;  3Q3F A;  1GOU A;  1T5Y A;  1AY7 A;  4EYC A;  3FCS B;  5AIG A;  5KP4 A;  4XM4 A;  3WDG B;  2RBI A;  2GU3 A;  1NNV A;  2OCT A;  2PNC A;  3CCQ 3;  1RGE A;  5M18 A;  1HZ1 A;  2BT3 A;  5CXO A;  2GXF A;  3F14 A;  3X40 A;  1IVV A;  1MWS A;  1Q42 A;  1VQQ A;  4HKV B;  3MKI A;  3PCR A;  3ECF A;  3FGY A;  5CK6 A;  4R9K A;  1N9J A;  2F99 A;  1IVU A;  1CYV A;  1O7M B;  4AEQ A;  1EQK A;  2CIU A;  3DGY A;  1QVG 2;  1TJD A;  3V92 A;  3NM7 A;  4RBN A;  3AMO A;  1ULI B;  1W2Z A;  5IEN A;  2GEX A;  2Z76 A;  4NRE A;  4ORL A;  1BAN A;  2ZHX B;  3MHE A;  2ML6 A;  1IQ8 A;  4FR9 A;  2F86 B;  3CME 3;  1JJ2 2;  4XBY A;  3LH4 A;  2HMJ B;  2WOH A; 
#chains in the Genus database with same CATH homology
 3DGL A;  3RGR A;  1U5O A;  3N54 B;  4O3V A;  2XFT A;  2W9Q A;  1M1K 4;  2BMO B;  2W56 A;  3Q2P A;  1VQL 3;  2YFL B;  1NWW A;  4HM5 B;  5CF2 A;  4QWT A;  2C10 A;  3O8Y A;  3EN1 B;  3LTB A;  3Q90 A;  1QVF 2;  4FCZ A;  1K28 A;  3H3H A;  2YFJ B;  3LTA A;  1YIJ 3;  3TDG A;  1N9E A;  3UNL A;  4HYZ A;  2C11 A;  4Q53 A;  1US1 A;  1K9M 4;  4G1M B;  2OTJ 3;  4IIA A;  1IQX A;  2RGQ A;  8CHO A;  3D3L A;  1NB3 I;  1CQS A;  3CC7 3;  2BO9 B;  2Z6B A;  1UI8 A;  3FG3 A;  5BXQ A;  1JN5 A;  4EC6 A;  3FF0 A;  5AIH A;  4HM7 B;  2IUJ A;  1W02 A;  3LYG A;  3VGN A;  3NBB A;  5BVB A;  7STD A;  1IK3 A;  3CXC 2;  1DYU A;  1QAL A;  1DMQ A;  3HX8 A;  1IVW A;  3T8N A;  3K5T A;  2FGT A;  4R4K A;  1AR0 A;  1CEW I;  3F8X A;  3LXU X;  1L5G B;  5IF6 A;  1W6G A;  2HMN B;  1OHS A;  2KCD A;  2R4I A;  2CH9 A;  3EC9 A;  1VQP 3;  3F40 A;  3MG1 A;  4LEH A;  1M1X B;  3PCS A;  1Z1S A;  5FW5 A;  1VQ4 3;  2OTL 3;  2YFI B;  3Q1C A;  4JF8 A;  3FG1 A;  4OK0 A;  4I4K A;  3DGO A;  5JBS A;  2B24 B;  2JQ5 A;  2W2C A;  4RNY A;  4MJD A;  1ULJ B;  3EX9 A;  3GZB A;  4XDW A;  1YI2 3;  5LC7 A;  4GB5 A;  5IG0 A;  1VQ9 3;  2P0X A;  1N8R 4;  1J2B A;  2B1X B;  5DRE A;  1JV2 B;  4L7K A;  2CFG A;  1LNH A;  2CWU A;  3K7C A;  1KQS 2;  3IPT A;  2CWT A;  3BND A;  5G2G A;  1JKG B;  4MMZ B;  1OGX A;  4MEI A;  4AKZ A;  4K61 A;  3KE7 A;  3OWY A;  4EV2 A;  4HM8 B;  1OAC A;  1W01 A;  2L4V A;  2P0M A;  3HZP A;  4KFE A;  3QRD A;  4RZM A;  3FF2 A;  1IQY A;  2OQE C;  4K1U A;  3S29 A;  1TP6 A;  3JUQ A;  4O8S A;  1FA3 A;  2IMJ A;  1OHO A;  4LGQ A;  2HMM B;  2BMQ B;  2W6J H;  1Q82 4;  3NQY A;  1JB4 A;  3ER7 A;  3GZR A;  1AVK A;  1GD4 A;  3NV0 B;  3CCE 3;  3DM8 A;  1W2B 2;  2CG0 A;  3KII A;  3NUV A;  4TX4 A;  5LC6 A;  1WQL B;  3GAX A;  3SVA A;  3CCR 3;  5AII A;  1GY6 A;  3KSP A;  3T0U A;  3WA3 A;  4HM6 B;  4CCV A;  2P09 A;  2CG1 A;  5EVH A;  3U97 A;  1UW1 A;  2E2V A;  1IDP A;  3LTC A;  2CK3 H;  3BLZ A;  3LML A;  4K90 B;  4WYK A;  1STF I;  4HVN A;  1VQ7 3;  3BNC A;  2XSO B;  3NQZ A;  1S72 3;  1VQ5 3;  4RNZ A;  4GL6 A;  5STD A;  2Z77 A;  2F98 A;  3CU3 A;  1RRL A;  1O7H B;  1OF5 A;  2CFD A;  2IUK A;  1VQN 3;  3DGM A;  1CYU A;  2GEY A;  1E97 A;  1ROV A;  2XGL A;  2INX A;  1STD A;  1V74 A;  3WOD G;  3E99 A;  1M9G A;  4R80 A;  4BTW A;  3AMO B;  3LT8 A;  1WNH A;  3F8H A;  1YJW 3;  3CCM 3;  2MC8 A;  1AV4 A;  2GU1 A;  3DXO A;  3DUK A;  1F8N A;  1W00 A;  1OHP A;  3EBT A;  4HBR A;  1O7P B;  3VF1 A;  4OVM A;  4WWU C;  5JPP A;  2PZV A;  2W56 B;  3MSO A;  4FMB A;  1EKM A;  1DVD A;  3NXJ A;  3STD A;  2P05 A;  3K0Z A;  5IEO A;  2XSH B;  1VQK 3;  2I9W A;  1JB2 A;  4LZI A;  4L8P A;  3LOY A;  3NX0 A;  3PS8 A;  4STD A;  3V99 A;  4HM0 B;  1O7G B;  3DMC A;  2W04 A;  3CPO A;  2UX0 A;  1EA2 A;  3KKG A;  3X3X A;  2STD A;  1QJG A;  3CNM A;  3JUN A;  1A2K A;  2CC3 A;  3BB9 A;  3CMA 3;  1WMN A;  2BNG A;  4N3V A;  1JN5 B;  3IJE B;  3F9S A;  1HU9 A;  3A76 A;  2M7O A;  2XR8 B;  3G16 A;  4PEJ A;  2E2T A;  1PFP A;  1OH0 A;  3GZX B;  3S27 A;  5IW9 A;  2WGO A;  1QAF A;  1GYB A;  2OQE A;  3B4P A;  3WMD A;  1ZX2 A;  3M8C A;  1ASK A;  3G0K A;  2QA4 3;  4N6L A;  5ELU A;  4HM4 B;  2CHC A;  5D82 A;  3SOY A;  4EBG A;  3FKA A;  1S5A A;  4U13 A;  1OPY A;  3RGA A;  2E2U A;  3D9R A;  2Q07 A;  1FGQ A;  4JRF A;  3FZW A;  1YHQ 3;  3CC4 3;  2WOF A;  3CD6 3;  3JUM A;  4O02 B;  3OV4 A;  3SX1 A;  3UL6 A;  1A67 A;  1SII A;  3PYJ A;  4ZM8 A;  5IG4 A;  2IA7 A;  1WMO A;  4FMD A;  3G71 3;  1GS3 A;  1E3R A;  4HM1 B;  1UUV B;  4N6U A;  3UB1 A;  1VQ6 3;  2RSX A;  3CCV 3;  1ISK A;  1RN7 A;  4X2O A;  3PXM A;  2MF7 A;  3UL5 A;  3MG2 A;  3B4O A;  3UJM A;  1N5H A;  4IPB A;  5A0O B;  1VQO 3;  3BNE A;  5I97 A;  3HK4 A;  3OWU A;  3OXA A;  2QGU A;  1LXE A;  5AI1 A;  3CC2 3;  2O3O A;  3N9H A;  1O7N B;  5IER A;  2CFW A;  1N8Q A;  3U1W A;  3HI7 A;  3WOE B;  2JDI H;  5AYS C;  3H51 A;  3PZW A;  3RDE A;  2W0Q A;  2Y73 A;  1Q81 4;  4LSO A;  3MG3 A;  3KZT A;  3L0R A;  1HKX A;  1JRQ A;  2XH9 A;  1SQW A;  1D6Z A;  4J9A A;  1IT8 A;  1TUH A;  2CKF B;  3CPW 2;  3I55 3;  5IG3 A;  1NDO B;  3J7Y d;  1YIT 3;  1FGT A;  3X3Y A;  3FH1 A;  4WFO A;  4K1V A;  4WHA A;  1SIH A;  1YGE A;  1KWI A;  5D81 A;  2QIY A;  5EEO A;  1IV7 A;  2D42 A;  2WGQ A;  4R1K A;  2CFK A;  1RJO A;  1TFO A;  2XFS A;  1EG9 B;  1TU5 A;  3NBJ A;  4N6T A;  3LT9 A;  1Q40 A;  3HII A;  1W6Y A;  4XBX A;  3CCJ 3;  1RKY A;  1FGR A;  3OW2 2;  2CFL A;  1A2V A;  4IT7 A;  3HIG A;  1D6Y A;  3SED A;  1FUW A;  2FXT A;  3CNX A;  2W9P A;  2V1L A;  2XF3 A;  2K0M A;  4WYK B;  4BTY A;  2O9U X;  1BUQ A;  1IVX A;  1DMM A;  1OF5 B;  4N6N B;  4KZ1 A;  5ELJ A;  1NJI 4;  3FG4 A;  6STD A;  2CWV A;  3EQQ B;  3G4S 3;  2ML5 A;  1UI7 A;  3LZA A;  2KRT A;  3EB8 A;  5TGN A;  4XDV A;  3EE1 A;  4FCJ A;  4MMX B;  3JVC A;  2HMK B;  1G96 A;  2P38 A;  1TIJ A;  3X42 A;  3JUO A;  2ZL8 A;  1AVL A;  1C7H A;  2Y74 A;  1DVC A;  2LQV A;  2XEP A;  3GZY B;  2RCD A;  2KXG A;  2Z7A A;  1JNQ A;  3FSD A;  1KSI A;  2XRX B;  4AKY A;  5IEP A;  3N8B A;  1YVB I;  3DY5 A;  1IV9 A;  3ALA A;  1ROA A;  1W7C A;  4BTX A;  2FNQ A;  5FGO A;  5HGR A;  3KFQ C;  4N6M A;  1D6U A;  4XBT A;  5KP1 A;  2OOV A;  1RRH A;  1IU7 A;  1A90 A;  4KFF A;  3NM2 A;  3V98 A;  1R4C A;  2WO0 A;  4EXR A;  1PU4 A;  1FGO A;  1QMA A;  3MPH A;  4MMY B;  5JPU A;  1MOL A;  4N6V 0;  3EHC A;  1UUW B;  4LMI A;  3LTD A;  4R9L A;  3SXX A;  1Q7Y 4;  1K8A 4;  5AEW B;  1QAK A;  3NHX A;  3JUP A;  4FCM A;  1W5Z A;  4EV5 A;  3S5C A;  3MYT A;  4HZ9 B;  3WOF B;  3G6E 3;  2XGN A;  1GY5 A;  3SOA A;  3QK9 A;  1FGM A;  1WTH A;  1OCV A;  2LYX A;  5CF1 A;  1YJ9 3;  2GBW B;  3S67 A;  3NBR A;  1WMP A;  1Q86 4;  4KVH A;  3WA2 X;  2HML B;  4KFD A;  3ROB A;  3EN8 A;  2CW9 A;  2D1W A;  2OWP A;  1LOX A;  1OGZ A;  5AIF A;  1TFK A;  2QEX 3;  1JB5 A;  3I0Y A;  4O2H A;  5D83 A;  4CDL A;  3CCU 3;  1M90 4;  1NO3 A;  1N5P A;  3S28 A;  1SPU A;  2A15 A;  4HZB B;  5AYR B;  3G8Z A;  3OX9 A;  1LVN A;  3IMA B;  3X41 A;  2K54 A;  4N6O B;  2OOV C;  1VQ8 3;  1DMN A;  2GBX B;  4HM3 B;  4FMC A;  3BNB A;  1VZZ A;  3FLJ A;  5AEU B;  4H3U A;  3X3Z A;  1W4N A;  4NHF A;  1JKG A;  2YX9 A;  4WP5 A;  5IG5 A;  4H61 A;  1YJN 3;  3T8U A;  3F7X A;  3K63 A;  1O7W B;  1GY7 A;  4XB5 A;  3I56 3;  1K73 4;  1KD1 4;  2BMR B;  3F7S A;  3CCL 3;  3KSE D;  2BHM A;  1IT7 A;  3EJV A;  3B7C A;  3EF8 A;  1KC8 4;  4HJL B;  5DRV A;  1MNL A;  2SBL A;  4J8T A;  4L8O A;  3CCS 3;  3EBY A;  5CLK A;  4OUQ A;  1NB5 I;  1U8C B;  3DGN A;  1SJW A;  1NU3 A;  1Y4K A;  5EQL A;  1E3V A;  5KP3 A;  3VSY A;  1ZO2 A;  3PGB A;  4FMA A;  2RFR A;  1GD3 A;  3K9M C;  2W03 A;  3MWZ A;  3GWR A;  1VQM 3;  1W6C A;  2ZDJ A;  3DZL A;  3NV0 A;  3GRD A;  3KN4 A;  1Q40 B;  3B8L A;  1K41 A;  3OWS A;  2HMO B;  4HM2 B;  4X2H A;  1OUN A;  3SLU A;  1T5Y A;  4EYC A;  5KP4 A;  3FCS B;  5AIG A;  4XM4 A;  3WDG B;  2GU3 A;  2OCT A;  2PNC A;  3CCQ 3;  5CXO A;  2BT3 A;  2GXF A;  3F14 A;  3X40 A;  1IVV A;  1Q42 A;  4HKV B;  3MKI A;  3PCR A;  3ECF A;  3FGY A;  5CK6 A;  4R9K A;  1N9J A;  2F99 A;  1IVU A;  1CYV A;  1O7M B;  4AEQ A;  1EQK A;  2CIU A;  1QVG 2;  3V92 A;  3NM7 A;  4RBN A;  3AMO A;  1ULI B;  1W2Z A;  5IEN A;  2GEX A;  2Z76 A;  4NRE A;  4ORL A;  3MHE A;  2ML6 A;  1IQ8 A;  4FR9 A;  2F86 B;  3CME 3;  1JJ2 2;  4XBY A;  3LH4 A;  2HMJ B;  2WOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...