3HXKA

Crystal structure of a sugar hydrolase (yeeb) from lactococcus lactis, northeast structural genomics consortium target kr108
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
256
structure length
250
Chain Sequence
NKSTFSLNDTAWVDFYQLQNYTFPAIIICPGGGYQHISQRESDPLALAFLAQGYQVLLLNYTVMNKGTNYNFLSQNLEEVQAVFSLIHQNHKEWQINPEQVFLLGCSAGGHLAAWYGNSEQIHRPKGVILCYPVTSFTFGWPSDLSHFNFEIENISEYNISEKVTSSTPPTFIWHTADDEGVPIYNSLKYCDRLSKHQVPFEAHFFESGPHGVSLANRTTAPSDAYCLPSVHRWVSWASDWLERQIKNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a sugar hydrolase (YeeB) from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR108
rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
molecule keywords Sugar hydrolase
total genus 63
structure length 250
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hxkA00
5FV4A 5EHNA 5BWBA 3A70A 1WHSA 2ZYIA 3WLAA 3WWDA 1J2EA 1KEZA 2WIDA 1IMJA 4AO6A 1Y7HA 4FKBA 4FTWA 3LIIA 3GFFA 1QOZA 4WJLA 3FYUB 5AM0A 3RARA 3TJMA 1SFRA 4WDQA 4FNMA 1MPXA 4AO8A 1EXWA 5EIAA 4K6GA 1E5TA 2ACEA 3D3NA 3OC0A 3GROA 4X71A 4BBZA 1L7AA 2Z5GA 2W22A 3GA7A 1QIGA 3DEAA 1VLQA 3BDIA 3L1IA 3VXKA 5JAPA 3W05A 5AK4A 2ECFA 1BU8A 1WPXA 2RGUA 4EHBA 2XQKA 4GW3A 2QVBA 4G8CA 5ALOA 1CUFA 2P8SA 4OU5A 3RLIA 5IVIA 1LBSA 2CZQA 2PSEA 1N1MA 3OG9A 5D3KA 3H2IA 3IUMA 1GZ7A 3QM1A 2OCGA 3EQ7A 5DYWA 3QMWA 4G9EA 1OILA 2AJBA 1E8DA 2BAGA 3OPMA 3H1BA 4DLNA 5ALSA 3D2AA 3DD5A 5LZ5A 4W1SA 1CUBA 4AQDA 4ZREA 1EK2A 4A5SA 4BZZA 2BCEA 3G9ZA 1BS9A 4GHWA 4ZRDA 4U2EA 2XUKA 3SWWA 1LGYA 3FSGA 3IDAA 5ALXA 1CRLA 1LPBB 2BUAA 4OSEA 3D5EA 4CG3A 4KRYA 3AUKA 4GLBA 4BE4A 1XZCA 1K6EA 3WK8A 1B6GA 1LZLA 1MNAA 2BJHA 1CVLA 3Q0TA 3WWCA 4J0DA 1PJAA 4B84A 1AURA 3R3ZA 5AI5A 4KR0A 1MJ5A 2DQZA 3ZLUA 3H04A 1H2XA 1UK8A 2EDAA 3DOIA 2RAUA 4H7DA 3V9AA 3G7NA 4W9RA 1AMNA 3FBWA 1GQRA 4EUSA 5AKYA 1R1DA 2X5XA 1ZI9A 2VSQA 4FBMA 3M83A 3BIXA 2I78A 4YASA 4ITVA 2IIVA 2ROQA 1XZMA 3MGAA 2O2IA 4FLFA 4B9AA 4QDTA 2QTBA 4BP8A 5CXXA 2CJPA 5AHXA 2XUFA 2WG0A 5HFAA 5LKRA 2HU7A 2JGIA 4LXIA 1KU6A 4IO0A 3QH4A 1C7IA 5CBKA 5ALJA 4WFIA 1FFAA 3PUHA 7YASA 3C6XA 4B82A 1S8OA 4UHEA 2Y2UA 3R3WA 1DTEA 2NW6A 4YPVA 1YB7A 1JT2A 4CCYA 1EVEA 5FOQA 2R11A 1A8QA 1RWQA 3WZLA 3I2HA 4Y2RA 3R3UA 5AKHA 3C6BA 1CUXA 3H2HA 5AOBA 3H1AA 4QLOA 2OCLA 4EY7A 1CQWA 1U8EA 3ESCA 4BRSA 3PF9A 5CT8A 2VQ6A 4X85A 4GDMA 5ALKA 1JU3A 3WL6A 1QTIA 2HFJA 3BE8A 5LZ4A 4BC0A 3PE6A 2FX5A 5JZSA 1H2WA 2GYWA 4L72A 2CEKA 2PX6A 5AKJA 1A88A 1EDDA 2XUOA 2Z3ZA 4XVCA 1XZJA 1MT3A 2FUKA 2BGRA 1CUZA 1ACJA 2AXEA 1GKLA 2CMFA 3QPCA 5HQ3A 1QFMA 4JH0A 3QPDA 3V1LA 4PO3X 2PBLA 3ANSA 5IVDA 5AH0A 4DMHA 4E11A 1QIEA 4UUQA 5AKEA 4U2FA 2PSJA 3VJMA 1XZLA 4DMFA 2E3JA 4CCYB 3FVTA 2DR0A 4EA6A 4BB0A 3AZQA 4DYHA 5ALLA 2PVSA 4RE5A 2CB9A 3F8SA 1Q83A 5A7GA 3VISA 4ZV7A 4BRZA 2ZSHA 4PSCA 4AMYA 5CT9A 3O4IA 1CR6A 5HK8A 4C87A 2PL5A 5AKKA 5A6VA 2PUHA 1BCRA 1UXOA 2DCMA 3G0CA 4MJ3A 3GZJA 3C5WP 4BTVA 2JGEA 3C70A 3STXA 1E8MA 2CKMA 5DNWA 1FSSA 3STTA 2QRUA 1MN6A 3WI7A 3I1YA 4DMCA 1JMYA 2ZVDA 1W6RA 2YASA 2XLCA 4HS9A 2RIPA 2WG1A 4V2IA 3U1TA 1G42A 4EY6A 5K3BA 5DTIA 2OXEA 2WU4A 5HF8A 2VJBA 3C8HA 3DJYA 1ZD4A 3EF3A 5AM3A 3W9BA 1WB4A 1C4XA 3L1HA 1EI9A 1SCIA 5ALMA 5JZBA 2V9ZA 4F21A 1UKBA 1ZI6A 1UWCA 2XB6A 5C81A 4QDOA 1XZKA 1BEZA 5CTAA 5BOVA 2WFMA 5ALFA 3I2GA 1CUUA 4UBJA 1ZI8A 2Y6VA 1HKHA 3D59A 1E3QA 3L1JA 1R88A 1BCSA 3UUFA 4CCWA 4GI1A 4X91A 1XZAA 5JADA 1U4NA 1GKKA 5AM1A 3P2MA 1TQHA 1K4YA 1ODSA 1DX6A 3QYJA 1U2EA 3PI6A 4UPDA 1CUHA 4KACA 2I03A 1AKNA 4S0XA 3N2ZB 2WQZA 1ZJ5A 5IKXA 2WU3A 5ALRA 2XMQA 4G8DA 1E8NA 1Q0RA 4KAAA 2UZ0A 2XMSA 1EB8A 1EDBA 1QONA 2XLBA 1MO2A 2XMZA 5CW2A 4H77A 2B20A 4J0HA 3AZOA 1CUSA 3LIPA 5K3FA 5FPQA 1CUCA 4O08A 3I28A 1F0PA 1YSCA 5EGNA 5ALHA 2O2GA 3JW8A 3V1NA 1IZ8A 2HU8A 3X3HA 4Q82A 4FHZA 4QWMA 4MEAA 1U65A 3WK5A 5JD5A 4TGLA 3STYA 3A6ZA 5T4BA 1ZGBA 4K6KA 3IURA 5AKZA 3STVA 1LPPA 1XZIA 4G4GA 5ESRA 2ZJ6A 2WIFA 3UUEA 1A8SA 5AI8A 2VAVA 5DWDA 4X6XA 4FBLA 4CI9A 2XUPA 2ZYHA 2GZSA 2I3ZA 4B80A 2QUBA 1ODCA 2X76A 5A2GA 2H1IA 1QJ4A 3O9MA 3NUZA 5LYYA 3WKCA 1VKHA 4C4XA 3CCCA 3QPAA 2OGTA 2OAGA 2H9YA 3WWEA 2DHCA 3H2GA 5AK5A 5E4TA 1H2YA 4WY8A 4DGQA 3G0GA 4W63A 1SOMA 5EFZA 2QOEA 5CH3A 1VOTA 3N0TA 1OXMA 5AKXA 4C01A 4HRXA 5IVKA 1EH5A 1K63A 4JUIA 3KWFA 4RGYA 1ZD2P 5KWIA 4BYMA 5ALIA 2ORYA 3DKRA 4X93A 5KBYA 2PU5A 4LXHA 4J0GA 4BVLA 4K2AA 4NS4A 2WSLA 2WHQA 3QZUA 4W1QA 5EHZA 3G9XA 4RNCA 4UBMA 1XQYA 5HQ3B 2G4LA 5ALPA 4N5IX 4I19A 5ALDA 1GPLA 3FCYA 4H7JA 2QKYA 1XFDA 2HA4A 3E4DA 1DX4A 5I7UA 2BUBA 3QMVA 1VE7A 3FYTA 2O7VA 3W04A 3I6ZA 1NU8A 5DLPA 1R3DA 3ILSA 4PW0A 1QIJA 5C8XA 1ISPA 5T4EA 3VDXA 2FJ0A 4HZGA 2C5GA 1YS1X 3WL7A 1ODTC 3HI4A 4N8SA 5LKAA 3E0XA 3HABA 4LXGA 5DJ5A 1H23A 4KEAA 4QE3A 1CQZA 2WHPB 5HF9A 3SK0A 1W4LA 2H7YA 3WA7A 3V1MA 1XKTA 4G4JA 1CUWA 4WY5A 2I3DA 4OB8A 3WKDA 5ALQA 4WFKA 3IA2A 1XZFA 1F0NA 3WZMA 3T52A 1W1IA 4UBNA 4E46A 1EINA 4G8BA 3EQ9A 5E4YA 3R41A 3WK4A 3LLCA 1ETHA 4A16A 2XQJA 4AXBA 1ZOIA 3O4HA 4Q3KA 3A2NA 1TAHA 2W6CX 1RYYA 4NVRA 5EHXA 4BVKA 2OGZA 4KE7A 2VF2A 4G5XA 4Q3LA 3KWJA 4HVTA 1BN7A 2XMRA 3STWA 1BE0A 1DQZA 4QNNA 1NX9A 2XQGA 2JGKA 2VJCA 1ZD3A 2XUAA 4OB6A 4FLMA 4P92A 3C43A 1VZ2A 1DWOA 2DHDA 4J0JA 2JEZA 3FCXA 2XI4A 3DYIA 2JGFA 3DDUA 5C8VA 1YB6A 3VJKA 4BVJA 4J0IA 4LYEA 2VEOA 4UBLA 2Z8XA 5AI4A 3WIOA 5T4FA 1XRRA 5DNVA 2XUDA 4YK7A 1FFEA 3IVMA 4LHEA 3BXPA 1LZKA 1DINA 3B3QA 2J3DA 1CEXA 4P9NA 1LPSA 1CUAA 4C89A 3RM3A 4X90A 1R9MA 2B4KA 3KD2A 1R50A 3WWOA 2HA6A 2YH2A 3KDAA 4UHDA 3LCRA 5DYTA 2WJ4A 5A7HA 1X70A 3BWXA 2WUGA 1WB5A 3ICWA 4NMWA 4QWWA 3O0DA 1CUIA 1W52X 2V96A 2GYUA 1DWQA 5K3CA 2R8BA 5CT6A 1ZIXA 4OUKX 4X6YA 4AO7A 4DNQA 2PKYX 1H2ZA 2ZSIA 1AGYA 3B5EA 4ZGBA 5D7BA 2QT9A 2GBGA 4MYSA 1QIKA 1L7QA 4CIAA 4ARAA 3R3XA 2Y2VA 2XUIA 1RP1A 5CURA 3FVRA 1EX9A 3FNBA 4AZ3A 4H0CA 2QJRA 5AI0A 1MTZA 4JYPA 3KSRA 1LPMA 5AO9A 5ALEA 4CIBA 3DYVA 2J4FA 4X3CA 4BAUA 3ZLTA 3PFCA 3AFIA 1MAHA 2GBCA 4KAJA 4PSDA 1UOQA 1JJFA 2XDWA 5SYMA 3AIMA 5C8ZA 1MU0A 2VT6A 5DNUA 3DCNA 4AB1A 3NOXA 2HDWA 4XIIA 1WPRA 2ZYSA 2VJAA 2GBFA 4WFJA 2WIKA 3D7RA 2DQYA 5A7FA 1JFRA 4Y2JA 1MX9A 2H7XA 1CUEA 3D2CA 1SCQA 1XRMA 3FLAA 2GYVA 4UFOA 4OB7A 4GXNA 5AOCA 1K5PA 4G4IA 1XQXA 3TEJA 4JEIA 4EY8A 3O4JA 1P0QA 3G0DA 1UZAA 2FJPA 4QDZA 2JBWA 4J0KA 4DSAA 4PSUA 4H7HA 4KYVA 3ZV7A 1CUDA 1FFBA 1UK6A 2HADA 2GBIA 1ORWA 1W76A 5JZ9A 3I1IA 1L7RA 3W06A 1OCEA 4I4CA 1KU0A 4Y9SA 2K2QB 4DNFA 4UHCA 5EI5A 4J0CA 4DNPA 4AMZA 4DMKA 5HFNA 5JD6A 4C4ZA 5HKAA 5FXMA 3AIKA 5CT5A 5FUMA 4P08A 5HF5A 3HSSA 1EA5A 4XJVA 3IBTA 4A23A 4OCZA 3WKBA 1XZHA 3AZPA 1LPAB 4X94A 4QA9A 3MVEA 4QZVA 2PSDA 2WKWA 2VA9A 3I2IA 4H7FA 4KE6A 2B61A 2WFLB 4J3JA 1P0MA 3H2KA 1QZ3A 1YA8A 4UFNA 3CXUA 3FAKA 4TPKA 4N5HX 4OPMA 1EK1A 3WK7A 1EVQA 1QIIA 4Z49A 3WL8A 4Y2YA 3NGMA 1F6WA 4QLAA 3HJUA 2RONA 4X92A 2CUTA 4UBIA 1YCDA 2HRRA 1AX9A 4IH9A 4UHHA 4UFPA 1LNSA 1M33A 1FFCA 3H19A 3PUIA 3H0CA 5CXUA 4F60A 1VXRA 4CG1A 4Q34A 5LZ9A 5K3DA 2HL6A 4PNZA 1ZGCA 2PSHA 4EY4A 4Q1VA 4B0OA 3QITA 1UFOA 5AP9A 5H3HA 3DNMA 3ESBA 5ALYA 4B9EA 3JYHA 5JD4A 5K5EA 4H18A 3BJRA 3RK4A 1Y37A 5K3AA 1TCBA 2ZJFA 2QXUA 4UBKA 1X2BA 1LPNA 3VVLA 3KXPA 1GPNA 3BDVA 1D07A 4BCBA 5K3EA 4IQ4A 1QFSA 1XRPA 1ORVA 1UKAA 2BUCA 1Y7IA 1J06A 2JGJA 1QE3A 2LIPA 4E15A 4RPCA 2ES4A 4B0PA 5SYNA 1Z68A 3PFBA 5EHQA 5K3FB 5JASA 2QZPA 3I6YA 2WFLA 2OQVA 4UBOA 1T4MA 1QIFA 5LZ8A 4OD0A 2V97A 2IITA 3CCBA 4J7AA 5FRDA 1HQDA 2Q0XA 2HA7A 2HIHA 2G5PA 4U2BA 2C5FA 4HXFB 3V1KA 1EB9A 1UK9A 2Y1KA 5F4ZA 2WJ3A 1UT6A 3SX4A 4X00A 1LPOA 1GT6A 5C7YA 4XWGA 3TRDA 4K5QA 3F9CA 4I3FA 4JYMA 2QMQA 3D4LA 3JWEA 1XLUA 3QMMA 4K6HA 4W1PA 4Y2XA 4ETWA 3DS8A 2D5LA 2WLSA 1BRTA 4LIPD 3ICVA 3OTQA 1WCYA 2EDCA 4EY5A 2X8BA 3IUJA 4FFVA 2V98A 1FJ2A 1G4HA 2OCKA 4CFSA 4KE8A 3I2FA 3EQ8A 1J1IA 2IX9A 3V48A 1XZDA 1P0PA 4ZV9A 1YAJA 2C4HA 1T2NA 1BROA 2HA2A 5JAUA 1NU6A 3WMRA 5AI6A 3OURA 1A8UA 2XUGA 3LP5A 1XZBA 3DQZA 3WKEA 2PUJA 2CBGA 2ZYRA 1HBJA 1QLWA 3HC7A 2RHWA 4GWLA 4OU4A 4H35A 3HLKA 2WUFA 2WFZA 3C6ZA 2WUDA 4PV7A 1HDEA 3K2IA 1E89A 3WK9A 4MEBA 1THGA 4U2DA 1MAAA 4L3WA 4BP9A 3S8YA 1CV2A 4BAZA 4QEKA 4Y7DA 5A71A 4EB0A 1XZEA 2GZRA 3G9TA 2QM0A 3DL7A 5CT4A 4FWBA 3CN7A 3O95A 1WOMA 4QDXA 1CUYA 4X97A 3ED1A 5IH7A 4JNCA 4AN0A 1WHTA 2OLEA 2B9VA 2Y6UA 1GGVA 1JMKC 3WJ1A 6YASA 2XMGA 5AICA 4KJXA 4IH4A 1N5MA 3BJMA 4GBGA 5AKIA 3FYUA 4C6HA 5KWJA 3WYNA 3VJLA 3PICA 5T4HA 2HU5A 3C45A 1UOPA 5ALUA 2WTMA 2WHPA 4BAGA 2PU7A 2DFPA 3MUNA 4ZWNA 2DSNA 1O6FA 4BDSA 1XZGA 1YASA 4FOLA 4C88A 1ACLA 1HL7A 2QUAA 3F97A 4XX1A 1UK7A 1QO9A 4BTLA 4N8EA 4C4YA 5AK6A 2XQFA 3IUQA 4U2CA 4ZI5A 2Z3WA 3AJAA 5AOAA 4WDRA 4GECA 4W1RA 4DTCA 5JARA 1LBTA 2HRQA 4GEGA 5EIEA 5AKLA 4QDUA 3T4UA 4Y2SA 2HFKA 3FLEA 3WWPA 1JI3A 3STUA 1Q0ZA 2AJ8A 3R3YA 4DIUA 4MQLA 2WJ6A 1MNQA 3FOBA 3M82A 2WTNA 2VTVA 1MX5A 4IHAA 3I2JA 4HXGA 1ZJ4A 2RHTA 4LYDA 4MWSA 5AK3A 3UMJA 3HZOA 3W9UA 4U2GA 2HA5A 5LP1A 1XKLA 3QVMA 4NZZA 3R3VA 1ZICA 2G63A 1HPLA 1GPKA 1VXOA 3RKSA 1XRQA 3D2BA 4G1FA 1YA4A 3ZWQA 2O7RA 3C87A 4IH1A 3LS2A 3DOHA 3VVMA 3S2ZA 4F5ZA 3F98A 3WYDA 2XMBA 4FDMA 5HF6A 4WCVA 1R9NA 3G8YA 2JGMA 1WB6A 1VJ5A 5LLSA 1XRNA 4PQEA 3WL5A 4TVKA 4AX4A 3DKKA 1EDEA 3Q8WA 1R4ZA 1P0IA 3R0VA 5IVHA 1C7JA 2WUEA 4HRYA 4LKOA 3WIBA 2RI6A 1VA5A 3HXKA 4BCCA 3G0IA 3PF8A 1H22A 5YASA 2WIJA 4J03A 3QBJA 4B85A 4UHFA 1K8QA 2PPLA 1CUJA 4FNGA 1UKCA 5E4JA 1IUNA 4BE9A 3W2TA 4BCDA 3G02A 2VAXA 3ESDA 2BFNA 4EBBA 4MYDA 5DTJA 1YAHA 4AN1A 5FKJA 2J4CA 3OOSA 5LZ2A 3FLBA 1QTRA 5ALNA 1AZWA 2WHRA 5HK9A 1AQLA 4HXEB 3OM8A 2H7CA 5HCUA 4MXDA 1TIBA 1XQWA 3C6YA 3F67A 2JF0A 2XE4A 3IULA 3R40A 5CH5A 2WM2A 5CRIA 2OPHA 3GBSA 3WJ2A 4HAIA 4EZIA 1THTA 2XUHA 4L9AA 4H7EA 4N8DA 4DNOA 3ZPXA 5AJHA 2AJLI 4X7BA 1IUPA 3GELA 2VATA 1IUOA 1IZ7A 4BDTA 3HYSA 3FSGD 5ALTA 3HRHA 1A7UA 5JALA 1VE6A 3ZLVA 5KREA 1YS2X 2ONCA 2QR5A 4B83A 5CMLA 1N5RA 3EIOA 3BL8A 1BN6A 4B81A 3BF7A 3EBLA 5J3JA 2AJDA 2Z8ZA 5BV7A 5AM4A 1IVYA 1CFJA 5D3ZA 3WQHA 5JAOA 1PFQA 1O6GA 1TKRA 5JYCA 3B12A 4MWTA 2YYSA 1XLWA 3G9UA 5AM5A 2HA3A 4G9GA 2OG1A 3ANTA 5AIBA 5LZ7A 2OAEA 3ESAA 2PM8A 5DYYA 4B7ZA 3G0BA 1CLEA 1DWPA 2G5TA 3KOOA 1CUGA 1CUVA 3FWHA 2D0DA 4YX9A 2DHEA 4KE9A 1GQSA 2QXTA 1QGED 4ROTA 4X6UA 1TCAA 2C0QA 3E1GA 1BEEA 1G5FA 3WA6A 1X2EA 4INZA 1N8SA 5CH8A 1E66A 1JU4A 3K6KA 3WKAA 1CPYA 2WG2A 4M0EA 3K9BA 4Y2QA 3A2MA 3MUOA 1DT5A 2PSFA 1ZIYA 1XQVA 1B41A 1SCKA 2AJCA 1DQYA 5AKGA 1AC5A 5I9IA 4AZ0A 2WIGA 5EIHA 1SC9A 1MX1A 4Y2PA 2BGNA 2ACKA 2WILA 3DL4A 1J07A 1HLGA 5JATA 1VA4A 1XLVA 1I6WA 2J3QA 3AIOA 5JIBA 1JKMA 5AM2A 1G66A 1PV1A 4PF1A 4E14A 3C8DA 3SC2A 1JJIA 3CN9A 3YASA 1EHYA 4Y2TA 1QIDA 4FLEA 5JANA 3IUNA 3NWOA 4Q05A 4FMPA 1Q84A 3ZI7A 1LLFA 1XROA 5ISMA 2VT7A 2XQIA 2XUQA 4ARBA 4B6GA 5AIAA 2C58A 4BZWA 1YR2A 4DM7A 1AUOA 1CIJA 3O4GA 5D6OA 1W75A 3A2LA 5ALWA 4KAFA 4M0FA 2C0PA 2OQIA 4FFWA 2OCIA 3I2KA 4Q3OA 4X95A 2ZJ7A 2JIDA 4DSZA 2JEYA 5ALVA 4OYLA 5HZGA 5FP0A 4F0JA 5FLKA 1TRHA 2YXPX 2OGSA 1F8UA 1XRLA 3VKFA 3M3DA 4OYYA 4HTAA 4H7IA 5ALZA 3H17A 5FPPA 5JAHA 2XT0A 5ALGA 4Y2VA 1DT3A 3H2JA 2VJDA 1GXSA 3O9VA 5BWCA 3DLTA 5I8PA 3TGLA 4P93A 4BATA 1JJBA 4RE6A 5AI9A 3FYUC 3PDCA 5HKBA 2JGLA 4L0CA 1QO7A 1QIMA 3H18A 5FDFA 3C5VA 2QS9A 1QIHA 3BF8A 5LIPA 2HM7A 4MQMA 1USWA 1ZD5A 3I6MA 4UHBA 3E3AA 2XUJA 3F96A 4BC1A 4CG2A 3IB3A 4H7KA 5A62A 1TCCA 3D0KA 1DU4A 2EEPA 4KRXA 1VZ3A 1UOOA 2BKLA 3HEAA 3GUUA 2C7BA 4ZXFA 3AILA 2O2HA 2QJWA 4Y2UA 5E2IA 2HHAA 1WM1A 4D9JA 3AINA 3M81A 2XMCA 3U0VA 3BIWA 3IIIA 2HA0A 3WK6A 1TK3A 2XMDA 4M0MA 3HACA 1FFDA
chains in the Genus database with same CATH superfamily
3LQ1A 1QU3A 1W581 3LA6A 1IHOA 5EHNA 4ZZ0A 5GTDA 1DTWB 5GP1A 5BWBA 3A70A 1NOIA 3PKIA 1CZLA 5HQTA 2I8LA 3WWDA 1J2EA 1QCZA 3K32A 5K03A 1OR8A 2HSJA 1Z08A 3ZU2A 3QYFA 2KW5A 1AKWA 2ATVA 4YROA 4F8YA 4WJLA 4WHMA 5JSZB 3EY9A 2IBMA 5K6TA 1Q7TA 3EMDA 4ZMBA 3VH2A 2IHVA 4KDRA 4UM9D 3SFTA 2WWWA 4LNUB 4A0HA 2UUCB 1Z25A 2C98A 2JFWA 3TJMA 2IPXA 3E3LA 4Q39A 1B0PA 3A1VA 2K7ZA 1KOJA 1MPXA 1T9ZA 5WRFA 3S1AA 4E32A 1ZW1A 1S8FA 4IDQA 1ILEA 5KDDA 2OZLB 4X61A 1WY7A 3H7AA 1GIAA 2YFYA 4OK5A 5D6NA 4ZT4A 3ERCA 1Q1AA 2PYZA 4LDAA 3T9DA 5EIAA 2RCYA 1YS4A 4LNAA 5KVSA 3Q3EA 3GHYA 3TH5A 3H86A 1R4NB 3V8QA 4WKOA 4FCWA 4MTLA 4EJSC 4FPXA 1QPZA 1TU4A 2BBOA 2NQ8A 1M3SA 5B57C 2K7FA 4KUHA 2EBWA 3GROA 3G7SA 4IJUA 5EXDA 3AI2A 4RCYA 2NGRA 3U1VA 2ZUBA 4JVMA 1QHYA 2GD2A 3NHYA 1E7YA 5BUZA 4MDFA 2Z4TA 5U4QA 3ER9A 4RKYA 2AF4C 2DHRA 4CMIA 3JATB 4YAGA 1AN0A 4MVJA 2WF6A 1OW3B 1VLQA 2ZT7A 4HF7A 4JBNA 3VNSA 3RRJA 1Y0BA 4MW6A 3Q5GA 2YQ5A 4FDTA 1W6UA 2I1LA 5BRNA 2ECFA 4YP1A 5D00A 4BNNA 1Z4LA 2W0SA 1WPXA 4EHBA 1QE0A 1MZVA 1J8DA 1XEAA 2XQKA 4HWKA 4O4LA 3ED5A 2F90A 3DOOA 4RAQA 2CUZA 4OLBA 3OLYA 2HMVA 5BMOA 2EW2A 1P2BA 3J81A 3B9QA 3IODA 1PT7A 1P1JA 2SCUB 1V8ZA 5F78A 4MVJP 1PR9A 3TCXB 1LBSA 2BT4A 4CGYA 2VK2A 4RQAA 1EUYA 4EL0A 3C3YA 4QXAA 2VH5R 3NKVA 3OG9A 5D3KA 3F6PA 1P1FA 1C7QA 1A50B 2BBSA 4EEKA 1S3FA 4BGDA 2NG1A 1ZDMA 2OCGA 1YU6A 4INOA 3EQ7A 1RJWA 4O2AF 1C9EA 3UICA 4BEWA 5EZQA 4P80A 4C14A 2ZSJA 3QNWA 1NN1A 2Y93A 4DDUA 4MEJA 4EH1A 2AZXA 1ND6A 2ZRPA 3HN7A 1JHOA 2PH7A 3OKAA 1ORHA 5IAEA 2GFHA 3VH1A 1NQWA 5LZ5A 5B7GA 1P1IA 2P78A 3ISTA 4RHUA 1CUBA 2Y1LA 2PZ8A 4QUJA 3G8CA 4S24A 3IVCA 4B8ZA 4LDPA 1I2DA 2HCBA 1QORA 1WVGA 3G85A 3F7OA 4YA6A 6REQA 1X38A 3K09C 5JG7A 1Z2EA 1V5IA 4QEDA 2ORIA 1HT2E 1U2ZA 3A6HA 3RRZA 2I99A 2XUKA 3SQOA 2D5CA 2GBLA 4E0BA 4E4YA 4TZKA 3SWWA 3KAKA 1MV8A 2P5TB 3IDAA 5FOSA 4IJ6A 4MB2A 4RVHA 1XNJA 2PG3A 3LOPA 2R2AA 4CIDA 4ZKDA 2EHDA 1XO1A 4QGGA 2JLBA 3H9UA 4ZFNA 4R8RA 3D5EA 5G1OA 1EVJA 3JQAD 4QUHA 4EHNA 4M1EA 1J0CA 1OC2A 1N5DA 4YECA 1V3VA 2YC2C 3OSUA 1QYWA 2BFDB 4NBWA 1B0ZA 1MQ8B 1C3JA 1K88A 3A4IA 2QUHA 1HMYA 2C4VA 4P4SB 1PHPA 4XIJA 4ZYTA 2BKAA 1KQOA 2Z2XA 5TARA 2Q5CA 1PTKA 2RG7A 3V55A 1GEEA 1A1VA 4DHEA 5J4HA 4EZEA 2EFYA 3W5DA 4BVHA 2JKVA 3FMOB 3TLEA 3EVAA 3OQIB 1GV0A 1HSZA 2H1VA 1WWKA 2IIBA 4RABA 3JU3A 2GCEA 1F2TA 3FBGA 3KR0A 3L4EA 4U6NA 1NGSA 2ZRJA 4HDNA 2QLJA 3GN1A 2BLLA 4YY3B 5E0OA 3V2HA 1DEAA 1ZNQO 2IOFK 2ZT6A 2DFLA 4OO3A 2PUFA 1JT9A 1D2MA 3PXAA 2GO7A 1PJAA 4BMDA 2H17A 1O94A 4AF8A 1CE8B 1X7YA 1QX4A 1AURA 4KFCA 4OHMA 1MA3A 2Q99A 1TADA 1LEHA 1VTKA 1DAOA 1OQAA 3MW8A 5GJWC 2X86A 3A1FA 1I4DD 2DQZA 4LPSA 1DV1A 3B82A 1H2XA 4HVLA 4E5NA 5DF1A 2EDAA 2OHXA 4G9BA 1IDN1 1BD3A 2CHVA 2H5JA 2FEPA 3NM6B 3V9PA 4ZDJA 1QTQA 2EC5A 4GOND 2J9YB 3EVZA 1UFQA 2PRIA 4LMBA 4AZTA 4EMBA 3G7NA 3PQ4A 2QE7D 5T64A 2RB5A 5IHXA 1C9DB 3BEDA 1AMNA 3T3MB 4LC0A 3JYLA 3GLIE 1U1IA 1ADYA 1KDVA 4JI0B 3RTAA 2OOKA 1R1DA 4XD7D 3HZZA 4UTXA 1U0SY 2VJLA 3JQQA 4FBMA 4ZC1A 1I0ZA 1FOEB 1PUJA 2C8VA 3M83A 5IN5A 1G8MA 5I45A 1DKNA 2POCA 3BIOA 1FU7A 3GP3A 1YFJA 1HG0A 2OGUA 5ILGA 2GK6A 1OH6A 2IIVA 2ROQA 3P7MA 2CMGA 1IM8A 2WE7A 5K8TA 3KPYA 2DWQA 2FI1A 3FCOA 4JCCA 5DBEX 5AVKA 1JFVA 2EXXA 2O2IA 5KX5B 2H5IA 3B5JA 3DMHA 1EG2A 2PXHA 2V4UA 2XIQA 1AK9A 4MJ7A 3TD2A 3WIEA 4FHDA 1BH2A 5FUYA 5AHXA 2BE9A 2J6IA 2XUFA 3RVLA 1CSEE 1K9SA 3KLOA 4URYR 5HFAA 4O4JF 5LKRA 1ZK2A 3DLBA 1NY6A 2W11A 3GLQA 1TM5E 3KZXA 3RGWS 2JGIA 3O2NA 3QYAA 4LNHA 1C7IA 2VHTA 3ACDA 4URUR 4X20A 3BHJA 2YHAA 3JY6A 3OOHA 5DM70 2YZNA 1OLSB 3AR3A 4MO2A 1ZWLA 2NNWB 3HXLA 4F1WA 5CBKA 2ZWMA 3WO0A 1TMKA 1FFAA 1U2GC 3PUHA 2V5VA 3HBLA 4B82A 3JALA 1C1DA 3Q7QA 2H48A 4NDZA 4NFLA 1GUYA 3IPLA 3R3WA 4ZC8A 4U1RA 4DLAA 1CERA 1C2YA 5C9ZA 3Q12A 3UMSA 1M0SA 1E2IA 4KRGA 4ZOLA 4AIIA 6Q21A 5MF6A 1QGUB 4K7JA 4IRMA 1EVEA 1HE5A 4MIOA 2RKOA 4DLVA 3FD8A 3KUDA 2CNNA 1FSPA 4OHXA 2O2JA 3ZCTA 1Y6ZA 2I62A 1R9JA 1DPFA 1L7BA 2O1XA 2PZJA 2WZQA 3WZLA 6CHYA 4AKIA 1GNPA 3I2HA 1TGVA 1FQKA 1YR7A 4MPPA 5FBQB 5CB0A 4K9LA 1JYEA 2REQA 1G20B 2VF5X 3IIJA 1KE2A 2JIRA 3IOCA 1QUFA 1SOVA 2I3AA 2XMPA 2J7KA 1B8NA 3H2HA 2NADA 2XE6A 2CJWA 4V02A 4HPJB 2G82A 1K9VF 2FYTA 3IAS1 1EVLA 5F5XA 2IOQA 3H1AA 2LWIA 4QLOA 1R6VA 1WMDA 4YQYA 4BVEA 3GEDA 1CQWA 4E30A 4R7TA 5L40A 2YV4A 4LYJA 4ZVNA 3TQHA 1CLUA 4J7UA 3PF9A 2CNOA 4KBGA 4PC2A 1ISFA 2OM6A 3FFXA 3ONVA 3WDLA 3E8XA 4WXYB 3GNTA 5ALKA 5TPWB 4RLQA 1XKXA 4BC0A 1Z17A 5KU7A 3PEWA 2JGRA 4BEBA 1JLMA 2AZMA 1SXQA 3UQYS 4ZJPA 3HBJA 3HUFA 3GLHE 5JZSA 1UCFA 1H2WA 3A3PA 1UMCB 4MRPA 3AP1A 2CEKA 3P9KA 4ND8A 3FA2A 3Q5EA 4K6FA 1N4AA 1PS0A 4MA5A 1H9AA 1KFKB 1S2GA 1ONBA 4IHJA 3TQOA 2DZDA 4XVCA 5LWQA 2Z2ZA 1LA2A 2XEDA 2XOXA 3AL2A 5L6LB 1YQQA 2AC2A 4IUDS 2W2PA 2A33A 4ICIA 1RIFA 4RHYA 1SXHA 2Q6LA 1N6OA 4BN4A 3DW3X 5IZCC 1A76A 1CUZA 2Q45A 2HRBA 4Z0HO 3KO8A 4IRUB 2J3KA 1GRNA 3IFSA 1U28C 2XGSA 4OFZA 5BR1A 2Z2KA 1WKCA 1VLVA 4HH3C 2B4YA 3BCSA 1JS1X 3G8BA 4KXUA 4C1NA 3JTEA 3O4RA 4CM9D 4GMDA 3UWMA 4OK6A 4AUMA 4PO9A 3AWIA 3HP7A 4G37A 1MRSA 3GT0A 1O03A 3SHOA 3VQTA 4R2WA 3V1LA 3W8FA 5GY7A 1A9PA 5IVDA 2FEKA 1MOQA 4TYPA 5AH0A 2FFQA 3WLIA 4RXUA 2WC1A 1QG2A 5AKEA 3GNQA 4U2FA 2D0OB 3I30X 1QAMA 3JQAA 4WBNB 5BW8A 1FRVA 1BMFD 2MSNA 4JVOA 4MP6A 4DL9A 1E0KA 2DJ5A 2PCJA 2R66A 3SS8A 1QFYA 4CCYB 5THQA 5C53B 5TPZD 3ZOZA 1T9AA 5DBOA 1E4EB 4ZMSA 1JEQB 1P62B 3N8KA 3L7MA 4C0JA 3LCVB 1THZA 3ORFA 3U5TA 1RZVA 3VO2A 1YZVA 3L9XA 4YUYA 1RU3A 1BHQ1 3D31A 2QZJA 3U44B 1WETA 5LD2B 4NCHA 4RE5A 2BFBB 3VR6H 2W8ZA 3TSZA 3F8SA 2Z9DA 3QJYA 5A7GA 3H6GA 3RS5A 1YQWA 4FGSA 3SQDA 3T3EA 2ON6A 2PTHA 5AW1A 1JXQA 1NXSA 2ZSHA 4RUKA 5KHAA 3GX1A 3M5DA 1XTSA 3KE8A 1TZBA 3ZXSA 5HK8A 3IA7A 1PX0A 1NIPA 1I7LA 4WACA 5TQ0A 5BXQC 1UXOA 4OJYA 4CIXA 1YIOA 2DCMA 4BFSA 4P3PA 4W82A 1KAEA 3RK1A 1E62A 3PUZA 3PEYA 3G0CA 4WWHA 3K9NA 1GDDA 3TECE 3OI7A 3ZZNA 4TMYA 3GZJA 3CKLA 2QYHA 6ABPA 4P4GA 3S68A 4DV4B 4O63O 1PL8A 1W9MA 1G2PA 3STXA 4X7MA 4V0RA 2WD9A 2H65A 4QO8A 4TRNA 2F48A 1FSSA 4G5OA 1TT7A 1ZXLA 5CFPA 4QXPA 5JI2E 2VPWA 4OREX 3GZNA 2PKQO 3G68A 3TIGA 1UXIA 1GNTA 1OH5A 2AW5A 1V26A 2YNMC 2XR1A 4JLOA 4G36A 2ZVDA 3UAGA 3UHOA 3F4BA 4LW8A 1VL0A 4ZOBA 2QSZA 3HY3A 1DS6A 4Y1GA 3FRIA 4X8OA 4ZAFA 1KBZA 4DANA 4DYVA 1G42A 4RH1A 4XX0B 5DB4A 5KVVA 2QROA 4HYQA 4EY6A 5K3BA 1GL6A 1I80A 1NBEA 2C2HA 2WMDA 1KRWA 1SH7A 3STUA 4OP3A 3VXKA 7ABPA 1B23P 4U7PB 1TVKB 4LYAA 1JLLB 2VJBA 4QDKA 4AYTA 1JEYB 4PZDA 3C8HA 3CUWA 1TKBA 1QB7A 4YRBA 2G07A 4XFJA 4DLZA 1RRGA 4ZDKA 1VSBA 1DC3A 2C2KA 3EF3A 3UBMA 1OMOA 3K0AA 2CF6A 2WYOA 4EDHA 5BV2P 4BFCA 1WB4A 5CA0F 4ISCA 5FQOA 1Z2PX 2JCSA 2K87A 3HLYA 3HB1A 1CDZA 2NSJA 3K8ZA 5FBKA 1KVRA 2WNIA 3U17A 5ALMA 4EPVA 3WGYA 1IOVA 4HDRB 3GT7A 1ZI6A 5TT1A 4EKDA 5JH7F 3DAFA 1YDGA 1X8LA 3VMFA 2LZ0A 3CH7A 1D4AA 2IOFA 1YB2A 4ZJUA 5HM6A 4QT4A 5C81A 1Y6RA 4IUCS 4KDCA 3VTFA 1XZKA 4O0MA 1BEZA 3K35A 3HVJA 2WPNA 5DT9A 8ABPA 1ZJZA 1S96A 1UBKS 5CTAA 5JRJA 3UTCA 4KLAA 5AT1A 1K7CA 3T1HB 1LBIA 3AYXB 4UBJA 1ZI8A 5I8WA 1TLTA 2O8EA 5DI3A 4BO9A 1P9OA 2WP0A 2CFRA 2C0CA 2XHEA 3M33A 4OAPA 1ZOLA 4KQIA 1NR1A 1Y4AE 1HQCA 1BCSA 1R88A 1UC8A 1V1MA 4QHYA 1TZKA 3V7WA 4CCWA 3VYTB 1J0EA 1SO8A 4B4KA 3DVLA 3RSLA 3ICOA 4RD0A 3PX2A 5H8WA 1RYMA 5IS2A 2V7PA 1KP3A 2PDAA 2OA0A 3V7NA 4JUCA 4PXSA 1PWXA 4YCSA 1P7YA 4BO4A 3JQ8A 1N2SA 1WCWA 3WBFA 3P2MA 2P40A 3LYLA 5DRYA 1F2VA 2G4CA 3CUEF 4JQOA 2JFYA 2Y9PB 4AY5A 4EPWA 5CEEA 3L4SO 2ZUWA 2F8MA 4OKSA 3TN7A 3NNNA 3PI6A 2H06A 2XWJI 3T5BA 1OGIA 3KYDB 2YZKA 3NORA 1CUHA 1EAYA 1SUEA 3WYEA 3CNOA 1AKNA 5AVVA 3RVPA 4J3FA 1G64A 5ALRA 2IEGA 5EXXA 3OQIA 4C2BA 4KFUA 4AY4A 5C4MA 1GLNA 4NSNA 1Y9ZA 1YS6A 1E8NA 1O54A 1F2TB 1Q0RA 4N18A 1KH2A 5DM1A 2WTUA 3TX6A 3THSA 1T9HA 3L40A 2UZ0A 3QELB 3V1UA 1ZWKA 2AI1A 4QGBA 3AKYA 2TMYA 5CFLA 2QM3A 4IR7A 1GGNA 5ILQA 4HEA6 5ADVA 5K4HA 3A3YA 3FR8A 2OSVA 1ORDA 3TLZA 5C3MA 2OTCA 3HZHA 4W7IA 2ZDGA 4HWPA 4PHCA 2J46A 1NJGA 3AKZA 1MO2A 2R7AA 1X1AA 3PK0A 3H6HA 5T41A 1HT1E 2ID8A 3HB9A 2HXGA 3UFXB 3AZOA 4M6WB 3HFJA 1MGPA 2J6HA 3IUSA 2XCSB 2A0XA 4PQRA 4BNMA 1S5PA 3PQDA 4OTZA 4EVRA 1U1EA 3EOBI 2G76A 4QM7A 4L8FA 2I4MA 4BU0A 5JDIC 5B2ZA 4QBGB 3RC1A 3O90A 4AMUA 2GZDA 3TAXA 3EW7A 5GZ3A 3L0ZA 2C82A 4V1CA 3VM6A 1NBHA 4GOLD 1KSJA 6NULA 3UT0A 1WU7A 3NNSA 4XH9B 3D3JA 3OZEA 5LM3A 1IAVA 1BD4A 1LD3A 4IXWA 2B1GA 1U7PA 3VNQA 2APJA 4B3MB 4G1UC 2RIRA 2YWFA 4LGYA 1JDZA 3IAXA 4YXWD 4WZBB 4ARZB 5T4BA 1JHMA 4ALLA 2IH2A 4R68A 5EWJB 4YR7A 2RE8A 1U9YA 3IURA 3UG7A 2QYTA 3WGKA 2QE6A 1MC8A 2V7WA 4KQ2A 4UZFA 5ESRA 3BXOA 3BGVA 1NYTA 4E33A 2YVAA 3IBSA 2ZJ6A 1MW9X 4JI1B 4A82A 1A8SA 1PJRA 3BE6A 3RYHB 1F2DA 4CZ2A 2OXFA 5TS2A 5I48A 2IHZA 4CM4A 1ZGAA 3N39C 1N78A 2FSSA 3UC5A 4XYMA 2O8VA 5K1ZA 2RDMA 3LHIA 3PVZA 4JC0A 4PSAA 1QGYA 3M3PA 5KYVA 1R5JA 2FQ1A 2ZYHA 3C74A 3MJFA 2OFFA 4LZPA 5CLJA 2QEQA 2W00A 4GRDA 3SZMA 4D8XA 4YP7A 5C46F 5C5IA 1RYZA 4IDNA 4B80A 1CQPA 2QUBA 1TAQA 2I6FA 3LHKA 2X41A 3RROA 4NEGA 4BJ5A 4PONA 3RWOA 2MSLA 3EVCA 3I9KA 5TQVA 1QGDA 4QIHA 2XF8A 3M89A 2DOKA 1P0CA 2FRDA 3HJHA 5ICMA 1W5TA 1TD1A 4XWWA 1FDUA 3S29A 1OFGA 1L0BA 1Y8AA 1GVHA 1XL1A 4IOKA 2I34A 4JK3A 5EQDA 3WKCA 4GLLA 1Q0SA 4AT1A 4NZYA 2I2XB 1QLHA 5JZMA 3CCCA 1V35A 1PVDA 2OV8A 4RIHA 3OTGA 2DY0A 2OAGA 1AD2A 3RSZA 5DWVA 1DDOA 4XJTA 3EXIA 1KBOA 2QSYA 3JXEA 1KZ1A 5LSAA 3RU2A 4DGQA 3G0GA 5L3SB 2G83A 4EGFA 4JENA 2YICA 4R2KA 5E7JA 4KHPB 1HYGA 2ZUCA 3QX9A 2GRUA 5DM4A 4LHSA 3W8RA 4FWIB 1O9GA 1GA6A 1G60A 2GBPA 1B14A 2PAAA 3WYFA 2ISCA 1DQNA 2OKCA 1OXMA 3L7KA 4MCIA 2GR9A 2H2AA 5AKXA 3V32A 3AUTA 3PI7A 1U0JA 4LXXA 3U39A 3VOTA 4DJDC 4PN7A 1W5FA 2C2MA 5ENDA 4N0QA 3KEMA 2QLFA 5FOXA 1ST3A 3KOMA 1K0FA 2AOUA 1ZD2P 3KWFA 4ECAA 1OY1A 2OCXA 3EMKA 2EBFX 2ZPAA 1OD6A 4KGZA 4LJ5A 4BYMA 1AZSC 4DM3A 5K8IA 4R1MA 2QVZX 1E0AA 4ZCTA 3WXMA 2ORYA 4R9UC 4XD2A 2F62A 2VR1A 3QXHA 1C14A 2IHNA 4IVPA 3K70C 1E3MA 3RUDA 4JDPA 4LXHA 3KU4A 4J0GA 4UJ3A 3C2QA 4GM4A 5AK0A 2BDEA 4BUCA 5KTNA 4K9SA 1SRRA 4MRMB 2OHGA 4NS4A 3RFUA 1COWD 1GYPA 1JR3D 1JHDA 2PZGA 1X8KA 2WSLA 3ES9A 4UEJA 4F6RB 5ADHA 2R751 2X8AA 2A14A 2ZSAA 5C7IO 4D0RA 3G9XA 2XGOA 4ZODA 1KO4A 3AEQB 4M0CA 2AFVA 3TIVA 1XQYA 4JS0A 3IESA 4TN5A 2AWOA 1F4VA 2XNDA 1H93A 4M9CA 4P7GA 3ZD7A 4LWPA 4N5IX 4MV1A 3N6XA 4C4TA 2FRDC 2HHCA 4RM2A 1I1NA 5J4LA 1FLDA 2IP1A 1Q95A 3Q6IA 3QVVA 4HDMA 4LWQA 2XGGA 4CUKA 3QU7A 4ZT2A 1WZNA 4G6ZA 5HKLA 3S99A 1CEQA 3T3PB 4H7JA 3RLFA 3URMA 3N8GA 4GE0A 5GVRA 2MINA 1WMFA 1XFDA 3THRA 2CHUA 4AZSA 1CQXA 3SS9X 1QHIA 2O3JA 4FK8A 4YO8A 5EMJA 3GIWA 5I4KA 2I4OA 2JFFA 2IL1A 3E4DA 2IIPA 4OI0A 1DX4A 2XDQA 5THXA 1WCIB 4MV9A 3QMVA 521PA 1GPDG 1N8TA 1LQUA 2PFSA 4YV0A 1VE7A 2R7LA 5IKEA 3N1UA 1ZEJA 2YX1A 4ZCSA 1JBQA 3JPWA 2R6DA 2AFRA 2O7VA 2O9JA 3AJEA 5AVOA 3U44A 3OQMA 4B45A 3D2LA 4B33A 1R66A 3MA0A 4YJKA 1G7RA 1XK7A 1R3DA 2XCRB 3WX0A 3VNVA 2VYQA 2GAOA 2VBCA 4OL9A 1PJZA 1J5EB 2WIBA 2WWTA 5TGZA 1SCUA 1E18A 2Q1UA 4F38A 5D51S 1WX1A 3R9XA 4Z4QA 3ML1A 3ZY2A 1ISPA 4C6TB 1JKJB 1KEUA 1NP3A 2YWJA 3NOOA 1NRIA 4FP9A 4FYKA 4HB3A 4R9VA 4A1FA 1YS1X 3C8ZA 4FFNA 3WL7A 1SZJG 2EX0A 1ODTC 1X1TA 3GRYA 3HI4A 2B92A 4P38A 1N3IA 5D01A 1U8FO 3VOAA 2HWUA 1GL3A 3HVKA 2PZFA 3E0XA 4TXHA 3ZVRA 4URXR 4R2IA 3NAMA 2DUMA 1H23A 2FUCA 4HS4A 1FJHA 4QE3A 4K9OA 3TK1A 1M0EA 1U7ZA 2IYTA 4G86A 3B48A 4JP5A 5J2TF 4JEMA 1FVFA 1T29A 4KSBA 3K0FB 3PRHA 2H7YA 3L8GA 3WA7A 1TMOA 2WSSA 3RRMA 3NG1A 4OAQA 5F2OA 4G4JA 2REBA 1MB2A 4WY5A 4A6DA 5LJIA 4E5MA 2XOEA 4OB8A 4DV2B 2ALJA 3WKDA 4FFSA 4WFKA 4XTRA 3Q3IA 3GUYA 2ADFA 3IA2A 3KFXA 4L51A 3SZOA 1ODIA 1XLTC 3ELUA 3ITNA 2VF7A 4G5GA 4Z54A 4K6MA 4RZHA 4KQKA 5JE8A 1GNSA 5JAQA 3THWB 5TMBA 4PTLA 3I09A 4NZNA 2RHGB 4P58A 1NXQA 3JD3A 4G8BA 3EQ9A 4ZYZA 5E4YA 3WK4A 4YEDA 3NV9A 1XNGA 1KJ9A 1E92A 3W3AD 5JV5A 3OU7A 4NQRA 4A16A 2C1EA 1DFHA 1M34B 2R8ZA 1KZ6A 2OCDA 2A9QA 1XN1A 2C7OA 1I01A 2C9ZA 4R83A 5J47A 2C9BA 4QPNA 3SOZA 3CURA 1YOVA 1KDPA 2AYXA 3BOSA 3RYTC 1PGJA 3W90A 2QG6A 2CV2A 1FXWF 3L9WA 3CEHA 4QOGA 4INAA 4MGYR 2VF2A 3R3JA 4G5XA 5BNWA 2Q29A 1E9AA 4HVTA 4M53A 2QNIA 2JC3A 1PLJA 4EECA 3STWA 1OFTA 1OASA 4QYSA 1U7UA 2ODWA 4QNNA 4RMGA 2EKBA 3KZMA 1NX9A 2XQGA 4RLHA 4DSUA 3SC6A 3L4KA 4NPHA 2JGKA 4OB6A 4CMHA 4ZU1X 1LSOA 3BMQB 3IAUA 4P92A 1ZK3A 2AMVA 3G5TA 1A9XA 5UKDA 1PQYA 1T6BY 4OIMA 3ZCPA 2C8KA 1F2UB 3RHZA 4J0JA 4IMRA 1L7EA 1FRNA 3UWKA 1FFGA 2W7TA 4F3KA 2JEZA 4KW7A 2P5UA 1QE5A 1U2RA 4KAXA 5C4GB 2LD4A 2XI4A 3RYFA 3WLTA 4WI1A 2FTKE 2ZI7A 5DI3B 2JGFA 3UJHA 4MVWA 4CDNA 4MDYA 4E7OA 5C8VA 2QUIA 2AX3A 3ZY5A 4UXIA 5J63A 5L7TA 3TXAA 1W4AA 4BFXA 3JQRA 1TJ4A 3E82A 1Z0UA 5DKFA 4WKPA 1IY1A 3A58B 3IP3A 3G5AA 1IQPA 4UBLA 1GGJA 3AP2A 3JQ7A 4G09A 5JLAA 1QK3A 1RBMA 3THOA 3OLCX 2ZCVA 1XRRA 1Y63A 4PX2A 2J0QA 5GAJA 1P74A 5I7HA 4ALJA 2CMHA 3L49A 2AI3A 2WUVA 3GDGA 1IEVA 1W44A 3JSXA 1X7ZA 2HWWA 4BX2A 3ZZ1A 1GZ4A 3P20A 4DEVA 3QGMA 4DUPA 1Z7GA 2V7QA 2J3DA 3KOXA 4R0MA 4RDIA 2V0GA 1WZUA 3ADDA 1WXGA 3D6TB 1FTNA 4P9NA 1LPSA 1NXTA 1FS6A 1FP1D 2X7XA 3NFYA 1EXMA 2WU8A 3ZYZA 4BNZA 2V1UA 1GO2A 2ZJ3A 4X90A 1GZ6A 2B4KA 1R50A 1KL7A 4RF3A 2HA6A 2PBZA 2YRWA 1P80A 4CCSA 1WLYA 1XLTA 1XTPA 2Z9BA 2H85A 4MAAA 2FN8A 5BSEA 3W6NA 1IB0A 2Z8YA 3IE2A 4LXQA 3RSQA 1KQ3A 1X70A 2NXCA 5FHRA 4M49A 4Z3KA 1ZN7A 3F6CA 3MELA 4JX9A 5EINA 4YCMA 3Q9UA 3RS3A 2A5LA 2B5VA 3K20A 3O0DA 1WMEA 3AVOA 4DXAA 4M6WA 2G9QA 1B6SA 2X2PA 5HJ2A 3W4JA 4B79A 4ESVA 3ZJ5A 3JZAA 2NZXA 2W93A 3RABA 3AFHA 4TL7A 5K3CA 3TOVA 4CTMA 2V7TA 4GGMX 1YHNA 2PLWA 3FVWA 4GPEA 1WXEA 1QANA 1AKMA 1U8UA 3SIWA 2I54A 5FA8A 4GC9A 4C7KA 5B3JA 1KYWA 3GRZA 2WWHA 3L1UA 1OUMA 3QBEA 4UTPA 3TF5A 1PR6A 3ZOKA 2GF9A 2GXUA 2A2ZA 3KKOA 2E87A 2GN2A 1JQEA 3AUXA 1QIKA 3E7DA 4PPGA 5KJFA 2HDNB 2FSIA 2CFOA 3DTTA 3N2LA 2ZVJA 4S1OA 3R3XA 1P44A 3PU6A 2TS1A 3QVJA 4X1KB 2XUIA 5CNIA 1EBUA 3THXB 1RP1A 6LDHA 4NBSA 4P3OA 4WE3A 3S1SA 3FNBA 1KS9A 4E09A 4MI3A 2ZTMA 4AZ3A 4D45A 3CUVA 3HWRA 3ELBA 1NR5A 1VIMA 4WCFC 3K9WA 5JRDS 3IEVA 3VDRA 3TWOA 1W4BA 1E20A 1XA3A 4QU0A 4UAVA 4WNCA 4ND3A 4J6FA 4XLZA 1NVXQ 5AI0A 5C0OE 4ABYA 2C3PA 4FUQA 4BNKA 5ES4B 1LPMA 3EEIA 1QCCA 4WZAA 1LVGA 1S3SA 2CDNA 1PS9A 2JJQA 3COZA 3H13A 4HB2A 1Z0SA 2F59A 2ZG6A 3T7EA 1KC3A 3PHIA 5FBVB 5LQSA 4AURA 3CZ9A 3PIIA 4L27A 4RF5A 4O59O 3BHMA 1W25A 1XAGA 2V7BA 5TQ2B 1T3TA 4OVKA 3S3TA 1LF5A 4WD3A 4QVGA 5F1PA 3J81k 1XG5A 3B8HA 3CPSA 3T8YA 4I1UA 4YHHB 3UCFA 7GPBA 5KNDA 3BWYA 5IG2A 4R1UA 2IY8A 3SC3A 4YCAA 5SYMA 4RTNA 3AIMA 3IEUA 5C8ZA 2JVJA 5DNUA 3GFRA 2P2GA 2QPTA 3D6UA 3DCNA 1GUZA 2I6UA 2OFXA 4MDHA 1N5LA 1WBDA 5F7XA 4ASUA 2I5PO 4K81B 3TFWA 3PL5A 1JIQA 2BHSA 2IV3A 1FYXA 4D9EA 4YV2A 5L3SA 3DE4X 2VBIA 1SULA 2CCGA 5A5FA 1P9NA 2P0YA 1GPBA 3IRVA 3NAQA 3QFTA 4JJZA 4PLYA 4PYLA 5EG5A 3ZXYA 5CA1B 2WVGA 1T34A 1JFRA 3FZQA 2B4TO 4HH0A 4RSMA 1CUEA 1X7XB 1NBIA 1XRMA 1S8NA 2N47A 3FLAA 2GYVA 3V8BA 4KU4A 4YT8A 4DYDA 4GXNA 1YDHA 2P75A 2JHGA 1K5PA 4OQ4A 4G4IA 1LDMA 4DG5A 3C5EA 3ENNA 1KSHA 4F3TA 4EY8A 3MAAC 1WUTA 2A9FA 3CEMA 4ZPJA 1SZCA 3IMEA 2E4XA 5FTLA 4ENPA 2Q2VA 4KLCA 1P0QA 1VHTA 4EJSB 4MAFA 2F3UA 1JEOA 2OAP1 4KIJA 1YVEI 4NBRA 4W9NC 1CF9A 4XM0A 3FWZA 3I5UA 4X8LA 3UJPA 3QVGA 1QBGA 1ZCJA 5REQA 2P4QA 5A5GA 1VRWA 3NANA 3TQCA 2XQVA 1XAIA 1Y3FE 2L17A 4EPRA 5KNCH 1N9ZA 1WJGA 1D1QA 3AEKA 3AMVA 4RA6B 3ZW7A 4B47A 1JDSA 1GLGA 4WKGA 2C78A 4DSAA 4Z8YA 4H7HA 4BGIA 1CUDA 1OAOC 4OH7A 5U4XA 3VBCA 5KYUA 2V3WA 5LYJA 2NUPB 1GM5A 2VYCA 2HADA 4EOGA 4YIHA 4PZAA 3FVQA 4L16A 1MXHA 1E3JA 1IPHA 4G2NA 5EA2A 2H1SA 3UJCA 3RVKA 1KU0A 4XJXA 2WAOA 4O4IB 1HE2A 4LBZA 2PGJA 5JD6A 4HDSA 3AG5A 5BURA 4C4ZA 4IIJA 4O6VA 1HC7A 2PBRA 3O93A 4Q3CA 2CKDA 3GGGA 1VRVA 7REQB 3CHYA 1XEXA 3ESQA 3IXQA 3RW9A 1GG5A 2D2FA 1FFXA 1UJMA 5DXJA 1X1QA 1MABA 2KLHA 1MOSA 2XDQB 4FW9A 3M1AA 4IFIA 3IBTA 2JJ1D 1Q77A 4TTPA 4OCZA 3QPUA 3ZDZB 4RJIA 4WJZA 3ZGOA 3ZV5A 4ZEXA 4QA9A 5BSMA 3RF7A 4Z4CA 2ZRGA 1P6QA 1DBQA 1M83A 1FQOA 1P18A 2WKWA 2NV6A 3O73A 1SKMA 1J24A 2OQ2A 2A1TR 1U2GA 2FP3A 4GG1A 2HQ1A 3QIVA 2A3RA 4J9UE 4YYZA 2VL7A 2V8OA 1FTGA 1AVTA 4GLFA 3UK1A 3L0OA 3RVQA 1C1XA 3VTKA 4X8HA 1FMCA 2IY7A 3LZDA 1W5SA 2RH9B 2JCBA 2B8EA 1H3NA 3K92A 4J3JA 4OHZA 2PFKA 4CM3A 2FHPA 4IZOA 4UD2A 1YA8A 2FSVA 1G3QA 1O5TA 3CXUA 3LUBA 2DBQA 4KDEA 4IL5A 5FI1B 4TPKA 4A4DA 3H2ZA 4OMFG 3LKBA 3IV6A 4N5HX 3EDYA 1EK1A 3R5SA 3WV4A 3ACCA 1QIIA 2O3UA 5DDIP 2UAGA 3I04A 3WL8A 4R54A 1HFEL 2QRQA 5L3QA 3HY4A 3NH6A 4JCOA 3WDKA 3EZ2A 2JHFA 4J6EA 1F6WA 3RB8A 5EMMA 3WBBA 3CH6A 4GSYA 3GLKA 3F5DA 3NHAA 2R8RA 2CBZA 1W5AA 4BN5A 4FFLA 2OE2A 4MNTA 1T1EA 3K96A 5U1PA 1N75A 2HJSA 4TYWA 2CYCA 1UPUA 4YRRA 4I1OA 1BNCA 2ZYTX 3H19A 1J1UA 2XD4A 3PNVA 3GFOA 2ETVA 2XD9A 3SGLA 4AJNA 1PL7A 4Q4CA 2C2BA 5IPFA 3SHWA 1U0BB 3I8OA 1VXRA 1WXHA 4YALA 4DWJA 1DE0A 2II6A 2MMGA 1Z6XA 5LZ9A 1ATZA 4LQDA 4B4UA 2BDTA 1CR2A 4MYRA 4PNZA 4NYJR 2PSHA 4PWZA 3K1YA 5MGBA 1W29A 2B5WA 1JNXX 1N0WA 4PFJA 3QITA 3D43A 4HRAA 2HTFA 3WNQA 4DG9A 4EGJA 1WVMA 2EJTA 5DIFA 2FPRA 2KS6A 3JASB 1A2BA 4FHFA 2FZGA 3JYHA 4YRQA 3SCZA 4Q19A 2RHCA 1SU4A 4FYXA 3SMQA 3VGJA 3EGCA 4IDGA 5JD4A 5K5EA 2W6OA 1DG9A 1XL0A 2H31A 3IJRA 1Y1LA 2NUTA 3WQQA 4TTJA 3VU0A 3JWPA 4MCAA 3GPLA 4EIWA 1F4PA 5K3AA 5IJ9A 2CV1A 1WUIS 1R4NA 4P6VF 3Q5DA 1E2LA 2W6IA 3VR4D 5BQ3A 1OPXA 1DPGA 3QVLA 4Q4AA 3ICQB 3VVLA 3RYCA 1BJTA 4L9WA 2G04A 4EJFA 5JXGA 1RQ7A 1DIHA 4CVNA 2WZBA 3ZZTA 1E7WA 3MLEA 2GEDA 4F6LA 1RRPA 3GFSA 4XGRA 1VIDA 2W2LD 1D07A 1UEJA 3BDVA 1OWPA 3BXHA 1QFSA 3I72A 3Q1KA 4HWOA 3ABSB 1XRPA 4XQGA 5ENVA 2OBLA 1MOZA 2W42A 4CEJB 3P9XA 1DJPA 1F2UA 1UKAA 1QB8A 2DQ4A 3UMFA 4EVIA 4N3AA 5TJ9A 4TX1A 5FLYA 1J56A 3BWBA 1XVVA 2FUEA 4BQEA 4UC0A 4RPCA 2ES4A 4B0PA 4DR3B 4KP7A 2ZS9A 1V43A 1M1XB 5JASA 3T94A 4XIFA 1EBFA 1BJKA 2WFLA 2C29D 2QD3A 1NVDA 2BD0A 1NYLA 3DB2A 2Q8QA 1IJBA 5JI3E 3QY0A 4OP2A 4GNRA 3KG2A 4YRNA 5EP1A 4NCBA 2O5VA 1PG2A 2C77A 8ADHA 3NIFB 2V7XA 3MSCA 1C9KA 3MS4A 3K15A 3VPSA 2E49A 4JUAA 3D4BA 1RAAA 4JWTA 3KQUA 1FUIA 2IITA 1M34E 1AK2A 4G5FA 1BMFA 1NM5A 5J5CA 1O97C 4R6WA 4RD1A 2HDOA 1HQDA 2NVUA 3F46A 1NV9A 4EW1A 3RC2A 1USGA 2Q0XA 1H0SA 5EQTA 5EGSA 3EIUA 1XCOA 2BBWA 1W8DA 3ZDYB 5CCEA 4U2BA 1ONNA 3OQOA 2PRSA 2NYUA 1VPLA 3FOZA 1SXJD 4OJMX 4DMGA 4M86A 3JD1A 1U04A 2GN1A 2WJ3A 1DIBA 3SX4A 2W71A 1TVEA 4C0QC 1SHJA 2CJYA 1T4GA 2YUIA 4RIFA 2ZFUA 1L7PA 3LHDA 4IDFA 4UULA 1REQB 1PFUA 3PQ3A 3BZUA 5AVQA 2QF7A 1D1PA 3BSWA 1HYHA 1NHWA 3CZ4A 2OO5A 3DE7X 1NFFA 1T0UA 3EPLA 2P0EA 4RSGA 1D3AA 3N53A 5K05A 3TB4A 2RHMA 3DCYA 2BGLA 1H1LB 4K6HA 4XCXA 4OQYA 5FUVA 2O8FA 3IMKA 1LTKA 4W1PA 3JQAB 3DS8A 3FGNA 4IX1A 1A2OA 1GTVA 3RTGA 4LPKA 3DAYA 5DXAA 1QCDA 3GPBA 2EDCA 1I1QB 1EGMB 1I6MA 2GEJA 2J5KA 1GU7A 1N6HA 3MOGA 4FFVA 1I4TD 3COJA 4BE7B 1FJ2A 2P2ZA 4FCTA 4R2MA 1EGHA 1VPDA 4CF5A 2G80A 2JAHA 3I2FA 4HLDA 3NVAA 3OIDA 1SHTX 1QOPB 1JU9A 2IX9A 3T99A 2D2IA 3U4MA 4ZV9A 1Q16A 2VPIA 1ESDA 5CFRA 2ODEA 1JA0A 3THXA 3VHLB 2FWNA 4DFDA 3C7TA 4GLJA 4A2CA 2DP4E 2HA2A 3OZUA 4ZOQI 1TO6A 2XH8A 1ANKA 4MA4A 4LRUA 1A5ZA 2O52A 5DGCA 3S7ZA 4CBVA 4YRMA 1GKYA 2C59A 5EJAA 3WWYA 4ZO9A 4GP6A 4J3NA 1XZBA 2X1HA 1Z8HA 3DQZA 2G5CA 3D0OA 1ARZA 1HY3A 2VXYA 3BD8A 3MTDA 4ZJZA 4X1YB 2H59A 1L1QA 1E60A 4LWOA 3AL0C 4H15A 5IXYA 3H8SA 1Z74A 1QH1B 1KZGB 3MTQA 2F8LA 3T5PA 2W0MA 2BEUA 4HQLA 1X39A 4GWLA 3ABIA 3CMMA 2COKA 1Y8QA 5GMOA 4D8VA 5EOVA 1I5OA 5AVZA 4TWZA 1V5EA 4F4FA 4QTUB 3KRTA 4EFDA 1OLUB 2K4MA 3NB0A 1OXKB 5JNVA 2O2CA 2PZLA 1HDEA 3VX3A 2JDID 4YBZA 2AXPA 4IGEA 2GHIA 5EPEA 1WUJS 4NTZA 3LY7A 1DQRA 2RKBA 1U02A 3K6SB 3WK9A 3ZHQA 1NFRA 1HNWB 4MEBA 4RFSB 1RLMA 1RLUA 2IPOA 3CW8X 1UWVA 2BR5A 2IHKA 4LHWA 5L3ZA 3ZWVA 4E08A 2PJZA 1NDUA 4LZAA 1VE3A 1TTQB 2I8AA 3JZDA 5H68A 2N42A 2V65A 2V7UA 3FDZA 4FNOA 1SD5A 2YY5A 4Q02A 4BAZA 1IJKA 1JEYA 3O6VA 1CY1A 2PL3A 1I4EB 3K72B 5I47A 4PY2A 3OZ7A 1O1YA 3L1VA 2PY6A 4R5HA 2QM0A 3OTIA 1DWUA 4WY2A 2HBYA 3HKBA 5AHOA 2AQ8A 3SDBA 3K9FC 2NTNA 2ZIUB 4LC1A 1V6CA 1R8SA 3I8XA 3DAGA 4QDXA 1CUYA 2GXSA 1FNSA 3GRCA 4LX0A 4JX8A 3I6BA 4B2LA 3M4XA 3KZCA 4S05A 3ED1A 4URVR 8GPBA 5BSFA 1FTSA 1MFPA 1T91A 1ZRMA 3NOQA 4FR5A 3RRBA 3P0RA 1CWUA 3QVGB 4CL2A 3H2BA 4YRIA 4WK0B 2GJ4A 3JSAA 4WA8A 2XB4A 5KQLA 3W5BA 2Y6UA 4H1WA 2L2QA 2BJWA 2OT3B 2XMGA 3TX2A 1EK5A 4KJXA 1SRQA 2JFGA 4L4ZA 4L28A 2OWDA 5HMLA 1T36A 3ORSA 2AC7A 3FTCA 3QOXA 5TSDA 3BJMA 1WCXA 1QC5B 1NULA 4FHGA 4CETA 3EZGA 3OZVA 3O5AA 3FYUA 4MI1A 1S0UA 3QF7A 1M0TA 1U3FA 3H4IA 5KWJA 1N33B 1PKEA 3DA8A 3R3SA 3VSCA 3D0QA 3BDAA 3WYNA 3KOWA 3LXRA 1JE0A 4RQTA 4ZQIA 4P22A 5HOQA 1B26A 2EG5A 2C88A 2QTMA 4QUIA 3QPVA 4QFDA 1J00A 1G1AA 3FOAA 1QWOA 2XVXA 3M6IA 4ISBA 5E9QA 1YBHA 1PJQA 3KR9A 5T4HA 2PJDA 3RUHA 3KXKA 3QEMA 2H07A 4CLEA 5HRAA 5ALUA 2IK8A 1XF1A 1MPTA 3FG9A 4ESOA 2HCTA 5FADA 4A5OA 3MUNA 4PZCA 4AWBA 1U3CA 2ZJ4A 3OTHA 2WDZA 3VZRA 3WFJA 3ORQA 4CMGA 2CXNA 3U2QA 4R05A 2RD2A 2ZS7A 4ZWNA 2DSNA 4TSFA 4BGVA 4PFSA 5B1DA 1O6FA 3NALA 4J75A 3PV0A 1RXUA 4RJJA 1VSQA 1RACA 1WD5A 4ZYWA 1KP2A 4NZMA 1HRKA 3HJNA 5C5EA 5I9LA 3OY7A 1ACLA 1OZFA 5C1BA 4GX1A 3EUEA 3NRBA 1OIVA 3JATA 3RSSA 3F97A 4UMVA 1WL8A 2B37A 2FPGA 4TYYA 4Q93A 4ZVKA 5E3HA 2R79A 1OBCA 2CFTA 3BMOB 1IOLA 1W87A 4WZBE 5FWDA 3VV2A 3IDQA 4EB8A 3LC0A 3RODA 1F1BA 1VP9A 3NTVA 2G9VA 2VHXA 2AMFA 3DG9A 2XZDA 3JQGA 4ZZ2A 3Q7TA 2IXFA 4NRDA 3A0UA 4IZ6A 4MJLA 2OAQ1 5AK6A 2SCUA 1K4KA 5TJHA 4AJEA 3TM4A 2NUBA 3FCAA 4TYNA 2J9XB 2Z3WA 1NMQA 2H1LA 3GJTA 3GUHA 3L7CA 4H9GA 3V7FA 3AJAA 1B2RA 4M8NE 4OAOA 4ZEMA 4NOLA 2VA8A 4FEEA 4W1RA 4XUDA 4WBNA 1YDWA 2QRNA 5EVJA 1UDXA 1DV2A 1U81A 4HQKA 1R0SA 2G09A 3RVNA 1MR3F 1T8RA 1TLLA 5JARA 3OZRA 1EDOA 2JZCA 4EYGA 4W99A 2C04A 3O8QB 1ZH0A 2VUUA 3NBFA 1ZJJA 3K4PA 3DXYA 3W3AA 4GEGA 5AKLA 3OQNA 4ARZA 1UEXC 2XIJA 4EVQA 2HCJB 4B46A 2ZYDA 3T4UA 2W6NA 4G0UA 2FA9A 4PYMA 4AICA 2PGIA 1U0FA 3BXXA 5CVCA 5KNDH 4CXMA 3HL0A 2ZTLA 5FA5A 2NLOA 4Q7LA 3EPKA 1H4QA 1O7JA 3BILA 4OBBA 4Y6QA 1CRQA 1EM8B 3IVRA 1B0UA 2C5AA 2BHTA 2WJ6A 4NPCA 4Z9XA 5AUPB 2YV1A 2PX8A 4RDXA 3ADCA 1VMAA 2EFGA 3H11A 1R9GA 1F12A 2O3TA 4QUDA 5G4KB 4JHLA 3M82A 2WTNA 4OXQA 4OJKA 2RH4A 4OA5A 3LY9A 1LB1B 1FDRA 2RHTA 3A06A 1VL8A 3LK7A 4MWSA 3SM9A 1UKVY 3SVZA 1VDMA 3F7NA 4MGEA 2CJFA 2B98A 3QKTA 4CKZA 4A2PA 4CDGA 3EFEA 5IH3A 1L7MA 1OFVA 2ZBVA 2EKLA 3KYCA 3OUTA 3OFVA 3GI1A 4KKVA 4TZ6A 4ZGGA 1I2MA 4AWAA 4YDQA 2B21A 2G63A 1HPLA 2PRKA 5DRTA 1XXHA 4AMBA 3RKSA 1QPBA 2Q28A 3HMKA 3PYMA 4G1FA 3DMTC 2XAAA 4JGGA 2DAPA 3VR6D 1Y3IA 3DZBA 3E6AA 1U6IA 3DOHA 1XT6A 3ZQ4A 3MWEB 3S2ZA 3UPTA 4CUJA 3F98A 2VI5A 3WYDA 4C5AA 1HQKA 4ND1A 5A1JA 5EJ9A 3EXFA 4N5LA 4ZK6A 1U1DA 4CQNA 1L8XA 2XMBA 3KQMA 3KL2A 4FDMA 3Q2OA 3VR4A 1SVKA 5JXWA 3MJRA 2QN3A 1TYAE 3UH1A 3G8YA 1TM2A 2XKBA 2FY8A 1DDGA 1U90A 1GWNA 1X0XA 2X3UA 2GFQA 2OD7A 3F6RA 3LHSA 4OHFA 2OMEA 3LRXA 2OCPA 1EFRD 4Q4LA 1SBZA 4RZSA 1G4AE 3H1GA 4JZYA 3AEUB 4DW8A 4DXDA 3I9OA 4CMEA 3OZDA 3UF0A 3DF7A 3VPHA 2IPNA 1VL5A 3WNCA 3L8YA 2L69A 2LKDA 5IVHA 1IM2A 1KE1A 3ETHA 4WECA 5AUOB 3ROGA 2NP7A 3UC9A 3KXDA 4C2UA 2EL7A 1QU2A 2N0SA 2RI6A 4XQ9A 1GZDA 3GNSA 2GK4A 2ZBPA 3EXEB 1WDLA 4BCCA 4DB2A 1RAFA 3PF8A 4WSOA 5IAOA 5KQPA 1YO6A 5FPTA 4CLDA 3UAVA 4UHFA 1K8QA 3DMGA 3OCJA 4PLVA 1NQTA 1W94A 2ZKLA 1CVIA 3MT8A 2PPLA 3EWSA 4RXMA 4K05A 1YZHA 4ARCA 2P62A 1NW6A 2JB9A 4O4IF 3OIVA 4WXHA 2ORVA 4V0KA 1JG3A 3TL3A 3ZE7A 1W96A 3W2TA 2N1BA 5JDCA 3FPBA 3FM9A 5G0WA 1S7GA 1BC5A 1NKSA 2UUPA 1AZLA 3BXFA 4RL4A 3LUPA 3N0XA 4XQ0A 2R8XA 4ZI7F 2BFNA 3MPOA 1ZMBA 3UK7A 4DR2B 3IILA 2ZEJA 1TM7E 2MJLA 2VYND 3PNYA 3MAJA 4FXPA 1I13A 4MPRA 4MYDA 4DCGA 5DTJA 3EEOA 4C5BA 1LW6E 5HVNA 10MHA 3VPCA 2YRXA 3CXRA 4Q1DA 2I91A 1PVOA 4NJEB 3HSKA 3F71A 4MUMA 5EJIA 3UO8B 2WNSA 3QVWA 4Y9RA 3E5RA 3VAZA 3KNZA 2Q4TA 3NR2A 4D5GA 3UPUA 4Z53A 4BMNA 1U3GA 1TE2A 4L73A 1O9BA 1QTRA 1SPXA 5HA5A 4NAVA 5ALNA 3WDSA 2ATXA 1AZWA 3O03A 1D6NA 2QW1A 3ZWBA 4E5VA 4L74A 3RRNA 5HK9A 1CVRA 2BM8A 3B3FA 5JSHA 5LJLA 1AQLA 4RTMA 1AKYA 2YZGA 3JV7A 5DTQA 1BW9A 3OM8A 2GHRA 2ZXUA 1T4CB 3HR8A 4UTNA 1SIBE 2H7CA 4R3WA 4WK6A 4TKLA 1PP4A 1QGUA 2XTJA 4TQGA 4UUBA 4FMDB 1G5QA 2DWUA 3ZWAA 2YW9A 5LQAA 3OZSA 3ULKA 2XWPA 5DOZA 1MP0A 2DJIA 1XYYA 4PYIA 3WRXC 1K92A 5C5CA 5BUQA 1IBMB 3LT4A 3AQIA 3F67A 3KM0A 2NPFA 3USZA 4FFOA 4HNTA 4KR3A 4K40A 4N47A 3PKZA 2IC5A 4GOJA 1WMSA 3REQB 4M8IA 4K3UA 3VKHA 4RA9A 4MQFA 3U31A 2F67A 2PMBA 3ZXUB 4D4MA 4F3CA 2EX1A 5CX1B 4CMEC 1H2BA 3QUBA 1R5NA 1CETA 3UFXA 4KBFA 3ROPA 4KXLA 3UJ6A 3ROTA 2AK3A 3UPDA 4EZIA 2WTXA 3A9WA 4AJ2A 4C6TA 3DO6A 3DEZA 4B3GA 1RTTA 4LS3A 3QKRB 3AR2A 2H4HA 2D8MA 2Z1NA 1Q14A 2I2DA 2PXCA 4Q7EA 5CNJA 1SVSA 3WGZA 3UMYA 2J8ZA 5LMUB 4I9UA 1P9RA 2VHJA 5K0NA 1N2IA 1K86A 1NG1A 3DBOB 4HJXA 3FPCA 4LF4B 2AR0A 4Q47A 4UDOA 4JELA 4EJ0A 1BS2A 1RMTA 4Q3DA 5AJHA 4TL9A 5B3KA 2J3JA 2RJ3A 2VDJA 2QX6A 1LRLA 4MV4A 3V34A 1QHFA 4DY6A 4QSHA 1GRCA 4XAQA 1R6UA 1XDZA 2YYYA 5AXCA 1PUIA 2M9MA 4BDTA 1KJQA 2F3SA 3HYSA 5F2NA 4EEZA 1HLDA 1I3CA 2OC9A 5IMSA 2Q5HA 2PT7A 3KPWA 3BE4A 3R5HA 1O5OA 1CEYA 4ZCMA 3NDIA 1JQ3A 4Y6SA 2PGAA 2I4NA 1LU9A 4JLSA 2AI2A 5AXAA 3ZLVA 1O8BA 2AXQA 1P7WA 2RC6A 1O3YA 2F3QA 4K9MA 1VMDA 3SR4A 3LX5A 4HADA 5JXIA 3LV8A 1G8JA 1QUEA 4EHKA 3G6WA 4JD5A 2P9JA 3UENA 4B83A 5HIMA 3PZRA 5A5EA 2CJXA 5A4JA 3BTOA 4I1VA 1BN6A 4B48A 4JEUA 4ZHQF 1RTKA 3DWGA 4W5HA 3AJRA 1R0XA 2AJDA 3R7LA 3FVVA 3JARB 2F9MA 1C0KA 4DPLA 1LLCA 1J20A 4EEXA 3MSXA 4N48A 4M83A 4D3ZA 1MC4A 1GGFA 1IVYA 2GN4A 2EVWX 4XSGA 3GDOA 3D5QA 1E1QD 1Z8DA 2YZ2A 3MOSA 5JWRA 3SVLA 1DJNA 3HO1A 4RDCA 5HIAA 5B64A 1O6GA 3DZHA 4KIGA 4G07A 4KH1A 2G9UA 2BZ0A 4B2YA 3CE9A 2GNPA 1RFGE 4WKNA 3GVHA 1SK9A 3G0HA 3E7WA 1ECBA 2JD0A 5FAKA 3PUYA 2LR0A 5AM5A 3HBAA 4EPTA 2H4JA 1MUUA 2G1UA 1M6HA 4KWTA 4W7HA 4E7PA 1OB5A 3BFXA 5ITZB 2F64A 5A5VA 3EDRA 3ANTA 3OJCA 3G1WA 4KUEA 5LZ7A 2RH8A 4GPZA 1TZ2A 4O4JA 3WMXA 3VR6A 3ESAA 1P72A 1G20E 2I80A 3GFQA 3MCVA 4YUXA 3CKMA 3V4FA 1KHTA 1UH5A 3G0BA 4BFWA 1W2WB 2J3HA 2H1WA 1OBFO 2GFIA 3D64A 4PE5B 4OBEA 1L3BA 4I6EA 2RHOA 3DQPA 1IBKB 1UP7A 1ZY2A 4DQUA 1OBOA 5KHLB 4GWKA 4BO1A 4YXFA 1FDOA 3HU5A 3OIUA 1VRCA 2EJUA 1Z5UA 4M88A 4RK0A 3VPAA 5BUSA 3B1FA 3HN2A 1SQ5A 4AIRA 2IUYA 1P61B 4EB6A 3IUPA 1DOHA 2FMKA 2DHEA 3OF5A 3OM9A 4QTTB 1GQSA 4Z0TA 3S70A 3OQ6A 1AQJA 4TRRA 1V4BA 2Y0EA 2ZPTX 1E6MA 4FYYA 4UDYX 1IN4A 1GTMA 1TCAA 5K8UA 2H1CA 3E1GA 4BO0A 1X3SA 2HMTA 4NMXB 3SHTA 5KTKA 1AA6A 2HBRA 1N8SA 1AKTA 3TTVA 1JU4A 2QXYA 5EUBA 1NJFA 1CPYA 1SKYE 5IKOA 2P2NA 1U8ZA 3ANMA 3AHEA 3I9JA 3IQIX 3LJKA 1BXZA 5DGIA 4ZTBA 4FZ3A 3RJ5A 2FJUA 2UZIR 4QRHA 3TLKA 1Y7TA 5G02A 4UOEA 4Z4GA 4Y2QA 4J0EA 4M9UA 5JFOA 1N1EA 1SUAA 2V54A 1GV1A 2IS6A 5ESDA 1NNSA 1RJEA 3K1AA 2NTVA 2A7QA 3KB1A 2DR3A 4NYMR 3A4NA 1ZC4A 5JHHB 3LDGA 2AJCA 3W3AH 3DMYA 2BFFA 2IZ6A 1PFKA 2DMRA 3FW1A 3G8AA 3AU8A 3GXOA 3P0JA 4WJKB 5AKGA 5A4MS 1SG6A 1XALA 2MYUA 2V0NA 4ILEA 4NFYA 2OBMA 4KK3A 4MINA 3UZUA 2WIGA 3DXFA 3LKDA 4ERNA 4YR9A 1OI2A 4ABTA 4EMSA 1KOFA 1SC9A 4YJGA 2DYKA 3EZFA 3VOBA 1OAKA 4U7FA 5B53A 2ZATA 3U0BA 4ZO8A 5LCXA 1J2TA 3ASVA 3DL4A 2RGYA 4EUFA 3IERA 2R9VA 4EW2A 3FZNA 1FYEA 1O94D 4D25A 5BQXA 4GI3A 3L82B 4EPYA 4K1LA 3PJRA 1IXRC 1EUQA 3A14A 1YRWA 2QJFA 2XWQA 1EBBA 4RVGA 4Z4FA 2PD6A 4P5EA 5FFFA 4HDOB 1AN9A 4IIBA 3NHFA 5IJXA 1XA0A 3A32A 1DLIA 3O83A 1DOAA 2B3DA 2Y1FA 2Q5IA 1H2RS 2Z09A 5IBRA 5JIBA 5K0GA 2C83A 2F1KA 4OX9B 2XNHA 1JHQA 3NAZA 3OKPA 5BQPA 2VF4X 2XBLA 2XADA 3SG0A 2OENG 5JNRA 2IV7A 1KA9H 4TSFD 3X1WA 3O0TA 5ED0A 2VSXA 4R31A 3A1EA 1L1FA 4DA6A 4EELA 5TIIA 2F43A 1VHQA 1V3UA 3MS7A 1ISJA 1VSTA 4TWRA 1HNNA 3GCZA 2O54A 3TI7A 3IUNA 1EFRA 1E1NA 1XROA 5A4KA 3LP8A 4WZAB 5ISMA 5G4KA 4QXMA 3NJ8A 1WXWA 2SKDA 4QXRA 4HR7A 5COQA 5JS2A 3OU6A 1PDVA 1JIUA 1BO6A 3F7TA 1DHRA 3H9BA 3LC2O 1RZ3A 2VK8A 3TFQA 5LMZA 2C58A 3PHLA 1KVUA 2DFDA 1JG1A 4BNDA 1G63A 3GP8A 2I2WA 3SP1A 1WG8A 1JB9A 1AOXA 1K89A 1M2JA 3AG6A 3TZKA 5AJUA 1DGQA 4XWAA 4QOHA 4I08A 1B3RA 1AUOA 1CIJA 2ZAIA 3FKSD 1FMJA 4R9SA 2BF4A 2CXUA 2JGDB 1V7ZA 3FHLA 3BN3A 3LW8A 3IOYA 3NO4A 4H08A 3AJ8A 5HE8A 5D6OA 1KY5A 1W75A 2E89A 5CR9A 1IU9A 3QXXA 5ALWA 5SICE 1MEOA 1LWOA 2OQIA 2YVUA 3AHCA 4JBHA 4JSYA 1I7DA 4YT4A 2OCIA 2X58A 1T3ZA 5DSZA 3DR5A 1JKIA 2XXBA 1DKPA 3IAFA 2IGBA 3PUWA 1AF7A 3NHPA 1GD1O 4FOTA 4P36A 3ENKA 4YS6A 3O8CA 3M9XA 1I4OA 5KPJA 2R44A 3JQ9C 1BHO1 1OTHA 4QJBA 3BL6A 4RORA 3BH0A 4FCVA 5J23A 5E7MA 1DB3A 3GFVA 5A03A 2ZJ7A 1DFIA 3TLJA 4JVLA 3ZN2A 1KI6B 3D6MA 5ALVA 4FSXA 2JFVA 2ZTUA 2ZUEA 4KREA 1TU3A 4S35A 1X7WB 5CHEA 5FP0A 2OXTA 3GCWA 2NSHA 2IF2A 5FLKA 721PA 4DSOA 2YXPX 4DIKA 5IYZF 3P0IA 3DUFB 4QELA 1S2IA 1ZN8A 5K3OA 2VUSA 3JQBC 4ZOLB 3VX4A 1OI3A 1PZGA 3P9ZA 1LFAA 1YDMA 2GZHA 1GR0A 1U2TA 3AU9A 3DFIA 4OYYA 4ZVLA 3M3DA 4BQSA 4B32A 1HR0B 1A8PA 1E2EA 4TWAA 3PLRA 3UJDA 4NICA 3AV3A 4G81A 2AZDA 2H4ZA 5REQB 5H83A 5DM60 5EKSA 5TS3A 4BS9A 3QTLA 4EB3A 1N9GA 2YQ4A 3R20A 4QNRA 5DCWA 3BMQA 2FK7A 1YI8A 3A1SA 4J4TA 5EWJA 3EJWA 3F47A 3II6X 5DLYA 3UAXA 3DHEA 1JDBC 2BR3A 2RBKA 2JH3A 1FMTA 3NJ4A 2BEVA 4DIBA 1E7MA 2G0AA 5L4LA 3HCWA 5I51A 5KYTA 2KI5A 3NEJA 4U00A 1S6YA 3N0WA 3IDOA 5BWCA 1BMQA 5I8PA 5EP3A 1NSFA 2A5DA 2W4IA 4E5UA 2UYGA 3V4PB 1SUIA 4EFNA 3GN2A 3CVVA 1ESNA 3GDHA 3GFPA 2HW8A 2BW0A 4C05A 4JFAA 1JDTA 3EW9A 5JSUA 2MSKA 4UQOA 4W8HA 2FXVA 3PDCA 4MVXA 1WUYA 4BVGA 1QO7A 1A8IA 3F7MA 1NNLA 4BX9A 3NW9A 5FDFA 2UYQA 4OLJA 4JMLA 4BLVA 1E1LA 3M6AA 4MKIA 4KFRA 4PG6A 5FUXA 4I5GA 1UM9B 1QIHA 1IRIA 4N7MA 2NACA 3NV7A 4HMQA 2KLBA 4MQMA 3WJ7A 5B12A 1ZD5A 3V4SA 5EKUA 5FOVA 4GKAA 4GP9A 3E3AA 1IG3A 1UIMA 3U3MA 3VI3B 5IP5A 3WLLA 2O8DA 2FSHA 1KYQA 4IHJB 5E7QA 1ZSNA 3I01A 3TG2A 4C4OA 1IWOA 1Y48E 3UJ8A 1V39A 3VR2A 3E8SA 1NMSA 4BEJA 4KRXA 4D3YA 2W5UA 1IY0A 3OJ0A 3L46A 4XGKA 3A28A 4JT8A 3V4OA 1KEPA 5JZVA 4TV9B 1UOOA 2Y05A 1PEDA 4DRYA 3HEAA 3GUUA 5FL7A 3N76A 4MIYA 2EQAA 2VYVD 3MTBA 1V3QE 1IN5A 3H4VA 3O2JA 2UKDA 2C7BA 1K75A 4P35A 5HNKA 3AILA 4K87A 3ZGZA 2PQMA 5FBHA 1YE8A 3WB0A 2QP9X 1L1EA 1Z2DA 2ZE7A 3CF4G 4D9JA 2OY0A 2MMCA 4FIDA 3SBOA 3T7TA 1PQWA 4I5DA 5IAAA 1AKRA 2XMCA 3U0VA 1U3UA 3ZH9B 2Q3EA 1JDUA 2XSZD 3VYRB 2RH5A 5EUQB 5L3QB 2FCRA 4JJEA 3F1KA 2EF0A 1IHXA 5BMVB 4TTVA 1VCHA 5BSKA 1I24A 3IVGA