3HXPA

Crystal structure of the fhud fold-family bsu3320, a periplasmic binding protein component of a fep/fec-like ferrichrome abc transporter from bacillus subtilis. northeast structural genomics consortium target sr577
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
272
structure length
272
Chain Sequence
b'YKAENGNVKIPKHPKRVVVMADGYYGYFKTLGINVVGAPENVFKNPYYKGKTNGVENIGDGTSVEKVIDLNPDLIIVWTTQGADIKKLEKIAPTVAVKYDKLDNIEQLKEFAKMTGTEDKAEKWLAKWDKKVAAAKTKIKKAVGDKTISIMQTNGKDIYVFGKDFGRGGSIIYKDLGLQATKLTKEKAIDQGPGYTSISLEKLPDFAGDYIFAGPWQSGGDDGGVFESSIWKNLNAVKNGHVYKMDPIGFYFTDPISLEGQLEFITESLTKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(3+)-hydroxamate-binding protein fhuD
publication title Northeast Structural Genomics Consortium Target SR577
rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 56
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2009-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hxpA02
1M34B 1QH8A 2AFHB 2YNMD 4LS3A 1G21B 3AEUB 2WI8A 4WN9B 5AFSA 5JJ5A 3MD9A 3BE5A 4TKUA 5CX1B 2PS9A 5KHLB 2ETVA 4HMOA 4ND8A 3AERA 1FP4B 1M1YB 3AEQB 4K3VA 5BVGB 5KOHB 1G20B 2OV3A 4UDOA 1MIOA 3AETA 4HMQA 4WZAB 4PAGA 3MWGA 5KOJA 3PDIB 4MO9A 4MDYA 4NNPA 4CL2A 2YNMC 3G9QA 4OXQA 4FNAA 3R5TA 1K0FA 2MINB 2OGWA 4UTPA 3MFQA 1QH1A 4H59A 5JOQA 2M6KA 3EIXA 3AEKA 4OVKA 1PSZA 4INPA 1N2CA 2XV1A 3ZKAA 1KARA 1QGUA 4XPIB 3MINB 4WZBA 1N2ZA 1EFDN 1M34A 2RG7A 3ZK9A 2PS3A 2QI9F 4FI3F 1G21A 4LJSA 4WN9A 3MWFA 4INOA 5GGXA 4B8YA 2Q8PA 3ZTTA 1M1NA 3AESB 1N4DA 5I4KA 3ZK8A 3AEQA 3U7QB 2XH8A 4TKVA 1G20A 1KAHA 2XDQA 2AFIB 5JG7A 4UTOA 3LI2A 3HXPA 3EIWA 1QH8B 3TLKA 4BBPA 1N4AA 2PRSA 2Q8QA 1KAEA 1K7SN 3NU1A 1H1LA 5CR9A 4N01A 5GGYA 4HMPA 2WHYA 4OXRA 2MINA 5HX7A 4WESB 1PQ4A 2R7AA 2XQVA 5FLYA 1XVLA 3K1AB 4G09A 5BVHA 5KOJB 4M7OA 4WNAB 4DBLE 4GICA 1ESZA 2AFHA 3AEUA 3CX3A 1TOAA 2M6LA 5CX1A 1QH1B 5M34A 1FP4A 1M1YA 3R5SA 5BVGA 4G07A 4MLZA 4UDNA 5KOHA 1L5HB 2PHZA 4HN9A 3U7QA 4WZAA 2PS0A 3TEFA 4FILA 3PDIA 2AFIA 5HDQA 4NNOA 3BE6A 4TKUB 3PSHA 2XY4A 5M3BA 1K2VN 4ND8B 3AERB 1K75A 3HJTA 5M2QA 5B58T 1M1NB 1MIOB 3AETB 2R79A 4TKVB 3LHSA 2OV1A 4FKMA 4PM4A 2XDQB 4WESA 5JPDA 2X4LA 5M29A 4XPIA 3PSAA 3GI1A 3MINA 4IRMA 3HH8A 3UJPA 3K1AA 3ZK7A 3TNYA 1H1LB 4WNAA 4MX8A 3AEKB 2OSVA 2XUZA 3AESA 4H0FA 2O1EA 1N2CB 1QGUB 4WZBB 1L5HA 5BVHB
chains in the Genus database with same CATH superfamily
4EQZA 4DMRA 4X60A 2BEUB 2PSDA 5TGDA 4ZO8A 1CR0A 1UPBA 1ZBQA 3IMFA 3Q12A 5L45A 1JLMA 2Q5QA 4XKJA 4BMOB 1P6QA 1DPGA 3ZJUA 3DDNA 4DJFC 1OAAA 3DS8A 3HVKA 4ENVA 1Z6ZA 1NJ1A 4GMKA 3GLTA 2BBWA 1C29B 4L9WA 1WEKA 4NE9A 5GJWC 3HDVA 3VDNB 3QP9A 1YAJA 4GMGA 3I45A 1QOQB 5AM5A 4PAGA 1XWIA 2BW0A 5EIHA 3TQCA 4DN6A 1W4CA 2ZRKA 2VP0A 3ULKA 1E2GA 2ZXFA 3CZMA 1W0KA 3KLMX 4V0LA 2VDUE 4LDNA 2HIGA 4B79A 3OTGA 2FEXA 4W82A 4PIPA 1LW6E 2NO1A 4JVOA 3U3XA 5T3YA 1U1DA 2QUZA 3AVYA 1JJFA 3QXJA 3JQ7A 1YBFA 5K0LA 1COWD 1JDTA 5JNTA 2J3DA 5EE5B 3WYDA 3A06A 4E22A 1NJSA 2ID9A 1HT1E 4GBED 2GPWA 5DIFA 5AKIA 1O94D 1SC6A 2Z6UA 4TRMA 4Z0HO 4B3IA 1SC4A 4URVR 2HL6A 5EXTA 3A6LA 4QUDA 3SKYA 4JAVC 2QMOA 5T8KC 3RVSA 3H2KA 4AG5A 1U1CA 4FYXA 3D0OA 1J2JA 2JIRA 3N0WA 1EFUA 4LG1A 5CAEB 3A32A 4PRKA 4FHDA 3VH3A 1ZCBA 2ZVPX 4HFMA 4P82A 3RUIA 4PN7A 3FNEA 1BDHA 1JDZA 2AJLI 2ZSFA 3BIXA 4IV0A 1ADCA 5J5VA 4Q39A 3FKQA 4DRYA 1E3MA 4FB5A 4C7OA 4KE7A 1DXHA 2XA9A 1OFIA 4JUDX 1JU3A 2Q3LA 521PA 3DTVB 3E9EA 1QDLB 4O08A 5ALVA 1T4CB 5E4JA 3QOXA 3QEBZ 3B2NA 2EBHX 1ULBA 1UWCA 2J48A 2IU6A 4ZVLA 4EG7A 3IVRA 4X0EA 3OFNA 5C4IA 3ONNA 2A1TS 3GN1A 3RM3A 4RE6A 3OQ1A 4TUYA 2NP7A 2XMSA 3LLMA 2WIAA 5DRYA 2P6UA 3TINA 1EX1A 1NXPA 4HS4A 1KVTA 5TX7A 2XT0A 2AN9A 2I1LA 1T8TA 4AY5A 4N6OA 5ALOA 4RZ2A 1C2YA 2CE2X 3R5SA 3DOOA 4GYWA 1Z68A 3K3PA 4L3WA 3RASA 2IPAB 3U7JA 1L1EA 5DLYA 1EJBA 1ZWKA 2FWIA 2XHEA 2H52A 2Q0QA 1X77A 4LV6A 3UWSA 4E5SA 4DR5B 1N25A 1Y3FE 3K1TA 2OPHA 4MW5A 2B34A 2HF9A 4DWOA 2WEKA 1VG0B 4Z9AA 5FL7A 2YXNA 5C8YF 3KSZO 4BTVA 4JR2A 1TX4B 1SK8A 2E3JA 5IULC 2YQ5A 1RWNA 3KTAB 4DM7A 3BIFA 1H69A 4QU8A 4F06A 2ZPTX 3HADA 3IAHA 3LRXA 5NULA 1PS8A 1GFIA 3GJ3A 2J08A 2P6OA 4M1TA 3T94A 3V4ZA 4CM4B 3AVVA 3AJ9A 2FV8A 3M0EA 3LWDA 4M88A 3U3DA 5JFTA 1NW6A 2XVAA 3FWYA 1YBMA 2UU9B 5EZ6B 4LYAA 4NK4A 4OIFA 5IM5A 4XGIA 3OCJA 4PC7A 1XJQA 5JQGA 1AKWA 2XWPA 1UC9A 4ZZ0A 1RXEA 3L04A 4IJ6A 2X7XA 2F62A 4DANA 3KR0A 2B99A 5KQMA 2IIQA 3LECA 1T3GA 4LV8B 2DFLA 1GZDA 4FMBB 1SY7A 3TD2A 1KMMA 4K9MA 1AGRA 1EAYA 1K86A 3AVTA 3JVVA 4Z4EA 1UBUS 4C9BA 3EG5A 1M1ZA 2JLVA 2JGIA 4DM4A 4HDMA 2X0FA 1DQNA 2QXUA 1Q57A 2R8ZA 2V5AA 3A4NA 4MOWA 3RCBA 4J1TC 3KUCA 4DSNA 4Z7NB 4ZTUB 2R7LA 2XMCA 2PCLA 3U1VA 4XLLA 4EY7A 3KJFA 3LPCA 1SCAA 2CE7A 1XEXA 4DOMA 1NJ6A 1Q16A 4O2RA 5A1TA 2GH1A 2PLFA 4RCZA 3MS2A 2WNIA 1A7KA 1JAHA 1NUTA 3GJRA 3JATB 3B53X 3JVDA 3KXLA 1ZGAA 4EMSA 4GL4A 2VZ9A 4GZLA 1TA0A 3PFGA 4KXUA 3RIEA 1BXGA 2CUNA 3QOYA 1P5FA 1FS5A 4G5YA 4LMRA 4M0UA 4QU5A 4DW8A 5ES3A 3C5HA 3GNQA 3DTTA 3AGQA 1WIWA 4O63O 3EFBA 2RK6A 1VIYA 4PX5A 5CPBA 4TS9A 1R8SA 4U9UA 4YP9A 3VPSA 2OBLA 1GVNB 5B12A 4KX5A 4O1MA 4PSVA 3AUSA 1VCNA 2Q45A 3PLAE 3D5QA 2IX9A 2G08A 3KYDA 2R0QC 2FP4A 2XOKA 5J2TB 1IUPA 2WQZA 4YXWA 2CXQA 4WXPA 4QGBA 1LV7A 2C2HA 1FPQA 2ZT5A 1CW2B 1NURA 1S2NA 3TZEA 2QQGA 2YIMA 3L82B 1P0CA 2VCYA 1JFFA 1BMQA 3NLLA 1SVUA 1JEQA 3G2QA 1UOEA 2XNDA 2A0FA 1OT5A 1RMQA 1NM5C 1XP5A 2AKYA 2WJWA 5EWMA 2Z8XA 4H08A 3AQ4A 5CDGA 1LLFA 2BFNA 1R5JA 2VPQA 2XDAA 1N7GA 2I76A 4N5NA 3THYA 1II9A 2A0WA 2DAPA 2A3NA 1J1ZA 4Q00A 1J5XA 2AKAB 5TQ2B 2RBGA 2ZQYA 4N47A 4YX9A 5DM4A 3K0KA 4ZEWA 1ZIOA 2QNBA 4FMCB 3H19A 2A2ZA 4YMIA 2DPGA 5IBCA 4C87A 3JAWB 2WVJA 3KDSE 1RAHA 1WSDA 2JCYA 2CMDA 4TTTS 2QAIA 3V34A 2CL7X 4IS3A 1DDGA 3QLVC 3WR5A 2XRYA 3D1VA 3ZQJA 1XVAA 4BEWA 4FB4A 3SE0A 3V7FA 1K2WA 2FB9A 4UNQA 1T4DA 5G4KB 2RJ3A 3BPSA 1M8KA 3G88A 1MA3A 2G4LA 2GM4A 1RJ9B 5TIIA 2I6FA 1J2YA 5KQRA 1MX5A 4RDHA 5C8ZA 2VHCA 3OI7A 3D0RA 4H77A 3RVQA 2V6IA 1N9ZA 4R1OA 3ZU2A 2WQ6A 2GM3A 3DV0B 1CF9A 3QEMB 2ALJA 3VPXA 4ALJA 1LBEA 5IDQA 2RDMA 3PF8A 2BUCA 1VG9B 1YA6A 3Q5GA 3WGUA 4XZ3A 3M6WA 4B80A 4JP1A 2QX6A 2IYVA 1DAIA 3EF0A 4NENB 1XU9A 4RAOA 2H0AA 3R6TA 5A7HA 3ZHRA 2HWXA 3C5EA 2D8MA 1O58A 1UJ4A 2RHBA 3NNNA 4RDXA 1GPH1 5M29A 3ICQB 1A7UA 3U4QA 3OKCA 1M8GA 1XTRA 1PBTA 4Z9BA 2VI5A 5G2OA 1U3UA 2HK9A 5LXTF 4B7UA 3HBMA 3HKCB 4CKBA 5BURA 1QHGA 3AEKB 3CEMA 3Q98A 4IUCS 3AHCA 3LT1A 4J49A 2H0RA 4C0BA 1XYYA 4IDGA 1P3Y1 2GBLA 3VZPA 1P1IA 5BRAA 3HVRA 1U8YA 1C9MA 2HCTA 2JLXA 5AM1A 3KPYA 4UBLA 3HZHA 2IE0A 2REQA 1X42A 3UF0A 1JA0A 2NTJA 4R71A 2ANCA 2JFNA 3A1DA 3RHFA 3DL4A 4NLLA 1VPTA 4F4DA 3PI6A 4P8RA 4Z8YA 3P4XA 4UDOA 2K7FA 2YTZA 2W4QA 3EPRA 3ZWOA 5I9SA 1H2XA 1QKIA 1G1AA 2QTMA 4ND5A 1L7QA 2AX3A 5JAHA 4RD1A 1Z74A 4RQTA 3VR3A 2V58A 4AS2A 2ZJ2A 4KNVA 1BKSB 1HM5A 4KH1A 1VJGA 3ZJ4A 5C80A 3RS4A 3H11B 3IQDB 3R0VA 4B6FA 3QPCA 5FWNA 3LXMA 3NIWA 3OEEA 1C8VB 1Q83A 1CUDA 4B2LA 4C89A 3E15A 3TZKA 1OX5A 2VPPA 4NU0A 1PSZA 2A35A 1A82A 4NPAA 2MR5A 3V1NA 4J94A 1P7WA 3LUDA 3WK5A 1GYPA 1BCRA 4YP5A 4B8WA 4R7ZA 4Z5XA 4NC9A 3ZK9A 2RIPA 1ZJWA 2RHOA 3G89A 1I1OA 1SKMA 3DXYA 3O6VA 2DHEA 5JJCA 5IT9A 2JHFA 3UZUA 3ET4A 3NRBA 4PQYA 3RBAA 4ZK2A 2ZSAA 4V1CB 3ZW8A 1KI9A 2O1WA 4MYUA 5KREA 2M98A 3K70D 3EIWA 4H7IA 3SXUB 2QMQA 1RJEA 1T9GR 1CQZA 3PYLA 1CY4A 5EJ2A 3ZNNA 4CMIA 5AIBA 5JYEA 4ITVA 1JYEA 1NI3A 3GLHA 4CKWB 2HRZA 3ESBA 2A9RA 4QOFA 4LOKA 3EIUA 1GGHA 1NRIA 3JQAB 1UODA 2P4EA 3RYHB 4QUIA 3WBJA 3RRYA 2I4TA 1BWPA 2J5KA 2VJMB 4X71A 3WQHA 1L7OA 3AQIA 4ZAYA 5HRAA 2LRHA 2JHAA 4WLOA 3PC8A 1RYYA 1W8IA 2J6IA 3H8SA 1GPDG 5H16A 2EP8A 2G82A 3ZCQA 2YVAA 2LPMA 1M75A 4BEJA 1QANA 2H8GA 2ZQZA 1RR6A 1V16A 3J80A 3WWZA 3TXYA 3SPXA 2ZJZA 2JARA 2P30A 1SEPA 3MFYA 4KIGA 2PKWA 2ZRAA 2HHJA 2QLTA 5IJXA 3RS8A 2P4HX 4I55A 4NSNA 5LIRA 1DUSA 1KY4A 4MNTA 3F6EX 3KKKA 4OHRA 4EHKA 1NNLA 2G76A 1YZQA 1EM8B 1IOZA 2GI4A 4PO1A 2VXBA 3TW0A 1KEZA 4DJDC 3KVRA 4NAVA 5GADl 1KI7A 5IW8A 4FM9A 3QYAA 1DBQA 3IUPA 1ADYA 1JTVA 4A7PA 3CX7A 3MCAA 5AXCA 2HSDA 2P3OA 4NZOA 5CJPA 1ZA2A 2FHSA 4I4TF 3ZWNA 5F5NA 1E1CB 4ND4A 2FK7A 3SM9A 2R6HA 3JQRA 5IBQA 3V2GA 4C29A 1GDTA 3D8RA 4Z4HA 3MINA 1JR4A 1CDEA 1EFAA 1NQUA 1SWVA 3KWJA 3IUEA 2V7WA 3ZK7A 1I7PA 3LFHA 4MUBA 3ZV5A 1A88A 2VLIA 3AUKA 3G79A 1AV6A 1E0KA 1BU8A 1HYHA 1AURA 4IY1A 1ZK0A 3DT9A 1KAGA 3A7DA 4EX7A 1EA7A 4DZTA 5FEMA 1X1CA 4ENWA 4Z99A 4XQGA 2HNBA 3T7IA 1SBQA 3IKJA 4UNRA 2PEYA 4W9MC 3PTAA 4JVLA 2HEIA 2PPLA 4CF4A 2A86A 4KEAA 2A9QA 2RHHA 1JEYA 2HTFA 4UQLA 1T91A 1AZSC 4W5WA 5IK2A 3TL6A 5BQFA 1E96A 4PZUA 3GQVA 4ND3A 3HJBA 3WGTA 3AHDA 2C5AA 2G6BA 3I4FA 5K8CA 4M0MA 4EELA 5JEDA 1UWKA 2BUAA 2WU8A 2BFMA 3H3JA 4TTVA 1T3LA 4NV3A 2IYNA 1G8JA 1EUQA 1UXJA 3FR8A 3LVQE 5EE0A 3I5AA 3WLAA 3QWIA 4IIJB 1B0ZA 3BS4A 5JATA 2UUAB 4L02A 3QV1A 1DBIA 1GL3A 4M8KA 1KI3A 2GXAA 1JR3E 4G67A 4M2LA 4ETIA 1XXHE 4NG5A 4RHXA 1XZFA 2PWYA 2CJYA 3WWPA 2BELA 2E4AA 4C4XA 1BCSA 4LE1A 5BYAA 1WBDA 3HACA 3QI7A 1TIPA 1N2CA 3EXG2 2PR2A 3IE2A 1S8OA 2ASEA 4OX9B 3DNPA 2VJNA 3DYVA 3QRWA 2RC6A 1A96A 2ZWOA 5KMGA 5LWHA 2P9QA 3TNJA 1RRGA 3TTTA 2BFBB 1DCFA 2C2YA 2PX4A 4NBKA 4MWCA 4EYGA 5KBYA 2I29A 5ELXA 1KKMA 1JZQA 3MJCA 5J4VA 1PGQA 2I62A 3QUCA 1KU6A 3NAQA 3OPNA 4XQCA 1O96A 3WL7A 1IVYA 3GLRA 4HSGA 4GMDA 5HILA 3WLEA 2MYPA 3TGLA 4MIOA 2FPIB 3SZOA 2VDLB 1VXOA 1FSZA 3RAJA 3MGAA 4Y2GA 2ATCA 4ADSG 4XOIA 1E1MA 1UK9A 4HMPA 3NH9A 2KMLA 3GB9A 4E1BA 2OSBA 4Q7LA 4U1RA 3CUEF 4B6QA 5DHPA 1ADJA 4DA6A 2BI8A 3VAAA 3R6DA 3GRYA 3WYFA 3RLIA 4EHFA 3W5IA 3P7MA 1UR5A 2I7CA 3BERA 3NX4A 3ZD8A 4UPDA 1ESZA 3IHKA 1ST3A 3C6KA 3KC2A 4KOEC 2EG5A 3UUFA 4FUTA 4BB9A 7REQB 2F1OA 2HEGA 3I01A 1W76A 3PQ8A 2VAMA 1OX4B 1ZISA 2Q5OA 3J81k 1KY2A 4GZ5A 4HY3A 3GLFE 1ORTA 1UT8A 4AMZA 3QF7A 1QHNA 1Z2NX 3B85A 4O4JA 2NWQA 5AVJA 1UZAA 2BFAA 2IOHA 4JYMA 4PY2A 3VMFA 5EIXA 2FPLA 2AFIA 1CUJA 4D96A 4M6WA 4BKRA 4PPNA 2J32A 4DMCA 5AHXA 4BAUA 5CD9A 4C4AA 5GVSA 3VZBA 5KVSA 3HCWA 2P79A 3BMNA 4FJ0A 3U56A 1TKAA 1WMDA 3AB7A 1SA0B 3DKKA 1ZD4A 4MVCA 1NDHA 3GLUA 1JJAA 3DDCA 1R0RE 2WYOA 1T2FA 3G85A 4XIFA 2FLKA 4RVHA 4TLMB 2CY0A 2YIJA 3CGWA 1BJTA 4Q0MA 3U3ZA 1EB9A 2YUIA 1Q1NA 3S2ZA 1QIKA 2Q29A 2XX3A 3VOSA 4AO7A 2B1RA 2GF9A 2QMYA 4UBNA 4CCAA 5FI3A 4F21A 3GEBA 4K9RA 4FX5A 4YT2A 4W5OA 3NOOA 5CUQA 1KDYA 2XRZA 4BO2A 1IQPA 3R5KA 4AX8A 2QHXA 4TS3A 1UJBA 2AMVA 3KD2A 2IIBA 4JUBA 4YRCA 1XRRA 1W1IA 5IAEA 2WA2A 2WJ3A 4MKHA 2ZSBA 3WFIA 1RM4A 3BXFA 2MTBA 2IHUA 4HH4A 3D0KA 5MHTA 1CY2A 3EXHA 2BEVB 1VRWA 5JD3A 3O03A 5JRJA 2AE2A 3AETA 3DAOA 4ND6A 1FFDA 4BNVA 4W6QA 3GGOA 1WX1A 1T26A 4UJ3A 1NA5A 3DEKA 1XRNA 4CV2A 2OL4A 1QHFA 3CRZA 2K2WA 3OF3A 1ZQ9A 3RHSA 3UA3A 1EFKA 1VJDA 2CZGA 3HNRA 4M1SA 5H82A 2ZCUA 1XTIA 1RYEA 3SFZA 2HXGA 4JUIA 2JC3A 1E2HA 2Q3FA 4O2AF 4TOIA 1RI1A 5K0GA 1X8JA 3I9OA 1FL9A 4J6FA 2OR3A 1RXWA 2EDCA 1KARA 1I14A 3C3KA 4EB3A 1KY5A 3Q2OA 2WRZA 5ER9A 2BAGA 4TL6A 2ZATA 1E9BA 4DKJA 2Q3HA 5BSWA 1S8FA 1BOFA 4KGDA 3D2CA 1L5YA 3Q2KA 1HT0A 4NU5A 4XFDA 3SX2A 4WKNA 4HSEA 1PW5A 2HSGA 2ZRLA 2DMRA 4UD2A 1FK8A 2H1HA 1KK2A 1E1DA 1ADGA 2LIVA 1Y9JA 4OHUA 3AM1A 2H54A 1RWPA 1Z35A 5J40A 5JG7A 2ZBRA 1WNTA 3RFUA 1U04A 1XWWA 2HFJA 4DA9A 3WMEA 2QLMA 4X1IB 3R77A 3ELDA 4KSCA 1QYIA 4JYAB 3K09A 2R8EA 5CNJA 2BGWA 3WMRA 3E4DA 2L17A 5K8LA 7REQA 2P90A 1EA5A 3DVQX 3W6UA 1E6UA 1HGXA 3GP8A 1GNTA 2XMBA 2GSDA 2VBFA 3FCSB 4CR7A 4MLCA 3SIXA 4BNLA 1L4HA 1CF4A 5E1OA 5JXWA 2M6LA 4EEZA 4WEOA 1KH2A 1ODJA 3M9XA 1BS2A 4U3JB 4NDZA 1SBYA 3V8RA 4LZOA 2XI4A 3PUXA 2C4KA 1EK2A 2EJUA 1MG5A 2RGDA 4PR0A 2WY2D 3S2EA 4CV1A 4GXTA 3DOJA 1YS4A 1GQYA 4YV1A 1P7CA 4YCNA 3C1TA 1M1UA 3K94A 4HWKA 1QO0D 4V3BA 5DGIA 2V98A 4IMJB 5AHKA 4EY5A 3AXSA 1SZDA 3FTCA 2IPLA 3N70A 1GGKA 3KBOA 3RUDA 3W8EA 2CLLB 3IBCA 3PXBA 1TTPB 1GTJ1 2C83A 1NIPA 2D1TA 3EUFA 4L50A 1QCZA 4L51A 4KXFB 1YQXA 4F91B 3WICA 1GUBA 2WV9A 2AQKA 4DYDA 4I7EA 4QM6A 1KVUA 5EZYA 2JAPA 4HBZA 2D0IA 4V0KA 5ANRB 1SOMA 2P2GA 4RJLA 5EPUA 4DTCA 5FF9A 4CM3A 1VZ2A 1S3GA 4DR3B 3DWGA 1G7TA 2B1JA 2F6RA 3ZJYA 4DDVA 3IEVA 4RTMA 1TB4A 1ZCJA 5CD1A 1N5KA 4URZR 2EGUA 4G4IA 4BO5A 2DEUA 1UINA 1JIVA 3LVBA 4K7JA 4S05A 4U6SA 9MHTA 1ZUIA 5LYJA 3SLGA 5HKAA 1GKIA 1H9AA 2ZJ4A 3ENVA 3E9ZA 2YOFA 1SJ9A 5CYFA 4TT3A 4ZXFA 3RKRA 3G8AA 1M8FA 1T29A 3DVRX 4UNSA 4K6FA 3AERA 4R51A 5H0IA 2AYYA 4JYCA 3UB3A 1XMQB 3HXKA 2ORIA 4BLWA 1BVRA 2F9LA 1NR1A 2WHQA 2ZBGA 5AO9A 3ZHXA 1LX7A 4RK4A 4YAUA 2XZDA 1T5IA 3EY9A 3L0CA 1NUHA 3L0BA 3FLEA 1ELOA 1NW7A 2XUGA 2OCXA 3TW6A 3QA3E 1TIKA 2CEAA 2GFHA 4D9EA 1C7QA 5K0EA 3RIHA 1PFKA 3L1VA 5TQVA 1YBAA 1XU4A 2JH9A 1IG0A 2H5JA 4L8WB 4G8JA 1Z4IA 3VH4A 3O8RA 1I8TA 3IL2A 1C8LA 3PF9A 4NWIA 4R7GA 2W48A 5C1DA 3NM5A 4IXTA 3IO3A 4JKIA 1DUVG 1WUIS 4NYIR 3BTOA 2UZ4A 2NXCA 3ST7A 1MNQA 2Y1WA 2ZIAA 3EIOA 4AUEA 3PXXA 2ESRA 3JAKB 1COWA 2GZ3A 1LS6A 2DJIA 1Y3CE 4WOCA 1Q14A 1O94A 1MB0A 2X4DA 1DWOA 4L75A 2RGEA 5HM8A 2JFQA 1OUMA 5T6MA 5HE8A 4PFJA 1N8SA 1PT9A 4JLDA 2GLUA 3ROXA 1XKTA 1T2UA 4AO6A 1H5UA 3LHDA 4XB6B 2IHZA 4EO4A 1GPYA 1DJLA 5JCPA 4GX0A 3KSRA 2QRNA 4M9SA 5ED4A 3H99A 4QYIA 3KZXA 1YT5A 2RHWA 3ZHTA 1B1CA 3CNEA 1U8XX 3I4LA 5AI4A 3QOWA 3SR3A 1E9FA 2W43A 4R7TA 4Y2HA 3SKVA 1YQ9A 2YQ4A 3QKUA 4I19A 1M73E 1YE3A 4YRLA 5G0UA 3H16A 3S5JA 4ALNA 4WE3A 1FTSA 3AI2A 1DAPA 1U28A 3BGSA 3H4IA 3H5VA 4ND2A 2PJRA 3LLSA 4GAEA 2QTVA 1C7ZA 4HYQA 1UC4B 4OMUA 5BOVA 5GINE 3N6XA 3K9NA 1AGYA 4V0OA 5HSGA 4KO8A 1DBPA 2XMRA 4HN9A 1CUXA 4TVKA 5IARA 3TEFA 4FILA 1JR6A 2Y3IA 3DZBA 3QXCA 4JJGA 4D79A 5EJEA 3G2PA 4P4GA 5M3BA 5CLFA 3OD5A 3F0TA 4PEVA 3EIEA 3NJ8A 2CNNA 2ZANA 4MGHA 4JIGA 3FPAA 2DP4E 4XVHA 1HDGO 1YB1A 5DGTA 3BKWA 5KEIA 1N7JA 2QZ4A 2QLNA 4X00A 2ZDQA 3BZWA 4GYKA 3DFMA 1W5AA 3D6FA 3FI9A 3THWA 1GLNA 1KS2A 1RYNA 3ZZ0A 3BF8A 3NUQA 3NXSA 5DBEX 1LX6A 4XRGA 2HT1A 1JUDA 2YWGA 4U0JA 1O4VA 2PBLA 3CC8A 3UATA 4JJ4A 5C18A 2GHIA 3FG9A 1XPUA 2IVZA 3H75A 2WNSA 5JJIA 5LQJA 4HQLA 1CUBA 2O0LA 2YICA 2GEUA 3QQ5A 5FOTA 2OXEA 1PDOA 3C45A 3PNLA 3E4CA 3UCFA 5LB2A 3WRYA 1FFYA 5ENDA 2C2WA 4RSMA 4RGYA 3EC1A 1UP4A 1DCMA 3UGQA 1XEAA 2YNMD 2O7SA 3ETCA 3O9VA 2G3YA 4IEIA 1RAAA 3UK0A 1RYZA 3ZUGA 5J5CA 1JA9A 2JIZD 3QPWA 5A6SA 2J59A 5C1BA 1QV9A 5EJ8A 4QOHA 1VBFA 3LYUA 2C4WA 4HXGA 2HLDD 3NBUA 1M2OB 3EPKA 3WTCA 2FRXA 2JI9A 2WUGA 4L73A 3HGTA 3VYTB 1FUEA 1ODFA 1F8UA 3CXUA 4B3CA 3QXHA 1YU6A 1WCXA 3P9KA 1QIEA 3WQRA 1H6BA 1TF7A 1U7TA 2BFCA 4C06A 1GUAA 1J8MF 2VH1A 2DERA 4M83A 5B4VA 1EWTA 2P69A 3E5MA 1DIAA 5JVDF 5E4FA 1OBVA 1KO7A 1YB4A 3LBIA 4HDAA 4YRPA 1YRQA 2VUIB 3RC7A 4B3GA 1OROA 4HYYA 5DBHX 5DBOA 5F5LA 4E12A 4MHTA 4RVUA 2V6JA 2E4XA 3PLRA 1Z15A 5TQ0B 3AJRA 3PVCA 1GQOA 5JAQA 3T5CA 1MOZA 1Q0SA 3LGXA 1HLDA 4AU1A 4FR0A 4AJ9A 1VL6A 1G8SA 4MYHA 5AW2A 3RT9A 1T0UA 4HXFB 3BXZA 3ETJA 3M4NA 2H2GA 4DT1A 5KNCA 2NUPA 1J25A 1ONBA 1F2UB 4M98A 3H6HA 4J2HA 3QEJA 2BL4A 3HMKA 3P71T 1Y4AE 3LY5A 4HPXB 2I7VA 5KDOA 1YJAA 1YCGA 3F1LA 4IRXA 3L8ZA 1OXUA 2H1LA 4OP1A 2HLHA 1E6WA 4RZHA 4A0HA 4ARAA 5BN5A 3KLBA 2I91A 4UVHA 4P4LA 1J70A 4L4RA 4O8ZA 1EUZA 1T6ZA 2BGKA 4DG8A 4NEHB 3LWZA 5L3SB 2HA0A 1L7RA 2Q5LA 2ZRJA 2UZ1A 3H3FA 4KK4A 5AVQA 1C1HA 2II6A 4QJIA 1GCAA 2YBEA 3GCZA 5EHNA 5ICSA 1KRHA 1J6UA 2QVYX 2ZJ8A 4AYWA 4L76A 4PPQA 4D3ZA 5LOVF 2H7XA 2RKWA 1YQTA 4HF7A 3P4YA 3EBLA 2DT8A 5HWSA 2ZFUA 3I9MA 5E1DA 5K0CA 2RFLA 3EZGA 3NWJA 2ZM5A 4LTDA 3WSTA 5D85A 4RA6A 1JLSA 1U2TA 2I2DA 3ZGZA 4GBMA 3P32A 4CLXA 3A70A 3RF6A 1AHNA 2GWHA 2WT4A 3W90A 2BIFA 2AL7A 4MRVA 1IWBB 4P6VF 4D3SA 2B35A 4EVIA 1YO6A 4GYYA 4INZA 4HNGA 4CR6A 3L1JA 4BMXA 4MAMA 1XTUA 1EVJA 1M34E 1RLOA 3DDWA 4GSLA 3S8MA 4C78A 1IN1A 4RY9A 1X7XA 1FA9A 2O9JA 2YZ7A 4C08A 3E53A 4B75A 1YRWA 4M21A 3A2MA 4JL8A 3VR6A 4HAVA 4JOSA 5JJLA 3DMNA 3MMPA 1CEYA 1DRJA 3UJPA 4A0FA 1IEVA 1T2NA 4XIJA 2P75A 2YN2A 1NUUA 2DHCA 3IKMB 3KB2A 1P4RA 4EY3A 1VFPA 3H5OA 4FLFA 2I3GA 2YOGA 3HCAA 3N0XA 2OZLA 2ZWVA 3T99A 1P74A 5CLGA 4NNJA 2Q1UA 3VHRA 5AJYA 1SCDA 4HZGA 3N28A 2X77A 3UWPA 2QW0X 1D8AA 1NFFA 4J0QA 4XYLA 1U9YA 3RUPA 2CLFB 1SU8A 1UKBA 3A6HA 4GI1A 2ZBPA 3QWBA 3L4EA 1Q0HA 4TLBA 4MW1A 1Y4SA 4O0MA 3LP5A 3KYIB 3T3DA 1V1RA 1H3FA 3F9IA 5BYKA 1FUIA 4M60A 5U4XA 5CA1B 2PSJA 1TQ2A 5ALXA 1RABA 1QP7A 2WE8A 4KWCA 4YJDA 2CDRA 4X8MA 2QN6A 5FB3A 4RSRA 4HCJA 2JJ8A 3TZ6A 5KYGA 5FOUA 3N87A 3RTGA 4Z4FA 1GPWB 3SNHA 3OZAA 1S2LA 2ATIA 2FR8A 4LYYA 4QGAA 3WKDA 1E6CA 1YFZA 1CEXA 5I4CA 5MF6A 1GNVA 3Q7QA 2BCJQ 3L02A 3M6UA 4G1FA 2I7XA 1KFBB 1ZS9A 4A91A 2M6KA 5H80A 2CXTA 3MTDA 4GHWA 3QBTA 4KX3A 4TUYB 4GR4A 3HNOA 4PSKA 2I4MA 4EYQA 5G02A 2QLFA 4G63A 1JQBA 3L8GA 2QP4A 1JTEA 5DW0A 2HU2A 4HT3B 5J2UF 3GLGB 2RK4A 1LVHA 1UZLA 3LG2A 1P1KA 4NAUA 1QDEA 2FEMA 1EWKA 2QL6A 2Y1DA 1OYWA 2Z2ZA 1J7JA 4P58A 2E4ZA 5E8JA 2QIOA 4AB1A 2HCJB 1ND5A 4TROA 2XB9A 2EGHA 2PZAA 1RQGA 2K87A 4QVGA 4AMBA 1T5TA 2D2XA 2LNDA 2VDQB 3TECE 2DBZA 3G0CA 4DXAA 5DT2A 1KR5A 5BN1A 2WUFA 4R16A 1F0PA 3DP7A 3VX3A 1TF2A 2ES4A 3NT4A 3PNQA 3M4ZA 5KX5A 4ROSA 1O6GA 2OBXA 1DLIA 2MINA 2OXCA 1O89A 4PZEA 1JQKA 3K53A 3A6PC 2VPWA 1G16A 3CJTA 3NVDA 2PD4A 1GZHB 1GCUA 3ZEIA 1Z63A 5L4SA 4ZZ1A 5BVHA 2R751 2N46A 1EHIA 1K9SA 1J24A 4D3DA 4JOBA 3R7AA 2NXNA 3ZWMA 3UK7A 5BY2A 5LU8A 4NCJA 3M3DA 1A3CA 2PDAA 3CLVA 3QMWA 4KRGA 2AH5A 1L5GB 5JQGB 4C2BA 3CLTD 4WJKB 1NOKA 4LVCA 1SXQA 3G8BA 1A50B 1YR3A 2WILA 2CUTA 3ZY3A 4DY4A 1L5KA 4I1UA 1UXHA 3LYHA 5T4BA 2GN8A 1FDVA 1QU3A 4N3NA 2O0JA 1AKRA 2FYTA 1IYZA 3HUDA 2QRUA 4Y6GB 1IVSA 1FFBA 1RBYA 2H4WA 3N75A 4MRRA 3SC2A 3V7YA 1P4HA 4E6EA 4HDMB 2ZAYA 3GELA 1NVWQ 4QXAA 2OLEA 2ZIGA 4B2PA 2EJTA 3B13B 3QUTA 1Q21A 1DJMA 3C8ZA 1U0OC 3DZCA 4KVGA 3I9NA 3GFTA 2ZYVX 5AJUA 4DHWA 3IPYA 1ZH0A 2WMYA 4P0TA 1RQRA 4EI9A 13PKA 2J07A 4J2OA 1KC1A 1V3QE 4OXIA 3FGPA 3LOPA 5EYPA 1WHSA 3MS4A 5DK4A 3RWMB 4GU5A 3RAFC 4C7VA 4DV4B 1OXVA 2JH8A 3NCHA 5AVXA 1DFHA 1K6XA 5ICCA 1G9SA 1N6PA 2O54A 1CPYA 1HE8B 4BS9A 3AONB 5H81A 1E3WA 5IZ4A 5CJ2A 3EGOA 4F8EA 1BXGB 3JQBA 4QEZA 4TSKA 1R8XA 1MTZA 2ATEA 4JL6A 1QRAA 3PR3A 1KWKA 3F73A 4ZHSA 2PX5A 1VP3A 3LDAA 3L7IA 1JFTA 3HKBA 3E05A 3OCWA 4F7WA 2EQ5A 2Y6UA 5LR6A 3FE2A 3J7AC 4W5NA 1WR8A 3OTOB 2X7JA 4PRYA 3N0TA 3HUTA 2NAPA 4B9AA 2FP4B 1FU8A 4BNTA 2B4AA 2CJWA 2OV3A 5SV2A 2Z5VA 4F56A 3BF7A 3DONA 2Z98A 1RC0A 5K0ZA 3AF6A 1KZ9A 3UJDA 1UIRA 2EQBA 4J03A 4WZAB 1G291 3OQJA 4PG7A 1FE8A 4A16A 3DG9A 4WLUA 3V1LA 5EWMB 1WXQA 2HADA 3GUHA 3BILA 2YR0A 2D3WA 3RRZA 1J0AA 2PMDA 2BI4A 2DKNA 2Q6OA 3O7WA 4ZU6X 3UICA 1OAKA 3THYB 4UMVA 5A4FS 3K15A 4LXXA 1RAIA 4DQDA 4XWKA 1Z7GA 1SAYA 4N5IX 1ECCA 2VT2A 4L15A 3K0AB 4P83A 2BEKA 1P44A 1JHUA 2Q41A 5H68A 1LNZA 5EZ5A 1D4AA 2OV2A 4RPLA 4TKMA 1OH7A 4CI9A 4MEJA 2WJ4A 4XJTA 1X94A 1OKKD 1EU1A 3PVZA 1V5WA 4Z54A 5ALEA 2O2IA 4DG9A 1JQ5A 4ECAA 3GUCA 4CGYA 2GERA 3R4VA 1YTLA 5EJ5A 4TGLA 1UK6A 1PEYA 1YGPA 2FSPA 4PF1A 1QUEA 4QECA 4RORA 5JLJA 4ZI5A 4NYJR 2PJUA 1GZVA 2ZJBA 5CK4A 2AJ8A 4I1YA 4Q1AA 3RH0A 1E5XA 3A37A 3EIFA 2NO4A 1ISPA 3T7SA 1QIGA 4YHHB 2JLWA 3I6YA 3LUCA 4PC3A 1I4WA 4CMAA 3WIUA 3KKMA 2BBSA 5KTMA 3FJ1A 4J4TA 4J0DA 2PUHA 1KJ9A 4K9KA 5K01A 4XEHA 4CMJA 3SU8A 3KVNA 5A62A 1B8UA 2VRBA 5BV0A 4Y9RA 4JKOA 4DMGA 1Z0DA 5KJ1A 3U4QB 1NXXA 5DWDA 1E18A 5EJGA 1PGOA 3QW4B 2AI2A 4Q6BA 2OMEA 1JR3D 4QAJA 3QIAA 1TU3A 1U4NA 4CE6A 1UEJA 2E48A 3GH1A 3IT1A 4BMVA 4C88A 1Q0QA 2AK3A 4W9NC 3KEGA 3K6SA 4WOPA 3R5JA 4W9RA 2E1RA 3HB1A 4IQ0A 2REQB 5BWLA 4OQZA 1M54A 4FGUA 4MV0A 1B93A 3HB9A 3D6HA 1HA3A 1Z34A 3T54A 4B48A 1EFVA 2YINC 4RXMA 2HA4A 4G4GA 1M2HA 3U39A 2ZUVA 3ZS8A 3LFTA 4EUNA 3BWBA 1S2OA 4OGKA 4PLWA 5JDIC 2Q8NA 4E70A 1LPPA 2HJRA 1R9MA 4RS4A 4OFXA 4DCCA 3BWVA 4ZO9A 4NHEA 3NBXX 2PEZA 3L43A 6REQA 4OQDA 2MU1A 3ZTYA 3S2GA 4HWSA 3RAPR 2WYUA 2B25A 3U7EB 3T12A 1K63A 4YMSA 4HB2A 4KVAA 2PSSA 2IOYA 1H94A 3K0EA 2C5GA 1XZDA 2IEIA 2DCMA 1U0GA 1ZCZA 3JPYA 3JSAA 3PPIA 3ADCA 5B7PA 3OE5A 4ABTA 5FUYA 2FMFA 2G5TA 4NONA 1GPAA 2ZEJA 4Q48A 2WWHA 2ZUWA 1BCRB 3TNFA 1N2XA 3EXIB 3OQHA 1M67A 1CF2O 2LR0A 4C22A 2V97A 4TV8F 1R6UA 2HK7A 1WSWA 5EP1A 4YUVA 1GUZA 2BKUA 4M8NE 2IV7A 1YC2A 2QY6A 4GRDA 3H2ZA 4OSOA 5FTNA 4EY4A 3B2EA 3IAS6 2AR9A 2CGEA 5CK5A 5U9CA 2PUDA 4AJIA 3KEQA 4QTTB 3UTCA 2W4MA 1UQUA 2W2NA 5EN4A 4JC4A 4NZMA 2D00A 3T1VA 2XYQA 1A98A 3DE3X 2FW8A 3NFYA 2BHLA 3QXGA 4FGSA 2IIVA 2NO5A 4HJXA 4RX1A 4RMIA 1YB6A 3NT5A 1UC5B 1YZYA 4Q9HA 1QYCA 3M1YA 4ZRDA 3IP9A 4CMIB 3GLHB 3K0HA 1ZL2A 3SFTA 3FA2A 3OU6A 1RKBA 2HF2A 3B9RA 1JYFA 2OGWA 3B5JA 3U49A 3DAYA 1A8UA 2EKQA 1ES9A 3TTYA 3KETA 3NG1A 5E7IA 5ALIA 2GHQA 4OVKA 1PJ3A 4CTJA 3GPCA 3FCXA 1W4RA 4EPVA 1P9RA 3UOAB 2PMWB 3LT0A 1XHLA 2YMQA 2ZVJA 1NBHA 3T7AA 1E79D 4JMPA 1RD4A 3ZY5A 2JLZA 1ZMTA 3RYCA 2QVCA 1OWMA 3E03A 3LLUA 3PKIA 1RP7A 2V7VA 2X5NA 2ZVDA 2PZGA 3MAJA 4KIWA 1N77A 1ULZA 4INOA 2Y1EA 3EQZA 1U94A 2ZXEA 4B3JA 2GR9A 1GGJA 1W5BA 2ZE6A 4G5XA 2IEYA 3BREA 4I55B 5CM8B 3PXGA 1FBTA 1ULTA 2X2EA 3Q3IA 4YJHB 1Z07A 4F1JA 3ORQA 1WL8A 2HQBA 2JZNA 1RLJA 1BVUA 3CTPA 4PYOA 4EUSA 5B57C 3L06A 2H85A 4K6GA 4KSBA 2Z08A 1GFWA 3CPHA 4DILA 2O3UA 1X70A 1VJCA 5FPTA 1HRKA 2JFBA 2X42A 3EEYA 4F12A 5G41A 2YRWA 5T4EA 3FVRA 4YUAA 2DB3A 1OXBB 3QI2A 2BOVA 2PT9A 1AHPA 1GZSA 3SBXA 4IIUA 3JQ8A 1XT6A 1NOIA 2WSIA 3ZIDA 4X85A 3TCKA 4LXYA 5REQA 2JLAA 1GDDA 4E2WA 5EZQA 1H9BA 1L7VC 5BOSA 3HRHA 5BN3B 3QPVA 3M1AA 3CBQA 1HT2E 4MP8A 4QU9A 5LNK1 2Q0HA 16PKA 1JJ7A 1U90A 2FPRA 2R8XA 3E9NA 3N05A 2HX1A 1FNMA 1QK4A 4RIEA 5EHQA 3WZLA 3AF2A 4TX1A 1I7DA 4ZOLA 4E5VA 1RQPA 3OZIA 2BP7A 2F3QA 1ISGA 2RJOA 1IY9A 4DSTA 1MO5A 4ZYWA 2I54A 1QAQA 1W36D 1AKEA 1FRZA 1K2VN 1T5HX 4BN0A 4DGSA 2H00A 3NKLA 3SMVA 4UZEA 2C3PA 4G9GA 5K4AA 1E5DA 1DQRA 2QAGA 4YLYA 3CEPB 4NBNA 4M1YA 2FWMX 2VATA 1NQTA 1JN0A 1U6IA 3GL9A 4JY7A 4UU0A 3GEDA 4RW0A 1JIJA 1Q1QA 3CONA 3ENNA 4YRRA 4BRZA 4J0JA 4MX8A 2YC2C 3PFNA 1TM7E 4ZXPA 2I6UA 4RVOA 4L5JA 1BJKA 2P1RA 1XA3A 4JJFA 1BCSB 4QHYA 3TI9A 1SCNE 3IDQA 3K16A 3OZTA 4FT2A 3V1MA 4DDMA 4UTRA 1N2CB 3ZIAD 4KZPA 4CKCA 3O82A 2VXOA 4J7CA 3DB2A 2NN3C 3O1IC 4MUYA 4A2CA 821PA 5KMGB 1BWQA 4TT8A 1XRQA 3PNBA 1KETA 5IVIA 5BXYA 2ZAOA 5T6BA 1MHTA 1HRDA 3ZHUA 1O96B 1OD6A 4MV5A 1KK3A 4E11A 4CLEA 4Q15A 1SHUX 4KDEA 1K9VF 4L27A 1WKVA 2DSTA 3A6DA 4IL5A 4CEIB 3GUVA 2YV4A 3JR3A 1V9SA 2NUAA 3S6JA 3PJRA 5B58C 1BFUA 2GZHA 4K1LA 2NYVA 2VSYA 1X0VA 2C2OA 2ACKA 3QWFA 1JG6A 5LUAA 2C07A 1HURA 1NYTA 4A0RA 5JRDS 2JFYA 3MERA 4ZU1X 1HF3A 3S2FA 3DHEA 1YDHA 3VPAA 2O2HA 3F5SA 4E3WA 1P1RA 4D4JA 4INPA 1FMJA 4FBGA 3KWFA 4FYMA 4I9UA 4UXHA 1UOOA 1ML3A 2O8EA 1SN7A 3OBIA 3VC3A 1G5QA 1XVIA 3DQZA 3EHEA 2V9PA 2VAVA 4BTLA 4YCSA 5A02A 5EJ7A 3CVXA 3IALA 2PXXA 1B15A 2CDBA 4CTNA 2H08A 2XWSA 1SC9A 1MR3F 3CZCA 4HGRA 2EFCB 1SHKA 2A7QA 3L84A 3ZDEA 5C51B 1EDDA 3O9ZA 2CFTA 3EQ7A 5FOSA 2ODAA 3OESA 2ZWPA 2ODPA 2AFIB 3MJVA 4LXHA 1DKOA 2XZPA 3TLKA 2RGGA 3EVCA 4WLVA 1TU4A 1DFIA 2QD4A 3OT1A 5CU7A 3BMNB 3GGCA 5G4LA 1K5DA 5H59A 2H18A 4YAOA 2XQIA 1U98A 1W34A 2Z9BA 5BSMA 3TLZA 4P54A 3UJ8A 3FI0A 4OFWA 2GCNA 1HNXB 4MUJA 4AYTA 5HJEA 4MQEA 1NY5A 1EG7A 1T2EA 3M5PA 1W5TA 1WRBA 1QLHA 5IWAB 3V4SA 3RSSA 4DBLE 3KB1A 3BJZA 2KWIA 2P65A 1HFJA 4F5DA 2GEKA 3S4YA 2IT1A 2ZWIA 3DLPX 4MA5A 3RS5A 3WDSA 2WP0A 2ROQA 3ROGA 3IILA 4YDRA 3O7MA 1DVRA 3SYNA 4DIOA 1SQSA 2PWBA 4E1VA 2I33A 3B38A 4F4JA 1E7YA 4OHFA 1ZCFA 4QFMA 2JA2A 3DLCA 3MHPA 2J0UA 3GMDA 4XLTA 3CUUA 4PONA 2MIIA 3W3ZB 4EZEA 3G2IA 3OZXA 5EL0A 2IKQA 4O4IF 4OHKA 1YRAA 1NASA 3HABA 1HYGA 4LWPA 5KNDA 1W8DA 1NG1A 5BRNA 3MCUA 2SCUB 3AETB 2O1XA 5FJIA 3BD6A 4EG8A 2BFEA 1C3XA 3JZMA 3DM5A 2A7XA 3AWIA 5KJEA 2FPPB 4HAIA 5I7SA 1FP7A 4TYNA 1A69A 4XPIA 1KYQA 1Z33A 2AMYA 4Y2SA 5AOCA 1A9SA 4FEGA 3SX4A 5EVJA 1Y1LA 3VV2A 3OJFA 3C3XA 3BMCA 4YCMA 1P7YA 3S8YA 2AZXA 2ORYA 3JZAA 4O4HF 4R3NA 1WQ1R 3NMUF 2IXBA 4Q4AA 4B85A 2QYSA 3CF4G 5JNUA 3K4QA 3BIOA 5IAOA 1VRVA 3OPYI 2CT8A 4MEBA 1KQOA 1E2IA 4E3ZA 4IZOA 5SY9A 1Z0AA 3AEUB 3IJ5A 1TKCA 3RI3A 4B2YA 4DG5A 5JJ5A 1SOAA 2NXWA 1TC2A 2PRZA 1OHHD 1HDIA 2JGAA 3BX1A 2F2TA 1N7IA 3FBTA 2I1WA 3PPXA 4UM7A 5IC5A 3SK0A 2Q0XA 4BZPA 4DXDA 4R8LA 4BWVA 3ROKA 3ZCTA 2YNMA 3PQ4A 4FEAA 3N2LA 5BW5A 2ZR8A 4URYR 2A14A 4LDAA 4RABA 2ZUDA 4RPGA 1CERA 1QO9A 2JAOA 3EXHC 2JIZA 3OMXA 4MRMA 3ZV6A 3JSXA 2W83A 2GNPA 3NTQA 1GPBA 3TNLA 4YRQA 5LP6A 1LD3A 3ZBTA 1P75A 3UJ9A 2GXUA 5HK9A 1QIMA 4BRUA 3L4BA 3EIXA 2E4UA 2DWCA 3LUBA 1TIBA 2IQ5A 3FHOA 2BE9A 4I5FA 3DYBA 3IMKA 4K9NA 1FU4A 3D8UA 5DI3A 1V39A 4OYHA 3H7AA 3ZKAA 2UXCB 1YS7A 1NLYA 5DGDA 5DYGA 1PWXA 1U9IC 3HMQA 3P5SA 4DV3B 2JLUA 2FFJA 3WGOA 1KPIA 1IZYA 2AA3A 2XECA 4D9IA 5M7EA 2HV8A 3ZLBA 3BWEA 3PGMA 5IX8A 1NVFA 5AKYA 4LF7B 4LGYA 3F5FA 1SK9A 2NM0A 3CURA 4MITA 1H0SA 1GZ4A 4F4IA 1JDBB 5CCEA 3CX4A 4BBPA 5KTYA 2Q0SA 1SQ5A 4DV5B 2IXDA 4LZLA 2W0SA 3ER6A 4AQYB 1WP4A 4FGKA 4XDHA 1LGYA 1Z47A 3KKOA 1CZLA 4CJXA 5AXAA 5C8VA 3CJQA 5AVVA 4EECA 1UXOA 2IYOA 3R2JA 4DDUA 1YDFA 2GN4A 1P2SA 4X92A 3GO4A 3VTAA 5EZYB 5HTKA 1D2CA 1GLVA 1JS1X 3K9GA 1M9NA 1PK9A 4NECA 2A9PA 3VYSB 3DW1X 3K30A 4DVJA 2XUAA 4BGVA 2XB2A 3NPAA 3Q9LA 2HSEA 1O97C 3GZNA 1AK1A 3ZQKA 3VI3B 4EGFA 1R0KA 4EQ6A 3FTPA 4JEIA 4XJSA 1W2GA 4B3XA 4FUQA 3KALA 4YH1A 2DFTA 1CNFA 3KE9A 1EDZA 3PC4A 3T5AA 2P9EA 5FULA 3H8VA 2ZUSA 5FO1A 1VYTA 5COQA 2NSDA 2YZ2A 3M6FA 3RJZA 4Q4JB 5TPWA 5DN6D 1EP2B 1IAQA 1DINA 2GPTA 5FBHA 4A27A 4OAOA 3PDIA 1PFQA 2I3AA 1HFWA 1E3EA 2IF2A 3E0QA 1KJ8A 3BGOS 3AERB 2PMKA 1XDBA 1G64A 2ZP1A 3DMPA 2HKIA 2C57A 2VDOB 3W8NA 2CLMB 4UVDA 3TSZA 2CLKB 2A92A 3EWNA 5BW4A 4LJ6A 3H2BA 5EXXA 4AMUA 4ZEMA 1FJGB 3KU1A 1JDVA 1U0HC 2W6JD 5M04A 5IRCD 1QWSA 1V6AA 4Q7EA 4CM7A 2DBQA 3CU5A 1VE6A 4RQAA 2QUIA 4HAZA 4OCZA 1RWVA 1M6WA 3LZDA 3BOSA 5HK8A 1XNGA 4ZGWA 1WOYA 4P2BA 1CYDA 1N6IA 1P60A 3OECA 4RLFA 2PMFA 2XRFA 3RYFA 3B7PA 3BJEA 4I1RA 1C14A 5CVVA 1LB1B 1Y3DE 4IH1A 5BP7A 1KH3A 2OK7A 2LDXA 1ZSNA 4F71A 2AUTA 2DM6A 4PZLA 3O75A 1HL3A 4OK3A 4G81A 1NQAO 4YIHA 1LCIA 4BCBA 1GG5A 1WB4A 3GBSA 1YOVA 1UF9A 1WF6A 2PYDA 3PXDA 5FWAA 1CJMA 2CHGA 2CL6X 2AEEA 1Y7HA 1GRRA 4KO1S 1DKQA 4IJKA 4RIFA 4MUIA 2QNRA 5FAKA 4UOQA 1Z22A 1E6LA 4W8GA 3ERCA 2HY7A 5GIOE 1JHVA 3T8YA 2P9FA 1HFEL 1JJBA 3EEIA 1RHMA 2CYCA 2DY1A 4BZQA 3KKZA 4WWHA 4EBBA 2XNSA 2ZBUA 4WW0A 3TPCA 3DHYA 2BD0A 4P7BA 4X93A 4QYIB 4CM8B 2OHJA 2Q1YA 4IV8A 3MJDA 3GFFA 1LK5A 4H0CA 4NJEA 5CFNA 3MWEA 4BO8A 1USKA 2PKQP 5HTOA 5DBIA 2N3ZA 3QG1A 1OJLA 3ZWVA 4CLDA 1J90A 3D2LA 1MAAA 2ZSJA 4G8DA 3K2EA 1RI5A 3A36A 2ZZKA 2QTVB 2G40A 3IBTA 3LKVA 4R1PA 3VH2A 1M1NA 3DBHA 1BD3A 3HUUA 3KOZA 1P19A 5BYBA 2WWYA 3FVVA 1KI1A 1NAIA 1RFGE 2NV0A 2OOSA 4CEJB 2WYWA 4AN1A 3C3AA 3ZJ5A 2WIGA 1O94C 3SFVA 4BV9A 4NCHA 5HXAA 2H1OA 1AQIA 2DSNA 4C0LA 3BB1A 4TPKA 3TX2A 4KO4S 1JV2B 4IOJA 2NPOA 1XFDA 4EAQA 2DHQA 3Q8MA 3ZKWA 1LRLA 5FIUA 2L19A 3T7KA 3G9ZA 1OR8A 3R4CA 5G3YA 3ZZMA 1IBLB 2VHYA 4EG1A 3THWB 3SBEA 4YMLA 4RKYA 1NFQA 3WGNA 2HRDA 3ZWYA 3TDNA 5CXUA 3CO0S 1PZGA 4OJTA 2FETA 2Y1OA 3F46A 3ZH2A 2B8NA 1IXKA 3NO4A 4MRPA 3FSJX 3UMVA 1J42A 2DTXA 5G3ZA 1UKAA 1MEEA 3GNSA 3OX1A 2R8RA 1R6TA 2FG5A 1PK8A 2NQ2C 3NIGB 3DCYA 4G07A 4KPGA 5CT9A 5E8RA 4AZWA 4BUJA 3CR8A 2HXYA 4OJYA 2VNKA 1UBEA 4Y7CA 3E84A 4C7MA 5JCJA 1OYOA 3PWSA 4M22A 4YO8A 2FTKE 3ZDZB 3UMJA 1CY1A 5BR7A 1FY2A 3SCZA 3RIXA 3VR5D 2B3DA 1NHGA 3C41J 2JAXA 2AK2A 2MSKA 4KB5A 2R11A 1Z8FA 4J1SA 1LPOA 2G80A 5F7OA 4AKHA 2GEDA 3GNTA 4RZ3A 5IKEA 1O8CA 1VKRA 3NDRA 4DUGA 4MP3A 3AY7A 3DGFC 1XV5A 2BFCB 3CLRD 1N6KA 3HDHA 3I76A 3TXXA 1IQUA 5ESDA 1GGEA 2C5HA 4IUYA 5EJ6A 4ALIA 3DOIA 2TSYB 1PE0A 2DVMA 1K6EA 3C5VA 4MCAA 4PG6A 2CZQA 4GF5A 1ZCAA 3BH0A 1Q0ZA 2AHOA 2H2HA 2ZRDA 1XRPA 2GRAA 4R9RA 3ZBQA 2DR2A 4H7PA 3LLCA 4WVLA 3DC2A 4YHBA 3ZHSA 8AT1A 2ILTA 1G7CA 1TUIA 4YI3A 1MO4A 2FFAA 2PBRA 2R2GA 1KFCB 1OWOA 2XAUA 3BTUA 4U00A 4X1YA 2OP0A 4KUGA 5F35A 3BE5A 1MENA 2NZ8A 1AM4D 5EJAA 3VO2A 1CUEA 1G3UA 4G6ZA 1B73A 2WIBA 3NRJA 4XM1A 1PVOA 1TLTA 4Y6PA 3OCVA 2V6FA 4HZUB 3HM9A 2BMWA 4PQGA 4PNHA 3KZOA 2ZSKA 4ZOEA 5BV7A 4BY9E 3HJRA 1JSZA 2P7IA 4MZXA 1XG5A 3QHQA 2PVPA 1SXJA 3JXEA 4P22A 4TN5A 2XTAA 1OSNA 5HFJA 1OQAA 2JGNA 4ZMRA 4LF9B 1ZM7A 1DIRA 1MC4A 5IDVA 4J1NA 5BN5B 4F04A 5EWLA 4P1ZA 1M2VA 5G0TA 4FWIB 3DM9B 3H04A 4H60A 1FVFA 1OIXA 1JEJA 3BWDD 3P5BA 5DASA 2UZ1B 1T4GA 2X0KA 1N8NA 2Q6TA 2FMUA 3BK2A 4U2FA 4IIHA 2EKZA 2VSQA 3IS3A 4G1BA 4X24A 4QVKA 1UC8A 5KIAA 3AFHA 1EB8A 1FSPA 3JWIA 4CL8A 4BX3A 3VQTA 5JFOA 2XDWA 1E1NA 1L4FA 3GCGA 3GJ5A 1QJCA 3OCCA 4RA6B 3NTLA 4BFVA 2IYZA 3CS3A 1AD2A 4BMSA 5T64A 1TT7A 3KOMA 3JZFA 4HFNA 1OKKA 4RXUA 4DC0A 3PL1A 1D2RA 5AW9A 3V5NA 3NHLA 3WWEA 4YV0A 1F2TA 3CNLA 3O2SB 1IN8A 3FH0A 5TRTA 5KDDA 1RPJA 1U2ZA 2XWBF 4JR0A 4R81A 4ZZ2A 3EVNA 1EGQA 2VPYA 1RE1A 4ZT2A 4TLEA 3W9UA 3I1FA 1FFGA 4AJOA 3C3MA 2WMNB 3E8MA 5SY6A 1ODCA 5J2TF 4Y18A 3S68A 3VBEA 1PNVA 3H84A 1BIFA 1C4OA 1HORA 1SUEA 5GAJA 1OB5A 4U7TB 2CHFA 2GVZC 2OZVA 1VI2A 2VJAA 3I9V6 4F1WA 1T13A 1VSQA 5DNCA 3HQ4O 1ZKMA 2DFNA 1ZGJA 1P9LA 2OHVA 1RDFA 2V9CA 2W2PA 4Q4DA 3ET5A 2I2CA 4KWEA 4G5GA 4RH3A 5DSTA 3V7UA 1YJCA 3GPIA 3WFJA 2IHJA 3AK4A 3GYGA 5ARCA 3TE6A 4DLKA 4PAQA 4CIVA 1KI6B 1K7YA 3ZVMA 4L57A 1JR3A 3KUDA 4ZVMA 2XZLA 1RHUA 4FMCF 4ZQBA 3EDMA 4V0RA 4DQ0A 4R2WA 3FPEA 1J9EA 2VYVA 4QOGA 5CFLA 5JTTA 4HBGA 4AAYA 1Q6ZA 2BM9A 3JWEA 5F7JA 3CSSA 3R20A 1YZFA 1PR2A 4D6YA 1DIHA 1EDEA 1GAJA 4MIYA 3C8HA 4KYTA 3KDPA 2Y71A 3I3SR 3VYWA 3RU2A 4RV9A 4EJSC 3UKJA 1N3YA 4LGMA 4LFBB 4NFSA 2QW8A 4NAHA 3FDZB 2JHGA 1C50A 5SYNA 5B1IA 3BDIA 1EXVA 4NCKA 2ZIEA 3RNLA 3VKVA 2R68A 1HH4A 4RYLA 2WZQA 1F48A 1Z6PA 4GS5A 3CLUD 3QVWA 3RUAA 2XUDA 3HBNA 3MWFA 3AVWA 3Q7EA 4DIFA 2YDXA 4H2DA 4ZQCB 1ACJA 2COKA 2NTVA 4JP3A 4NPCA 4CM9D 5B37A 5I9LA 4V0NA 3CLSD 3L7AA 2AF4C 5DTJA 2C29D 2HRCA 3B1FA 3DAGA 4GOOD 3T5PA 2ZWMA 1HY3A 1ZYUA 2VHVA 2VP6A 3I1JA 1FP4B 4LC1A 3F5DA 2QAJA 1PNRA 2UUCB 2CXRA 2PUWA 3LVRE 2BRUA 1CXZA 4FCCA 1DBSA 1V5IA 1UJ2A 3NKVA 2QGZA 4BMNA 1W88A 5A03A 2ZT7A 4L4UA 1IZ0A 4Q9IA 3EXFA 4MGZR 3GLFA 4DIBA 2MINB 3L18A 4OA8A 1BA2A 1BZYA 2JBAA 3F5QA 4CDGA 3MCVA 3IFSA 5A1JA 2RMKA 4NL4H 2M6RA 4ZZIA 3T95A 4A26A 1GWNA 1FZTA 1B4DA 4DDTA 3USES 1UDXA 5I5EA 1CLEA 4JGIA 3S1SA 3NI2A 5K6TA 1TFUA 2X15A 5LSAA 4UU8A 1V71A 1T5SA 4EYSA 3PCTA 4QPNA 5K5EA 2R1ZA 1RAEA 1V25A 1WD7A 1COZA 2CV1A 3MN1A 3DPIA 4BNDB 4OKNA 2GCPA 2LE0A 1TKRA 1Z3IX 3AR5A 3A4IA 4YEDA 1IZ7A 2JIMA 3ZK8A 1E79A 1S9HA 1YVEI 1ONSA 2B8EA 2QTLA 4TKVA 2HOQA 1RM3A 3IIMA 1DC7A 4DREA 1WCIB 1LZKA 2C2XA 4DCUA 2G5CA 4GM1A 4P53A 2P5SA 4RPKA 2ERXA 1Q12A 2QNIA 2IWHA 3SC2B 2X7HA 4C30A 3VNQA 4DARA 2Q9CA 2IV2X 1ZNWA 3S28A 4IJVA 3WLPA 4LRSB 2BUBA 5AI5A 3TLGB 3OPQA 3S29A 4JV5B 4RANA 2HPVA 1KQGA 1RWMA 3V00A 3TFOA 1W93A 1L3BA 2WAXA 2QR5A 3I72A 5JYDA 1Y4DE 4RKQA 1KZHA 4BRWA 1DJNA 5EYPB 1OX6A 1SO8A 2GETA 4AN4A 1BH6A 3K70C 1F14A 2XDYA 1FSFA 1VMEA 4N82A 4NOLA 1A8QA 1E3WB 1VIDA 1E2MA 4HQ6A 4KVZA 1E58A 1PYDA 3V6MA 3EGVA 1BEUB 4QQ8A 3MUEA 4EHAA 2JLSA 4ZO7A 5C7YA 1VYHA 5I8WA 2OM6A 5AICA 5DHAA 3DBLA 1YKGA 5A4AA 3D7RA 3HKBB 4GVLA 5HCUA 2P5TB 2R6CA 1Z5UA 3QA9A 5LQDA 1XPRA 1A7AA 4WJZA 5EP2A 2GBPA 4DZZA 3PNMA 5PNTA 3CLKA 1M2WA 1YAHA 2YIVX 2IHVA 2QN1A 3HCEA 1W85B 3M8KA 3P19A 4FYKA 4LHSA 1HC7A 2RI6A 5F1YA 3ROFA 4JXZA 1PWZA 3EXEA 3VBCA 5CB8A 5LPNA 1Y1RA 2JFVA 3IH5A 3ORRA 3FRHA 3WL8A 2C9MA 4PO3X 4BKOA 1KZGB 1XJ5A 2Y2UA 2JD1A 5THQA 3IV6A 2C00A 1IEWA 5LZ8A 2IU0A 1T3TA 3X1DA 3IAFA 4C6RA 3HYSA 1O1YA 2JCBA 5CMLA 5FPQA 2ZS9A 3FYUA 1ZZEA 4B3FX 5ISMA 5HQTA 1FJ2A 5FI1B 1NL3A 3CTMA 2C2GA 4PG5A 1I3MA 4CKEA 1V43A 4PAOA 5FWDA 2ONJA 3ZQ4A 4CI0B 3K96A 4IGKA 4QRDA 4HN4B 4R2IA 3UC9A 3T4XA 5JY1A 2JAHA 4JLOA 5D3KA 2EZ8A 3E9RA 2XIJA 4KQ9A 4MTLA 1RKVA 4B82A 4CR8A 4DRZA 1WOMA 2H7VA 2B4TO 1IJEA 3CKYA 3R3JA 3NTOA 4FYVA 1ZRHA 4N39A 3SZLA 3L0OA 4CKXA 3G49A 2QPTA 1ECBA 2ASVA 1I1QB 3NWPA 3A6KA 1M1YE 3G5MA 4KKXB 4AZ0B 3EMDA 4AF6A 4ISBA 1GEGA 2PX8A 1P62B 4NKRA 4O29A 2D6FA 5IS2A 4BPBA 2IUUA 4BVEA 3KYJB 4QBHA 2GCOA 2RI1A 4NULA 1DE0A 4P93A 4BEBA 1QHYA 4KBGA 1VJ5A 3DFIA 4M9ZA 3HWSA 5FBZA 3TSWA 5KPDA 1CS0A 1UAAA 5ETJA 1MFZA 3EUWA 1F60A 1Q0RA 3I32A 4IHJA 4BNUA 5D3MB 1TQHA 3AP3A 3JQFA 4HQ0A 4ZHQA 4EFKA 2BH9A 4MVJA 3MVEA 1TMYA 3LUHA 2N9UA 3I0ZA 4MGYR 3GRFA 4EG0A 4IIJF 1BMFA 3O2JA 2R6ZA 4WN9A 2IXFA 3U16A 2H1VA 3I8OA 1IG3A 2HN9A 3R3SA 6NULA 3PR2B 3ZHBA 1JBQA 3K6SB 2Z57A 5ALKA 3IESA 1I3CA 4MI3A 4XQEA 5K03A 1F6BA 3AJAA 1IATA 4V0SA 5TE9A 1I7LA 1NTRA 1EBFA 1QHIA 3HV0A 4P84A 1D4FA 1T9BA 1EFVB 2WYHA 4D5GA 2QLLA 3OIVA 2ZTVA 4PX9A 4ER7A 5CA0B 5D6NA 2AJDA 1EK1A 1QE3A 3B78A 2LGJA 3FWKA 3VM6A 2ANBA 3VPHA 1EVKA 4ENPA 2G9RA 3KHKA 3B5EA 4N5MA 5ALTA 4TMWA 5K99A 4HQNA 2Q2QA 2ID7A 2WPDD 1Y5NA 2XUJA 1VA4A 4FOSA 2OA0A 3G6WA 2VK2A 3WIOA 4MH0R 4B0OA 1LS1A 1P2FA 2WG2A 6REQB 5JECA 5FXMA 1ZNXA 2JIOA 5BSVA 2BKLA 1QFSA 3DBIA 1JWAB 1XX6A 3F6CA 3I2HA 3OLYA 4MB6A 4WL0A 2WJPA 2X0IA 1E8MA 1Z5NA 4GVXA 4OA5A 1TKBA 3B1VA 4B33A 5KTTA 4NCBA 4AKIA 5HOEA 2VF5X 1DQSA 3AV3A 5JJBA 2O4CA 1TEXA 2HBQA 1AHHA 4BNYA 3IA7A 1BQ4A 5D1HA 2VWPA 4YP0A 3FWNA 3RUCA 1JLLB 1F4VA 3WWYA 1U7OA 4N48A 4HG2A 2QZJA 3N3BC 4W63A 4P33A 4WI1A 3ZXXA 3BRCA 4XM0A 5B1HA 5K3CA 5JY6A 4JLJA 1UPXA 1M3SA 3N7TA 3CT4A 1N36B 2XRMA 4J3FA 2HC9A 3LPNA 2PO5A 2XDQB 1H8HD 1PIWA 3UMMA 3TK1A 4I6GA 2I3DA 3UC5A 4BFXA 1V7CA 4P34A 4E03A 1V5FA 1VHLA 3HY4A 5IG2A 2O0MA 1Q3KA 5ESWA 4FE3A 4GE0A 5FUMA 4LVNA 4JI7B 2XLCA 4YRKA 1M5TA 1EFCA 4Y6QA 1KJIA 4N41A 1LBSA 1KGSA 1NJ2A 2UYCA 1P4AA 3QE0A 1ML4A 3CT6A 1D2GA 3L9XA 5AJZA 3AR4A 1YJ8A 1CP2A 4OHPA 5DM60 4NDNE 4X54A 4CU2A 3FGNA 4LS3A 3PDHA 5MGNA 1LDEA 1FNBA 2AI1A 3A9RA 3BA6A 3HSYA 3W5HA 2PGOA 3QFFA 4P81A 4OI0A 1NN0A 4LKRA 3ZDRA 3TBKA 3KR1A 2HLNA 4PZPA 4A92A 4LNHA 1KYIA 1YNSA 4L0MA 3PEYA 5KOHB 1OGJA 4LVOA 2WKPA 3DD1A 4HUTA 5ER6A 2WE7A 4GSYA 4CT4B 4PXAA 2NG1A 4Z49A 2X9GA 2QRMA 4I4IA 3HCDA 4JOCA 5D5HA 4Z0NA 2QA5A 4R3UC 3TNDA 2FEWB 3QJYA 5E0OA 1EJ6A 4HX5A 1AKVA 3TW4A 1PR5A 1O57A 3NS7A 4O6VA 4LGVA 4WOBA 5DGHA 2B4YA 5EKUA 5H3CA 3SJCA 1W96A 3FZYA 4I5DA 4RMGA 1PZHA 5T4FA 1H0KA 1EVIA 4GGOA 4PZAA 3MIZA 4K2HA 3V4LA 3K9FC 3GBVA 2WM3A 2QY9A 4Q9LA 2ZI5A 1WLSA 3JQ6A 3JQ8B 2L0XA 1U5CA 4C0SA 5REQB 1LWOA 1QFMA 2LKDA 3FTDA 4DJTA 4JH0A 5C5DA 5FUQA 5JBQA 1WB5A 4EEKA 1NC3A 3N5KA 4LX8A 1SKYB 1T6YA 2P1ZA 4WD3A 2RGWA 2VP3A 2OD2A 1ULUA 3HLYA 3K5PA 4O2BA 2BY4A 1G19A 2JJ2D 4TMKA 4JLMA 3STTA 4NBVA 1JSCA 1P1FA 2GEVA 3OIFA 4ZYTA 5LD2C 3HN6A 2WYVA 3PXAA 3RYIB 3GLKA 4JUCA 4ZT7A 1PF7E 2VUTA 1NVVR 5LJLA 1B8PA 3FTFA 4W7HA 2G4CA 4MRSA 3IHLA 4U2EA 5E2AA 1S0UA 4V03A 3LXUX 1OXMA 1OBHA 5H4HA 5AW5A 4EHDA 3QK7A 3HP1A 1XRSB 3BGDA 3X1KA 1TVMA 3I62A 5IYZA 1IUOA 3EF1A 1GN9A 3ICWA 1KTIA 4JCCA 5HQJA 5IVKA 5JS1A 3S3TA 1SB9A 1NULA 1T5BA 3O26A 4MWDA 3S40A 5CG2A 1GTL1 3INNA 1HQYE 2XMGA 3EBPA 4P98A 1EIWA 1MJFA 2YJ4A 4QDXA 3PGLA 1NI4B 2FR1A 3TZHA 4O2LA 5T41A 2J6CA 1QBGA 1LZLA 4BZWA 1KIAA 4U2DA 3K2QA 1KQFA 3I2FA 1R5OA 1VG8A 2GO7A 3IQXA 4LIPD 3SKXA 2IY8A 3PK0A 4CKCB 4GQBA 4YRFA 2FOLA 4HWOA 3KTFA 5I9BA 3BJMA 1OU0A 3I6QA 2FSIA 2NU7B 5J63A 1Z25A 2Z95A 3ESRA 5BV8A 3ECCA 3SZUA 1AMOA 1X86B 3SE7A 3UHFA 3Q3EA 2ZIXB 5LQAA 1SVMA 3KEOA 4K6KA 2G9VA 2CWWA 3GRCA 4GP9A 5AKZA 5JSUA 5KNBH 2FSHA 3SWWA 4TZ0A 1JMVA 3D59A 5JD5A 2QX9A 4ZCIA 4ABYA 2CXHA 1LH0A 3JQGA 4LQLA 2NUAB 4GFDA 3ZVLA 3GRUA 1IN6A 4BP3A 4PLHA 3AKYA 3JALA 4INJA 5ILGA 4RH1A 2L2QA 3RAGA 3SP1A 1JH9A 2QAGC 5L7TA 2AUNA 2YUTA 4LWOA 4OXXA 4YYEA 4CMBA 1FX0A 2V8OA 3R23A 1APBA 2A58A 3BSWA 1GR1A 3OTHA 4F84A 2OSVA 2WVHA 1ZITA 5K09A 1F4LA 3AW8A 4IGIA 9ATCA 3CR3C 2I4RA 3TE7A 2XCRB 2O8EB 3NAMA 1NLFA 2Q28A 4Q9AA 3GF4A 3G5UA 5EKDA 5J1SB 2Q49A 3PCXA 3WQQA 4Q24A 1O2DA 3W3AD 3EFOB 2F1HA 3M89A 3OLCX 4TM8A 1W1UA 5JZVA 3THXB 1ZR2A 1E69A 1VL1A 2XLBA 1IL0A 1DBWA 2GJ9A 3P9XA 4M46A 2PZKA 5BVGB 4YN3A 3R24A 3KL4A 2CF6A 5GVRA 2J9GA 3MSXA 3EQ9A 3AM5A 2C99A 4L9RA 5BRJA 1EGVB 1E92A 2HF8A 2I6XA 1Z7WA 3NNDA 3OT1B 4N8DA 4MO9A 1UAYA 1IHUA 3GZ4A 4JQYA 2XKAA 3SF8A 1B6SA 1SHLA 4MW7A 1PUIA 4OXQA 4PCLA 1J9ZA 1TO6A 1XCOA 2G9QA 4UHJA 2FMHA 2GCGA 4F5EA 2Z6QA 1R0BA 4MQEB 3KFLA 1YSCA 3ZNQA 1GTG1 1XL0A 5CVEA 3VO8A 2TYSB 1OILA 2O23A 2VJDA 3CZAA 4E94A 2YWHA 1KFEB 3NOXA 2YXBA 3M6VA 1L6IA 1ZMOA 1CIPA 4QLBA 1YTUA 5FWXA 4EY6A 2O0KA 1VE9A 1Z29A 3I8XA 1M34A 1C7IA 3J7TA 5LZ2A 1UDRA 4X1OA 2RKBA 2UVQA 4L7QA 2LDBA 3R44A 3FTQA 2O3TA 2VOJA 1YD7A 4LNUA 4IIBA 4N0PA 3RTEA 3VZSA 5B1DA 2AKEA 5AKXA 4MLPA 1U2SA 4GR9A 1W7AA 2J0UB 2FZLA 3ABIA 3CX8A 3DL0A 1R4NA 3FR7A 4BEVA 4HPWA 3HI4A 2PUVA 4YACA 4YAIA 1EE2A 3VHXB 5F9MA 2UVPB 5CFMA 2O06A 1FZQA 4Z4IA 1Q3TA 4LXTA 1ZNYA 3SIWA 4W99A 5GGYA 1HE3A 1UFOA 2XXJA 4ZAZA 2YZMA 3WTBA 1NU8A 2FN8A 2BPOA 2ZT8A 4GC5A 3UQYS 4AZ3A 1J5EB 2R7AA 1PSDA 4HFJA 1UMDA 2HJWA 4WNYA 1TMOA 3ZVRA 4JS0A 4BX0A 4DRXB 2NVBA 5E3HA 5DX1A 2J9XB 1F17A 2DLDA 1T8SA 2MWMA 3A10A 1C8KA 1EFRD 2FF7A 1V3UA 2JFPA 3BMCB 3H1BA 1SUWA 1VPDA 5FBKA 2XPCA 4F4HA 3BIWA 2B6NA 2HMWA 4I4CA 3EHDA 1QE0A 1IBRA 4Q4AB 3T7TA 5B7QA 5ITWA 5JROA 1JG3A 4LE2A 1DI0A 1XGKA 2M6SA 2H5EA 5TVKA 4EAAA 2HF7A 3D6NB 4WBNA 4Q3NA 4GP6A 1OOEA 1EHYA 2CLCX 1LV8A 2VCHA 3JQ9A 2IWRA 2NYUA 1IIBA 4GECA 4R2XA 4D46A 1H2RS 5CYOA 4EG5A 2X23A 3KKNA 3HV2A 4M99A 4MPTA 2VT3A 2PXCA 4YMHA 4YROA 4E2ZA 1ZRNA 2JCSA 3N0RA 3WL3A 1DWPA 2VSOA 3E5NA 2QG9A 1J2TA 2HU5A 3AG6A 4N4AA 3AIKA 4GLOA 1NBEA 4E6PA 5BNWA 5B1EA 1HDZA 2NTNA 3FOEC 2H1CA 3MJ4A 1F2DA 1R64A 1UAGA 4LRTB 3N6VA 4FHGA 4EFLA 3ML1A 5I8PA 4GQAA 3TGPA 2XTNA 4CV3A 2FQQA 1G20E 2QF7A 3HXQA 1L9XA 3WYAA 3SQOA 2XIQA 3A4LA 2GXQA 5DNAA 3T1YB 1B00A 4LCEA 3KX2A 3N5CA 1GKUB 1A95A 2JPDA 2R7MA 1RRMA 1X15A 3TLAA 5DI3B 1TPYA 5BW8A 5IAAA 4V3CA 2G72A 5GQSA 2JHPA 4UHKA 4XVRA 1HDOA 1CBUA 1DZIA 1RIIA 221PA 3O90A 2IHYA 1PEAA 3V1YA 5LUBA 2DHDA 3VUFA 4AJKA 2HRRA 5HBGA 5PGMA 2I4OA 1N6OA 3ABSB 1ZGBA 5GONA 3K0CC 2HQSA 3CG0A 1KTVA 1W4BA 3RGGA 5FEUA 3AVQA 3BL5A 4JLNA 4JLBA 2Q9BA 3KM0A 4AQ7A 4XW2A 3WISA 3FMFA 1GSOA 1JIQA 1HV8A 2AV6A 1TA9A 1ZNQO 3KBBA 1V3TA 2XCSB 2YNMC 4QUGA 4C2TA 2R6GA 4U02A 2RGNA 2V8BA 3RVBA 4RH0A 4IW3B 3VRHA 3U1TA 1XTSA 1IM8A 2GJSA 1N1DA 1X7GA 1RSZA 1Q50A 3QKIA 2GZ2A 4CVNA 1A4RA 4Q93A 1GV1A 3NAZA 3NYWA 3S2IA 3GZNB 3L4BC 3NIBA 3NVAA 4YXFA 1OY1A 5K3AA 5BSRA 5I7UA 4XUEA 1KJZA 2PA0A 1E9DA 3N2ZB 5EUBA 1GGFA 5BSUA 4XUCA 1ETUA 1WVGA 2GKOA 1HK7A 5TPWB 2ECKA 1R6DA 3OTWA 3TUJC 5U4QA 3MTBA 2CFRA 4RM3A 1KAMA 1WUYA 2G70A 3AEZA 4KXVA 3MBIA 3IJPA 1DO0A 1FTGA 1QH8B 3DW3X 1XTZA 4IUBS 3OLWA 3BFPA 5D5QA 4G01B 1VG1A 3BWYA 2AWOA 1ESDA 2WJHA 5CDUA 4M8SA 4TWIA 1FOEB 1DAKA 1ZMRA 1SCIA 1N9KA 4V1CI 1V5EA 3FPGA 4YP6A 5ARDA 3FCYA 3LQKA 4OLBA 4D25A 1T8PA 1JKXA 5CDFA 4CYMA 1SCQA 3C5WP 5HFAA 3MWJA 1IJKA 5I7FA 4CRWB 1P1JA 1KXJA 1QFZA 3O94A 5A71A 3HJFA 3GJYA 1H2AS 3BFJA 1EGMB 3A31A 2H9AA 1O95D 4QVIA 4RTRA 2QRLA 4TKLA 3CWCA 4DSZA 2YZNA 1K7CA 2P8SA 1FLNA 2XCLA 3MYRA 4HFRA 1F1BA 2PS0A 4IQ4A 4P3OA 3TLJA 3GMSA 3L7YA 1WZUA 2R2AA 3B1ZA 2BCEA 2FX2A 3O4HA 5MN6A 5TY0A 1JVSA 2L82A 3DE6X 2C95A 1D3AA 1YCDA 2E21A 4R4JA 3T3IA 1N5DA 1QRDA 3KYCA 3LD9A 2NLOA 4K87A 3PC3A 2FWAA 4R83A 4YRTA 4RTJA 1DELA 3R9XB 3NBQA 4MQ4A 1PW7A 4K3UA 3I01M 1RWWA 2YWBA 2AEJA 5UKDA 4B45A 5GJVC 2IW3A 3JYPA 3C6ZA 3DBOB 4G97A 4QHSA 1WQ3A 3GGDA 5B3JA 2XKKA 3PQ5A 1B8OA 5EQTA 4WFJA 1MQ8B 4R9VA 3W2FA 4DQLA 3IUBA 1SBTA 3LZ6A 5ESXA 5IBRA 3O8QA 1UJNA 1VIVA 3HVHA 1L0BA 2WVAA 3QITA 3FUUA 1PLLA 4R8SA 4XFKA 3SYKA 2WJJA 4B74A 1ITZA 2G0NA 4BO4A 4COOA 1IM2A 1TRKA 2O2ZA 4TYWA 3EA5A 1G5PA 1G63A 4UHFA 1AB6A 2C98A 3KOYA 4IO0A 3Q4GA 4KV9A 3DEHA 3NIFB 1AQ6A 4LY0A 4D4IA 1KZ1A 3IUYA 5CX1B 3DBHB 1QAMA 4RD3A 1UEXC 2HM7A 3FWHA 4B4DA 1P0PA 1IDOA 1KP2A 2W2KA 2AFHE 5EFZA 1Z45A 5K6AC 4S1NA 2WZDA 3TDMA 3PHCA 2HIAA 3USCS 2EKPA 2AEFA 4CM9A 1BAPA 2Z2KA 3KD3A 4OQMA 4Y98A 4UOZA 4BNXA 4KYIB 4N40A 1TT5A 2WAMA 3DFKA 4HEHA 3HRIA 4ND1A 5CCDA 3HZZA 3HDGA 5C8YA 4YY3B 2JH3A 3A6EA 2W00A 1JIXA 3ZKWB 3AUJB 4KQGA 3F8TA 5H9VA 3WLHA 1NSTA 4FFPA 4J75A 4YJ2B 4J0KA 4EG3A 5CA1F 2OENG 3U5TA 1OGIA 1W75A 5DT9A 1EUDA 3V4FA 5HNKA 2J0SA 3NHFA 4YCJA 4AD8A 1GYQA 1XZBA 1YB5A 1GKKA 3HYCA 5KO2A 4WOKA 2PS3A 3U44A 5FWYA 3HKDA 4PBRA 2Y99A 3W8RA 2GD2A 3LT4A 2FA9A 2E2WA 1QNFA 2IJGX 1N4DA 1Y8ZA 2Z04A 1YDGA 3NM4A 2QOEA 5I4KA 3FLAA 4IVNA 4DGQA 4BJ5A 1LJLA 2XQGA 4TXLA 5CW1A 4RWEA 5I9TA 2J0QA 1L8LA 1UJMA 2NZUG 2YWJA 3IVGA 3LCRA 2GBFA 2OFPA 3CNOA 3O8LA 3QVMA 4UJ5A 1QH9A 2CXNA 4FYHA 5E3IA 3UWKA 3ZX4A 4ZDKA 5JD6A 4P5EA 3O5AA 2VHWA 2HU8A 4NI5A 5TNXA 1A04A 1CRWG 1NOJA 5JZSA 3P0FA 4MWOA 1K88A 4XVQA 4YCBA 4J29A 1T2AA 5LQSA 3VO9A 1R5NA 3ZJVA 4IZIA 1DAOA 5C3MA 3AX6A 3CUYA 4QJ4A 3CEJA 2AF3C 4H4DA 1JWBB 3KAKA 2CJXA 2C7BA 2WSBA 5A6VA 5I7RA 2EFYA 3OOSA 4LSZA 2C3UA 2GJ8A 2AZMA 3C4JA 1Y5IA 4LJAA 1NSFA 1NRJB 4HDCA 2VUUA 3DQPA 4RAQA 4UHEA 5JPIA 3AUTA 3OJXA 2PMCA 5FV4A 4OYLA 5JQWA 4I1OA 2Z9CA 4K28A 1SVSA 4X1YB 5JZOA 1XZQA 3VC1A 2X40A 5L7YA 3RS9A 1G9TA 1XZIA 2IVFA 3KJHA 1FQWA 2SKCA 3T5MA 5JSZA 3HJTA 1KK1A 2CCKA 1X1RA 1A9RA 3UJHA 4PRZA 4RESA 3ZPXA 3LK6A 2Q1WA 1B6RA 2QQFA 1QH0A 1V4BA 2QN3A 1PHPA 3CLTC 1E2BA 2DCUA 1ZFNA 4B6EA 3OOHA 4GQIA 1SXJB 2XQJA 2QRVA 3B6EA 1KFKB 1LXCA 1I2ZA 3MTAA 2RARA 1JLKA 4XEUA 8ATCA 1MV5A 1UZNA 3WQSB 1GGVA 1M2VB 2PLWA 3GCXA 4WNAA 2IHNA 2BWJA 4PLGA 5KDLA 1VGQA 4B5KA 2EHJA 1RPAA 3E9YA 2B7LA 4V0ME 1Q91A 1MVLA 1GQ2A 3E8SA 1DU4A 2FW7A 2OGUA 3UJNA 2PYIA 4ZZ3A 1X1EA 1L2TA 2V0NA 4F3KA 5T8KA 1PP4A 4ON9A 3TPFA 4UTVA 3EQ8A 4KUHA 1EK0A 1DTEA 4FMDB 3WVNA 1MGOA 2GK3A 3QE3A 1KSGA 5I7HA 4A8JA 5JDCA 1CZKA 1GCIA 2ETVA 3VPBA 3P9PA 1BX1A 4F6RA 3JQCA 4OOFA 5H3HA 4W5RA 1RKUA 7MHTA 1OAOC 2B61A 1EVLA 2JVJA 4QPZA 5K0SA 4LYEA 3G0HA 3FPHA 3WIBA 1E61A 1R37A 3TEJA 1NQVA 4J0HA 3ZWWA 4UXIA 3VDXA 5I3ZA 2E87A 2D2IA 3BJIC 1F2TB 4AJEA 2VIIA 1JA1A 2Q3DA 1VSBA 2VRCA 4REMA 1HE1C 2YOHA 1NNI1 2R97A 3QSGA 5AW4A 4WNIA 2QORA 2JJMA 2XXAB 2NAFA 2P1DA 5CLQA 3WWDA 2XWJI 4C7BA 4R8KA 1DEOA 2VJPA 4GNRA 3KQUA 3EPLA 1DHTA 4G9EA 2GBCA 3VC7A 4DM3A 1L1RA 3M1LA 1TTTA 4PYNA 3CUKA 4JITA 3IDAA 3F3SA 3B6IA 4XX1A 1L9KA