3HXKA

Crystal structure of a sugar hydrolase (yeeb) from lactococcus lactis, northeast structural genomics consortium target kr108
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
256
structure length
250
Chain Sequence
NKSTFSLNDTAWVDFYQLQNYTFPAIIICPGGGYQHISQRESDPLALAFLAQGYQVLLLNYTVMNKGTNYNFLSQNLEEVQAVFSLIHQNHKEWQINPEQVFLLGCSAGGHLAAWYGNSEQIHRPKGVILCYPVTSFTFGWPSDLSHFNFEIENISEYNISEKVTSSTPPTFIWHTADDEGVPIYNSLKYCDRLSKHQVPFEAHFFESGPHGVSLANRTTAPSDAYCLPSVHRWVSWASDWLERQIKNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a sugar hydrolase (YeeB) from Lactococcus lactis, Northeast Structural Genomics Consortium Target KR108
rcsb
source organism Lactococcus lactis subsp. lactis
molecule tags Hydrolase
molecule keywords Sugar hydrolase
total genus 63
structure length 250
sequence length 256
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00326 Peptidase_S9 Prolyl oligopeptidase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hxkA00
4J0KA 1UKCA 2C4HA 4K5QA 4KE9A 4BBZA 1EH5A 2QTBA 1DQZA 3HI4A 4CI9A 4BAUA 3EQ7A 3PE6A 3WYNA 5EHNA 4E14A 4F21A 3G0GA 3TRDA 5KWIA 4H18A 3B12A 2ZJFA 4FTWA 4BRSA 4ZI5A 5EIAA 4LXIA 1CUWA 2RIPA 3H19A 4KYVA 4OYYA 1WB5A 3R3ZA 4JH0A 3WYDA 2I3ZA 3NGMA 4E11A 1XZDA 3W2TA 1LPPA 3HRHA 1W52X 3GBSA 2WHPB 4AXBA 3WKCA 2IITA 5HFNA 4M0MA 4ZREA 3A2LA 1A8UA 4U2GA 5JAPA 3AUKA 2HA5A 2OQVA 2JF0A 5FRDA 3ANSA 2WHRA 4H77A 2WJ3A 3C87A 5JZ9A 4LYEA 1XZCA 5DTJA 4H7KA 3KXPA 2BUAA 4H7HA 3I28A 4KRYA 4FWBA 2PSFA 4B7ZA 1X70A 2WIGA 1C4XA 1EXWA 4XVCA 1VZ2A 1R88A 2G4LA 2QJWA 2WFMA 3FYUC 3HC7A 5ALLA 4G4JA 3W05A 3R3YA 2C5FA 2O2GA 1BCRA 1LPNA 4FFVA 2JGLA 1XRMA 3ICWA 3I6ZA 3QM1A 4W1QA 4QNNA 1P0MA 1AKNA 1F6WA 3G02A 1W1IA 1FJ2A 5IVDA 4FFWA 1CR6A 1BEEA 3H2IA 3F9CA 3PFCA 4W1PA 5EFZA 4FLMA 3WJ1A 1IMJA 4H7EA 3BWXA 4FHZA 1J07A 1QIKA 2WJ4A 4EHBA 4GHWA 1E8MA 4AQDA 4UHDA 1USWA 1FSSA 5C8XA 2HU8A 1BS9A 3IUMA 4W63A 2Z5GA 1TCAA 2XUAA 4X94A 3HSSA 3FYTA 2W6CX 1XROA 2ZJ6A 4BVLA 4J0JA 1UK9A 5IKXA 1DWQA 2BAGA 3GZJA 5ALWA 4GECA 3QMVA 5AI8A 1K63A 3VDXA 5AOBA 1BE0A 1L7AA 4J7AA 1CUZA 4CG2A 1LZLA 2YYSA 4EY5A 1MTZA 3WMRA 2D0DA 5ALUA 2UZ0A 2VSQA 4H0CA 1MAAA 3FCYA 3F96A 2XUGA 4G9GA 1GQRA 4N5IX 3FYUB 2BGNA 3QMMA 3K2IA 3R40A 4B82A 2QMQA 2J3QA 4BTVA 2DHEA 4DSZA 4AN1A 1CUDA 1YAJA 1ZGCA 2VJBA 4BAGA 3FSGA 2Z3WA 2ZSHA 1DT3A 5ALDA 3ILSA 1B41A 2GBCA 2ACEA 4P9NA 2C58A 4XWGA 1AURA 1UK7A 3HLKA 5AOAA 5EHXA 1ZD2P 3CCCA 1VJ5A 2PSHA 4M0EA 1H23A 4Y2UA 3O4HA 3AIKA 4INZA 5JD4A 2JGKA 1X2EA 3WKDA 3DNMA 1QZ3A 4UBMA 3FNBA 3STYA 3ED1A 3IDAA 3S2ZA 1H2XA 1CUCA 4Q3KA 2PSDA 4QWMA 2ONCA 2WM2A 4LHEA 5LYYA 1KU6A 1LZKA 4RPCA 1G42A 2QVBA 4PV7A 4CG3A 4DNPA 1ZIXA 2C0QA 2HFJA 3FLBA 3PF8A 1U65A 5FV4A 4BVKA 4QLOA 3QPDA 1EA5A 1MAHA 5AKHA 2GBFA 3HZOA 4UFPA 4UFNA 3N2ZB 4NMWA 5I7UA 5JYCA 3ZPXA 5ALQA 5ESRA 2X5XA 4X93A 4EUSA 1QFSA 2WFZA 2HM7A 1TCBA 3SWWA 4X7BA 5AI4A 1LPAB 3HEAA 5DTIA 5JIBA 4YX9A 1XZIA 2WUGA 1SCQA 2ZJ7A 3WL8A 4KE6A 4BDTA 1DWOA 1ZIYA 2OCKA 1VXRA 4P92A 4MXDA 3R3WA 5C81A 2OGSA 1SC9A 5AK5A 2QRUA 4J0IA 5LZ4A 3H2KA 2G5PA 2BGRA 4AO6A 2FJPA 5LZ8A 4K6HA 1CPYA 2ES4A 2WIJA 3RLIA 2WU4A 2ZYIA 3VISA 3K9BA 2XMQA 1LBSA 4FKBA 3AZQA 1U4NA 4P08A 3WA7A 3LP5A 3D0KA 3G0BA 1IUPA 4XX1A 1UZAA 1CEXA 1AGYA 2XLCA 4B83A 5ALFA 4B81A 4G5XA 2QR5A 1PV1A 4C87A 3FVTA 5AH0A 2Y2VA 2GYVA 4Y2TA 1ZGBA 5ALSA 3X3HA 4Y2XA 1QIHA 2JGFA 2XUOA 1ZOIA 3G9ZA 3IB3A 4OB6A 3RK4A 1A8QA 3W9BA 2XUQA 5KWJA 2XMSA 2CJPA 4Z49A 4WJLA 2VAVA 1ZD5A 1JJIA 3VKFA 1E8DA 1IUOA 4UHCA 3UUEA 1W76A 1VA5A 4JNCA 3C5WP 5ALGA 3EIOA 5HK8A 3DKKA 4ZWNA 4AB1A 4CCYA 3A6ZA 1JT2A 4CIBA 3D5EA 3OG9A 2RI6A 4U2BA 4KE7A 4N8DA 2DQZA 1QE3A 4DNQA 3WA6A 3R41A 4RNCA 1OILA 2WSLA 3H1BA 4GEGA 2PSEA 4U2DA 4ZV9A 5ALNA 3EQ8A 3GROA 2G63A 4NVRA 5LIPA 4HRYA 1QIGA 4UPDA 1MNAA 2PL5A 4GI1A 3ZI7A 4IH1A 3M81A 1BU8A 4ZGBA 5AI5A 5CW2A 3FYUA 1JFRA 5AM1A 3RKSA 2GZRA 3QPAA 4OUKX 2IX9A 4IH4A 2OAEA 1YS1X 3R3UA 3WI7A 4AX4A 5SYMA 4G9EA 4J0GA 1CUXA 3N0TA 3IVMA 1I6WA 3VJMA 4QA9A 4NS4A 3H18A 2OXEA 3JYHA 4PQEA 5AM5A 3A70A 3M83A 1XZAA 4ARBA 5AO9A 5DNWA 4BC1A 1RWQA 4OPMA 1C7IA 3WK6A 5EHZA 3TJMA 3F67A 5C8ZA 1ZD4A 1WM1A 4BE9A 4N5HX 5HZGA 2V96A 2ZYHA 3ICVA 1JU3A 1UK8A 1CUHA 3SC2A 4AMYA 4QE3A 1EX9A 2H7YA 5E4YA 1JKMA 3WQHA 5D7BA 2I3DA 1DT5A 1GKKA 3DYVA 3DEAA 5CH5A 1T4MA 4QDOA 2XMDA 5AOCA 4QLAA 5LLSA 3BF8A 3I2HA 3STXA 5K3FA 1WOMA 4XIIA 1UKAA 4UBLA 4EY6A 4X95A 2BUBA 3WWPA 2PSJA 4JYMA 5JADA 1R50A 4I4CA 2WG1A 1MX1A 2Y6UA 3BJRA 1C7JA 5AI6A 4WFKA 1GZ7A 1LPMA 3HXKA 2OG1A 1IVYA 4BYMA 5K3FB 4TVKA 2VQ6A 4KR0A 5AIBA 3ZV7A 1JJFA 4G1FA 3IUJA 3QPCA 3WLAA 1XZHA 3P2MA 1FFDA 2VAXA 2XLBA 2HU7A 4YK7A 4C01A 4ZXFA 5JD6A 4YASA 5AJHA 3WZMA 5DLPA 5HFAA 5HF9A 4OB7A 4Y2SA 4U2FA 2WUEA 3BIXA 4H7JA 1LPOA 2VA9A 5JARA 3V1MA 2HA0A 3DLTA 2XUFA 3T4UA 3H2JA 2OGZA 1ACJA 1GPKA 2D5LA 1XZGA 2WTNA 3WL5A 3RARA 1XZLA 1QLWA 3M3DA 2QUAA 4MYSA 2AJ8A 5J3JA 3K6KA 5DJ5A 5ALRA 1R4ZA 1TCCA 4DIUA 2R8BA 4OU4A 3BIWA 1HDEA 5LZ9A 1ZICA 1CUVA 3T52A 4BC0A 3PI6A 1MX5A 4J0CA 2HL6A 3ANTA 1P0QA 3VJLA 2Y6VA 4C88A 2QZPA 1A8SA 4L0CA 4NZZA 2BFNA 3KWFA 2X76A 5T4FA 1DX4A 1XZMA 5T4EA 2Y1KA 1TKRA 3AINA 3IIIA 2Z8ZA 1ODCA 4DNOA 3W04A 4FOLA 3PICA 4Q34A 1EINA 5EIHA 1VXOA 1CQWA 2QKYA 4OCZA 2PU7A 5E4JA 1VE6A 5HKAA 1OCEA 4MQMA 2XI4A 5T4BA 1BROA 3IA2A 3VXKA 3MVEA 4C4XA 4G4IA 4MWTA 3DCNA 2HA2A 5A62A 5ALJA 2PPLA 5IVHA 3R3XA 3C45A 4KAAA 3G7NA 4HRXA 5T4HA 2CZQA 4PF1A 1N5RA 1RP1A 2AJLI 3G9TA 5AICA 1FFBA 3C6ZA 4Y7DA 3OM8A 3QVMA 5LP1A 1L7QA 5AK3A 1W6RA 5BV7A 2PM8A 2QXUA 3AIOA 2VF2A 4J0HA 5JASA 1MU0A 1A7UA 1MX9A 2QOEA 4AN0A 4FDMA 2AXEA 3WIBA 4DMCA 1WHTA 3I2IA 3QH4A 1GGVA 3YASA 2HHAA 1CRLA 1Y7HA 5ALKA 4X92A 2WHPA 3C70A 3LIPA 3AZOA 5E2IA 2WU3A 2B4KA 3V1NA 1MJ5A 4FNGA 3AILA 1H2YA 1YAHA 1AZWA 1UKBA 1EDDA 2BJHA 3WK7A 1DWPA 3PUHA 2XQKA 5A2GA 3H04A 2ROQA 4MJ3A 1EB8A 1Q83A 3GUUA 1S8OA 1QIDA 3EBLA 2Z8XA 5FPPA 4UUQA 5ALIA 1TRHA 1HBJA 1QIJA 2ACKA 4L3WA 1B6GA 1CLEA 1J1IA 1AMNA 3OPMA 5F4ZA 5ALZA 4CCWA 3TGLA 3ESAA 4Y2JA 1BN7A 2J4CA 5H3HA 5DYTA 5LZ2A 3L1IA 3GA7A 4B84A 2DHCA 5AK6A 1THGA 5CXUA 4I19A 3KDAA 1ZJ4A 4X6XA 1E8NA 2EDCA 1TK3A 2WJ6A 3FAKA 1HQDA 1DX6A 4B0PA 1G4HA 1QIEA 2OQIA 1H22A 3HABA 1VA4A 1ACLA 1X2BA 5AM4A 1IUNA 1IZ8A 3D7RA 2B20A 4PSDA 1YCDA 3DOIA 4ETWA 2VATA 3B3QA 1XRPA 4GDMA 4H7FA 4WDRA 1RYYA 1QIFA 1QOZA 3IUNA 3Q8WA 3U0VA 2GYUA 3STTA 3DOHA 3O9MA 6YASA 3F8SA 1HL7A 3JWEA 2VEOA 3E4DA 3G9XA 5FLKA 4H35A 3W06A 2Y2UA 4S0XA 3ZLTA 2CUTA 5JD5A 3FCXA 4X6UA 5EGNA 5DNVA 3WK5A 3C5VA 1NU8A 5ALMA 3JW8A 2XQJA 1FFCA 3L1JA 4FNMA 4EY4A 1CUYA 4PW0A 1J2EA 1XFDA 2HRRA 1TQHA 4WY5A 3S8YA 1NX9A 1QONA 4DMKA 4L9AA 4AO8A 1R9MA 4K6GA 2BKLA 2GBIA 5AKEA 1DU4A 4WY8A 2WG0A 5A7HA 2PVSA 2Z3ZA 3VVLA 3O0DA 4PSCA 1WB4A 4GXNA 1XQXA 1ISPA 2H7XA 4UHEA 4BZWA 3NOXA 4N8EA 4EA6A 1EI9A 4WDQA 4HAIA 1Z68A 4DGQA 3E0XA 5EI5A 3FBWA 1G5FA 1VE7A 1BEZA 2P8SA 4HS9A 4X91A 3WWEA 1W75A 4DNFA 1CUIA 3PDCA 3DJYA 5BOVA 2X8BA 2XQFA 4MQLA 3I1IA 5HF8A 2WFLB 3CXUA 3MGAA 3O95A 1XKLA 2CKMA 4QDUA 4BP8A 2I03A 2PX6A 5JATA 3OC0A 3STWA 4W1RA 4BCDA 1EB9A 2V98A 4MEBA 4Y2VA 1QTIA 1SOMA 2XDWA 2XMZA 1UWCA 2XUIA 2JBWA 3G9UA 5DYYA 1VOTA 3G0CA 2XUPA 2HFKA 5LZ5A 1XZKA 3BF7A 5AKYA 5HKBA 3I6MA 3R0VA 2DQYA 1ZI8A 4C4ZA 2HA4A 2ZYSA 4EY8A 4B9AA 3ZWQA 1ORWA 4DYHA 2H9YA 1YASA 1J06A 2XUJA 2B9VA 1G66A 4UHFA 1TAHA 2PUJA 3IULA 1HPLA 1E66A 2JGJA 3MUNA 2I78A 1XLVA 3STVA 3V9AA 3BJMA 1M33A 3CCBA 1FFAA 3KWJA 1E3QA 4A5SA 3C43A 1UOOA 4ROTA 3HJUA 4ITVA 2AJDA 2XE4A 5K5EA 2WIDA 4Y2QA 5AI0A 2RHWA 2HADA 3F98A 5AKXA 3EF3A 3O9VA 2NW6A 4B80A 1K4YA 2V9ZA 1MN6A 3DL4A 2Q0XA 3G0IA 3C6XA 4H7IA 1CUGA 2GZSA 2FJ0A 2WUFA 3VJKA 4N8SA 3BDIA 2VJAA 5HQ3A 4HXFB 3L1HA 2RGUA 2DHDA 4OYLA 3V1KA 3I6YA 4C6HA 3NUZA 5HK9A 1O6FA 3QZUA 2GYWA 2VTVA 1LLFA 1L7RA 3WKAA 1QO9A 1UXOA 2JGIA 4BB0A 3IUQA 1UT6A 1ETHA 1XZEA 5IVIA 4BAZA 3BE8A 3BDVA 4EY7A 1QFMA 5AM3A 5K3DA 3QYJA 2JEYA 3SX4A 3HYSA 2O2HA 5D3ZA 5CH3A 3O4IA 2G5TA 1Q84A 4GW3A 5SYNA 1AC5A 4X90A 2QM0A 4E15A 3WZLA 2H7CA 2JGMA 4OD0A 1SCKA 2WIFA 1Q0RA 1UFOA 3FVRA 5CT5A 1FFEA 4BTLA 3TEJA 2HU5A 4A16A 4F5ZA 2O7VA 5CH8A 3ESCA 4OU5A 3M82A 4TGLA 3H2GA 3MUOA 3D2CA 1XRQA 3QBJA 2OGTA 2XMGA 4Q3LA 2OAGA 4PO3X 2R11A 2XMCA 3C8DA 1CUFA 1JMKC 4KJXA 2BCEA 1JMYA 5BWBA 4M0FA 2PU5A 5CT6A 1EDEA 1QGED 4K2AA 1WPXA 3KOOA 4X97A 4YPVA 1T2NA 2XT0A 4C89A 2OLEA 1BRTA 5K3EA 1F0NA 4DM7A 2WTMA 3O4JA 4GWLA 1EDBA 4RE6A 1EVEA 5HQ3B 3PFBA 4KRXA 4HTAA 1N8SA 4DTCA 3OTQA 1U8EA 3AZPA 1XQVA 2HA3A 4WCVA 1R1DA 1WHSA 4GBGA 3ZLVA 4WFIA 4DLNA 4X6YA 3OOSA 3ZLUA 1ORVA 4C4YA 4RGYA 1CQZA 1ODSA 3EQ9A 2DR0A 5K3BA 2QXTA 4K6KA 4B6GA 3D2AA 5CMLA 2OCGA 2EEPA 1QIMA 3H1AA 1TIBA 4GLBA 5A6VA 1XQWA 5HF5A 5JAOA 2B61A 3WJ2A 5ALOA 1H2ZA 4BDSA 1XRRA 2J3DA 2XQGA 2K2QB 1LPSA 4G8BA 4LYDA 4Q1VA 3IBTA 4WFJA 1ZD3A 3V48A 4UBNA 1N1MA 1SFRA 4X85A 1XLWA 4BE4A 3F97A 3DL7A 4BATA 4QZVA 2OCIA 3ESDA 5FDFA 3DS8A 4L72A 3O4GA 5AM0A 5LKAA 2OCLA 1DINA 1MO2A 5A7GA 3E1GA 1QTRA 3QITA 1EK1A 4G4GA 5YASA 5JANA 1CUJA 3DYIA 1UK6A 5CTAA 1BCSA 4G8DA 4BVJA 3AFIA 5AM2A 5FPQA 4J3JA 4CIAA 2XMRA 1DQYA 1Q0ZA 1CIJA 1E5TA 1PJAA 2WILA 2BUCA 1ODTC 5AKJA 3BXPA 1CV2A 4UHHA 3NWOA 1GT6A 2XMBA 1Y7IA 5D3KA 5EHQA 4O08A 1CUSA 1YSCA 4CG1A 2C5GA 2HA7A 1MPXA 2EDAA 5ALPA 1CUEA 4MWSA 5LZ7A 5K3CA 4Q05A 1AX9A 5IVKA 4AMZA 5I8PA 5AIAA 3WWCA 1WCYA 5FUMA 3AIMA 1W4LA 4BZZA 2JIDA 1U2EA 1O6GA 2J4FA 3WWDA 3STUA 1K6EA 2HDWA 4AZ0A 1THTA 3I2FA 3VVMA 1IZ7A 1HLGA 5CURA 3Q0TA 2AJBA 4B0OA 4LKOA 2QT9A 1XQYA 2V97A 1P0PA 5A7FA 4UFOA 4KAJA 4OSEA 1OXMA 2ZYRA 2DCMA 1KEZA 4MEAA 1D07A 4HXGA 1GPNA 4FBLA 4XJVA 2WUDA 2WQZA 5JAHA 1QIIA 5JZSA 3WL7A 4PNZA 2RHTA 3A2NA 3FSGD 4X71A 1XRLA 1UOPA 5D6OA 3WK9A 4QDXA 4G8CA 3U1TA 2XUKA 2HIHA 4UHBA 3LCRA 2OPHA 2ZVDA 3DKRA 4ZRDA 1VKHA 2HA6A 3R3VA 4KEAA 5ALHA 1Y37A 1JI3A 4JYPA 2FX5A 1LBTA 5AKZA 1XZJA 3D4LA 5ISMA 5HCUA 3IURA 3WWOA 4OB8A 1P0IA 1YB6A 5FOQA 1XRNA 4JUIA 4JEIA 3WL6A 5AKIA 5JALA 1SCIA 2PKYX 1CVLA 2LIPA 1CFJA 3WKEA 3FLAA 5AKGA 4AO7A 3G0DA 1GKLA 1XLUA 4Y2YA 1EK2A 3FWHA 3H0CA 1QO7A 5JZBA 3DD5A 5JAUA 1GQSA 2XUDA 4ZV7A 4X3CA 3W9UA 2VJCA 1MNQA 1AQLA 1VLQA 7YASA 2VT7A 4BP9A 4KAFA 4QEKA 5C7YA 5C8VA 2AJCA 1LPBB 1BN6A 4BRZA 1A88A 1ZI9A 3G8YA 4A23A 2JEZA 2C7BA 4MYDA 2PUHA 1NU6A 4B9EA 1CUUA 4UBJA 1XZBA 5KBYA 5CT9A 2O2IA 3LIIA 5K3AA 3ESBA 4EB0A 2GBGA 5CT8A 5LKRA 1GPLA 2C0PA 2WHQA 2WIKA 1H2WA 4KACA 4F0JA 1AUOA 5BWCA 2QUBA 1YB7A 5FXMA 3DQZA 1PFQA 4Q82A 5ALEA 4I3FA 4EBBA 4BCCA 3OURA 1F8UA 3FOBA 3I2KA 5EIEA 2DFPA 4F60A 1VZ3A 5ALTA 4DMFA 4UBKA 3HACA 4RE5A 3CN7A 3H17A 1CUBA 3I2GA 3FLEA 4P93A 3A2MA 4ARAA 4FBMA 4B85A 3D3NA 1K5PA 2WLSA 4FMPA 3UMJA 2WKWA 1XZFA 4X00A 2ORYA 2ECFA 1K8QA 1WPRA 4UBIA 2CMFA 4LXGA 2DSNA 3PF9A 3GELA 4V2IA 3E3AA 3KD2A 3C6YA 3QMWA 3WK4A 5AKKA 4IO0A 2HRQA 1EHYA 4U2EA 4U2CA 1GXSA 5CXXA 4J0DA 2CEKA 2CB9A 3RM3A 2H1IA 4TPKA 1YA8A 3I1YA 1DTEA 2QJRA 1LGYA 1N5MA 2QS9A 4DSAA 4UBOA 5AP9A 2O7RA 2YXPX 4LXHA 4EZIA 5FP0A 1ZJ5A 5HF6A 3BL8A 3B5EA 3WIOA 4DMHA 3WKBA 3LS2A 5E4TA 3D59A 4HVTA 3KSRA 2YH2A 2E3JA 2W22A 5AI9A 5AHXA 2WG2A 4W1SA 3LLCA 1CUAA 5ALYA 1E89A 1ZI6A 1R3DA 5A71A 4QWWA 2JGEA 4H7DA 4AZ3A 4FLEA 2FUKA 4CCYB 2XUHA 4IQ4A 2YASA 5CBKA 2XQIA 4Y2RA 3D2BA 3UUFA 4IHAA 4CFSA 2VT6A 1HKHA 3I2JA 3V1LA 4QDZA 4QDTA 5FKJA 2CBGA 2RONA 1KU0A 3WK8A 4Y9SA 1JU4A 4Y2PA 1WB6A 1LNSA 5CRIA 1QJ4A 4KE8A 4Q3OA 2WFLA 5DYWA 5ALXA 1YR2A 1XKTA 5AK4A 1EVQA 2RAUA 5I9IA 1YA4A 4IH9A 1F0PA 4W9RA 2ZSIA 3H2HA 4LIPD 5KREA 1JJBA 5DWDA 3C6BA 1R9NA 1UOQA 2VJDA 5IH7A 3PUIA 2XB6A 4HXEB 5DNUA 4PSUA 4J03A 3DDUA 1YS2X 5ALVA 4D9JA 3GFFA 4HZGA 1MT3A 3SK0A 5CT4A 2IIVA 4FLFA 5AKLA 2PBLA 4E46A 3AJAA 3CN9A 4BCBA 3C8HA
chains in the Genus database with same CATH superfamily
4Y8VA 3U6KA 1EX6A 4TKVA 2C4HA 1MDFA 3K9LA 2NPIA 3OQJA 3U3JA 1ZNZA 4O63O 3ZD9A 4R8LA 4FYKA 1JDVA 3T0GA 1CXZA 3GDFA 2PUWA 2XKAA 3ZE6A 3GBPA 2DQKA 3ZJ5A 1VG9B 2ECPA 4HXYA 3ZX4A 1Z3CA 2SECE 2WINI 2PUVA 3BL6A 4O2BF 4BFXA 5CR9A 4IJ6A 4BAUA 1Z4OA 3PE6A 1LCIA 3WHLA 1G5RA 1WW2A 4M99A 4X8LA 4Z0TA 5H4HA 3U4DA 1GZUA 1A9PA 3W2EA 3WGIA 1BH6A 3INRA 3Q5EA 4BNLA 1H3FA 3U13A 5F7ZA 4CYMA 3GFSA 1NNI1 2XWBF 2Z2ZA 3PDWA 1I1OA 2NV6A 4RYLA 4C0AC 4ARIA 5KWIA 2PX4A 3B12A 1GPH1 2L18A 2VT2A 3PEUA 4QT0A 4R1TA 2C9BA 2OXRA 3PUYA 2FR8C 2AN1A 4FTWA 2D74A 4ZRMA 3TN7A 3PD1A 4JI6B 3HHEA 2GRAA 5EIAA 2WAYA 4XDHA 3P9RA 1Y8AA 3L6DA 3Q72A 4LXIA 5DU2A 3K0FA 3SM9A 3WIUA 4CQMA 4CQMB 2E4ZA 2JGDA 1W46A 3H19A 2AQ8A 3QXGA 5FD8A 2JBAB 4CMHA 3SC3A 2FY8A 4BEWA 3RTDA 1WIWA 1QQ6A 4OYYA 5IKMA 1ZAKA 3T5CA 1I7NA 1WB5A 3VVBA 4CKXA 1T9GS 2CJFA 2XECA 4FFRA 4TXLA 4EARA 3ORQA 1C3VA 1YZUA 2GR9A 2ZBRA 1JAXA 3JYPA 4D9FA 1HSOA 3L05A 3EIHA 1G98A 1LPPA 1JG2A 2YDYA 1HNNA 2JFHA 5C8YB 2NZVG 5BW6B 4BL5A 2I4RA 1US8A 5IDVA 1AV6A 4AUNA 3TNJA 4KUEA 4AJ4A 5C5EA 1WD7A 1HLPA 3PXBA 4I4TB 1EGHA 4NH0A 3UOAB 5TIIA 2DB3A 2G40A 1DOAA 3U4AA 4IYJA 1V37A 1ONSA 4EG7A 3WKCA 5HFNA 1G8HA 1TO6A 5TMEA 2YJGA 4R5MA 1H6BA 1SU8A 4E3ZA 2HA5A 1X1SA 2WR8A 4BJ5A 2FH5B 1Y42X 5FRDA 1BC5A 4WEQA 1T0PA 1L4YA 4CV0A 3SVTA 4B7XA 2FPIB 3EGDB 4HB3A 1AQIA 4TL9A 5FH9A 3PFFA 4MWZA 4ZA2A 3LL7A 2VI5A 5JZ9A 1QGUA 3I0MA 3O2SB 1WP9A 4LAFA 1SUSA 1I2BA 3WWYA 1U28C 4R9UC 5E3HA 4DAOA 4AULA 1ZW1A 2BUAA 2YHUA 3V97A 3HLTA 4PZZA 2DH6A 4H7HA 1ABBA 1F7UA 1DKMA 1F0YA 5GY7A 3CW8X 3FDXA 3MJSA 4KL8S 4BX0A 5BORA 1X70A 4KCGA 5F9HA 1GTG1 1PUXA 2OV2A 4FDUA 4G0MA 1C4XA 3ZJTA 3I9KA 1EXWA 5DRTA 3S4YA 2H51A 4XWWA 4EG1A 1O87A 4WN9B 4AL4A 4CODB 2HK6A 3M5DA 5ICSA 5ALLA 4LGYA 4DA8A 4G4JA 4LC9A 2PUTA 4ZHQB 1DFHA 1G1AA 4KQXA 1Y9EA 3LE8A 3B3FA 3FRJA 3K0BA 1WV0A 4BZPA 1Z4PX 3FUXA 3RAEC 2A92A 8GPBA 5JC1A 1L6RA 2H1FA 2EW1A 4W99A 4DPMA 2D0PB 3LXUX 5LKRA 4K9PA 2FX2A 2AOWA 3FPFA 2MSWA 3KZKA 1AKTA 4LWQA 4NBWA 4IDCA 1M3SA 4QNNA 3VV3A 4IV5A 3DAHA 1Z2NX 4NCBA 1W1IA 4KR6A 4WKOA 1YQGA 4GYWA 1MORA 2J87A 10MHA 1N36B 4FFWA 3EHDA 4R9SA 2ATEA 5BURA 4KIGA 5H81A 5I9MA 1O5OA 2OXIA 3JYOA 3NRJA 2H1VA 5K8JB 4XQEA 2LNDA 1G7CA 3BSWA 2D2VA 2RH5A 3IE2A 5DX0A 3T95A 4AP9A 4CLOA 3S5JA 1A72A 3ZH2A 1Y1KE 3PQEA 3QLUA 1UH5A 3WJ1A 2PJRA 2QL5A 4YLEA 4TN5A 3B9PA 1IMJA 1W36B 5E4FA 2PH7A 2JJMA 2LV8A 4RK5A 4AG3A 1J2TA 3ND5A 4UZSA 5J1SB 4G0PA 2FPIA 3EGDA 4DQDA 5IAOA 5JY1A 3U7GA 1FTNA 2GF9A 4QTZA 4UHDA 1USWA 1FSSA 1V5EA 1TVCA 3NTUA 2HU8A 5G0SA 1XSEA 1V43A 3QVJA 4Q7EA 3U9SA 2ZGVA 1BD3A 2Z5GA 3H9UA 3MGKA 2YFHA 3CZMA 4LVCA 5DTEA 1Z34A 2A67A 2I1LA 2XUAA 1HFEL 4X94A 4DIFA 3QWBA 2CCJA 1FW6A 2A3RA 1DC5A 2HPZA 1XROA 3RVBA 2FPPA 4DGSA 3AL2A 3UYLA 3ZV6A 2F9FA 3SQWA 2YNMD 1VJRA 1JP7A 1UK9A 4Z53A 3BMCB 4N5NA 5M3BA 5GIPE 1MV5A 2X8AA 4Z3OA 4PINA 2Q4DA 1G5HA 1Y3BE 1B6RA 4HN9A 4LE0A 4NCJA 1TM5E 4CMAA 1DG9A 3W2IA 3GCWA 5AIBA 1IB0A 3P5SA 3EFBA 4EK9A 1BE0A 4IQ0A 4R68A 1K66A 3TIGA 3PENA 2NX2A 1G7SA 3B51X 5BMVB 2RKWA 1JLMA 4FU0A 4D5GA 4JU8A 3I9V1 3TRFA 1CQJB 2I3GA 4MLCA 5KSWB 2KSQA 2FP4B 1LZLA 1SCJA 5LLDA 3NHKA 3KXKA 3WMRA 2AD5A 4C0LA 1ZN7A 5ALUA 1T4GA 4WV3A 3D7LA 1V4NA 4LRYA 4GOLD 2VSQA 4O4LB 4X3OA 4ZEOA 4RJTA 2O20A 2OG2A 1EUZA 1ADGA 1NJ8A 4URFA 4H0CA 1KVRA 3EY4A 3FCYA 4XCXA 4EHDA 2D0OB 2GNAA 2V7WA 3I8OA 1D7OA 2C5EA 3PU6A 1I80A 4EO9A 2ZAGA 1O95A 4QUAA 3ONEA 4LQDA 2J5XA 2C5LA 1AN0A 2O2YA 3FTQA 4QQ8A 4RVDA 2XGOA 4MO9A 1PQ4A 1ONNA 1U3FA 3DVSX 3EWSA 5A3QA 2GAFA 3UJ3X 1NI4B 1PJQA 1W9MA 2BKEA 2WMDA 1NFQA 2FQ1A 1GFWA 1SOVA 3ODPA 4MAMA 3CNEA 3ND7A 3TBHA 4OAPA 4B82A 5GONF 2QMQA 2J3QA 2X0DA 4AZTA 4BWGA 5CB4B 1XNGA 4Z1MD 1IAVA 2DHEA 1EUCB 1A50B 2HRDA 2I2DA 1NQAO 2Q3CA 1IY1A 1P72A 3MC1A 1E7RA 5DIZA 3I5YA 1CUDA 2JIBA 2X0RA 2NYRA 2VJBA 3AI1A 4NYJQ 4M8LA 1GUYA 1S2MA 4CL0A 3IMGA 3MOGA 1JTVA 5EG5A 2JNWA 2ZSHA 4RM2A 1LS6A 2B8NA 4HWKA 4MVJG 4Z9AA 2V0CA 1BCRB 1TVEA 4DCMA 1B41A 5HP4A 3IP8A 4CCSA 5F2EA 1RZRD 4CQLA 3IOEA 3QPUA 3Q2IA 1RWVA 5T64A 3D1VA 2VTBB 1XPOA 2FWBA 2NXJA 4XWGA 1M1YB 4UQPA 5EIWA 5BQPA 5FR1A 1JSCA 3K6SB 4B3XA 4B2PA 2CXXA 1U90A 2B30A 3MN1A 4ZOLA 3EEBA 5FFNA 3DDSA 1P2TA 3CCCA 1G17A 1VJ5A 2OB2A 3GFBA 4LDZA 5EJ4A 1B8NA 1H23A 4Y2UA 2PGLA 5JMWA 5HYVA 5IRCD 1PDVA 2Q3DA 3O4HA 4DKXA 5LYJB 2AZXA 1R0WA 3EIXA 5G0TA 5JZOA 1I3LA 5KCZA 1CIPA 4FJ0A 2JGKA 3STHA 3FM9A 3DNMA 3STYA 4QKQA 5BN4A 3DNPA 1TU3A 1M5TA 1V9LA 3ED1A 3G2KA 4IHQA 4W5WA 3VH1A 4FR2A 5AVTA 1ECJA 2FZ5A 3F7MA 2YR0A 4JK3A 1YI1A 4DWWA 4NSNA 5KYGA 1AN9A 4EELA 1KSFX 4MS4A 1L3BA 1YUNA 4LKRA 4EVIA 5F7JA 2O1WA 1CUCA 1E2JA 1H3NA 4X41A 3H6KA 1SKBA 3QKSA 5FAKA 4NYIR 4O2RA 3UWSA 5JS8A 4LI3X 1UJ5A 3NPMA 3PUWA 3UFBA 1GZVA 4P5PA 3L9XA 5KTRA 2XCTB 1M0WA 4J76A 1A1VA 5DSTA 5J5CA 2BGKA 1MABB 4IXTA 1KXJA 3IPRA 1JIXA 4CEJB 4KODA 2BJWA 1I24A 3DWFA 4MUXA 1LTHR 1QHNA 4WUVA 4Q3AA 3VTFA 1INLA 2VNKA 3ZLJA 2VJQA 3BWDD 3FLBA 3PQ5A 4MK4A 4MMZB 1QOPB 3ZDCA 2W6QA 3NVMB 4LPSA 5G4LA 1U6KA 3HDHA 3ZVMA 5BQFA 3JQPA 2QUKA 4QVKA 4YMIA 1P73A 4DRZA 2R66A 1K6IA 3ZE8A 2TMGA 4QLOA 3L84A 3N2EA 1GSAA 1IVNA 1CQIB 2B0CA 2JH8A 1EA5A 1T36A 5FNVF 3EZXA 3UJ9A 1GLVA 2Q1UA 4UFNA 1DAGA 4PLHA 4ZZ0A 1N92A 2ZYWX 3I4CA 3ZK8A 4BFZA 4ZYVA 5I7UA 3FOZA 1M2KA 3DPUA 3L0OA 4FOTA 5FOSA 1YR8A 2CFIA 3P0RA 3OLCX 1X1DA 4FWIB 4HTFB 2A4KA 2B8JA 3BYZA 3PUVA 5ALQA 2X5XA 1Q22A 5EZYB 5ICEA 2FB9A 3CB4A 1V5FA 2AMJA 4IZOA 4X93A 4KP7A 1VI5A 3PHBE 3Q0EA 4X54A 4EGJA 1JQBA 4EI2A 4B3SB 1BEUB 2HU2A 3WAJA 1KPGA 5EZSA 3SWWA 4DVGA 5CFOA 4W5JA 2BFWA 1KO8A 1FRQA 3UV7A 2H9AA 3PT9A 4PTYA 1P5RA 2YWFA 1LK7A 1SUIA 1SA0B 1HQKA 3PNVA 4IJ5A 5A6SB 3AOGA 2HCBA 4Q12A 3C4QA 1RHQA 4YROA 3RFXA 4YCLA 3VOSA 1SQ6A 5DNYB 4BNDB 4D0NA 3A37A 4KE6A 4MW6A 2W5UA 1CRWG 1EK5A 1QOQB 5MF6A 4F96A 4DDTA 2JZCA 2OK7A 3W77A 1U31A 5KQPA 1VXRA 4P92A 1BU5A 1IEWA 1RPNA 1GEEA 2HBZA 1Q6YA 2QQ5A 4MXDA 4O1MA 1REQA 4D0LB 2OGSA 3NTOA 1SC9A 3QFRA 1WU8A 2NZXA 5AK5A 5JECA 1MB2A 4WUTA 1PF7E 2BTQA 4KMOA 5BVHB 2XBUA 4J0IA 2VPQA 2ZRGA 1QHIA 3T7CA 3WRXC 2WT9A 3SF0A 1E3SA 5CEFA 5JQGA 3H2KA 3O8OB 5LZ4A 2GARA 5CX1A 1R6UA 4UEWA 3ZJ4A 4JJFA 1Z5ZA 3GIDA 3K96A 1TQ2A 3CLKA 4I55A 1N6IA 2G08A 3GK3A 2GDZA 4YREA 5C1PA 3UQYS 1WVGA 4DMGA 2WIJA 4HQ0A 3ZBPA 3RLIA 2RK4A 4EUFA 2FDXA 4G0VA 2WU4A 4JVNA 3K9BA 4P32A 1L1FA 4RENA 4AJ9A 3QPBA 3ZIAA 2ENWA 1GZ5A 4ILKA 4TMYA 3RE1A 2DULA 3DBVO 3OZTA 1U4NA 3UYKA 5BN4B 4PPNA 3BIOA 3WA7A 3JQAB 1EVLA 3NH9A 4Y6PA 2H16A 2ZPUA 4OHWA 4G9BA 5BY2A 4E3WA 1UC4B 2EW2A 4MI3A 4AXXA 3H1PA 1VL5A 4JUBA 1OFUX 3WBKA 4L1KA 1CEXA 1AGYA 4C14A 1UFVA 3HBLA 3VSAA 1ZJZA 4MQEB 2PS1A 3O2JA 4B81A 1A2KC 1GRCA 5C80A 1CVRA 1XVIA 2FPUA 3PIRA 4G25A 2QR5A 2Z2IA 1YONA 5AH0A 3OHMA 2B37A 3UKOA 4E5UA 4YONB 1I9GA 1M76A 3ZY6A 4AW9A 4CM7A 1Y1QA 3LCUA 3TQSA 4JC8A 5AXDA 1ZGBA 4OGWA 4NZPA 5DM60 2PVPA 3NTVA 3ERCA 3ZBTA 4KBFA 3BBPA 3V6MA 3LFUA 3BK2A 2D4HA 4MUJA 2NTJA 2GN1A 4GPTA 4M1QA 3PC6A 1UP7A 2AEJA 3AONB 2UZ1A 3BSSA 3GQBB 2JHPA 3KQWA 3FMOB 3QU5A 5EXEA 3T54A 5LP6B 2V1UA 2G6BA 2Q1TA 3T61A 4RCYA 3OHPA 2AE2A 3LXXA 4HNAB 5EWJB 4NV0A 3LCCA 4B33A 1A69A 5DI3A 3RK4A 2Q2QA 4TUYA 3HYTA 2RBGA 2ZR9A 2O1XA 3HDYA 2GJSA 3GEPA 3G85A 4RWZA 1YDFA 2HPVA 2ZRKA 1YHZA 3I6IA 4UQOA 5K8UA 3CVUA 3A3OA 4DCVA 1UMBA 1H2EA 2PH5A 2ZT8A 4WJLA 4R98A 5J58A 2FSGA 1V9CA 3BFKA 3DE7X 4R83A 4TYPA 1EVJA 5FPHA 3RG2A 1XCMA 3KKMA 3PYMA 4UHCA 1VMDA 3RYFA 4DXDA 3VAAA 4BVEA 3GFVA 4CR7A 3UMYA 3HMKA 4WEOA 3B6JA 3QQPA 3COZA 1XMSA 2Z58A 4JNCA 3BKXA 4O4LA 5ALGA 3EIOA 4F12A 4C22A 4J6FA 1YZLA 3A6ZA 3DQQA 3FI9A 1JT2A 1M6VB 1C8BA 1RWKA 3BMNA 1VPEA 4CIBA 4MPTA 1L8AA 4ZO4A 3S27A 3U3MA 2VK4A 2PGOA 3LA8A 4KE7A 3BB4A 4N8DA 2WKQA 4EUNA 4QOGA 1IRIA 1JQJC 4RH0A 2H1HA 3V8VA 4Z4CA 5BSGA 4BV9A 3ZGZA 1G8GA 3EQ2A 2ANBA 1RTTA 3G5LA 2IELA 1OILA 2MSLA 4MUNA 3EPKA 1TNDA 4P0PB 2QM3A 4DMMA 4UVHA 3RTGA 4RL4A 4GE3A 2CSXA 2Q1XA 1RPTA 4JQOA 1RXCA 1SM4A 4QGAA 1QQ7A 1Z0AA 3G2HA 1W0CA 4OA8A 4ESVA 2XCRB 1OBVA 2F64A 2HV8A 2QE7A 2RC6A 1YA6A 2INGX 4HRYA 1KP3A 4ZHSA 1KMCA 4RKEA 1ZOOA 1G6OA 1C9MA 1MT0A 2EL9A 1QIGA 1VTKA 2GK3A 2IF0A 3JAWB 3MB8A 4YS6A 2G9VA 4BO8A 2I6GA 3L8FA 5J2TB 1U28A 1MNAA 4RKFA 3W5DA 3RAGA 2OSVA 5T41A 4CLHA 5HIAA 3M81A 2IK8A 3MT8A 4IXDA 4JXKA 1XTUA 5DGHA 3PEWA 3HZZA 3RASA 4I1PA 4LXUA 5FV7A 3V80A 4BQNA 1XTJA 4P31A 2JFGA 3R5TA 2C59A 4E2FA 1IATA 2IH5A 2EFGA 3RKSA 3WDSA 4EO4A 1P61B 1AH2A 2P67A 4FYPA 3DCJA 2QENA 2BMVA 4GYYA 2I7XA 4IH4A 1KJQA 2OAEA 4MV9A 3OJFA 3P2KA 3R3UA 1FNMA 2NO4A 5SYMA 1BVRA 2IUUA 5KUTA 5A3VA 1IRXA 1CQPA 1XEWY 1XWFA 2GZ1A 3D8RA 3VJMA 4JI2B 4GR5A 4S1TA 2AR7A 1NQXA 3RBVA 1WXIA 4O4JB 3KELA 5H80A 2BGTA 3UXHA 4PQEA 1O77A 1B74A 4N0DA 4Q1BA 4XCVA 2CL6X 5TPZA 1AS0A 2V7PA 3KVOA 3ZE2B 2HLHA 1L5SA 4CGYA 1ITZA 4YAKA 5LXTB 1TJ4A 2E2WA 3HRIA 5DNWA 4RSRA 1RWQA 4OPMA 3LOUA 3RBXA 3WK6A 4OI0A 2C2OA 4HAVA 4MVJP 3TK1A 4KH1A 3DVLA 5CFZA 3TJMA 2DWCA 2FK8A 3K1JA 3TLCA 1XC7A 3AVWA 1N5KA 1WM1A 2CFTA 1XRSB 5HZGA 5C4GB 5CB8A 1UM9B 1RQXA 2ZWOA 1FU4A 4N54A 5KQRA 5L7WA 4NZ9A 1JU3A 1NF9A 1G38A 3GLHE 3LYUA 3MT0A 2WJZB 4OYHA 1EP3B 5TPZD 1P74A 4IBOA 3J81k 4QE3A 4A8JA 1EX9A 1UFKA 4Y9DA 1L5FA 1HDOA 1NVGA 2R44A 3D4NA 4MKFA 5KNDH 3DXZA 1Z16A 4BNXA 1EZZA 1J21A 1HYHA 2F1IA 1JKMA 2BBTA 1KI9A 2Q6IA 5E4YA 3A1EA 3LVBA 5D7BA 1SUDA 3MLAA 4PG6A 4P83A 4D9BA 3AVPA 2BSQA 1XTKA 1UMCA 2MT9A 4EIWA 4BO2A 1GDTA 3LCJA 1EUQA 3T3EA 1URPA 2GTIA 4Z6KA 2I4MA 4JGBA 3BF8A 2QSZA 5AJTA 4IIBA 1YFKA 1EGVB 3AHHA 2FQYA 3PX2A 1DGQA 1OXKB 4N5LA 4KQHA 1KSGA 1TZJA 5K3FA 3DF9A 3OZRA 4PZ0A 1RPJA 2AOTB 3DUWA 3PQ3A 3K6SA 2NUAB 1Z2OX 5B64A 5ED4A 1IVSA 2QEQA 2VEDA 3KJZA 2ISQA 3GJTA 5CW1A 3A9SA 3ROFA 3UMGA 2ZRQA 4JJEA 4MKZA 4HH0A 2A35A 3TYXA 4A8JC 4EY6A 4IOJA 4GQIA 2CUZA 4BMSA 3A8TA 4PC7A 3NEYA 4X95A 1VLLA 1KVSA 1M1UA 2VHJA 3WWPA 3N6XA 1CW2B 5KTPA 2OCXA 4XWTA 3RRMA 4CV2A 5JADA 1KR5A 4I4CA 4R2IA 1YCHA 1C7RA 1MX1A 1L2TA 1A3CA 1DFGA 2Y6UA 3D0RA 1MCZA 4TVBA 4CMIA 4LBVA 6ABPA 3RYCB 1L7OA 4J1TA 2HWYA 2NO7A 5B3AA 3ZVNA 4MCAA 2QORA 2EC5A 4C4SA 2VYCA 4A2QA 4FUTA 4LF8B 4QTXA 5E9JA 2QRQA 2PWAA 2O2JA 4QAJA 1RRPA 2NO9A 3SLKA 5SZIA 1P1BA 4GBED 5EC8A 2F4NA 1XEXB 1FRNA 1JG6A 2V7XA 2EG5A 1M6WA 4H7PA 4N0QA 4WFKA 3M6AA 1GZ7A 2GCOB 2X23A 2OG1A 4BPBA 1DDOA 3AUJB 3TL6A 4BYMA 2AOUA 1Y5LA 3H65A 1M83A 2Q0SA 4B3TB 4I81A 3H7AA 4ENWA 1RNLA 4FKZA 3U56A 3LKZA 5HUJA 4I4IA 4CKWB 1PGOA 4J3NA 3KFLA 4F6CA 4TXJA 5EIOA 4P4GA 4QXRA 4IUCS 4FCVA 3B82A 4MA0A 4GGOA 4KBYA 5IJ9B 1KDOA 3KJIA 5GV8A 3HKCA 1J20A 3F3KA 2O6HA 4YR9A 3AKEA 3I9OA 3EEYA 4P4TA 3FNRA 5IUKC 3PT5A 3P2MA 1PK8A 4HDNB 4TRMA 3ZWNA 1LDGA 1G7RA 1WXEA 1IL0A 3FG9A 3LA6A 3OKCA 4TL7A 4UUBA 5HQJA 2XGMA 1RI5A 3U26A 2IP1A 4ID9A 4FJ1A 1XTRA 4DIMA 4NG5A 1XZNA 4HYTA 2C2GA 4YAEA 2AK2A 2XKBA 2ZTLA 2R86A 2VH1A 2QTTA 3PPYA 5AJHA 3WZMA 2AGVA 4HUQA 2ZS9A 2GI4A 5DLPA 4FYJA 4ZI3A 4ZZ1A 4S24A 3ASUA 2YJ4A 4DRXA 1TAQA 3G1TA 3L7YA 5HF9A 5HFAA 4U2FA 2ZUBA 1YK0A 2WUEA 5DM2A 3VZSA 5JFGA 2JI6A 3KKPA 3IR5A 4ZVMA 1NJ6A 3EZ9A 1IN6A 1QP0A 4ZQHA 5EWLB 3E5RA 2RBKA 1FQOA 4H7JA 1LPOA 2QYTA 4YRNA 3EYWA 2JD1A 4MQBA 2WICA 2NUPA 3A9CA 3EXHC 2PZAA 4JP8A 4BKRA 5EJFA 3VYSB 1TT7A 2JJ1A 4E6EA 4UD2A 3WGVA 2PO7A 3LLVA 1RLIA 2XUFA 4G2TA 1SG0A 2MOKA 5DLDA 1W8IA 1QK3A 2IKQA 5FIUA 4FZJA 2PFKA 3IV6A 4QYTA 1USUA 1V16A 1E79D 2ZVQX 3GAAA 4E32A 2B4RO 2XNJA 1DXYA 1IK4A 2QTGA 5KQMA 5B30A 4KKXB 3OUZA 3AYXB 4Q4CA 621PA 1RBYA 4P53A 1MB3A 1AU9A 3N2NA 1PN3A 4BNKA 1XZLA 2AW5A 4JOBA 3IEIA 2IZOA 4CG3A 4PC6A 5JD3A 2DBVO 5B7QA 5CLLA 3ZXYA 3OIUA 4O02B 1J9GA 3U9LA 1TEZA 1PR4A 3WV5A 5IZ4A 2FP4A 4XDYA 3TM4A 4B6JA 3A1FA 2Z1NA 4ALMA 2O2SA 3KAKA 5L3QA 1N33B 1AGPA 1NKVA 3RODA 4IIVA 2DLCX 1Q7GA 3FDJA 2CHEA 3LBNA 3EQ6A 2IXTA 1UDRA 2ODPA 1GZ6A 2Q3HA 1HDEA 3BIWA 4MTLA 3IBYA 4ND5A 3U49A 4H31A 1CUVA 1PRYA 2NZYA 2PV0A 3KM0A 2CXHA 3LC1O 4Q4AA 2ZUSA 3T3IA 3CKKA 2I6FA 2MJLA 2JI4A 1GAEO 1FPQA 3DG9A 3G13A 1SHLA 1P4RA 2D2XA 4Y98A 1VG0B 4QQNA 1FTSA 2BLNA 1HTWA 3G0OA 4C88A 3QFSA 3N6VA 1FUUA 4LQCA 4KYTA 1QG6A 4L0CA 1PJ4A 3HUTA 4PYLA 3SXJA 2YY5A 4RAOA 2DERA 4F9FA 3WYGA 1TEXA 1YQWA 4R2KA 4GUAA 5T4EA 1G19A 3DO8A 4EWLA 1KZ7B 1N0WA 1NBIA 2R48A 2AF4C 4DNOA 4RDHA 1AM4D 3ZDEA 4JFAA 1GAXA 3IHKA 3RJMA 2FPOA 1LSSA 5AUPB 5FYQA 5HIJA 1Q3TA 5GWXA 3SR3A 3KZXA 1NW5A 3GLQA 5EMHA 3LQFA 3GEGA 3LOQA 3NUQA 3QEBZ 4OCZA 2J9YB 1VE6A 2QVGA 1E6MA 1HI9A 3BH6A 1GCOA 1PNOA 3JASB 2OXCA 1NQOA 1L4BA 1IQRA 4B75A 2O54A 2JHGA 4GU5A 5T4BA 2HRZA 4D4HA 2C92A 3CLTD 4TL8A 3IA2A 1Z5UA 2YV2A 4DWVA 4KKVA 1GTRA 1P80A 1G55A 3NJRA 1U98A 2IVFA 3KR1A 1JR4A 1UM9A 1N9KA 1M34B 1NQVA 1OKKA 1VDZA 2KLBA 2XTAA 2ZJ0A 4JUCA 4XSGA 1WEHA 1ILWA 4E5NA 1JT9A 3X2EA 2V03A 3RIXA 4LDNA 3W1WA 4OMFG 3TE7A 1LBEA 5A9SB 2NQ8A 2OENG 3C45A 4KAAA 1W73A 3TVYA 1I7DA 3MJTA 4HLUC 2H11A 5CNMA 1E7SA 1E5XA 2IBSA 3WG9A 4PU0A 1SXPA 4I5FA 2BKVA 3R5JA 4M1OA 4NU0A 5HIKA 4PF1A 3G9TA 1MUUA 4WPGA 1P6UA 5BR4A 1FFBA 1MQ9A 3LL4A 4U7JA 1PBTA 1ZZEA 4CMEA 3OM8A 2D1SA 2QJTA 5E3JA 5JR3A 2R7LA 3ZTTA 1HE2A 1L7QA 3CHYA 2A5DA 3P45A 3U2QA 4D9NA 2IZ1A 7ADHA 4ND7A 4BVAA 2HHHB 2QMOA 4E31A 4RMGA 3HN7A 4DANA 1ZJ6A 3UK6A 4TV9F 4FUQA 2XB9A 4QYWA 5CLHA 4LJYA 3ZS8A 4HBGA 5EY5B 2BYTA 4F92B 2ZZKA 2EF0A 4LE2A 4RORA 1KQNA 1S96A 1Q0LA 4KGZA 2A88A 1T5BA 1TPYA 3RC7A 2EZUA 4A5SA 4K0KB 1EQUA 2BIFA 2PGDA 1UDBA 3DB1A 3DOJA 2EZ9A 3JD0A 3OC6A 3Q9UA 4IKPA 2DXIA 3KJNA 4TSKA 2QD1A 3WIBA 4UNPA 3AI7A 3QH4A 2CXQA 3CPJB 1GGVA 2G36A 3YASA 3VHLB 3D8TA 4B4DA 2A0XA 1HOXA 4HATA 4DRXB 1Y7HA 1C2TA 2BEKA 3K7EA 4JT4A 3TLAA 4N1AA 3ECCA 1VIAA 2Q3JA 1DC4A 1GT91 4GXQA 2WNHA 2P62A 2VTKA 1DIOB 2WHPA 3C70A 4TM8A 3IJ5A 3Q7RA 3IUPA 5D8DA 2BDEA 5E2IA 2WU3A 2B4KA 2VRNA 2VK2A 3V1NA 2PA0A 1HF3A 1X15A 1XU4A 1CTQA 2YRXA 4K87A 3PA6A 1H2YA 1Z0UA 4O33A 4C7XA 1O08A 1YAHA 2AL7A 3B1XA 1HEIA 4JLUA 5TPWA 3JV7A 3ZBUA 1EDDA 3WK7A 3ZW9A 2ZIXB 1Z22A 3E81A 1DWPA 2A78A 1NJGA 3PNYA 4DB4A 1VP3A 1SPBS 2N42A 2MSDB 3H1TA 3FSJX 3TDMA 1PE0A 4OYRA 3Q3HA 4LXTA 2HRBA 4LY3A 1JXQA 1UAGA 2X4GA 4JCCA 4DJDC 2B98A 3R74A 1GGFA 1NGSA 1E5LA 1I3CA 3TG8A 1EB8A 2IYNA 1V3TA 4C0WA 9GPBA 1Q83A 2NQ2C 4D9GA 1KF0A 3OCXA 2Z4TA 4BB6A 3GUUA 3M9WA 4B47A 4NKRA 4OKIA 1VE5A 2FWMX 5LN1A 1C7FA 5IU6A 1NYTA 3PXUA 1I01A 3W5SA 3ZDXB 1I6MA 4EO7A 1QIJA 3GEEA 1XP5A 1DLIA 2A1UB 2WMYA 2Z0MA 3UV6A 2ZRIA 2EFHB 3EB9A 1P91A 1CLEA 5FBZA 4A26A 3LPAA 4U0KA 1AMNA 2PUEA 2SICE 3QEMA 1NXPA 1CB0A 4MLPA 1E64A 5A4JA 1GYRA 4FQ8A 4RDCA 1M6EX 1FYFA 1ZK4A 2R5NA 3ACCA 5FL7A 2WQ7A 1XBTA 3KR0A 3OCZA 3L4JA 3EIUA 4P1ZA 5EZ5A 2HGZA 1PEDA 1QJCA 2JRCA 3CLTC 3WGMA 3UH1A 3F6SA 1IDOA 3HJNA 1L3CA 4WX2B 5DYTA 1Z73A 1NBMD 1PO7A 3GA7A 4B84A 5AK6A 2PXAA 4EZEA 4Q01A 3DV9A 4CF4A 3DOUA 4ZK6A 3M6MD 2RHJA 2EDCA 2QYHA 2B4YA 3QYAA 1RRCA 3GD7A 2WJ6A 2G4VA 3L02A 1F8FA 1U2DC 1SOWA 2CDAA 4ATNA 3O8NA 4XD7D 1YB2A 2YN2A 3BD8A 3KTOA 4RA9A 1QIEA 1T4CB 3R24A 5FPTA 1IY9A 3UMBA 1SIBE 2GNPA 3GLSA 4YA6A 3UB3A 4H1HA 1JR3D 1ACLA 4RA6B 2YIMA 3RIYA 5EP3A 4D43A 1IUNA 1EHCA 2GJ8A 2GM4A 5J9FA 3VPAA 1B73A 2YCLA 5B55A 2H0AA 3NDIA 1JA9A 2EJWA 5JSZA 3SZLA 3FFTA 2VLBA 1PDOA 1TZKA 2AV6A 3LH5A 2H4YA 4NDZA 4ETWA 4HNTA 4ZTZB 2HXYA 5D3QA 3ITNA 3OD5A 4GDMA 4H7FA 3FOAA 2F6RA 1C4KA 2J46A 1QDEA 2QN2A 1SXGA 3OT4A 1WXFA 2OXFA 3KEOA 4I55F 1QIFA 4QICA 1NNUA 4XD7A 5SY6A 1T5TA 3L6CA 3OFVA 1Z45A 5ENDA 5CU7A 3QX9A 4WQMA 1FTGA 3WMFA 3UUWA 5IHPA 1CY8A 2HRCA 3NLLA 5BQ5A 3RS4A 4YJ2A 4UC0A 2JHFA 3LQ2A 5IEBA 2YZMA 4IDFA 1H0KA 2BM8A 5DWVA 5U4QA 3OEHD 6YASA 3IQHX 3TW8B 4TRNA 3JWEA 3NNNA 4UPVA 2ZXEA 1XMOB 1NDUA 4IJUA 4ALLA 5FLKA 2PKXA 5C8YF 3W06A 3DHNA 4G1VA 2IF2A 4OQYA 2GLXA 4EECA 3ZLTA 1FNDA 5TS2A 1W5TA 4I50A 1BXRB 2IODA 4DJFC 3MELA 3WRVA 4F1JA 3A6LA 3ENVA 2G0AA 3IP6A 4BNDA 1FFSA 2RGNA 3FCXA 1MKYA 1KRWA 2QRPA 2VS1A 3QVKA 3ZWOA 4WJZA 3SFVA 4GMKA 3NV9A 1A2BA 1WMFA 3U6BA 4X1YB 5HEKA 3ZG6A 4DR3B 1PJ2A 3GLGE 1W0KD 1JHDA 2R47A 1W4BA 2V9CA 3C5VA 5DLQC 1I10A 1NYLA 1IWOA 2Q49A 2P5TB 5ALMA 3JW8A 2PQ6A 4F97A 4HDKA 2DBZA 3G2LA 4OQFA 1VE9A 2F00A 1PGQA 1P45A 4EY4A 1DARA 1VE3A 2F1KA 3CLSC 3HWSA 1BDBA 3KYCB 5FUBA 5HJEA 1Z63A 4FDLA 2BM9A 2HRRA 4WY5A 1FUIA 1RHRA 2A0FA 1GQYA 1KQGA 1X9GA 1X38A 4DMKA 2WVJA 1UL1X 5AJUA 3LLSA 2O7NA 4IDBA 3CISA 2GBIA 2Z5LA 2ZUVA 3OMXA 4WZBA 2O5RA 3AUSA 4JBNA 4XXHA 5FBWB 4ER0A 1ZUNB 1O6BA 3ZIUA 3MQ2A 2R2GA 3P4XA 4BFVA 1XPRA 4PQGA 3M3PA 3TRHA 1G21B 2PVSA 3VUEA 3LY5A 1A9SA 3S2YA 1U0RA 1NPYA 3O0DA 4JC4A 2AS0A 3JWIA 1XIVA 1SB9A 2BDUA 4JR2A 1FBNA 2VJYA 2WE8A 4KO2S 4GEKA 4RFSB 2O8FB 2RHCA 4GP7A 4UASA 4Q15A 3RRFA 1N6KA 4BGDA 1KA9H 1XLTA 1WQ1R 3ADKA 3F5QA 4M60A 4OGFA 4CEJA 2P6MA 1HURA 1OFTA 3OPXA 4UHEA 3JXEA 5BUZA 3AVXA 4WA7A 1XHLA 2C07A 3I6BA 3OJCA 1YK1A 5JI3E 1NBEA 1VHJA 3PD7A 2CZGA 1NMYA 2ZUEA 3A1NA 3NOXA 4EA6A 4M0UA 2PFGA 5EVJA 1EI9A 1AJEA 3M9LA 3E9ZA 1JG4A 3L41A 4RA6A 1BXGB 4WDQA 4KQJA 4Y6QA 1Z68A 3BZBA 4QRIA 5JCOC 4ON9A 3IPYA 5FADA 5IKOA 3QXCA 1BEZA 1EU1A 2P8SA 4X91A 1O4VA 5EKXA 3AEUB 3DL0A 1PNQA 5GP1A 3Q88A 1LF0A 2D13A 2C42A 5HOEA 2IDKA 4E1AA 5T6MA 4FFSA 1P2DA 3RC3A 4UTOA 4OOEA 1YJ5A 3LUHA 2NUTA 4ZT3A 5IBRA 2DF8A 2ZJZA 3DJYA 3ESYA 3AR6A 4G5RA 3HUUA 1U0JA 3KQYA 5G3ZA 3UMFA 4M6WB 2GN2A 3AGPA 3S1AA 2Y0BA 2X8BA 1DQNA 2CXRA 4MQLA 1QWSA 3EZ6A 2C9CA 1ZC3A 4FZ3A 2XV1A 3W2FA 4HYQA 3RYIA 4RPLA 3L2OB 1XTBA 2C82A 4LXYA 3CZAA 1IOLA 2QW0X 4OL0A 1GN8A 2FSPA 2HLPA 4NYIQ 3AV3A 1V4VA 1OAOC 2F9MA 2OZKA 4F2PA 3T7IA 1FTYA 1OLSB 1TDJA 4N0PA 1MW9X 5FNVB 1JEYB 1QQBA 2DWPA 3AXTA 5JPCA 3STWA 1A2QA 3L1KA 5CFQA 1Z26A 1Z5GA 5DNCA 2YWHA 3B89A 2C7OA 4URWR 3GRCA 3DE5X 4LJ7A 4Q66C 4FMDB 3ZS9A 4B3GA 2B4AA 2SKDA 2ZBDA 5HVNA 1QTIA 3BWBA 1R6TA 1GU7A 4FONA 1V6SA 3I01M 3TZEA 4AWXA 2XMZA 2I6QA 4YPOA 2GPNA 2GCEA 1CHNA 1QR2A 3C16C 4F8EA 3AYZB 3CTPA 1WR8A 5IJ0A 3G9UA 4ESHA 1H69A 1SD1A 1WXQA 4DCGA 2Q45A 3IMFA 2O3UA 2HCTA 4OMCA 2ZT5A 2WYUA 2NNLD 1KC1A 5E38A 2WKRA 3EXEA 2FVXA 2O50A 1Z29A 1KJZA 4L22A 1TLLA 2PEZA 5AKYA 5LZ5A 5REQB 3I1FA 4S12A 2DPXA 1C1XB 5A5DA 4B4WA 3WSWA 1FFXB 4U1RA 1P39A 1TI7A 3L6OO 4YJHB 5KWVA 1OLXA 3VH2A 2HEGA 2H07A 3SD7A 3MAAC 2BFAA 1MGOA 1NNEA 2REOA 3E8MA 3OT1B 4W82A 5GQSA 2F4VB 2Z1DA 2AFIE 3JRWA 5F9FA 2ZYSA 4I9UA 1XMIA 5WRFA 3AC0A 4D4IA 8OHMA 4CNQA 2A9VA 4R31A 1PGJA 4L6CA 2CN1A 3CLUC 4DYHA 2OKCA 4Q1AA 5C5CA 1NV8A 2BMEA 2A9QA 1YASA 1A1SA 1BE8A 2NU9A 2WMOB 4EVQA 5JOQA 3PITA 2B1JA 2R00A 2IOHA 2NADA 1FDTA 2C1EA 2K4MA 5TR9A 2XUJA 1J8DA 2B9VA 1JTEA 3F3SA 1TZMA 2YNMC 4BMCA 3Q6NA 4AWBA 5A4AA 4GI3A 5KSZA 1LQUA 1RI1A 4MIYA 4RCVA 4NU8X 2P2CA 2QF7A 3DAFA 5JCPA 5AT1A 4A4DA 2I78A 1XLVA 3IAS1 4O2AA 5IKPA 1ZL2A 2HYDA 2JJQA 3EF1A 4R2XA 2RARA 3BJMA 3CCBA 2ODEA 4UMVA 1ZM7A 1FYXA 1FFAA 3L0DA 3LMKA 2IYRA 1UBGA 1QHFA 1DZ3A 2I6TA 2VDWA 4DCUA 4OVKA 4NENB 3UANA 2ID4A 1JJAA 1QYXA 2AI2A 3B9RA 4FE7A 4G0XA 4CV3A 5ER9A 2AQKA 3HN2A 1E5VA 1LY1A 2IE0A 1HE5A 3ZY3A 3KLPX 1WUHS 3A14A 3LY7A 1RRKA 4A2PA 16PKA 4ITVA 2AJDA 2I9KA 2RAPA 2XE4A 3DDWA 1TAGA 3ONWA 1M2VA 3TKLA 6GPBA 3AW9A 3M5CA 4G1MB 4EBFA 4F2HA 2Y66A 5AI0A 3VR4A 1PT6A 2HBQA 3QJGA 5C5DA 4BS9A 2H1SA 4F91B 4MZDA 3LSYA 2CFCA 4DIEA 3CNQS 2ESRA 1N1DA 3HR4A 2GHQA 3CV3A 1MLDA 1VRVA 5FBRB 5MFZA 2XR1A 1OLOA 2QI9C 2EWVA 1YNOA 2EXXA 4Q9AA 3O9VA 1K27A 1ZCAA 1NVVR 3FSEA 2I0FA 4MICA 2I4NA 3TRIA 5KJFA 1W85B 5CTJA 5CG1A 2DX7A 2PTGA 3ZV4A 2GERA 4ER7A 2IHZA 1YO6A 2VKQA 2LW7A 2YHIB 3FETA 3FOCA 3MSCA 4PQRA 2JCSA 3I09A 1A9XA 3B8HA 4JT8A 2W7TA 1MN6A 3DL4A 5TS3A 4ENTA 5BVGA 3V2IA 2VFAA 3G0IA 4Q6WA 1QQ5A 1CETA 2XZOA 4RQTA 5FPYA 2QMUA 3BHJA 3QTTA 3U62A 2ZR7A 2WLTA 4N7MA 3VJKA 5FO1A 5I9SA 2X6TA 1GPAA 1J2YA 5JPDA 1SXIA 4OP3A 3IDQA 4JWTA 4OQQA 2VJAA 1G2OA 1A7KA 4CUZA 4QTTB 1CJCA 1GFZA 2WT4A 1O89A 3IBGA 2WB4A 4GF5A 2ZSUA 3QHQA 1I7LA 3Q8KA 3LBYA 4EM6A 1SIWA 4BLUA 5F77A 5HK9A 3QUTA 3RTEA 4C7VA 3BD7A 3DDNA 1YZ3A 1WUYA 4TVOA 4ANFA 6LDHA 3MWJA 1QQTA 3OETA 4RJIA 2GYWA 1LLFA 2HV9A 4L95C 3RSOA 1M0TA 1DE0A 4P7GA 2IUEA 3DC7A 1AHNA 3G0HA 2HMSA 4Q16A 2I4OA 1KOJA 4BB0A 3HFJA 2YVQA 3AG6A 4P3YA 4DJTA 3EA5A 3GJ3A 5IVIA 3BWMA 3W4JA 1GG2A 2GD1O 3ZDZB 3KJXA 3K92A 4BFTA 4BO3A 1QFMA 4HNRA 5IABA 1G20A 4EFDA 4F6RA 2CD9A 1LU9A 2MMCA 1WCV1 4LF6B 3A9UA 2JEOA 5TMBA 4F45A 4ZI7B 1TX4B 4R1SA 1GADO 1QH8A 2WAOA 1S5PA 2XJ9A 4Z2AA 2VXBA 4CHTA 4DIKA 2A9JA 1U94A 1EFKA 2HI0A 2IQ5A 2XE6A 2XMPA 1BX0A 1YR9A 1KAMA 2BEJA 1D1TA 1SU7A 2P2ZA 2P8JA 2XHZA 5KYVA 2EFEB 4IIUA 3TOZA 3TOVA 2V9PA 5SYNA 3VNAA 3U31A 1ZU5A 1VHTA 2VHWA 3VSEA 2QM0A 1G6HA 2Q5IA 5JSFA 5ADWA 1M2JA 3WZLA 5JROA 5JHHB 2VP2A 3F9RA 4QLBA 1I7QB 1ZYUA 4JX9A 1C8KA 3NBFA 3OEWA 4KO1S 1U5BB 4OD0A 2BY4A 4RMNA 3WNZA 2WP0A 1S9DA 3HCAA 5KOHB 5EIBC 1O94D 1QB8A 3GCDA 2LDXA 3WNCA 5B1EA 1XDWA 1Q1EA 1UFOA 2YC4C 2ZWPA 3FVRA 3D5QA 4XCQA 2VQDA 3QGMA 1VGVA 4N7RA 4DW8A 3FXAA 3NIFB 1EESA 2CE7A 5AXAA 4A16A 1BA2A 1LDEA 4PE5B 4XZ3A 2I34A 3IO5A 1X86B 4BBPA 1SRRA 4N49A 3T7TA 3GRUA 2PIAA 2REXB 2VDUE 4O4HB 2IZ7A 3H2GA 2W70A 4M89A 4PAOA 4WOJA 1KOGA 2ZSEA 2IHYA 4P3XA 4GRAA 2FEOA 1V8BA 3HDGA 4U63A 1TCVA 3HBNA 3R7NA 3SHTA 5CGQB 3SXUA 5CCEA 1E1NA 1EGAA 5I7RA 4TMZA 1E94E 1JEQA 4IKOA 3S44A 2WTUA 4GQBA 3OZGA 2V7UA 3ZNNA 4Q3LA 5LB4A 2P6UA 3ENZA 4IFEA 5KTTA 1MB9A 2X9GA 3KVNA 2X58A 3PNMA 4G0NA 1R2QA 4LJ8A 4ND8A 3T4PA 2OCAA 2OVFA 1RC0A 1YH3A 3AUTA 3H3JA 4M7WA 5JVDB 4CKEB 5MN6A 2VH2A 3L77A 4CZ2A 4F9TA 3ZXSA 2C3YA 5EPUA 3RAFC 1WZEA 2YJ3A 1C5KA 3Q7QA 3BN3A 2BGLA 5F52A 5BWBA 2NMVA 5JJIA 3WFJA 1UFRA 4X62B 4R1OA 3DEYX 1SBYA 5I3CA 4BNJA 3CZPA 1WMBA 1L3IA 2KHZA 4IDEA 1O0SA 3EWAA 3KOOA 1C7EA 1P2VA 3JARA 4MWOA 4X97A 4Y6RA 1GTMA 4B1FA 4BQRA 1Z82A 3AUUA 2P2DA 3IAS6 2XT0A 3HKCB 5JMTA 3B20A 4TKUB 2OLEA 3W7AA 1B8OA 2BJVA 3X43A 1BRTA 4FILA 4Z4IA 3WLIA 4KDCA 2LDBA 1VECA 4L4XA 2WTMA 3O4JA 2ZRFA 4DDUA 1NC1A 3SQMA 2BEUA 2VJMB 4RE6A 1VGRA 3OTIA 3AF3A 4KRXA 1WSWA 5IUJC 2HGSA 4CLOB 2AOUB 1XELA 1Z5VA 5JH7B 2VP4A 2V6GA 2Y27A 4FK8A 3TVTA 4D57A 4MP3A 3QXSA 1W96A 3R0JA 2YRWA 3GN1A 1U8EA 1HZZA 5DI3B 1UT8A 5DZSA 1SU4A 4RF5A 1YJCA 4GBGA 5HM6A 1VBNA 3ZWPA 3L4KA 4MSUA 1VJTA 1BDHA 1CY0A 2YXNA 1TA9A 4NCHA 5AW5A 4CF6A 3JVIA 4JBLA 4KG7A 1KVTA 4C1NA 1C4WA 1B2RA 4GOOD 4JXZA 1FX0A 1U4SA 4YH1A 1VPTA 2UYGA 2RHMA 3TZBA 2CMDA 1P2UA 4N3GA 4NPCA 1R8YA 2V6JA 4AJKA 4L2IB 3H1AA 4LC1A 1YF3A 4IIYA 1SVOA 1QANA 1EWTA 1RJFA 4J1QA 2AOTA 4RM3A 4E09A 2FFBA 5IJWA 2JS7A 3PQ4A 1MVOA 1NHGA 2GKGA 4GWKA 3FJOA 5JSKA 5E1BA 5A3SA 1KJYA 1ZESA 4GT1A 1SCBA 4EJSC 1V47A 1ZMXA 4UEKA 4WCFC 5F76A 2JRLA 4ZHQF 1RZ3A 5FI1B 1PNRA 1F4PA 4WE3A 3O75A 1D2AA 3UK1A 3ET4A 1LPSA 4BUZA 3UJBA 1E61A 1JS1X 4JLSA 1TZ2A 3K5IA 1SCUB 1O94C 1NZJA 2XYRA 4U39A 2NU7A 3AHCA 1N1MA 2X3YA 4ETMA 1QGUB 5BN3B 4MTCA 4X85A 3RR2A 3UN1A 2QL9A 4DUZB 3RANA 1XLWA 4IGFA 1FJGB 1ZN2A 1SBNE 4K1LA 1XTVA 2W2VA 4R54A 4BATA 3K8OE 5KOIA 5KJCA 4RYDA 2BHSA 3HADA 2GT1A 3UIEA 4A15A 1FJXA 2VAMA 4LMRA 1T3TA 1ID1A 2Q1WA 3AFHA 2YVAA 5CX1B 1X7YB 4RL6A 3PGMA 2E1PA 3MLBA 4H6PA 3RUHA 3SOZA 4BO6A 2IBMA 1Q7TA 4DXAA 2AR0A 1E1QD 2PRIA 3JQ8A 3T8YA 4LZLA 4LX0A 5LKAA 2C1XA 3H84A 4IIGA 4K6OA 4C03A 2X2EA 4DLTA 3IPCA 1NI5A 2X2FA 1PJ3A 2QYSA 3MMSA 1ZMBA 2DUUA 1R0BA 3FCSB 3JQ7B 4WKPA 4X6LA 2Z9DA 1FDSA 4M8NE 3T3DA 3V7UA 3RIMA 3S68A 5AVWA 1ZVVA 4E12A 4G4GA 4XJXA 1DCFA 1XAIA 3F9IA 1UK6A 3S5UA 5CTAA 1ZG3A 3TB6A 3B6EA 3B8EA 3K32A 3RJTA 3AFIA 4O4JA 1QP8A 4GIBA 4BBAA 1NLFA 5G4KB 3HKEA 2WV9A 3DFUA 3KQTA 4WZAE 1Z4IA 2IS6A 3VSCA 1EQAA 1C1XA 3GHHA 3LI2A 4OH7A 2WILA 2RGYA 4Y9UA 2H06A 4JKOA 3ZVRA 1DEAA 1KJJA 1ODTC 3AJRA 2HN9A 3R0XA 2KYRA 2ZK7A 3C6MA 3QX8A 4KWCA 4HY3A 4BTEA 1Y7TA 2JGDB 2COKA 5H3LA 3R7BA 3W90A 4FPXA 3OWXA 3T0FA 2BGUA 1ATZA 4GD3Q 4NENA 2ONZA 2JLXA 1JPUA 1Y7IA 4G0QA 5DXJA 2KB0A 3ROZA 3HP4A 4B3JA 4RZ3A 4BV8A 3U4MA 4IGIA 2Z9BA 3CE6A 3MUFA 1CUSA 2CJWB 1Q0UA 1NW3A 1GLNA 2R6R1 3HDVA 3F4KA 4GYKA 4DQXA 1Z37A 1OZFA 4KMMA 2Z43A 2ZQYA 3JAWA 4BNZA 4KN5A 3E53A 4S1PA 3SEZA 4C07A 1VL1A 2EDAA 3OM1A 4PYJA 2C96A 5ALPA 2NZ8A 1COWA 3HNRA 1OV6A 3HU5A 4JC5A 5K2MA 5K3CA 3RYIB 5CEEA 2IEZA 4BKPA 3JTMA 3PNQA 4Q05A 4DBZA 3LT4A 2QM8A 3LHIA 1DQPA 3CW9A 3IAAA 2GF0A 5IVKA 4V24A 3S1AB 1EX7A 1W88A 1OI2A 2BP7A 3B7WA 3ICOA 3ABSB 1F60A 4YCJA 3SJAA 1WCYA 1CULC 1NYQA 5KSPA 3C5HA 1QE5A 3OT1A 1T15A 2QAJA 3BMQB 3DT8A 5CITA 1UWKA 4JYZA 3Q1LA 5CLFA 5LDDC 3GT3A 2B5WA 2HXSA 1PP4A 4TYQA 1I2AA 2GAAA 3STUA 2WHEA 4PYRA 1THTA 3ASYA 1RHUA 4HBZA 3I2FA 5KINB 3LBIA 2H6EA 1IZ7A 4V0OA 1QLHA 1Q21A 5REQA 1BFDA 4DA4A 3RV4A 1PJTA 2AJBA 3UY4A 4B0OA 3D81A 5DM1A 1YVPA 4E5KA 1CF9A 2B99A 4U3JB 2VPZA 3PXDA 3KJHA 4V2UA 4KAJA 2O3SA 1UXGA 2W2KA 2G82A 1E7QA 1OXMA 2KLHA 2H00A 2Z4RA 2ATIA 4G67A 5KZMB 3H6HA 5JSUA 4Q1FA 5LQUA 4OJKA 1RYBA 2BR3A 2PIDA 4ZU6X 4YUAA 1HE3A 4RPJA 4J4HA 2C9OA 2VTBA 1IOVA 3JYNA 2V3VA 1ORRA 2IW3A 1AZSC 3G23A 3I9MA 4I5IA 3AR3A 3L79A 3QK7A 3A6JA 4C2AA 4PHTA 1CY7A 2Y1XA 5DCLA 4WBSA 4IGEA 2BHLA 4KH0A 1OB5A 4HB4A 3IUYA 3U7IA 1E62A 1Y6RA 2FYTA 5KPJA 1EXVA 3TUIC 4QOJA 5CB6A 1ZONA 2GKSA 1OC4A 2GK6A 2EL7A 1OX6A 3A6EA 3FSGD 4OH1A 4RTJA 1ISMA 3P94A 1UOPA 4Q93A 4E51A 4FEAA 3HA7A 5AYVA 4BB9A 1K2VN 3OHSX 4YQZA 4ODIA 3HYRA 4L4YA 2V7TA 4H6WA 4BNFA 1WVIA 4QDXA 2DPYA 1EAYA 1ZQ9A 1Q19A 1ZGGA 2GHTA 3KYDA 1NI4A 4RK7A 2RB5A 1JHQA 1BQ3A 2Q5FA 3MGCA 1OWMA 3UJ6A 3EGXA 3GQVA 5EE0A 1W4ZA 3OVMA 2ZVDA 3DKRA 1VKHA 3QTLA 3OCCA 1ZNYA 2OCYC 4J0FA 3WV4A 4FNAA 4BQIA 1Z17A 3JCZA 4C6TA 2I67A 1NXOA 5ALHA 5SICE 1P33A 5L7TA 2Y1LA 2QSJA 3DV0B 4HAZA 5K03A 1H9CA 4BMVA 4P38A 3N8IA 4YV2A 1KR2A 4TV9B 4W9NC 1AO3A 1E7WA 1W5EA 4NV1A 1V9SA 5ISMA 2DHQA 4MVJH 1HDIA 1P1IA 1TYCA 3WWOA 2B83A 1IWBB 1V95A 1NURA 2H5JA 2PYIA 3TUJC 1QH0A 1FFHA 4CE6A 5EJIA 1Y8RB 1IM8A 1ODFA 4QYMA 2IYZA 4E4YA 2E18A 5FOQA 1YB6A 3EPRA 4QUIA 1SELA 4JUIA 2JCYA 3LX5A 4JEIA 1XU9A 1K3FA 2HD4A 1LLUA 3A4MA 3DZKA 4M53A 4QODA 3WL6A 1QGAA 3K8QA 4EW3A 3PTAA 2DPLA 4HH4A 3V34A 4CDMA 2X3FA 4WK2B 3V6LA 2LIPA 1CFJA 5EP4A 5B3LA 2L82A 3GVCA 1J0EA 1XL0A 3PXXA 4PXAA 1AHIA 1ZEJA 1IJKA 1O8CA 1QG0A 4L8VA 3D8SA 3LUGA 3ND9A 4W5OA 3BCUA 4Y2YA 1WX1A 3RRYA 1EK2A 3NMUF 5DLYA 3B7PA 3CQ9A 5DM4A 4TS4A 3PB3A 1LW6E 5JZBA 2J07A 2XTMA 2HMWA 5CNIA 3LSTA 3IDOA 4PM4A 5D3MB 3T7JA 1W5AA 2XUDA 4KO8A 5LMNB 4GKJB 4NYMR 4RC9A 4B8WA 1HZJA 1KAHA 2DPMA 3AERB 3AP1A 1K9SA 2ID9A 1SUPA 3I32A 1KQPA 3ICPA 2ORIA 3MQFA 3B1JA 1CNEA 2R4TA 2XGSA 2A33A 4S04A 1R5NA 1B6TA 3FPAA 5CHEA 4GS5A 4ZANA 2XEDA 1I3KA 3ZCVA 1E3LA 1TC1A 4XVUA 4PO8A 4X1IA 3ZQ4A 1RJEA 4GPAA 3ESZA 1CP2A 5EVCA 3CG4A 1VHDA 1A88A 3BOSA 4D6PA 4RTQA 4W8HA 1ZI9A 1EJ2A 5AVQA 1E2EA 4HQOA 2JFVA 3DV0A 1AKVA 1YBAA 2WWXA 1TMGE 4M1ZA 4BGEA 3C3KA 4UM9B 2C7BA 2NO6A 4QBKA 3WDKA 4MYDA 4OHOA 2QE6A 4RVGA 3QX3A 3GZ4A 3HB4X 1NU6A 1HNWB 3ZXUB 1KDPA 2HH9A 4B9EA 1KFKB 1FW8A 4DM4A 1RAFA 1IZZA 5CT9A 1T36B 3TRJA 2AG8A 3BMXA 2O2IA 4QQRA 1Y4AE 2VNHA 3TPZA 2Z2JA 2D59A 3LIIA 3D5TA 3D54D 3MS2A 4NAVA 4EB0A 3S99A 4JUFA 3AY6A 5JYEA 4K7JA 1GPLA 1SVSA 3LHSA 3RTAA 5K4GA 2C0PA 4EMSA 4K9DA 3CVYA 4PGHA 3NHUA 2WIKA 3PE3A 1FRVA 3OU7A 4Q21A 4TZ6A 2I6SA 3PGVA 4YRAA 4RTKA 4WMLA 3L0BA 1PTJC 1YB7A 1B6SA 5AHOA 1P9OA 3TTXA 1K75A 1QGYA 3RF6A 2QA5A 5H02A 5JH7F 4HP8A 4D9MA 3GI1A 4J8PA 3WQBA 4ZYLA 5CA1A 1U6IA 3AU8A 4WZZA 4DA9A 5L6LB 4OLHA 3THWB 1RBQA 4YYZA 1Q57A 2JANA 3Q11A 3FOBA 5J2UA 2PH1A 3MPUA 1Z07A 4BWYA 3MZ0A 1YJXA 5DB4A 5EIEA 3VKGA 4TLDA 5BRJA 4F60A 2I4LA 5JSZB 1YRLA 3AEXA 5ALTA 2O0MA 1UBNA 3ZDQA 4UJ5A 3KQKA 2PKEA 4RE5A 4BQQA 1J56A 2I2BA 2HSEA 4OX9B 2PWBA 4R7TA 5CCDA 4PRYA 2PBFA 4GP6A 4AUEA 3RGGA 4RA9B 4DYVA 4ZK2A 3WGZA 3GB9A 4HR7A 2A5LA 5HSGA 3NJ4A 4PO9A 1CD5A 1G8SA 1VKJA 5TPWB 1A27A 3NIBA 3GLRA 1XP8A 3H3XA 1Z2DA 2TMYA 3PG5A 1BJTA 5IMBA 5TQ2A 5ILQA 4Z9XA 3GNLA 4KPGA 1HDYA 4IEIA 3PC8C 4EITA 2C95A 2P4HX 1QGZA 4RKRA 2C20A 5BR7A 1MFPA 1UINA 4D9KA 2Z6VA 3LY9A 3P9IA 3QE0A 4KFCA 3QWHA 4GZ3A 1NOKA 2CMFA 1N32B 3MMPA 1N7JA 2Q8QA 3M1YA 1EXNA 1DELA 1KYTA 1MENA 3I9V6 4LJ4A 1JHAA 3E3AA 3BJEA 4FZRA 3S0JA 2POQX 1Y1LA 4DN6A 1NSTA 2Y3IA 2PMDA 2YL2A 3OQHA 4C04A 1T3HA 2IOFK 1DMSA 4UU7A 5JT1A 4CN9A 1H94A 4XGKA 1HQCA 2HRQA 2WJGA 4NOLA 3W4IA 1NJFA 5EPEA 4U2EA 1MC4A 2BKXA 4FNOA 4U2CA 1VPWA 4F3KA 2IS2A 4EYSA 3G8BA 4BN5A 3OOWA 1NF2A 1IFXA 3RM3A 1P8AA 3SF8A 3VYVA 3OQOA 2D7JA 2V6IA 3ZHOA 1C4OA 1TMYA 1UC8A 1DTEA 3HU3A 3AKYA 3K6RA 2QJRA 3AWDA 3OP4A 3RREA 3U3OA 3FZNA 1N5MA 3WR5A 3R9WA 2DFLA 4Q3CA 4P3KA 1CJMA 5AP9A 5IFLA 3FNQA 2YXPX 4KIJA 4GC9A 4LOIA 2R2AA 4G97A 1P1KA 3UJAA 2G1UA 4F46A 5LD2C 1E1MA 3GEIA 4N01A 1EUDB 1JHRA 1YZTA 3EK2A 4I8DA 4X7MA 3ZUPA 1KFBB 3C8ZA 4KNWA 4JJGA 4HK4A 5JWOA 1OXSC 3B5EA 3F5MA 2BI4A 1USIA 4H27A 2QNIA 4PCLA 4TWAA 2CNDA 2YWCA 1XCBA 1Z0SA 3MJFA 3WLTA 2AX3A 1OD6A 3AB7A 4I1YA 5D1HA 3D59A 3KQNA 3WGTA 1FNBA 2F43B 3W6ZA 5CLIA 5T57A 3F6PA 1ICEA 4G0ZA 4I8IA 4CIWA 4YY3B 5B12A 1P8JA 3KLOA 2F59A 3L4SO 1EPUA 2YH2A 3W34A 4REQA 1L5LA 3FI0A 4D5EA 4TOIA 2NAPA 3KQOA 5BRAA 3RRBA 5IS2A 2ZE8A 3B48A 2RG1A 3GJXC 3R9KA 5LQKA 3UCFA 4DG5A 5JXGA 2R6GA 1YQTA 1R0YA 4AIRA 2O7QA 4W1SA 3RVJA 1PVOA 3WTCA 1ECGA 4DA0A 4RSHA 5E9AA 3WXMA 2AFHA 4RPKA 3WSTA 4GX0A 4CM4B 2FOXA 4M9QA 1LVHA 1GA6A 2AC2A 1XCLA 4RADA 5DCUA 5BSUA 3D6FA 3NU1A 4M0PA 1YBVA 2QRGA 4FEGA 1JDSA 2ECOA 1U0LA 3EXIA 5A71A 4MRSA 3DTNA 2YVKA 2JGEA 2BONA 3ZHSA 2VYNA 3FYHA 3NC4A 1KMHB 1Y5IA 1GNQA 4AZ3A 4LOLA 2EKZA 3WJAA 2NXWA 3B5IA 2GXUA 3NTXA 4S1VA 2WF9A 1JAHA 1IG0A 2C99A 2PVCA 1LBIA 2K7ZA 3QVOA 1GZHB 4D99A 3AEYA 3AUYA 3OPQA 1UJBA 4Y2RA 3D2BA 3UUFA 2J0QA 3KU1A 3AMVA 2J3JA 3FMPB 4IHAA 4V3CA 4B6RA 4CFSA 3U16A 2DFKB 1HKHA 2FRXA 4RW0A 2WC1A 3VDRA 2XE7A 4YJGA 4HFMA 2VPXA 5IDXA 2C2BA 4BQPA 4QDZA 1PG2A 3THXA 1DIAA 3KSMA 3H6GA 1OOEA 2GLUA 3UJDA 4H9GA 4MUMA 1A5TA 1WW3A 1PZEA 1YDEA 3DYBA 3ME5A 3AF2A 3ND8A 5BQOA 2X0FA 3RHTA 2HJ9A 1WBDA 4L5BA 3CR3C 3KU4A 3OCWA 4Y2PA 3A04A 4GBJA 2G09A 4HEA1 1T6BY 2V8BA 5U9CA 1IIBA 5KI6A 3D6TB 3IH5A 4L5AA 1R8XA 4LOAA 1KO4A 3NB0A 1WDMA 5F3RA 3TW8A 3WRWA 3HQ4O 1JX6A 3MK31 4WESA 1E2KA 3WGGA 3ZWYA 3H9CA 3ISJA 1E9FA 1EFUA 1TK2A 1K2WA 2ZSJA 3CYFA 2CLFB 3GGGA 4KQ6A 4BMNA 4MGZR 1PLJA 4RIIA 5I9IA 2HUNA 4D82A 3DAOA 1CJTC 1F0PA 2Q3BA 4HG2A 4EB3A 2Q6TA 4C0XA 2HNKA 3K2EA 4P4LA 4CLXA 1UDAA 2FEMA 5K9ZA 3VR6A