3HXCB

Engineered rabggtase in complex with a peptidomimetic inhibitor (compound 8)
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
327
structure length
323
Chain Sequence
QKDVTIKSDAPDTLLLEKHADYIASYGSYEYCMSEYLRMSGVYWGLTVMDLMGQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVVAYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranylgeranyl transferase type-2 subunit alpha
publication title Design, synthesis, and characterization of Peptide-based rab geranylgeranyl transferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 117
structure length 323
sequence length 327
ec nomenclature ec 2.5.1.60: Protein geranylgeranyltransferase type II.
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 3hxcB00
2ZIRB 4FXGB 1D8DB 1FT2B 2XQWA 1FPPB 3Q73B 3SQCA 3KQ4A 2G02A 1MZCB 2V3PA 4GTQB 3KSQB 5FO9B 1JCQB 2BEDB 2F0YB 1N4PB 3DRAB 5AGDA 3DSXB 1DCEB 1GXOA 3DSWB 3K7XA 3G6JB 1TN7B 2B39A 4BOJA 1O1SB 4ZRQA 2WINB 4BOKA 1W6JA 3D5RA 4C1SA 1D8EB 1GXMA 1TNOB 3DPYB 1H36A 4KKIA 3E34B 4ZH1A 2R2LB 2G0DA 3D5SA 3DSUB 1O5MB 1FT1B 1R76A 1N9AB 1QQFA 3SFXB 3DSTB 5FO7B 1SA5B 4ONTA 4M76A 1H3CA 1N94B 5FO8B 3Q7FB 2WY7A 1O6HA 2BB5A 2BB6A 3KSLB 4V1RA 3HXBB 2PN5A 2A73B 4FXKB 1N4SB 3OEDA 4L9PB 4D94A 4D4AA 3KLSA 2V8KA 3PZ1B 1O1RB 4D4BA 1C3DA 4LNGB 4EHMB 3PZ4B 1TN8B 4ZRPA 3E32B 3PZ3B 4MU9A 1QBQB 2IEJB 2SQCA 1UMPA 2ZISB 1H37A 2WIIB 1TNZB 1TNBB 3Q7AB 1GSZA 1TNUB 1O79A 1N4QB 3SFYB 2H6IB 3DSVB 1O1TB 4GTTB 1JCRB 3EU5B 3Q78B 4GTOB 1QSJA 1SQCA 2NOJA 2H6FB 2V8JA 1X81B 2BBCA 3HXDB 3HXCB 3E30B 3CU7A 2H6HB 3HXFB 4GTSB 3C72B 3DSSB 1LD7B 3HXEB 5FOBB 1NI1B 1N95B 2XWBB 4MBGB 1KZPB 1SA4B 2V3NA 4LNBB 3RJ3A 1H3BA 1GXNA 4GTMB 5JPMB 1TNYB 1LTXB 2GOXA 2H6GB 1O6QA 1S64B 2V8IA 4V1SA 2PMVA 1HZFA 2WY8A 3EUVB 1O6RA 4YDEB 4D4DA 1S63B 4GTRB 3Q75B 1JCSB 1N4RB 4GTVB 2I07B 1H39A 3E37B 1H3AA 1H35A 1TN6B 3PZ2B 4YDOB 4D4CA 4GTPB 1W6KA 3Q79B 2XWJB 4LNVA 1KZOB 1LD8B 1GHQA 1NL4B 3E33B 4KKJA 5JPNB 3OXUA
chains in the Genus database with same CATH superfamily
1D8DB 5IM1A 3WIQA 3M7EA 2V3PA 1N7RA 1JCQB 2BEDB 5KKBA 3WC3A 1GXOA 3T33A 3WKHA 3PMMA 3E7JA 1L2AA 2CQSA 3VSMA 1NXCA 1C82A 4BOKA 1W6JA 3QDEA 3RSYA 1GXMA 3WIRA 1WU4A 3DSUB 1O5MB 4MMHA 1FT1B 1LXMA 1N9AB 1XWTA 3P5PA 2ONHA 3SFXB 1AYXA 3M7CA 4M76A 1H3CA 3H7LA 3M01A 2WY7A 3M75A 1UG9A 3HXBB 4J5TA 4FXKB 4L9PB 3W7UA 4Z4JA 2VN4A 2V8KA 4AYPA 3W7XA 1O1RB 1W3YA 5ILDA 4EHMB 1TN8B 1GAIA 1N1BA 2CQTA 2E24A 3E32B 4JJJA 1QBQB 2ZISB 1H37A 4WVAA 3W5MA 1O79A 1N4QB 1F1SA 1JCRB 3Q78B 4GTOB 3RX8A 1QSJA 3WIWA 5IL8A 3S4DA 5IKAA 2WCOA 5ILKA 4OK4A 2H6HB 4GTSB 1GA2A 3G4FA 1HM3A 4EL8A 5FOBB 1RW9A 3M00A 3LZ9A 1KZPB 4MBGB 2EAEA 5M7YA 3QG0A 2D5JA 4LNBB 3EZ8A 3RJ3A 1HX9A 1H54A 4GTMB 5DGQA 1LTXB 4Q88A 1FAEA 1X1JA 1HZFA 2FV1A 1CB8A 5EATA 1G6IA 3ANIA 4YDEB 3ACSA 1S63B 1JCSB 1FP3A 3ANKA 3PZ2B 4GTPB 2BRPA 1HM2A 2BRVX 4F10A 1NC5A 5C05A 1KZOB 4WVBA 2ZIRB 1N20A 4FXGB 1FT2B 2XQWA 1FPPB 3ACTA 3M77A 2NVPA 3S4AA 5DGRA 2ZBLA 2AFAA 2ONGA 1DCEB 3G6JB 2B39A 5EASA 4WU0A 3CIHA 4BOJA 1F9DA 1OJMA 1V7WA 4ZH5A 1FO3A 3K11A 2XFGA 1LF9A 2AHGA 1TF4A 1H36A 5GY3A 4ZH1A 3D5SA 1R76A 4CJ0A 2AHFA 1IS9A 5FO7B 4AYQA 3AFJA 5FO8B 1RWGA 5MEHA 3RX5A 1V5CA 2BB6A 1KKTA 3KSLB 1GAHA 1CEMA 2PN5A 3P2CA 2ZZRA 3KLSA 3EU8A 5EAUA 1X1IA 4LNGB 4ZRPA 2RI8A 5JMDA 4MU9A 1HXCA 4FUSA 3QT9A 1TNBB 1N7OA 1N1ZA 2H6IB 3DSVB 3W7TA 3E6UA 4GL3A 4ZG8A 3GLYA 3WKFA 1KSCA 2Q1FA 5IK6A 3W5NA 3E73A 2OKXA 2D8LA 3A0OA 4MMIA 5DHIA 1N22A 2JJBA 2P0VA 1N95B 1G87A 1H3BA 2DRSA 2GOXA 3H2WA 1O6QA 1QAZA 1S64B 2V8IA 3QPFA 1DL2A 2A8ZA 2PMVA 1O6RA 2X03A 4D4DA 3ON6A 5IK0A 3Q75B 4GTVB 4NEIA 2I07B 4OJZA 1H3AA 3QRYA 1H35A 4YDOB 5ILIA 2XWJB 1OJNA 4KTPA 4LNVA 1GHQA 3GZKA 1IA7A 4OK2A 5CZLA 3G4DA 2EACA 1V7XA 3Q73B 2RI9A 3SQCA 1HV6A 2FBAA 1KSDA 1MZCB 2E22A 5CD2A 3M71A 4Z4LA 2F0YB 4GAXA 4KTRA 4E1YA 3DSXB 3VW5A 3QXFA 3K7XA 1N23A 4FNVA 2B4FA 1O1SB 4ZRQA 3A3VA 1N7QA 4WVCA 4TXTA 3NFVA 4C1SA 1D8EB 3DPYB 2FUQA 3QT3A 4FJQA 1EGUA 2DRQA 4KKIA 3E34B 3W7WA 2R2LB 1HCUA 2WYNA 2YIKA 1QQFA 3DSTB 1VD5A 2VN7A 4ONTA 1JS4A 3RRSA 1N94B 1I8QA 1KRFA 3Q7FB 3M02A 4L0GA 1WU6A 4V1RA 3X17A 2F6DA 1XWQA 3QFZA 3N0FA 3RENA 1HN0A 2FV0A 1FBWA 3RX7A 4D4BA 1C3DA 1FO2A 3PYAA 3PZ4B 1CLCA 1X9DA 3AFLA 3M72A 3NNBA 1GLMA 2GH4A 2IEJB 1FCEA 2SQCA 1TNZB 3Q7AB 3M7BA 3QSPA 1FBOA 1J0NA 1H12A 1O1TB 4GTTB 4LIXA 3EU5B 2RGKA 1SQCA 2EADA 2NOJA 1ULVA 3W7SA 2H6FB 1G9GA 1LXKA 2BBCA 2V8JA 3CU7A 1UT9A 3SDTA 3C72B 3DSSB 5DHKA 3HXEB 3D3IA 1NI1B 1G9JA 4CJ1A 2XWBB 5IL3A 3M76A 5ILHA 3SDRA 1GXNA 5JPMB 1TNYB 3M74A 2FUZA 2BRWA 1J0MA 4V1SA 1DOGA 1H13A 1RWHA 5ILZA 5IKHA 1RWFA 1N7NA 3ANJA 1H39A 1X1HA 2QNOA 1KFGA 1TN6B 2J5CA 1LOHA 3GT5A 1XW2A 1NL4B 2JG0A 4F13A 2GZ6A 5CA3A 3QFYA 4TF4A 1F9GA 3KQ4A 2G02A 4GTQB 3KSQB 1HXGA 5FO9B 1N4PB 1OJOA 1RWAA 1WU5A 2DROA 3DRAB 5AGDA 3PYBA 3DSWB 1TN7B 1K72A 4DOEA 3QXQA 2WINB 3D5RA 2Z07A 1TNOB 4Q2BA 3N0GA 1HXAA 2G0DA 1RWCA 3S4CA 5GW7A 1SA5B 2EABA 1L1YA 4AYRA 1F9OA 4DI5A 1HMUA 1RQ5A 1O6HA 1N7PA 2BB5A 3SAEA 1KWFA 3TF4A 2A73B 1N4SB 3OEDA 5IK9A 3P5RA 4D94A 4D4AA 1KREA 5GZKA 3WUXA 1OJPA 3PZ1B 3WKGA 5JMFA 5ILYA 3S9VA 3H3KA 3PZ3B 1UMPA 1AGMA 2WIIB 3S4BA 1GSZA 1TNUB 3SFYB 5E2JA 3SDQA 1LF6A 2DRRA 1V7VA 1KS8A 1X81B 3HXDB 3HXCB 3E30B 3HXFB 1IA6A 4YCRA 1LD7B 2FUTA 3QWTA 4RNQA 3WKIA 5ILJA 3M73A 2JF4A 1H14A 4OZWA 1SA4B 2V3NA 3M78A 4L6XA 3EQAA 1N21A 4QT9A 3E80A 2H6GB 4OZVA 3M7LA 1V5DA 3EUVB 2WY8A 1N24A 5M7IA 3SDVA 4AYOA 4GTRB 1N4RB 2WDAA 3VSNA 3E37B 1WZZA 4CE7A 4D4CA 1W6KA 3Q79B 1HMWA 3E33B 1LD8B 4KKJA 3VXDA 5JPNB 3SDUA 4DODA 3OXUA 1FMIA 4XUVA
chains in the Genus database with same CATH topology
1D8DB 3WIQA 3M7EA 2V3PA 1JCQB 2BEDB 5KKBA 3WC3A 1GXOA 3T33A 3WKHA 3PMMA 1L2AA 2CQSA 1NXCA 4BOKA 1W6JA 3QDEA 3RSYA 1GXMA 3WIRA 1WU4A 3DSUB 1O5MB 1FT1B 1N9AB 1XWTA 3P5PA 3SFXB 1AYXA 3M7CA 4M76A 1H3CA 3H7LA 2WY7A 3M75A 1UG9A 3HXBB 4J5TA 4FXKB 4L9PB 3W7UA 4Z4JA 2VN4A 2V8KA 4AYPA 3W7XA 1O1RB 4EHMB 1TN8B 1GAIA 2CQTA 3E32B 4JJJA 1QBQB 2ZISB 1H37A 4WVAA 3W5MA 1O79A 1N4QB 1JCRB 3Q78B 4GTOB 3RX8A 1QSJA 3WIWA 3S4DA 2H6HB 4GTSB 1GA2A 4EL8A 5FOBB 4MBGB 1KZPB 2EAEA 5M7YA 3QG0A 2D5JA 4LNBB 3EZ8A 3RJ3A 1H54A 4GTMB 5DGQA 1LTXB 4Q88A 1FAEA 1HZFA 2FV1A 1G6IA 3ANIA 4YDEB 3ACSA 1S63B 1JCSB 1FP3A 3ANKA 3PZ2B 4GTPB 1NC5A 1KZOB 4WVBA 2ZIRB 4FXGB 1FT2B 2XQWA 1FPPB 3ACTA 3M77A 2NVPA 3S4AA 5DGRA 2ZBLA 2AFAA 1DCEB 3G6JB 2B39A 4WU0A 3CIHA 4BOJA 1F9DA 1V7WA 4ZH5A 1FO3A 3K11A 2XFGA 1LF9A 2AHGA 1TF4A 1H36A 5GY3A 4ZH1A 3D5SA 1R76A 4CJ0A 2AHFA 1IS9A 5FO7B 4AYQA 3AFJA 5FO8B 5MEHA 3RX5A 1V5CA 2BB6A 1KKTA 3KSLB 1GAHA 1CEMA 2PN5A 3P2CA 2ZZRA 3KLSA 3EU8A 4LNGB 4ZRPA 2RI8A 4MU9A 4FUSA 3QT9A 1TNBB 2H6IB 3DSVB 3W7TA 3E6UA 4GL3A 4ZG8A 3GLYA 3WKFA 1KSCA 3W5NA 3E73A 2OKXA 2D8LA 2JJBA 2P0VA 1N95B 1G87A 1H3BA 2DRSA 2GOXA 3H2WA 1O6QA 1S64B 2V8IA 3QPFA 1DL2A 2A8ZA 2PMVA 1O6RA 4D4DA 3ON6A 3Q75B 4GTVB 2I07B 1H3AA 3QRYA 1H35A 4YDOB 2XWJB 4KTPA 4LNVA 1GHQA 3GZKA 1IA7A 5CZLA 2EACA 1V7XA 3Q73B 2RI9A 3SQCA 2FBAA 1KSDA 1MZCB 5CD2A 3M71A 4Z4LA 2F0YB 4KTRA 3DSXB 3VW5A 3QXFA 3K7XA 2B4FA 1O1SB 4ZRQA 3A3VA 4WVCA 4TXTA 4C1SA 1D8EB 3DPYB 3QT3A 2DRQA 4KKIA 3E34B 3W7WA 2R2LB 1HCUA 2WYNA 2YIKA 1QQFA 3DSTB 1VD5A 2VN7A 4ONTA 1JS4A 3RRSA 1N94B 1KRFA 3Q7FB 4L0GA 1WU6A 4V1RA 3X17A 2F6DA 1XWQA 3QFZA 3RENA 2FV0A 1FBWA 3RX7A 4D4BA 1C3DA 1FO2A 3PYAA 3PZ4B 1CLCA 1X9DA 3M72A 1GLMA 2GH4A 2IEJB 1FCEA 2SQCA 1TNZB 3Q7AB 3M7BA 3QSPA 1FBOA 1H12A 1O1TB 4GTTB 4LIXA 3EU5B 2RGKA 1SQCA 2EADA 2NOJA 1ULVA 3W7SA 2H6FB 1G9GA 2V8JA 2BBCA 3CU7A 1UT9A 3SDTA 3C72B 3DSSB 3HXEB 3D3IA 1NI1B 1G9JA 4CJ1A 2XWBB 3M76A 3SDRA 1GXNA 5JPMB 1TNYB 3M74A 2FUZA 4V1SA 1DOGA 1H13A 3ANJA 1H39A 2QNOA 1KFGA 1TN6B 3GT5A 1XW2A 1NL4B 2JG0A 2GZ6A 5CA3A 3QFYA 4TF4A 3KQ4A 2G02A 4GTQB 3KSQB 5FO9B 1N4PB 3DRAB 1WU5A 2DROA 5AGDA 3PYBA 3DSWB 1TN7B 1K72A 4DOEA 3QXQA 2WINB 3D5RA 2Z07A 1TNOB 4Q2BA 2G0DA 3S4CA 5GW7A 1SA5B 2EABA 1L1YA 4AYRA 1F9OA 1RQ5A 1O6HA 2BB5A 3SAEA 1KWFA 3TF4A 2A73B 1N4SB 3OEDA 3P5RA 4D94A 4D4AA 1KREA 5GZKA 3WUXA 3PZ1B 3WKGA 3S9VA 3H3KA 3PZ3B 1UMPA 1AGMA 2WIIB 3S4BA 1GSZA 1TNUB 3SFYB 5E2JA 3SDQA 1LF6A 2DRRA 1V7VA 1KS8A 1X81B 3HXDB 3HXCB 3E30B 3HXFB 1IA6A 4YCRA 1LD7B 3WKIA 3QWTA 3M73A 2JF4A 1H14A 1SA4B 2V3NA 3M78A 4L6XA 3EQAA 4QT9A 2H6GB 3M7LA 1V5DA 3EUVB 2WY8A 5M7IA 3SDVA 4AYOA 4GTRB 1N4RB 3E37B 1WZZA 4CE7A 4D4CA 1W6KA 3Q79B 3E33B 1LD8B 4KKJA 3VXDA 5JPNB 3SDUA 4DODA 3OXUA 1FMIA 4XUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIR B;  4FXG B;  1D8D B;  1FT2 B;  2XQW A;  1FPP B;  3Q73 B;  3SQC A;  3KQ4 A;  2G02 A;  1MZC B;  2V3P A;  4GTQ B;  3KSQ B;  5FO9 B;  1JCQ B;  2BED B;  2F0Y B;  1N4P B;  3DRA B;  5AGD A;  3DSX B;  1DCE B;  1GXO A;  3DSW B;  3K7X A;  3G6J B;  1TN7 B;  2B39 A;  4BOJ A;  1O1S B;  4ZRQ A;  2WIN B;  4BOK A;  1W6J A;  3D5R A;  4C1S A;  1D8E B;  1GXM A;  1TNO B;  3DPY B;  1H36 A;  4KKI A;  3E34 B;  4ZH1 A;  2R2L B;  2G0D A;  3D5S A;  3DSU B;  1O5M B;  1FT1 B;  1R76 A;  1N9A B;  1QQF A;  3SFX B;  3DST B;  5FO7 B;  1SA5 B;  4ONT A;  4M76 A;  1H3C A;  1N94 B;  5FO8 B;  3Q7F B;  2WY7 A;  1O6H A;  2BB5 A;  2BB6 A;  3KSL B;  4V1R A;  3HXB B;  2PN5 A;  2A73 B;  4FXK B;  1N4S B;  3OED A;  4L9P B;  4D94 A;  4D4A A;  3KLS A;  2V8K A;  3PZ1 B;  1O1R B;  4D4B A;  1C3D A;  4LNG B;  4EHM B;  3PZ4 B;  1TN8 B;  4ZRP A;  3E32 B;  3PZ3 B;  4MU9 A;  1QBQ B;  2IEJ B;  2SQC A;  1UMP A;  2ZIS B;  1H37 A;  2WII B;  1TNZ B;  1TNB B;  3Q7A B;  1GSZ A;  1TNU B;  1O79 A;  1N4Q B;  3SFY B;  2H6I B;  3DSV B;  1O1T B;  4GTT B;  1JCR B;  3EU5 B;  3Q78 B;  4GTO B;  1QSJ A;  1SQC A;  2NOJ A;  2H6F B;  2V8J A;  1X81 B;  2BBC A;  3HXD B;  3HXC B;  3E30 B;  3CU7 A;  2H6H B;  3HXF B;  4GTS B;  3C72 B;  3DSS B;  1LD7 B;  3HXE B;  5FOB B;  1NI1 B;  1N95 B;  2XWB B;  4MBG B;  1KZP B;  1SA4 B;  2V3N A;  4LNB B;  3RJ3 A;  1H3B A;  1GXN A;  4GTM B;  5JPM B;  1TNY B;  1LTX B;  2GOX A;  2H6G B;  1O6Q A;  1S64 B;  2V8I A;  4V1S A;  2PMV A;  1HZF A;  2WY8 A;  3EUV B;  1O6R A;  4YDE B;  4D4D A;  1S63 B;  4GTR B;  3Q75 B;  1JCS B;  1N4R B;  4GTV B;  2I07 B;  1H39 A;  3E37 B;  1H3A A;  1H35 A;  1TN6 B;  3PZ2 B;  4YDO B;  4D4C A;  4GTP B;  1W6K A;  3Q79 B;  2XWJ B;  4LNV A;  1KZO B;  1LD8 B;  1GHQ A;  1NL4 B;  3E33 B;  4KKJ A;  5JPN B;  3OXU A; 
#chains in the Genus database with same CATH topology
 1D8D B;  5IM1 A;  3WIQ A;  3M7E A;  2V3P A;  1N7R A;  1JCQ B;  2BED B;  5KKB A;  3WC3 A;  1GXO A;  3T33 A;  3WKH A;  3PMM A;  3E7J A;  1L2A A;  2CQS A;  3VSM A;  1NXC A;  1C82 A;  4BOK A;  1W6J A;  3QDE A;  3RSY A;  1GXM A;  3WIR A;  1WU4 A;  3DSU B;  1O5M B;  4MMH A;  1FT1 B;  1LXM A;  1N9A B;  1XWT A;  3P5P A;  2ONH A;  3SFX B;  1AYX A;  3M7C A;  4M76 A;  1H3C A;  3H7L A;  3M01 A;  2WY7 A;  3M75 A;  1UG9 A;  3HXB B;  4J5T A;  4FXK B;  4L9P B;  3W7U A;  4Z4J A;  2VN4 A;  2V8K A;  4AYP A;  3W7X A;  1O1R B;  1W3Y A;  5ILD A;  4EHM B;  1TN8 B;  1GAI A;  1N1B A;  2CQT A;  2E24 A;  3E32 B;  4JJJ A;  1QBQ B;  2ZIS B;  1H37 A;  4WVA A;  3W5M A;  1O79 A;  1N4Q B;  1F1S A;  1JCR B;  3Q78 B;  4GTO B;  3RX8 A;  1QSJ A;  3WIW A;  5IL8 A;  3S4D A;  5IKA A;  2WCO A;  5ILK A;  4OK4 A;  2H6H B;  4GTS B;  1GA2 A;  3G4F A;  1HM3 A;  4EL8 A;  5FOB B;  1RW9 A;  3M00 A;  3LZ9 A;  1KZP B;  4MBG B;  2EAE A;  5M7Y A;  3QG0 A;  2D5J A;  4LNB B;  3EZ8 A;  3RJ3 A;  1HX9 A;  1H54 A;  4GTM B;  5DGQ A;  1LTX B;  4Q88 A;  1FAE A;  1X1J A;  1HZF A;  2FV1 A;  1CB8 A;  5EAT A;  1G6I A;  3ANI A;  4YDE B;  3ACS A;  1S63 B;  1JCS B;  1FP3 A;  3ANK A;  3PZ2 B;  4GTP B;  2BRP A;  1HM2 A;  2BRV X;  4F10 A;  1NC5 A;  5C05 A;  1KZO B;  4WVB A;  2ZIR B;  1N20 A;  4FXG B;  1FT2 B;  2XQW A;  1FPP B;  3ACT A;  3M77 A;  2NVP A;  3S4A A;  5DGR A;  2ZBL A;  2AFA A;  2ONG A;  1DCE B;  3G6J B;  2B39 A;  5EAS A;  4WU0 A;  3CIH A;  4BOJ A;  1F9D A;  1OJM A;  1V7W A;  4ZH5 A;  1FO3 A;  3K11 A;  2XFG A;  1LF9 A;  2AHG A;  1TF4 A;  1H36 A;  5GY3 A;  4ZH1 A;  3D5S A;  1R76 A;  4CJ0 A;  2AHF A;  1IS9 A;  5FO7 B;  4AYQ A;  3AFJ A;  5FO8 B;  1RWG A;  5MEH A;  3RX5 A;  1V5C A;  2BB6 A;  1KKT A;  3KSL B;  1GAH A;  1CEM A;  2PN5 A;  3P2C A;  2ZZR A;  3KLS A;  3EU8 A;  5EAU A;  1X1I A;  4LNG B;  4ZRP A;  2RI8 A;  5JMD A;  4MU9 A;  1HXC A;  4FUS A;  3QT9 A;  1TNB B;  1N7O A;  1N1Z A;  2H6I B;  3DSV B;  3W7T A;  3E6U A;  4GL3 A;  4ZG8 A;  3GLY A;  3WKF A;  1KSC A;  2Q1F A;  5IK6 A;  3W5N A;  3E73 A;  2OKX A;  2D8L A;  3A0O A;  4MMI A;  5DHI A;  1N22 A;  2JJB A;  2P0V A;  1N95 B;  1G87 A;  1H3B A;  2DRS A;  2GOX A;  3H2W A;  1O6Q A;  1QAZ A;  1S64 B;  2V8I A;  3QPF A;  1DL2 A;  2A8Z A;  2PMV A;  1O6R A;  2X03 A;  4D4D A;  3ON6 A;  5IK0 A;  3Q75 B;  4GTV B;  4NEI A;  2I07 B;  4OJZ A;  1H3A A;  3QRY A;  1H35 A;  4YDO B;  5ILI A;  2XWJ B;  1OJN A;  4KTP A;  4LNV A;  1GHQ A;  3GZK A;  1IA7 A;  4OK2 A;  5CZL A;  3G4D A;  2EAC A;  1V7X A;  3Q73 B;  2RI9 A;  3SQC A;  1HV6 A;  2FBA A;  1KSD A;  1MZC B;  2E22 A;  5CD2 A;  3M71 A;  4Z4L A;  2F0Y B;  4GAX A;  4KTR A;  4E1Y A;  3DSX B;  3VW5 A;  3QXF A;  3K7X A;  1N23 A;  4FNV A;  2B4F A;  1O1S B;  4ZRQ A;  3A3V A;  1N7Q A;  4WVC A;  4TXT A;  3NFV A;  4C1S A;  1D8E B;  3DPY B;  2FUQ A;  3QT3 A;  4FJQ A;  1EGU A;  2DRQ A;  4KKI A;  3E34 B;  3W7W A;  2R2L B;  1HCU A;  2WYN A;  2YIK A;  1QQF A;  3DST B;  1VD5 A;  2VN7 A;  4ONT A;  1JS4 A;  3RRS A;  1N94 B;  1I8Q A;  1KRF A;  3Q7F B;  3M02 A;  4L0G A;  1WU6 A;  4V1R A;  3X17 A;  2F6D A;  1XWQ A;  3QFZ A;  3N0F A;  3REN A;  1HN0 A;  2FV0 A;  1FBW A;  3RX7 A;  4D4B A;  1C3D A;  1FO2 A;  3PYA A;  3PZ4 B;  1CLC A;  1X9D A;  3AFL A;  3M72 A;  3NNB A;  1GLM A;  2GH4 A;  2IEJ B;  1FCE A;  2SQC A;  1TNZ B;  3Q7A B;  3M7B A;  3QSP A;  1FBO A;  1J0N A;  1H12 A;  1O1T B;  4GTT B;  4LIX A;  3EU5 B;  2RGK A;  1SQC A;  2EAD A;  2NOJ A;  1ULV A;  3W7S A;  2H6F B;  1G9G A;  1LXK A;  2BBC A;  2V8J A;  3CU7 A;  1UT9 A;  3SDT A;  3C72 B;  3DSS B;  5DHK A;  3HXE B;  3D3I A;  1NI1 B;  1G9J A;  4CJ1 A;  2XWB B;  5IL3 A;  3M76 A;  5ILH A;  3SDR A;  1GXN A;  5JPM B;  1TNY B;  3M74 A;  2FUZ A;  2BRW A;  1J0M A;  4V1S A;  1DOG A;  1H13 A;  1RWH A;  5ILZ A;  5IKH A;  1RWF A;  1N7N A;  3ANJ A;  1H39 A;  1X1H A;  2QNO A;  1KFG A;  1TN6 B;  2J5C A;  1LOH A;  3GT5 A;  1XW2 A;  1NL4 B;  2JG0 A;  4F13 A;  2GZ6 A;  5CA3 A;  3QFY A;  4TF4 A;  1F9G A;  3KQ4 A;  2G02 A;  4GTQ B;  3KSQ B;  1HXG A;  5FO9 B;  1N4P B;  1OJO A;  1RWA A;  1WU5 A;  2DRO A;  3DRA B;  5AGD A;  3PYB A;  3DSW B;  1TN7 B;  1K72 A;  4DOE A;  3QXQ A;  2WIN B;  3D5R A;  2Z07 A;  1TNO B;  4Q2B A;  3N0G A;  1HXA A;  2G0D A;  1RWC A;  3S4C A;  5GW7 A;  1SA5 B;  2EAB A;  1L1Y A;  4AYR A;  1F9O A;  4DI5 A;  1HMU A;  1RQ5 A;  1O6H A;  1N7P A;  2BB5 A;  3SAE A;  1KWF A;  3TF4 A;  2A73 B;  1N4S B;  3OED A;  5IK9 A;  3P5R A;  4D94 A;  4D4A A;  1KRE A;  5GZK A;  3WUX A;  1OJP A;  3PZ1 B;  3WKG A;  5JMF A;  5ILY A;  3S9V A;  3H3K A;  3PZ3 B;  1UMP A;  1AGM A;  2WII B;  3S4B A;  1GSZ A;  1TNU B;  3SFY B;  5E2J A;  3SDQ A;  1LF6 A;  2DRR A;  1V7V A;  1KS8 A;  1X81 B;  3HXD B;  3HXC B;  3E30 B;  3HXF B;  1IA6 A;  4YCR A;  1LD7 B;  2FUT A;  3QWT A;  4RNQ A;  3WKI A;  5ILJ A;  3M73 A;  2JF4 A;  1H14 A;  4OZW A;  1SA4 B;  2V3N A;  3M78 A;  4L6X A;  3EQA A;  1N21 A;  4QT9 A;  3E80 A;  2H6G B;  4OZV A;  3M7L A;  1V5D A;  3EUV B;  2WY8 A;  1N24 A;  5M7I A;  3SDV A;  4AYO A;  4GTR B;  1N4R B;  2WDA A;  3VSN A;  3E37 B;  1WZZ A;  4CE7 A;  4D4C A;  1W6K A;  3Q79 B;  1HMW A;  3E33 B;  1LD8 B;  4KKJ A;  3VXD A;  5JPN B;  3SDU A;  4DOD A;  3OXU A;  1FMI A;  4XUV A; 
#chains in the Genus database with same CATH homology
 1D8D B;  3WIQ A;  3M7E A;  2V3P A;  1JCQ B;  2BED B;  5KKB A;  3WC3 A;  1GXO A;  3T33 A;  3WKH A;  3PMM A;  1L2A A;  2CQS A;  1NXC A;  4BOK A;  1W6J A;  3QDE A;  3RSY A;  1GXM A;  3WIR A;  1WU4 A;  3DSU B;  1O5M B;  1FT1 B;  1N9A B;  1XWT A;  3P5P A;  3SFX B;  1AYX A;  3M7C A;  4M76 A;  1H3C A;  3H7L A;  2WY7 A;  3M75 A;  1UG9 A;  3HXB B;  4J5T A;  4FXK B;  4L9P B;  3W7U A;  4Z4J A;  2VN4 A;  2V8K A;  4AYP A;  3W7X A;  1O1R B;  4EHM B;  1TN8 B;  1GAI A;  2CQT A;  3E32 B;  4JJJ A;  1QBQ B;  2ZIS B;  1H37 A;  4WVA A;  3W5M A;  1O79 A;  1N4Q B;  1JCR B;  3Q78 B;  4GTO B;  3RX8 A;  1QSJ A;  3WIW A;  3S4D A;  2H6H B;  4GTS B;  1GA2 A;  4EL8 A;  5FOB B;  4MBG B;  1KZP B;  2EAE A;  5M7Y A;  3QG0 A;  2D5J A;  4LNB B;  3EZ8 A;  3RJ3 A;  1H54 A;  4GTM B;  5DGQ A;  1LTX B;  4Q88 A;  1FAE A;  1HZF A;  2FV1 A;  1G6I A;  3ANI A;  4YDE B;  3ACS A;  1S63 B;  1JCS B;  1FP3 A;  3ANK A;  3PZ2 B;  4GTP B;  1NC5 A;  1KZO B;  4WVB A;  2ZIR B;  4FXG B;  1FT2 B;  2XQW A;  1FPP B;  3ACT A;  3M77 A;  2NVP A;  3S4A A;  5DGR A;  2ZBL A;  2AFA A;  1DCE B;  3G6J B;  2B39 A;  4WU0 A;  3CIH A;  4BOJ A;  1F9D A;  1V7W A;  4ZH5 A;  1FO3 A;  3K11 A;  2XFG A;  1LF9 A;  2AHG A;  1TF4 A;  1H36 A;  5GY3 A;  4ZH1 A;  3D5S A;  1R76 A;  4CJ0 A;  2AHF A;  1IS9 A;  5FO7 B;  4AYQ A;  3AFJ A;  5FO8 B;  5MEH A;  3RX5 A;  1V5C A;  2BB6 A;  1KKT A;  3KSL B;  1GAH A;  1CEM A;  2PN5 A;  3P2C A;  2ZZR A;  3KLS A;  3EU8 A;  4LNG B;  4ZRP A;  2RI8 A;  4MU9 A;  4FUS A;  3QT9 A;  1TNB B;  2H6I B;  3DSV B;  3W7T A;  3E6U A;  4GL3 A;  4ZG8 A;  3GLY A;  3WKF A;  1KSC A;  3W5N A;  3E73 A;  2OKX A;  2D8L A;  2JJB A;  2P0V A;  1N95 B;  1G87 A;  1H3B A;  2DRS A;  2GOX A;  3H2W A;  1O6Q A;  1S64 B;  2V8I A;  3QPF A;  1DL2 A;  2A8Z A;  2PMV A;  1O6R A;  4D4D A;  3ON6 A;  3Q75 B;  4GTV B;  2I07 B;  1H3A A;  3QRY A;  1H35 A;  4YDO B;  2XWJ B;  4KTP A;  4LNV A;  1GHQ A;  3GZK A;  1IA7 A;  5CZL A;  2EAC A;  1V7X A;  3Q73 B;  2RI9 A;  3SQC A;  2FBA A;  1KSD A;  1MZC B;  5CD2 A;  3M71 A;  4Z4L A;  2F0Y B;  4KTR A;  3DSX B;  3VW5 A;  3QXF A;  3K7X A;  2B4F A;  1O1S B;  4ZRQ A;  3A3V A;  4WVC A;  4TXT A;  4C1S A;  1D8E B;  3DPY B;  3QT3 A;  2DRQ A;  4KKI A;  3E34 B;  3W7W A;  2R2L B;  1HCU A;  2WYN A;  2YIK A;  1QQF A;  3DST B;  1VD5 A;  2VN7 A;  4ONT A;  1JS4 A;  3RRS A;  1N94 B;  1KRF A;  3Q7F B;  4L0G A;  1WU6 A;  4V1R A;  3X17 A;  2F6D A;  1XWQ A;  3QFZ A;  3REN A;  2FV0 A;  1FBW A;  3RX7 A;  4D4B A;  1C3D A;  1FO2 A;  3PYA A;  3PZ4 B;  1CLC A;  1X9D A;  3M72 A;  1GLM A;  2GH4 A;  2IEJ B;  1FCE A;  2SQC A;  1TNZ B;  3Q7A B;  3M7B A;  3QSP A;  1FBO A;  1H12 A;  1O1T B;  4GTT B;  4LIX A;  3EU5 B;  2RGK A;  1SQC A;  2EAD A;  2NOJ A;  1ULV A;  3W7S A;  2H6F B;  1G9G A;  2V8J A;  2BBC A;  3CU7 A;  1UT9 A;  3SDT A;  3C72 B;  3DSS B;  3HXE B;  3D3I A;  1NI1 B;  1G9J A;  4CJ1 A;  2XWB B;  3M76 A;  3SDR A;  1GXN A;  5JPM B;  1TNY B;  3M74 A;  2FUZ A;  4V1S A;  1DOG A;  1H13 A;  3ANJ A;  1H39 A;  2QNO A;  1KFG A;  1TN6 B;  3GT5 A;  1XW2 A;  1NL4 B;  2JG0 A;  2GZ6 A;  5CA3 A;  3QFY A;  4TF4 A;  3KQ4 A;  2G02 A;  4GTQ B;  3KSQ B;  5FO9 B;  1N4P B;  3DRA B;  1WU5 A;  2DRO A;  5AGD A;  3PYB A;  3DSW B;  1TN7 B;  1K72 A;  4DOE A;  3QXQ A;  2WIN B;  3D5R A;  2Z07 A;  1TNO B;  4Q2B A;  2G0D A;  3S4C A;  5GW7 A;  1SA5 B;  2EAB A;  1L1Y A;  4AYR A;  1F9O A;  1RQ5 A;  1O6H A;  2BB5 A;  3SAE A;  1KWF A;  3TF4 A;  2A73 B;  1N4S B;  3OED A;  3P5R A;  4D94 A;  4D4A A;  1KRE A;  5GZK A;  3WUX A;  3PZ1 B;  3WKG A;  3S9V A;  3H3K A;  3PZ3 B;  1UMP A;  1AGM A;  2WII B;  3S4B A;  1GSZ A;  1TNU B;  3SFY B;  5E2J A;  3SDQ A;  1LF6 A;  2DRR A;  1V7V A;  1KS8 A;  1X81 B;  3HXD B;  3HXC B;  3E30 B;  3HXF B;  1IA6 A;  4YCR A;  1LD7 B;  3WKI A;  3QWT A;  3M73 A;  2JF4 A;  1H14 A;  1SA4 B;  2V3N A;  3M78 A;  4L6X A;  3EQA A;  4QT9 A;  2H6G B;  3M7L A;  1V5D A;  3EUV B;  2WY8 A;  5M7I A;  3SDV A;  4AYO A;  4GTR B;  1N4R B;  3E37 B;  1WZZ A;  4CE7 A;  4D4C A;  1W6K A;  3Q79 B;  3E33 B;  1LD8 B;  4KKJ A;  3VXD A;  5JPN B;  3SDU A;  4DOD A;  3OXU A;  1FMI A;  4XUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...