3HXCB

Engineered rabggtase in complex with a peptidomimetic inhibitor (compound 8)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
327
structure length
323
Chain Sequence
b'QKDVTIKSDAPDTLLLEKHADYIASYGSYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Design, synthesis, and characterization of Peptide-based rab geranylgeranyl transferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 117
structure length 323
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3hxcB00
3E34B 1N4PB 2H6HB 1H35A 1GSZA 2V3PA 3Q73B 3HXCB 1NL4B 3HXEB 4BOJA 5JPNB 2WIIB 5AGDA 3Q7AB 1N95B 3E33B 4FXGB 3KSQB 4GTSB 5FO9B 2V8JA 3CU7A 3D5RA 4BOKA 2V8IA 2H6FB 3EU5B 1N94B 1S64B 1H39A 2G02A 4LNGB 4GTPB 1O1SB 1O6HA 1C3DA 3DRAB 2XQWA 3SFYB 1DCEB 3G6JB 4GTVB 2BBCA 2XWJB 1LTXB 1TN6B 1QQFA 1HZFA 3OXUA 2B39A 1SQCA 1SA4B 5FO7B 1MZCB 1D8EB 4ONTA 2SQCA 1GXOA 1S63B 3PZ3B 2WY8A 1QBQB 4D4CA 1H37A 1LD7B 2BB5A 3KSLB 3KQ4A 3Q7FB 2NOJA 3DPYB 4D4DA 4GTMB 2BB6A 1JCSB 1TNUB 2A73B 2I07B 1TNBB 1TN8B 2H6GB 1H3AA 3C72B 1O6QA 1R76A 4D94A 5FOBB 4EHMB 1GHQA 3PZ2B 4M76A 1O6RA 3K7XA 3DSWB 1O1TB 2R2LB 4KKJA 1H3CA 1D8DB 4YDEB 3DSSB 1SA5B 2PMVA 2H6IB 1TNYB 4KKIA 1TNZB 3HXFB 4MU9A 3PZ1B 4L9PB 2IEJB 1TNOB 1JCRB 3D5SA 1O1RB 3E30B 1N9AB 1GXNA 4ZH1A 3SFXB 1H36A 1X81B 2BEDB 1GXMA 2GOXA 2V8KA 4C1SA 2V3NA 4D4BA 3Q75B 4LNBB 2PN5A 3HXDB 4MBGB 1FT2B 3DSVB 2ZIRB 1LD8B 5FO8B 4D4AA 4FXKB 4LNVA 1KZPB 2F0YB 4GTOB 3DSXB 4GTQB 5JPMB 1TN7B 4YDOB 4GTRB 4V1SA 1N4QB 3Q78B 2ZISB 1KZOB 3PZ4B 3HXBB 3KLSA 1W6JA 1QSJA 4GTTB 4ZRQA 3SQCA 1N4SB 4ZRPA 1UMPA 1FPPB 3EUVB 2WINB 2WY7A 1N4RB 1W6KA 3DSUB 1FT1B 1H3BA 1O5MB 3E32B 1NI1B 3Q79B 3RJ3A 4V1RA 1JCQB 3OEDA 2G0DA 3E37B 1O79A 2XWBB 3DSTB
chains in the Genus database with same CATH superfamily
3E34B 4KTRA 4Z4LA 2ONGA 2P0VA 3HXCB 2RI9A 4CJ0A 1V5DA 2JF4A 5GY3A 3E33B 2OKXA 3D5RA 4BOKA 3ACTA 3QPFA 3K11A 3QG0A 2GH4A 2BRPA 2G02A 1RQ5A 4LNGB 4TF4A 1HMUA 1VD5A 3ACSA 3GT5A 1FCEA 3OXUA 1W3YA 4OZWA 1SQCA 3M02A 3QWTA 5KKBA 3W7TA 1QBQB 1H37A 2EAEA 1X1HA 3DPYB 1TNUB 5IKHA 2I07B 2H6GB 4AYRA 3C72B 2YIKA 1GHQA 5IL8A 4AYPA 3QSPA 1K72A 1O1TB 4WU0A 4KKJA 1SA5B 4OJZA 4KKIA 1LOHA 1FO3A 2IEJB 2B4FA 1TNOB 3W7XA 1JCRB 1HXCA 3SDRA 1O1RB 5M7YA 2Q1FA 2E24A 2VN4A 3RX8A 1X81B 3WUXA 1C82A 1IA6A 3RX5A 2PN5A 3NFVA 3H2WA 2GZ6A 3QXFA 4XUVA 2FV0A 4FXKB 3CIHA 2DRRA 2F0YB 4GTOB 5MEHA 4GTQB 1OJMA 4CE7A 1N4QB 3Q78B 3WKGA 2ZISB 1KZOB 4GTTB 1QSJA 3SQCA 3AFJA 1GA2A 2WY7A 3DSUB 1H54A 5EAUA 3AFLA 2DRQA 3Q7AB 2G0DA 5GZKA 1UT9A 1N1ZA 1LXMA 1N4PB 1H35A 2V3PA 3H3KA 2F6DA 1NL4B 1WU5A 1HX9A 2WIIB 1N95B 4QT9A 1V7XA 4GTSB 1QAZA 1HN0A 1KWFA 2V8IA 4Q2BA 3EU5B 1S64B 1L2AA 3S4DA 3P2CA 1O6HA 1C3DA 3A3VA 1DL2A 3DRAB 1OJNA 2XQWA 3SFYB 1GAHA 3H7LA 5DHIA 2BBCA 1LTXB 1TN6B 3WIRA 1RW9A 1HZFA 3WKFA 3PMMA 3SDQA 4ONTA 5IK9A 2FV1A 3QFZA 4OK2A 1HV6A 3SAEA 4AYQA 4DOEA 1H12A 1ULVA 2BB5A 1FBWA 3KSLB 3G4DA 2DRSA 4GTMB 1X1IA 3RENA 1GLMA 2A8ZA 1J0NA 3W7SA 3M75A 1KSDA 1TNBB 2AFAA 2CQSA 1R76A 2EADA 3QT3A 2WYNA 3QRYA 1RWFA 3DSWB 3GLYA 1G9GA 1D8DB 1H3CA 3DSSB 1FMIA 2PMVA 3VSNA 1H13A 1KRFA 5ILJA 1KREA 3M74A 1UG9A 1HM2A 3M7LA 4F13A 3D5SA 1N23A 3E30B 1CLCA 1N9AB 1GXNA 3E7JA 3SFXB 1H36A 2BEDB 1F9DA 2V8KA 3SDTA 2BRWA 1KKTA 4LNBB 1N7RA 1N21A 1F9GA 1KSCA 5C05A 4Z4JA 4CJ1A 1DOGA 5IK6A 3RRSA 4LNVA 3PYAA 1V5CA 5DGQA 2FUZA 4V1SA 5EATA 1WU6A 4WVBA 3D3IA 3HXBB 1W6JA 4ZRPA 1FPPB 1N7QA 4DI5A 1RWGA 2XFGA 1H14A 1N4RB 1N22A 1W6KA 1FT1B 4L0GA 1O5MB 2Z07A 3A0OA 3E32B 4V1RA 3M76A 1FBOA 1NXCA 4OK4A 2XWBB 3DSTB 1WZZA 1CEMA 1LF9A 3Q73B 2EACA 4E1YA 1AGMA 3HXEB 4BOJA 5JPNB 2NVPA 5AGDA 3M00A 3M78A 3KSQB 5FO9B 1N24A 2AHGA 2X03A 1N94B 1KS8A 3QDEA 1FP3A 4MMHA 5ILKA 3E6UA 3P5PA 1JS4A 2DROA 3G6JB 4GTVB 2XWJB 2JG0A 4YCRA 1F1SA 1SA4B 1MZCB 1HCUA 2E22A 3M72A 4NEIA 3ON6A 5ILHA 2ZZRA 1GXOA 3PZ3B 3T33A 3X17A 2VN7A 5JMFA 3Q7FB 2NOJA 3S9VA 5GW7A 3WIQA 4KTPA 2BB6A 3WKHA 3WC3A 1JCSB 2ONHA 3S4CA 1FAEA 1LXKA 4FJQA 5IM1A 1TF4A 5CD2A 1H3AA 1WU4A 4D94A 1RWHA 5FOBB 3PZ2B 3K7XA 3WKIA 5CZLA 5EASA 1IA7A 1KFGA 3M7EA 2RGKA 3M73A 4YDEB 4FNVA 1V7VA 2BRVX 2H6IB 1N7NA 1TNYB 1TNZB 3HXFB 3PZ1B 4L9PB 5DHKA 1AYXA 4ZH5A 3S4BA 1OJPA 1GXMA 1RWAA 2V3NA 3WIWA 1OJOA 3Q75B 5ILIA 5IL3A 4MBGB 1CB8A 3DSVB 2ZIRB 1LD8B 3VW5A 1G6IA 4JJJA 3W7UA 3W5NA 1KZPB 4Q88A 3NNBA 3DSXB 5JPMB 3ANJA 3RSYA 4YDOB 5M7IA 4GTRB 1LF6A 3SDUA 1RWCA 4ZRQA 3KLSA 1N4SB 1UMPA 5ILDA 2WINB 4LIXA 3ANKA 2FUQA 2JJBA 4AYOA 1NI1B 1XWQA 1J0MA 3QXQA 1JCQB 4J5TA 4OZVA 5ILZA 3E37B 2H6HB 1GSZA 3QFYA 3M01A 1HXGA 3M7CA 4DODA 1F9OA 1N20A 3P5RA 4FXGB 2J5CA 2V8JA 3CU7A 1HM3A 1X9DA 2H6FB 1G87A 2D5JA 3VSMA 1H39A 4GL3A 4GTPB 1O1SB 4TXTA 2AHFA 4GAXA 3N0FA 2WCOA 1DCEB 3G4FA 4WVCA 1QQFA 1XWTA 3M71A 3M77A 3TF4A 3W7WA 2B39A 5FO7B 1D8EB 1V7WA 3W5MA 2SQCA 1EGUA 1S63B 2WY8A 2CQTA 4D4CA 1IS9A 3LZ9A 1LD7B 1FO2A 3KQ4A 4FUSA 5DGRA 4D4DA 4EL8A 2A73B 1N1BA 1TN8B 1X1JA 3EU8A 4L6XA 2RI8A 1O6QA 4EHMB 2FUTA 1NC5A 1O6RA 5E2JA 4MMIA 2EABA 1G9JA 2R2LB 3EQAA 3N0GA 1HMWA 3PYBA 4MU9A 1GAIA 1HXAA 3M7BA 5JMDA 3GZKA 5IKAA 4F10A 1N7OA 4ZH1A 3S4AA 1I8QA 2GOXA 3E80A 4C1SA 2FBAA 4D4BA 2QNOA 1N7PA 5ILYA 3HXDB 3E73A 1FT2B 3RX7A 4ZG8A 5IK0A 2WDAA 4D4AA 5FO8B 4RNQA 3ANIA 3VXDA 1TN7B 5CA3A 3PZ4B 3EZ8A 3EUVB 2D8LA 3SDVA 1XW2A 1H3BA 1L1YA 3QT9A 3Q79B 3RJ3A 2ZBLA 3OEDA 4WVAA 1O79A 4M76A
chains in the Genus database with same CATH topology
3E34B 4KTRA 4Z4LA 2P0VA 3HXCB 2RI9A 4CJ0A 1V5DA 2JF4A 5GY3A 3E33B 2OKXA 3D5RA 4BOKA 3ACTA 3QPFA 3K11A 3QG0A 2GH4A 2G02A 1RQ5A 4LNGB 4TF4A 1VD5A 3ACSA 3GT5A 1FCEA 3OXUA 1SQCA 3QWTA 5KKBA 3W7TA 1QBQB 1H37A 2EAEA 3DPYB 1TNUB 2I07B 2H6GB 4AYRA 3C72B 2YIKA 1GHQA 4AYPA 3QSPA 1K72A 1O1TB 4WU0A 4KKJA 1SA5B 4KKIA 1FO3A 2IEJB 2B4FA 1TNOB 3W7XA 1JCRB 3SDRA 1O1RB 5M7YA 2VN4A 3RX8A 1X81B 3WUXA 1IA6A 3RX5A 2PN5A 3H2WA 2GZ6A 3QXFA 4XUVA 2FV0A 4FXKB 3CIHA 2DRRA 2F0YB 4GTOB 5MEHA 4GTQB 4CE7A 1N4QB 3Q78B 3WKGA 2ZISB 1KZOB 4GTTB 1QSJA 3SQCA 3AFJA 1GA2A 2WY7A 3DSUB 1H54A 2DRQA 3Q7AB 2G0DA 5GZKA 1UT9A 1N4PB 1H35A 2V3PA 3H3KA 2F6DA 1NL4B 1WU5A 2WIIB 1N95B 4QT9A 1V7XA 4GTSB 1KWFA 2V8IA 4Q2BA 3EU5B 1S64B 1L2AA 3S4DA 3P2CA 1O6HA 1C3DA 3A3VA 1DL2A 3DRAB 2XQWA 3SFYB 1GAHA 3H7LA 2BBCA 1LTXB 1TN6B 3WIRA 1HZFA 3WKFA 3PMMA 3SDQA 4ONTA 2FV1A 3QFZA 3SAEA 4AYQA 4DOEA 1H12A 1ULVA 2BB5A 1FBWA 3KSLB 2DRSA 4GTMB 3RENA 1GLMA 2A8ZA 3W7SA 3M75A 1KSDA 1TNBB 2AFAA 2CQSA 1R76A 2EADA 3QT3A 2WYNA 3QRYA 3DSWB 3GLYA 1G9GA 1D8DB 1H3CA 3DSSB 1FMIA 2PMVA 1H13A 1KRFA 1KREA 3M74A 1UG9A 3M7LA 3D5SA 3E30B 1CLCA 1N9AB 1GXNA 3SFXB 1H36A 2BEDB 1F9DA 2V8KA 3SDTA 1KKTA 4LNBB 1KSCA 4CJ1A 4Z4JA 1DOGA 3RRSA 4LNVA 3PYAA 1V5CA 5DGQA 2FUZA 4V1SA 1WU6A 4WVBA 3D3IA 3HXBB 1W6JA 4ZRPA 1FPPB 2XFGA 1H14A 1N4RB 1W6KA 1FT1B 4L0GA 1O5MB 2Z07A 3E32B 4V1RA 3M76A 1FBOA 1NXCA 2XWBB 3DSTB 1WZZA 1CEMA 1LF9A 3Q73B 2EACA 1AGMA 3HXEB 4BOJA 5JPNB 2NVPA 5AGDA 3M78A 3KSQB 5FO9B 2AHGA 1N94B 1KS8A 3QDEA 1FP3A 3E6UA 3P5PA 1JS4A 2DROA 3G6JB 4GTVB 2XWJB 2JG0A 4YCRA 1SA4B 1MZCB 1HCUA 3M72A 3ON6A 2ZZRA 1GXOA 3PZ3B 3T33A 3X17A 2VN7A 3Q7FB 2NOJA 3S9VA 5GW7A 3WIQA 4KTPA 2BB6A 3WKHA 3WC3A 1JCSB 3S4CA 1FAEA 1TF4A 5CD2A 1H3AA 1WU4A 4D94A 5FOBB 3PZ2B 3K7XA 3WKIA 5CZLA 1IA7A 1KFGA 3M7EA 2RGKA 3M73A 4YDEB 1V7VA 2H6IB 1TNYB 1TNZB 3HXFB 3PZ1B 4L9PB 1AYXA 4ZH5A 3S4BA 1GXMA 2V3NA 3WIWA 3Q75B 4MBGB 3DSVB 2ZIRB 1LD8B 3VW5A 1G6IA 4JJJA 3W7UA 3W5NA 1KZPB 4Q88A 3DSXB 5JPMB 3ANJA 3RSYA 4YDOB 5M7IA 4GTRB 1LF6A 3SDUA 4ZRQA 3KLSA 1N4SB 1UMPA 2WINB 4LIXA 3ANKA 2JJBA 4AYOA 1NI1B 1XWQA 3QXQA 1JCQB 4J5TA 3E37B 2H6HB 1GSZA 3QFYA 3M7CA 4DODA 1F9OA 3P5RA 4FXGB 2V8JA 3CU7A 1X9DA 2H6FB 1G87A 2D5JA 1H39A 4GL3A 4GTPB 1O1SB 4TXTA 2AHFA 1DCEB 4WVCA 1QQFA 1XWTA 3M71A 3M77A 3TF4A 3W7WA 2B39A 5FO7B 1D8EB 1V7WA 3W5MA 2SQCA 1S63B 2WY8A 2CQTA 4D4CA 1IS9A 1LD7B 1FO2A 3KQ4A 4FUSA 5DGRA 4D4DA 4EL8A 2A73B 1TN8B 3EU8A 4L6XA 2RI8A 1O6QA 4EHMB 1NC5A 1O6RA 5E2JA 2EABA 1G9JA 2R2LB 3EQAA 3PYBA 4MU9A 1GAIA 3M7BA 3GZKA 4ZH1A 3S4AA 2GOXA 4C1SA 2FBAA 4D4BA 2QNOA 3HXDB 3E73A 1FT2B 3RX7A 4ZG8A 5FO8B 4D4AA 3ANIA 3VXDA 1TN7B 5CA3A 3PZ4B 3EZ8A 3EUVB 2D8LA 3SDVA 1XW2A 1H3BA 1L1YA 3QT9A 3Q79B 3RJ3A 2ZBLA 3OEDA 4WVAA 1O79A 4M76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E34 B;  1N4P B;  2H6H B;  1H35 A;  1GSZ A;  2V3P A;  3Q73 B;  3HXC B;  1NL4 B;  3HXE B;  4BOJ A;  5JPN B;  2WII B;  5AGD A;  3Q7A B;  1N95 B;  3E33 B;  4FXG B;  3KSQ B;  4GTS B;  5FO9 B;  2V8J A;  3CU7 A;  3D5R A;  4BOK A;  2V8I A;  2H6F B;  3EU5 B;  1N94 B;  1S64 B;  1H39 A;  2G02 A;  4LNG B;  4GTP B;  1O1S B;  1O6H A;  1C3D A;  3DRA B;  2XQW A;  3SFY B;  1DCE B;  3G6J B;  4GTV B;  2BBC A;  2XWJ B;  1LTX B;  1TN6 B;  1QQF A;  1HZF A;  3OXU A;  2B39 A;  1SQC A;  1SA4 B;  5FO7 B;  1MZC B;  1D8E B;  4ONT A;  2SQC A;  1GXO A;  1S63 B;  3PZ3 B;  2WY8 A;  1QBQ B;  4D4C A;  1H37 A;  1LD7 B;  2BB5 A;  3KSL B;  3KQ4 A;  3Q7F B;  2NOJ A;  3DPY B;  4D4D A;  4GTM B;  2BB6 A;  1JCS B;  1TNU B;  2A73 B;  2I07 B;  1TNB B;  1TN8 B;  2H6G B;  1H3A A;  3C72 B;  1O6Q A;  1R76 A;  4D94 A;  5FOB B;  4EHM B;  1GHQ A;  3PZ2 B;  4M76 A;  1O6R A;  3K7X A;  3DSW B;  1O1T B;  2R2L B;  4KKJ A;  1H3C A;  1D8D B;  4YDE B;  3DSS B;  1SA5 B;  2PMV A;  2H6I B;  1TNY B;  4KKI A;  1TNZ B;  3HXF B;  4MU9 A;  3PZ1 B;  4L9P B;  2IEJ B;  1TNO B;  1JCR B;  3D5S A;  1O1R B;  3E30 B;  1N9A B;  1GXN A;  4ZH1 A;  3SFX B;  1H36 A;  1X81 B;  2BED B;  1GXM A;  2GOX A;  2V8K A;  4C1S A;  2V3N A;  4D4B A;  3Q75 B;  4LNB B;  2PN5 A;  3HXD B;  4MBG B;  1FT2 B;  3DSV B;  2ZIR B;  1LD8 B;  5FO8 B;  4D4A A;  4FXK B;  4LNV A;  1KZP B;  2F0Y B;  4GTO B;  3DSX B;  4GTQ B;  5JPM B;  1TN7 B;  4YDO B;  4GTR B;  4V1S A;  1N4Q B;  3Q78 B;  2ZIS B;  1KZO B;  3PZ4 B;  3HXB B;  3KLS A;  1W6J A;  1QSJ A;  4GTT B;  4ZRQ A;  3SQC A;  1N4S B;  4ZRP A;  1UMP A;  1FPP B;  3EUV B;  2WIN B;  2WY7 A;  1N4R B;  1W6K A;  3DSU B;  1FT1 B;  1H3B A;  1O5M B;  3E32 B;  1NI1 B;  3Q79 B;  3RJ3 A;  4V1R A;  1JCQ B;  3OED A;  2G0D A;  3E37 B;  1O79 A;  2XWB B;  3DST B; 
#chains in the Genus database with same CATH topology
 3E34 B;  4KTR A;  4Z4L A;  2ONG A;  2P0V A;  3HXC B;  2RI9 A;  4CJ0 A;  1V5D A;  2JF4 A;  5GY3 A;  3E33 B;  2OKX A;  3D5R A;  4BOK A;  3ACT A;  3QPF A;  3K11 A;  3QG0 A;  2GH4 A;  2BRP A;  2G02 A;  1RQ5 A;  4LNG B;  4TF4 A;  1HMU A;  1VD5 A;  3ACS A;  3GT5 A;  1FCE A;  3OXU A;  1W3Y A;  4OZW A;  1SQC A;  3M02 A;  3QWT A;  5KKB A;  3W7T A;  1QBQ B;  1H37 A;  2EAE A;  1X1H A;  3DPY B;  1TNU B;  5IKH A;  2I07 B;  2H6G B;  4AYR A;  3C72 B;  2YIK A;  1GHQ A;  5IL8 A;  4AYP A;  3QSP A;  1K72 A;  1O1T B;  4WU0 A;  4KKJ A;  1SA5 B;  4OJZ A;  4KKI A;  1LOH A;  1FO3 A;  2IEJ B;  2B4F A;  1TNO B;  3W7X A;  1JCR B;  1HXC A;  3SDR A;  1O1R B;  5M7Y A;  2Q1F A;  2E24 A;  2VN4 A;  3RX8 A;  1X81 B;  3WUX A;  1C82 A;  1IA6 A;  3RX5 A;  2PN5 A;  3NFV A;  3H2W A;  2GZ6 A;  3QXF A;  4XUV A;  2FV0 A;  4FXK B;  3CIH A;  2DRR A;  2F0Y B;  4GTO B;  5MEH A;  4GTQ B;  1OJM A;  4CE7 A;  1N4Q B;  3Q78 B;  3WKG A;  2ZIS B;  1KZO B;  4GTT B;  1QSJ A;  3SQC A;  3AFJ A;  1GA2 A;  2WY7 A;  3DSU B;  1H54 A;  5EAU A;  3AFL A;  2DRQ A;  3Q7A B;  2G0D A;  5GZK A;  1UT9 A;  1N1Z A;  1LXM A;  1N4P B;  1H35 A;  2V3P A;  3H3K A;  2F6D A;  1NL4 B;  1WU5 A;  1HX9 A;  2WII B;  1N95 B;  4QT9 A;  1V7X A;  4GTS B;  1QAZ A;  1HN0 A;  1KWF A;  2V8I A;  4Q2B A;  3EU5 B;  1S64 B;  1L2A A;  3S4D A;  3P2C A;  1O6H A;  1C3D A;  3A3V A;  1DL2 A;  3DRA B;  1OJN A;  2XQW A;  3SFY B;  1GAH A;  3H7L A;  5DHI A;  2BBC A;  1LTX B;  1TN6 B;  3WIR A;  1RW9 A;  1HZF A;  3WKF A;  3PMM A;  3SDQ A;  4ONT A;  5IK9 A;  2FV1 A;  3QFZ A;  4OK2 A;  1HV6 A;  3SAE A;  4AYQ A;  4DOE A;  1H12 A;  1ULV A;  2BB5 A;  1FBW A;  3KSL B;  3G4D A;  2DRS A;  4GTM B;  1X1I A;  3REN A;  1GLM A;  2A8Z A;  1J0N A;  3W7S A;  3M75 A;  1KSD A;  1TNB B;  2AFA A;  2CQS A;  1R76 A;  2EAD A;  3QT3 A;  2WYN A;  3QRY A;  1RWF A;  3DSW B;  3GLY A;  1G9G A;  1D8D B;  1H3C A;  3DSS B;  1FMI A;  2PMV A;  3VSN A;  1H13 A;  1KRF A;  5ILJ A;  1KRE A;  3M74 A;  1UG9 A;  1HM2 A;  3M7L A;  4F13 A;  3D5S A;  1N23 A;  3E30 B;  1CLC A;  1N9A B;  1GXN A;  3E7J A;  3SFX B;  1H36 A;  2BED B;  1F9D A;  2V8K A;  3SDT A;  2BRW A;  1KKT A;  4LNB B;  1N7R A;  1N21 A;  1F9G A;  1KSC A;  5C05 A;  4Z4J A;  4CJ1 A;  1DOG A;  5IK6 A;  3RRS A;  4LNV A;  3PYA A;  1V5C A;  5DGQ A;  2FUZ A;  4V1S A;  5EAT A;  1WU6 A;  4WVB A;  3D3I A;  3HXB B;  1W6J A;  4ZRP A;  1FPP B;  1N7Q A;  4DI5 A;  1RWG A;  2XFG A;  1H14 A;  1N4R B;  1N22 A;  1W6K A;  1FT1 B;  4L0G A;  1O5M B;  2Z07 A;  3A0O A;  3E32 B;  4V1R A;  3M76 A;  1FBO A;  1NXC A;  4OK4 A;  2XWB B;  3DST B;  1WZZ A;  1CEM A;  1LF9 A;  3Q73 B;  2EAC A;  4E1Y A;  1AGM A;  3HXE B;  4BOJ A;  5JPN B;  2NVP A;  5AGD A;  3M00 A;  3M78 A;  3KSQ B;  5FO9 B;  1N24 A;  2AHG A;  2X03 A;  1N94 B;  1KS8 A;  3QDE A;  1FP3 A;  4MMH A;  5ILK A;  3E6U A;  3P5P A;  1JS4 A;  2DRO A;  3G6J B;  4GTV B;  2XWJ B;  2JG0 A;  4YCR A;  1F1S A;  1SA4 B;  1MZC B;  1HCU A;  2E22 A;  3M72 A;  4NEI A;  3ON6 A;  5ILH A;  2ZZR A;  1GXO A;  3PZ3 B;  3T33 A;  3X17 A;  2VN7 A;  5JMF A;  3Q7F B;  2NOJ A;  3S9V A;  5GW7 A;  3WIQ A;  4KTP A;  2BB6 A;  3WKH A;  3WC3 A;  1JCS B;  2ONH A;  3S4C A;  1FAE A;  1LXK A;  4FJQ A;  5IM1 A;  1TF4 A;  5CD2 A;  1H3A A;  1WU4 A;  4D94 A;  1RWH A;  5FOB B;  3PZ2 B;  3K7X A;  3WKI A;  5CZL A;  5EAS A;  1IA7 A;  1KFG A;  3M7E A;  2RGK A;  3M73 A;  4YDE B;  4FNV A;  1V7V A;  2BRV X;  2H6I B;  1N7N A;  1TNY B;  1TNZ B;  3HXF B;  3PZ1 B;  4L9P B;  5DHK A;  1AYX A;  4ZH5 A;  3S4B A;  1OJP A;  1GXM A;  1RWA A;  2V3N A;  3WIW A;  1OJO A;  3Q75 B;  5ILI A;  5IL3 A;  4MBG B;  1CB8 A;  3DSV B;  2ZIR B;  1LD8 B;  3VW5 A;  1G6I A;  4JJJ A;  3W7U A;  3W5N A;  1KZP B;  4Q88 A;  3NNB A;  3DSX B;  5JPM B;  3ANJ A;  3RSY A;  4YDO B;  5M7I A;  4GTR B;  1LF6 A;  3SDU A;  1RWC A;  4ZRQ A;  3KLS A;  1N4S B;  1UMP A;  5ILD A;  2WIN B;  4LIX A;  3ANK A;  2FUQ A;  2JJB A;  4AYO A;  1NI1 B;  1XWQ A;  1J0M A;  3QXQ A;  1JCQ B;  4J5T A;  4OZV A;  5ILZ A;  3E37 B;  2H6H B;  1GSZ A;  3QFY A;  3M01 A;  1HXG A;  3M7C A;  4DOD A;  1F9O A;  1N20 A;  3P5R A;  4FXG B;  2J5C A;  2V8J A;  3CU7 A;  1HM3 A;  1X9D A;  2H6F B;  1G87 A;  2D5J A;  3VSM A;  1H39 A;  4GL3 A;  4GTP B;  1O1S B;  4TXT A;  2AHF A;  4GAX A;  3N0F A;  2WCO A;  1DCE B;  3G4F A;  4WVC A;  1QQF A;  1XWT A;  3M71 A;  3M77 A;  3TF4 A;  3W7W A;  2B39 A;  5FO7 B;  1D8E B;  1V7W A;  3W5M A;  2SQC A;  1EGU A;  1S63 B;  2WY8 A;  2CQT A;  4D4C A;  1IS9 A;  3LZ9 A;  1LD7 B;  1FO2 A;  3KQ4 A;  4FUS A;  5DGR A;  4D4D A;  4EL8 A;  2A73 B;  1N1B A;  1TN8 B;  1X1J A;  3EU8 A;  4L6X A;  2RI8 A;  1O6Q A;  4EHM B;  2FUT A;  1NC5 A;  1O6R A;  5E2J A;  4MMI A;  2EAB A;  1G9J A;  2R2L B;  3EQA A;  3N0G A;  1HMW A;  3PYB A;  4MU9 A;  1GAI A;  1HXA A;  3M7B A;  5JMD A;  3GZK A;  5IKA A;  4F10 A;  1N7O A;  4ZH1 A;  3S4A A;  1I8Q A;  2GOX A;  3E80 A;  4C1S A;  2FBA A;  4D4B A;  2QNO A;  1N7P A;  5ILY A;  3HXD B;  3E73 A;  1FT2 B;  3RX7 A;  4ZG8 A;  5IK0 A;  2WDA A;  4D4A A;  5FO8 B;  4RNQ A;  3ANI A;  3VXD A;  1TN7 B;  5CA3 A;  3PZ4 B;  3EZ8 A;  3EUV B;  2D8L A;  3SDV A;  1XW2 A;  1H3B A;  1L1Y A;  3QT9 A;  3Q79 B;  3RJ3 A;  2ZBL A;  3OED A;  4WVA A;  1O79 A;  4M76 A; 
#chains in the Genus database with same CATH homology
 3E34 B;  4KTR A;  4Z4L A;  2P0V A;  3HXC B;  2RI9 A;  4CJ0 A;  1V5D A;  2JF4 A;  5GY3 A;  3E33 B;  2OKX A;  3D5R A;  4BOK A;  3ACT A;  3QPF A;  3K11 A;  3QG0 A;  2GH4 A;  2G02 A;  1RQ5 A;  4LNG B;  4TF4 A;  1VD5 A;  3ACS A;  3GT5 A;  1FCE A;  3OXU A;  1SQC A;  3QWT A;  5KKB A;  3W7T A;  1QBQ B;  1H37 A;  2EAE A;  3DPY B;  1TNU B;  2I07 B;  2H6G B;  4AYR A;  3C72 B;  2YIK A;  1GHQ A;  4AYP A;  3QSP A;  1K72 A;  1O1T B;  4WU0 A;  4KKJ A;  1SA5 B;  4KKI A;  1FO3 A;  2IEJ B;  2B4F A;  1TNO B;  3W7X A;  1JCR B;  3SDR A;  1O1R B;  5M7Y A;  2VN4 A;  3RX8 A;  1X81 B;  3WUX A;  1IA6 A;  3RX5 A;  2PN5 A;  3H2W A;  2GZ6 A;  3QXF A;  4XUV A;  2FV0 A;  4FXK B;  3CIH A;  2DRR A;  2F0Y B;  4GTO B;  5MEH A;  4GTQ B;  4CE7 A;  1N4Q B;  3Q78 B;  3WKG A;  2ZIS B;  1KZO B;  4GTT B;  1QSJ A;  3SQC A;  3AFJ A;  1GA2 A;  2WY7 A;  3DSU B;  1H54 A;  2DRQ A;  3Q7A B;  2G0D A;  5GZK A;  1UT9 A;  1N4P B;  1H35 A;  2V3P A;  3H3K A;  2F6D A;  1NL4 B;  1WU5 A;  2WII B;  1N95 B;  4QT9 A;  1V7X A;  4GTS B;  1KWF A;  2V8I A;  4Q2B A;  3EU5 B;  1S64 B;  1L2A A;  3S4D A;  3P2C A;  1O6H A;  1C3D A;  3A3V A;  1DL2 A;  3DRA B;  2XQW A;  3SFY B;  1GAH A;  3H7L A;  2BBC A;  1LTX B;  1TN6 B;  3WIR A;  1HZF A;  3WKF A;  3PMM A;  3SDQ A;  4ONT A;  2FV1 A;  3QFZ A;  3SAE A;  4AYQ A;  4DOE A;  1H12 A;  1ULV A;  2BB5 A;  1FBW A;  3KSL B;  2DRS A;  4GTM B;  3REN A;  1GLM A;  2A8Z A;  3W7S A;  3M75 A;  1KSD A;  1TNB B;  2AFA A;  2CQS A;  1R76 A;  2EAD A;  3QT3 A;  2WYN A;  3QRY A;  3DSW B;  3GLY A;  1G9G A;  1D8D B;  1H3C A;  3DSS B;  1FMI A;  2PMV A;  1H13 A;  1KRF A;  1KRE A;  3M74 A;  1UG9 A;  3M7L A;  3D5S A;  3E30 B;  1CLC A;  1N9A B;  1GXN A;  3SFX B;  1H36 A;  2BED B;  1F9D A;  2V8K A;  3SDT A;  1KKT A;  4LNB B;  1KSC A;  4CJ1 A;  4Z4J A;  1DOG A;  3RRS A;  4LNV A;  3PYA A;  1V5C A;  5DGQ A;  2FUZ A;  4V1S A;  1WU6 A;  4WVB A;  3D3I A;  3HXB B;  1W6J A;  4ZRP A;  1FPP B;  2XFG A;  1H14 A;  1N4R B;  1W6K A;  1FT1 B;  4L0G A;  1O5M B;  2Z07 A;  3E32 B;  4V1R A;  3M76 A;  1FBO A;  1NXC A;  2XWB B;  3DST B;  1WZZ A;  1CEM A;  1LF9 A;  3Q73 B;  2EAC A;  1AGM A;  3HXE B;  4BOJ A;  5JPN B;  2NVP A;  5AGD A;  3M78 A;  3KSQ B;  5FO9 B;  2AHG A;  1N94 B;  1KS8 A;  3QDE A;  1FP3 A;  3E6U A;  3P5P A;  1JS4 A;  2DRO A;  3G6J B;  4GTV B;  2XWJ B;  2JG0 A;  4YCR A;  1SA4 B;  1MZC B;  1HCU A;  3M72 A;  3ON6 A;  2ZZR A;  1GXO A;  3PZ3 B;  3T33 A;  3X17 A;  2VN7 A;  3Q7F B;  2NOJ A;  3S9V A;  5GW7 A;  3WIQ A;  4KTP A;  2BB6 A;  3WKH A;  3WC3 A;  1JCS B;  3S4C A;  1FAE A;  1TF4 A;  5CD2 A;  1H3A A;  1WU4 A;  4D94 A;  5FOB B;  3PZ2 B;  3K7X A;  3WKI A;  5CZL A;  1IA7 A;  1KFG A;  3M7E A;  2RGK A;  3M73 A;  4YDE B;  1V7V A;  2H6I B;  1TNY B;  1TNZ B;  3HXF B;  3PZ1 B;  4L9P B;  1AYX A;  4ZH5 A;  3S4B A;  1GXM A;  2V3N A;  3WIW A;  3Q75 B;  4MBG B;  3DSV B;  2ZIR B;  1LD8 B;  3VW5 A;  1G6I A;  4JJJ A;  3W7U A;  3W5N A;  1KZP B;  4Q88 A;  3DSX B;  5JPM B;  3ANJ A;  3RSY A;  4YDO B;  5M7I A;  4GTR B;  1LF6 A;  3SDU A;  4ZRQ A;  3KLS A;  1N4S B;  1UMP A;  2WIN B;  4LIX A;  3ANK A;  2JJB A;  4AYO A;  1NI1 B;  1XWQ A;  3QXQ A;  1JCQ B;  4J5T A;  3E37 B;  2H6H B;  1GSZ A;  3QFY A;  3M7C A;  4DOD A;  1F9O A;  3P5R A;  4FXG B;  2V8J A;  3CU7 A;  1X9D A;  2H6F B;  1G87 A;  2D5J A;  1H39 A;  4GL3 A;  4GTP B;  1O1S B;  4TXT A;  2AHF A;  1DCE B;  4WVC A;  1QQF A;  1XWT A;  3M71 A;  3M77 A;  3TF4 A;  3W7W A;  2B39 A;  5FO7 B;  1D8E B;  1V7W A;  3W5M A;  2SQC A;  1S63 B;  2WY8 A;  2CQT A;  4D4C A;  1IS9 A;  1LD7 B;  1FO2 A;  3KQ4 A;  4FUS A;  5DGR A;  4D4D A;  4EL8 A;  2A73 B;  1TN8 B;  3EU8 A;  4L6X A;  2RI8 A;  1O6Q A;  4EHM B;  1NC5 A;  1O6R A;  5E2J A;  2EAB A;  1G9J A;  2R2L B;  3EQA A;  3PYB A;  4MU9 A;  1GAI A;  3M7B A;  3GZK A;  4ZH1 A;  3S4A A;  2GOX A;  4C1S A;  2FBA A;  4D4B A;  2QNO A;  3HXD B;  3E73 A;  1FT2 B;  3RX7 A;  4ZG8 A;  5FO8 B;  4D4A A;  3ANI A;  3VXD A;  1TN7 B;  5CA3 A;  3PZ4 B;  3EZ8 A;  3EUV B;  2D8L A;  3SDV A;  1XW2 A;  1H3B A;  1L1Y A;  3QT9 A;  3Q79 B;  3RJ3 A;  2ZBL A;  3OED A;  4WVA A;  1O79 A;  4M76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...