3HXPA

Crystal structure of the fhud fold-family bsu3320, a periplasmic binding protein component of a fep/fec-like ferrichrome abc transporter from bacillus subtilis. northeast structural genomics consortium target sr577
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
272
structure length
272
Chain Sequence
YKAENGNVKIPKHPKRVVVMADGYYGYFKTLGINVVGAPENVFKNPYYKGKTNGVENIGDGTSVEKVIDLNPDLIIVWTTQGADIKKLEKIAPTVAVKYDKLDNIEQLKEFAKMTGTEDKAEKWLAKWDKKVAAAKTKIKKAVGDKTISIMQTNGKDIYVFGKDFGRGGSIIYKDLGLQATKLTKEKAIDQGPGYTSISLEKLPDFAGDYIFAGPWQSGGDDGGVFESSIWKNLNAVKNGHVYKMDPIGFYFTDPISLEGQLEFITESLTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target SR577
rcsb
source organism Bacillus subtilis
molecule tags Transport protein
molecule keywords Iron(3+)-hydroxamate-binding protein fhuD
total genus 56
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2009-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hxpA02
1N2CA 1KARA 4MO9A 1FP4B 3AETA 2PHZA 4K3VA 4B8YA 3AESB 2XDQB 4FILA 5KOJB 2M6KA 2O1EA 4HMPA 5HX7A 5M3BA 4NNPA 5FLYA 3AERB 3MINB 5JG7A 2OGWA 3MFQA 3GI1A 5JOQA 3BE5A 4PAGA 4UDNA 4HN9A 1TOAA 2OSVA 2R79A 5GGYA 3HXPA 1QGUB 5CX1B 2YNMD 3K1AB 3U7QB 5I4KA 4IRMA 1K75A 2XH8A 2QI9F 2AFIA 3BE6A 3HJTA 4XPIA 3TEFA 1K7SN 1K2VN 4LJSA 3AEQB 2XQVA 3LI2A 4HMQA 5M2QA 4GICA 3MWFA 4INPA 2MINB 4OXRA 3PSHA 4MLZA 5BVGB 3R5SA 3ZTTA 4UDOA 1PQ4A 1KAHA 3ZK9A 3MD9A 3AEUB 1MIOB 2WI8A 3MINA 4ND8B 1PSZA 3AETB 3G9QA 4WN9A 2PS0A 3AESA 5BVHA 1XVLA 2PS9A 5KOJA 4FNAA 5M34A 4M7OA 4WESB 3PSAA 4UTPA 2RG7A 4NNOA 4TKUB 5M29A 2AFIB 3UJPA 1N4AA 3HH8A 2AFHA 4PM4A 3AEQA 1EFDN 4G09A 5KHLB 3PDIB 1L5HB 2PS3A 2Q8QA 4MDYA 2XUZA 2YNMC 1G21A 5CR9A 3AEUA 4XPIB 2M6LA 1H1LB 4WN9B 3EIWA 3TNYA 1G20A 3LHSA 5BVHB 2MINA 2OV1A 4WZAA 5BVGA 2XY4A 3AEKB 2WHYA 1M1YA 1M34B 4WESA 5B58T 2R7AA 4WZBB 1M1NA 1KAEA 4WNAA 5AFSA 5KOHB 1MIOA 4ND8A 1ESZA 3NU1A 1QH8A 5GGXA 2Q8PA 1QH1A 1FP4A 4FI3F 4MX8A 1K0FA 3MWGA 4LS3A 4FKMA 1N2ZA 2ETVA 2XDQA 3PDIA 4H59A 4TKVA 4HMOA 2XV1A 1N4DA 2OV3A 3EIXA 4OVKA 4TKUA 5JJ5A 1G21B 5HDQA 4N01A 1N2CB 3AERA 2AFHB 4DBLE 4BBPA 1L5HA 3ZK7A 2PRSA 3ZKAA 4INOA 4H0FA 4WZBA 4CL2A 1M1NB 5CX1A 1H1LA 3CX3A 5JPDA 4OXQA 3U7QA 1G20B 1QH8B 4G07A 2X4LA 1QH1B 4WZAB 3AEKA 3TLKA 4UTOA 1M34A 1M1YB 3R5TA 1QGUA 4TKVB 4WNAB 3ZK8A 3K1AA 5KOHA
chains in the Genus database with same CATH superfamily
1VIYA 5I9SA 1PFKA 1J0BA 1OTYA 2VEDA 1SIWA 3IP9A 1YA8A 3PP8A 1M2EA 1GUAA 4AN1A 4NR0A 1NC3A 3ZDRA 2JGKA 1Z6YA 2VJMB 2M32A 3DP9A 1EEXB 3A9CA 3JQCA 3V8QA 3HDHA 3FVTA 4J3FA 3CISA 5E6SA 4S1VA 2EF1A 1MX1A 2ZRNA 4KQHA 3SGLA 4F9TA 1PNTA 1WDMA 1WIWA 3Q5DA 3VKGA 3FPHA 3U2QA 4J0IA 5JU6A 2RGGA 3BREA 1XAHA 3HCRA 1SRQA 2EFJA 4DMKA 4CV0A 1W49A 1PWEA 1UK6A 1VLQA 3LOQA 1E0AA 4Q0MA 4D9HA 4OYYA 3GFQA 3N8GA 4R2HA 4BFXA 3QJ5A 3AFGA 2AFIA 4KVAA 4HLUA 4ECAA 1FFHA 4CEJB 4HEJA 4OBWA 4Y1EA 3B7GA 7ABPA 2UZAA 3AKYA 1EWVA 1EFCA 3MTGA 3IP1A 4G5FA 1PT5A 2AZTA 2C5SA 3NKFA 2HF2A 4GYJA 3E1KA 3MBIA 3SZGA 5DJ5A 5JBNA 1DOAA 1V11B 1UBHS 1H65A 3C3CA 2GAIA 4UREA 4J0JA 1CUCA 4M1ZA 2O8EB 5EIBD 2O8VA 4PVCA 2IXGA 3R0ZA 5E6SB 4LCEA 3T5TA 1LFDB 5TV2A 4TVSA 4OH1A 5IN5A 5KPDA 1QGYA 1NJ6A 4YAFA 2QQ0A 1K5GA 1Y81A 4DA8A 4UFPA 1PRYA 2BZ0A 3QKSA 4LDPA 4N5HX 1TJNA 1WQ3A 4DCSA 1LDGA 1TC1A 2J9ZB 4YH1A 4CW7A 2OEPA 5KSZA 2VT2A 1GILA 2Q0HA 4JBHA 5B1EA 3HXMA 3RM3A 2YHUA 1MAVA 1NVFA 2JEZA 3TNYA 4EEZA 5KHOC 4V39A 1UJ2A 3ZD7A 2OA0A 4OIMA 5EMHA 3GGJA 1I4DD 4NMHA 3C4QA 5EL0A 1GNQA 4QC2A 1QHFA 1JSZA 2R25B 2NVOA 4ETMA 3C6XA 3HDYA 3QK7A 5CDGA 1DEAA 1OQAA 1X7XB 4J7UA 1XXHA 4QEZA 2I6GA 1HQKA 5ITZA 1ULUA 3S8MA 4AUKA 5J5CA 3CC8A 3IFSA 4WOPA 2J08A 5AVXA 2FPGA 3L7YA 4Y6QA 1CY7A 2Q50A 1PE0A 3CW9A 2HCFA 3SJAA 1EFRD 1WDKA 3JWJA 4HRVA 4FN4A 5FAXA 3SPXA 4ZT7A 4B4WA 5IU6A 2EJUA 1B1CA 3ZWMA 4W7IA 3S27A 4YCSA 3PLNA 4LY3A 4HNHA 4V3BA 1XZLA 1KC3A 1U90A 1XZNA 3CNHA 3LJKA 4PYMA 4WBSA 5EIOA 5CPFA 3U9LA 4BECA 4AY2A 4XEUA 3U3XA 5HRAA 1RAHA 1P2FA 2RHRA 3A0UA 3BWCA 3RNLA 4ZTZB 2ATXA 4ZVMA 2LKDA 4PWZA 1NF2A 3X2EA 4LTMA 4MEBA 1P7CA 3RSHA 4YCCA 1W34A 1VIVA 1P75A 2FUNB 4P3XA 1J49A 3ZLTA 4E4YA 3BIOA 4UTOA 4F2GA 1W4CA 4GPZA 3ZQUA 5FOWA 3GZJA 4KFUA 3T99A 3M1IA 3KYDA 4IFEA 4Q7EA 2BDTA 3VV2A 5EQDA 3IB3A 1KARA 1Y34E 1K8RA 4QQRA 1L5KA 3A32A 3DBHB 1FS6A 3V42A 3GQVA 3V7YA 4CCAA 1FP7A 1LVHA 3U3ZA 3NWPA 2W43A 2ZJ7A 4FMDB 3VDXA 4WY2A 1S89A 1P0MA 2K7FA 1RD4A 2ZIVB 2CFCA 1RE0A 3ESZA 3CA8A 4PZAA 2QTBA 4X3PA 5CBKA 1C0EA 1RJ9B 4M99A 3LDHA 4DYVA 2ZJBA 2OBBA 2XTAA 3EGDA 3PA6A 3UQZA 3LM8A 5BR4A 1JPNA 4MI6A 3O8QB 2O14A 3DW3X 3H1TA 1QO0D 2LPMA 2QE7A 4W63A 2HIAA 3ADCA 2VF4X 1E79D 1R88A 3EMDA 2WP0A 1SQFA 4X63A 2NUAB 4YJDA 3PFGA 3EB9A 5K3FB 3VVCA 3VPDA 1ZD4A 5DYIA 3W9SA 5E38A 4P5DA 2UU9B 4P5EA 1EVJA 4LXHA 4B46A 2V97A 5A4JA 2JLCA 1G4UR 3GFSA 1AKMA 4UAGA 1AUOA 1T6BY 3FYSA 3GA0A 4OMDA 4J6EA 2I03A 4YQZA 4F45A 1MT0A 1QFJA 1SC3A 3DCYA 4ZOLA 4AU1A 4B4OA 3O2JA 4FMCB 3DZJA 5CYFA 3RQSA 2M6RA 3A1VA 4KX3A 4IFTA 1AK9A 1KDZA 3P9YA 1UDXA 2C8JA 1DQNA 4NE9A 2OAGA 5A0TA 1SWVA 4DLBA 4XSVA 2F67A 4MVJD 4QD3A 4EJFA 1NONA 4Q7QA 3IVMA 5DV9A 3FMFA 3C15C 1DC7A 1F5NA 1KK1A 2FQWA 3ETNA 1GL6A 2R4QA 2QW1A 4MA4A 4AJ9A 5KHLB 2QNBA 4I9GA 3WWPA 2Q0XA 1E98A 4RKEA 5E0KB 1IHDA 3CEHA 4GBJA 4PSAA 3W90A 2B5WA 3CRNA 4YJHA 5BMVF 3GFOA 4HWKA 1E7YA 4R2WA 1CETA 4LV5B 4XR4A 4D57A 4X6LA 4D9KA 5LXTF 3P0HA 1U0BB 2JGFA 4INAA 3GEPA 1M7HA 2B25A 4MQEA 2C4VA 2WHYA 3GBVA 2ZUWA 3EOBI 4JEHA 4OHMA 3TO5A 4D46A 1ULTA 2VJYA 4G0OA 1TIPA 1RXVA 4OIFA 3S2IA 2C3MA 4MR8A 5DNVA 4ND8A 4ZVSA 1EWTA 1M1XB 3QWFA 1S1CA 1LQ2A 4NU0A 1Y9EA 4XDYA 2NWQA 4N0PA 1UQTA 3RS9A 1WEHA 7GPBA 3W3AA 4X1IA 5A0VA 1QTIA 4MUHA 1H22A 4C6TB 1EESA 3JATB 5BNWA 1R8SA 4TPKA 2PX8A 2CL7X 3RRFA 1BA3A 5AMXA 5KUTA 1DI0A 1X80A 1BH2A 1YS2X 5F7ZA 1SQ6A 2OD7A 2VYVA 1ECPA 4U9HS 3QYFA 3R23A 3ZLUA 4JDPA 5B57C 3ESAA 3QU2A 3LAWA 2CBXA 5L3QA 2REQB 1IHUA 3KLMX 3KYBA 4MVJF 2FXIA 4XYBA 5C4MA 2PK3A 1OT5A 1D09A 2G3YA 3CPSA 4UUBA 3DKIA 1KZ4A 1SM4A 2QMEA 2OHIA 2ZCUA 4PZZA 4UM7A 2WSLA 1YR7A 2OCXA 1XMPA 3L1JA 3ZJVA 2WJ3A 1WM1A 4KQCA 1Z4PX 2FMHA 4MB6A 3RDPA 1C8BA 5I8ZA 3JD1A 1W75A 5LP6A 2B5OA 4RQBA 1P9LA 4B8WA 2AN1A 4RANA 5DHQA 1CVLA 3A31A 3EZ7A 3WBJA 1XZGA 3B1XA 1JWAB 1YUBA 1GZHB 3MUFA 3TM5A 2PBZA 2BGJA 1I5OA 2YZ2A 3L0DA 3BEDA 1ND6A 2FK7A 1CS4C 1GVHA 3L5KA 2XMBA 4E6EA 1HBJA 3TKLA 1F7UA 1DS6A 4QOHA 5C1DA 2AE1A 2COEA 4KREA 4MYHA 4B31A 2DUUA 1A7KA 3NHWA 5JJLA 3PITA 5FBLB 2OVFA 3ZDDA 4AVYA 3AUSA 2H5EA 3P1JA 2O0MA 5E4FA 3O4RA 3HJUA 3TUZC 4ZMBA 4IV8A 2A1TR 4NV1A 2VXYA 4U7PB 3VPHA 1L7PA 3EK2A 3PQ5A 1T43A 2WZCA 2IH5A 1IQRA 2FPSA 1VXOA 2N46A 2ZJYA 1JLMA 4HDKA 4KQMA 3CG4A 3KFLA 5CK4A 3CKKA 2JB9A 2PZLA 4MKXA 4OHOA 3O03A 3KWLA 3WVNA 5LXTA 1DBIA 2IOYA 2IVFA 2X5OA 4YT2A 2F1JA 3N5KA 4YX9A 2VBFA 1KGDA 1WW8A 4RY0A 3H2ZA 5C1BA 4R1LA 2IPOA 1EQAA 4HP8A 1EM8B 1SG6A 4IG4A 3RVKA 4YCMA 3PD1A 4P4TA 5IASA 3R3UA 1X8LA 3L1UA 4IIJB 2ADMA 3CLUD 4MCIA 4UBNA 2IF0A 1CTQA 3F4LA 4BX2A 4J7XA 2BI8A 1VG0B 4MVJH 2IZ7A 1JDSA 3L0IB 4ZVUA 5IW8A 2H00A 1G17A 3GEHA 4UXIA 3Q6NA 4PAQA 4UE6A 2DSTA 4EHNA 1IU9A 1JU4A 3LMKA 1Q12A 2NUTB 1PJ2A 3EF3A 2W6QA 3TINA 2Z5FA 4L0CA 1P1CA 4YCLA 2RKBA 1V3QE 3GLUA 4NQRA 1VE7A 4OMFG 4ARAA 4D45A 4F04A 4ESOA 2BF7A 4A0GA 4WNIA 1L4YA 4MV1A 3FUCA 4W7SA 1T8YA 4DQUA 2AVDA 5CFZA 4WFIA 5HW0A 3FJYA 1DJNA 3KZOA 1RSZA 4IKPA 1XKTA 2EW2A 3EJ6A 3HL0A 5DZSA 4YONB 4D56A 1GPH1 1ZONA 3RUCA 1U8FO 4OM8A 4NBVA 3SZRA 5CCEA 1Y8QA 3LY7A 1YMUA 4ANFA 1MC8A 1CZRA 2AC2A 4F1JA 3M3PA 4X7PA 5LCXA 4TKVA 3OQNA 3AVVA 3OPVA 3N9IA 1FTQA 3UEOA 4LX0A 1KSGA 4HPXB 3SF8B 2A0FA 2ZYWX 1Z4JA 3FPKA 2GYWA 4AF7A 1E1QA 3H5OA 2V6GA 3NBUA 2XB6A 2ZRQA 1R2QA 3PHJA 3VZDA 4OLAA 1IONA 4PN3A 1I3NA 2GNOA 4JP3A 4KAJA 1K89A 1JLRA 1FU8A 3F3MA 3KOMA 4QWWA 3UWKA 1GNRA 4E2FA 2JCXA 4R01A 2VSQA 4YP7A 4BYGA 3ER6A 2WHPB 3B6JA 3SXJA 2YMPA 2GTPA 5FNVF 3FMOB 3ZJ5A 4EP1A 4NU8X 3EFEA 3LKVA 3RU7A 1DC5A 4KJXA 4HH3C 3FFTA 1VB5A 4LN1A 1YULA 1UJ5A 3FTNA 4WLFA 4WZAB 5EEGA 5ALIA 5GONA 3ZHBA 5EZQA 4ZVVA 4YLYA 5B2ZA 2FNAA 3SOZA 1QRTA 1DFIA 1ZIDA 5TJ9A 2WJWA 2J09A 1G2OA 2VNJA 4WOCA 5AOAA 1C4KA 5B1DA 1OYOA 1E2KA 3GG9A 5NLLA 4E2ZA 2JEYA 1YNOA 3AJRA 3AVQA 3DKPA 1XI2A 4FGUA 4OREX 2WNSA 5U1PA 4QGSA 3LL7A 1ECJA 1FUUA 3I2FA 3PE6A 4MWEA 4CGZA 1U8ZA 2H4HA 2IUYA 4HLCA 2WF8A 3BRWA 1IG0A 1CDZA 5JG7A 3FDIA 2BFCB 4OOFA 3IQEA 3PQ8A 3QVJA 4MYRA 4OXKA 1V41E 1YAJA 4QDOA 4W9NC 2FWPA 3P0JA 4MWBA 2C8KA 2IT1A 2CWWA 1K75A 1E2JA 3PDJA 3IIEA 1G8JA 3DMTA 2JIOA 1O96B 3RVSA 4FI3C 2FHPA 1M7GA 2IDMA 3ASVA 4G63A 4RY8A 2I8LA 2Q45A 5CM8B 1YONA 3BD6A 2GAFA 1KDTA 4AZVA 6AT1A 2WPDD 1DO0A 1LC3A 1BNCA 1WPXA 2ZAYA 3OOSA 3TZQA 2VWGA 2HHAA 1IJFA 2YWXA 3OUTA 1EVZA 1OH6A 3FNRA 1DLIA 2BFDA 2ZUBA 3CF4A 3NC4A 4M7OA 4KRYA 4ZCTA 5KMGA 3Q6MA 1CZUA 3IBTA 4X8OA 1TQHA 4JUDX 4LYYA 3ZWDA 4ILKA 3O1JC 3CRQA 3U4GA 5T4FA 1NVVQ 5IJ9A 3WGGA 1E2UA 3ETEA 3R0VA 5IX8A 1RM5A 1A88A 3RAFC 4AKHA 4BVLA 3KSZO 2Z6UA 2WUFA 3B52X 3K09C 4L51A 2YIVX 4A3SA 1GA6A 2KHZA 2WPNA 3OKFA 4IZOA 4F9FA 5EJ6A 4OKSA 1XALA 4JBWA 2EKDA 3EEQA 2C54A 4QUAA 4D0SA 3U4IA 4FFMA 4TL8A 2ODEA 2F1HA 4TWZA 4QICA 3KR0A 1G3IA 2B8NA 2FX3A 2QHXA 3I4FA 1KH2A 1RQXA 2E4YA 5ALOA 3P4UA 5FF9A 3T7KA 2FMXA 1BH6A 3G0GA 1ANKA 2R5WA 4D96A 2REOA 3WTBA 4D6XA 3EPJA 3SOPA 4R05A 5FWAA 2J48A 4J07A 1Z34A 3LLCA 5F2NA 1ZNZA 3WIEA 4MMZB 1UMKA 4V0OA 3L0OA 1MFPA 5H1YA 5HIMA 2O54A 5B1IA 4G65A 4PSVA 1BXGA 4OVKA 2EL7A 4FDTA 5BSTA 4Q21A 3TBHA 1C9NA 5GJCA 4HQKA 5IJ9B 3IQFA 2NNWB 1KI6A 2H4JA 3NCHA 4FE7A 1NN5A 4YN3A 4KJZA 4GP6A 1C5KA 1UBUS 2YJGA 5U4QA 1BZYA 3KHTA 2VDMB 4B79A 2BJVA 2FSFA 2NTEA 1T1JA 1ZPDA 2G72A 5JCPA 3TSAA 4Z51A 5CH5A 3UWSA 4IEFB 5LU8A 1KIAA 4EHFA 4KN6A 3OOWA 3LXXA 1QF7A 4YC7A 1KE2A 4ENUA 3IKTA 3PFIA 1DKQA 2OWDA 2QZZA 3UV7A 4PHGA 5CB4B 4JCCA 4IVNA 3O8RA 2UYGA 1SBHA 1MC4A 1O95A 1ZN8A 5CT8A 3W1EA 2VPIA 2EOAA 4HAUA 2SKEA 4IEIA 5KHAA 5A9SB 1CUEA 2EZTA 3AHIA 3AYZB 2EAUA 5FFFA 3PRYA 5KJFA 3I0ZA 2OMEA 1T1SA 3TNDA 1ZI6A 4A73A 2JLZA 3UG6A 4UMVA 2QTRA 4YDHB 13PKA 4QPZA 3QPCA 3U4MA 1JDBB 1B0ZA 2IEBA 4BNMA 3B48A 2GF9A 1J0XO 1UPXA 4ND5A 1WB5A 3PGVA 4G1UC 1TM2A 1E0DA 1GKLA 4XWYA 2XVXA 2NVUA 1I7NA 1A50B 1WMFA 1ODLA 2J3LA 2E49A 1X8KA 2F64A 4X6XA 5LD2B 2YWDA 5EHNA 3WK7A 1SULA 4AO7A 4HQRA 1VGQA 2H2AA 4DSUA 5JMOA 4GOLD 4LRXA 5IDVA 1CNEA 1F8XA 1X1AA 1U99A 2HSZA 3PC3A 4P3KA 4U8HA 2Q7DA 2XYHA 1L4FA 2BMVA 1ZYUA 3L6DA 4P3PA 3ROZA 3ZK9A 1KEZA 3QFRA 2KX7A 3S2EA 1QONA 3DLHA 3RS4A 3G23A 4ZC1A 2JARA 3HFJA 3UK2A 4MB2A 1THMA 3UB3A 4D82A 4JP2A 1JDBC 4H9GA 5FQNA 4ZU3A 5AVVA 3ZR4B 4OHFA 2FPIB 2FW0A 2OCIA 2X2EA 4DNQA 2HMYB 3OHSX 3G9TA 3N2EA 2IDJA 1EVEA 3WQSB 3LTNC 4BUJA 4IJMA 3EYWA 4BQQA 5IF3A 2I4OA 3IKMB 1FTYA 1M3SA 3HBFA 3UT5B 4EVSA 3CBGA 5IWAB 4Z3OA 4C2AA 2CLSA 3AR3A 4JMLA 2VJCA 4PLPA 1W5TA 3JQAA 2VF7A 2F6RA 3P9KA 4G5XA 4A0SA 4E5UA 5L40A 2JLUA 4JFAA 4TS3A 2HJSA 1TPZA 2R1ZA 4Q6WA 4BP8A 2IW3A 1YRAA 2A4KA 3C3YA 4RV4A 2ILTA 3CEJA 3PF8A 4BKMA 3NXSA 4PXAA 1ZVJA 4HDRB 4W1RA 2GHTA 3SZOA 4ZJPA 3E9QA 1GAEO 3VU8A 1JV2B 4DREA 3SKYA 3C5HA 4H2DA 2K7ZA 3RI3A 3D0OA 3FG9A 3CUUA 4N7JA 2ZTMA 2II6A 2XQJA 4MA0A 1Z2OX 1BVYF 5ALSA 3ZY2A 4Q4LA 3OCZA 1P72A 2XW6A 4BN4A 4JXZA 3EH2A 5EGSA 1ISHA 1FA9A 5C51B 1Q95A 3GLRA 4URFA 3QOFA 3HKBA 4M83A 5ALTA 2IUFA 2C0CA 4KQ1A 4MB0A 2D1QA 4R2MA 4XGQA 4BO0A 1JG7A 1F8GA 1SU4A 2QTWB 5LQAA 4OXQA 1MJGM 4O4LB 4OSEA 4TROA 4Y2JA 5FOVA 3W9UA 3JVEA 2HHHB 1VFPA 1JAXA 1KNQA 1YB2A 1G6OA 3FOBA 2IHNA 1YQQA 3TLKA 2FP4A 1O97D 2F62A 2ALJA 3U61B 3HGMA 1XT6A 3FGOA 4X1OA 1OZFA 5TIIA 4IDEA 4X8HA 2P7IA 2C5LA 2ZSFA 3D0KA 4XLLA 4JZKA 1Z8HA 3EEYA 4HDRA 4N49A 3MPUA 4RTMA 1JX6A 4CF4A 1NW3A 3FZNA 3BWXA 2BBSA 4C87A 2VTEA 1TYDE 1R9NA 2VHQA 4QBTA 3PC4A 1HI9A 1OGYA 4B0OA 4GBMA 3VYRB 1QM5A 3TR6A 1A4UA 2VDVE 2ZE7A 2FE4A 2QAGC 3QFSA 1IAVA 4Q9DA 2I80A 2H18A 3CT4A 5FWDA 4IHJA 4ENSA 5B6IA 1F5SA 5HKLA 3DNMA 2X4DA 4D74A 5BWNA 2PUVA 5CYGA 5LJIA 1E3MA 3RTBA 4O4IA 1UT8A 4AG6A 3KB2A 3U7QB 1W6UA 4PCAA 4MJLA 1KMNA 2FZLA 5DM2A 4IIJA 4LDNA 3WLTA 4B6OA 1UKEA 2BKAA 4KK3A 4C89A 3BYZA 1NQOA 2QR3A 4ADSG 1BS2A 1VBMA 1C29B 2JIPA 1BSVA 3INRA 4QUJA 4E15A 3WKEA 1YE3A 3S55A 3FAKA 4JVMA 2CUZA 2HLHA 2UXCB 1JFVA 1ABFA 4DSNA 4MWCA 3L40A 5ILOA 1T5BA 4IUDS 3UK0A 3OQ6A 3ZQJA 1VECA 1XRQA 2HDWA 4OY3A 1K0UA 4MTLA 4AJKA 3T3GA 1CU1A 4A7PA 4F5DA 4D4KA 3TMYA 1PS9A 4ROTA 4JX9A 5EKUA 1EX9A 1ZJJA 2ZQ5A 1P5ZB 2VJNA 2LCQA 2CXQA 1DBPA 4LBZA 3LNCA 3ODPA 4BNGA 5IM4F 1OD6A 2X0NA 1EP9A 4MS1A 3T34A 5F76A 3IR7A 4DYDA 3FNHA 4MWZA 1HC7A 3RVJA 1YI1A 1BVUA 2W71A 5I4BA 2QX4A 3PHHA 4D6PA 4M53A 1GKKA 1HSOA 3RH0A 2HLNA 1NYQA 2KLBA 3ZGYA 3V4ZA 4EH1A 2OHGA 1UAGA 4ZI7F 1TW2A 2BHNA 5FQOA 4CM5A 1E2DA 1OFGA 3EXHA 4A4DA 4CT0A 4K3UA 4LHWA 2P9HA 3N28A 4K6HA 4Y2VA 4XD2A 3T1TA 3ZW9A 5BYAA 1UANA 3EGVA 5K6AC 3D9QX 3BH7A 2IEGA 4ZXPA 3ENQA 4MVXA 4M3NA 3WGZA 2O59A 3O8OA 2B4QA 1MXHA 3GDFA 1U28A 2PJDA 1XDZA 2E4AA 2O6LA 1LCIA 1CIVA 2BFFA 2ZQYA 3EOZA 1KEEB 3M9XA 4FE3A 4TN1A 1EJ2A 1LVGA 1THGA 4J3JA 4OATA 4B48A 4I5EA 4MDEA 3EQ6A 4Q4AB 2H07A 4FS8A 3HGTA 3MM4A 3BHNA 1U04A 3F7MA 3KJNA 3A4IA 4ZV4A 3NHJA 5H3HA 3BX1A 3Q3IA 4J0HA 4EPTA 4XSHA 1UWLA 1XVAA 3M2TA 2CHVA 3O8DA 2CB0A 1G5TA 5JHGB 4MS1B 4WXRA 4MS4A 3NHFA 2ZREA 4BEJA 4RXUA 1OFHA 1ZITA 1HT2E 4ZEMA 2H85A 4AI6A 1EX7A 4BBPA 2ZE8A 1GPLA 1O2DA 1KU0A 2POQX 1G5PA 2IYVA 5JFOA 1YZGA 2EJBA 5SZHB 1I4TD 4P6VF 1BMFA 4ETIA 1IM2A 5CLIA 3RE1A 2JGAA 2WHXA 3D5EA 1VSBA 2D5CA 2IPMA 1FTWA 2OZEA 3ETJA 5IG2A 1ISRA 1TDJA 5DTMA 2JBHA 1R0KA 1EVIA 1TKRA 3D7SA 3UMGA 2UXDB 2D4HA 2NU7B 4GZLA 2LWIA 4GKKB 1WCXA 2IYOA 1QUEA 3DAYA 1Q7EA 2PRIA 5DHTA 3WRVA 5JI2E 4W6ZA 2D3WA 1Z0AA 1I4EB 5D7NA 4B3HA 4KN5A 5LQSA 1GWNA 5I47A 5KYXA 1GDTA 4EA9A 4TZ6A 1EHIA 2O2SA 4JI5B 1E6KA 5GVSA 2AMFA 2X1VA 3HRHA 4RVGA 2Z57A 3P2MA 2Q62A 2R1TA 3GFVA 2Y1DA 2O1EA 3BSYA 3NEYA 2D0IA 3A1SA 3KQWA 3SN6A 2YIJA 3FD8A 4Q39A 4YROA 5HEKA 1M2OA 2W2VA 4DG9A 2JAOA 4QPNA 1JHPA 2C5BA 3TPCA 2EP7A 1DWQA 2OHOA 2X58A 2YY5A 3OE7A 2DWCA 4MWGA 4AURA 5TC4A 1NULA 5IUJC 4HEQA 9ATCA 4MRAA 5AI4A 2D62A 3WS7A 4BQPA 3WAGA 4XKJA 1VLJA 2FPWA 1VL8A 1HE5A 1YVUA 1FMTA 4X61A 3T12A 4Q4CA 1UBGA 2QN8A 3EDYA 1U0RA 4B45A 5AVSA 1CUYA 1T3SA 3L0SA 4Y9SA 2GN2A 3BIXA 4YAIA 5B4TA 2LCIA 2W22A 4JI4B 3A6PC 1RYBA 3EVAA 1MO5A 4X54A 1FL9A 2QJTA 2OFOA 4G1VA 4MYUA 4Q6BA 2C2GA 4MKGA 1MF7A 2QTGA 4PZDA 5JISA 1CR1A 1T26A 3A2MA 2GZAA 4K2AA 5M5BA 2ZYVX 1L5MA 3KZXA 5I9TA 3A6FA 2X7JA 2H59A 1PWZA 2PUAA 2EZUA 1GZ6A 2L2QA 4M87A 3MOGA 1JE0A 2PSHA 4MVJE 3AU9A 2WOJA 3UJ3X 3Q8LA 3AJ8A 4N8EA 2G25A 4KQXA 1T2FA 4YR7A 1QDLB 1U9IA 3B7WA 1QHEA 3G6KA 4R9RA 5F33A 2Q3DA 2ZG6A 4IQFA 1EIZA 2Q21A 3QVTA 1C4OA 1LTKA 1LI4A 1BXGB 1QIJA 1Z3IX 3TH5A 3U7EB 4IOLA 2H06A 2VDRB 1KERA 2ZVJA 3LX4A 4BGEA 1W9MA 5GV8A 4DDUA 4LV6A 4D9BA 2UYOA 3TSOA 1N6PA 3UYLA 3MWJA 4NC9A 3EVEA 1L3BA 1OAOC 1WO8A 3WKCA 5GIPE 1F17A 2P9FA 3C3BA 5LMNB 3DOOA 4UTVA 2NZYA 5D01A 1MAAA 4IXDA 4LX8A 3IT0A 1A72A 2HXSA 3ETLA 1AS3A 1R16A 3RYFB 2X40A 5JFTA 3G0IA 4WN3A 5JC1A 4JU8A 4DCOA 2SBTA 4X90A 1JQAA 1R15A 2JBAA 4QHTA 5LYJF 1A8SA 3GOQA 1HNNA 4Q15A 2XKJE 1T35A 2YWEA 3NG1A 3P9ZA 4QNNA 4RQUA 2RG1A 3SQDA 4UE2A 3VX3A 4PF1A 4BO9A 4PG7A 2VTKA 4OI2A 3SX4A 1OWPA 1RXCA 1EI9A 1UZUA 3PYMA 4FHDA 1CY0A 1DG3A 2VG8A 3DM9B 5G4KA 3RVNA 2FAXA 4ARVA 5JD6A 5K3DA 4NZPA 3RV3A 1U2GA 1RAFA 3U17A 5I3CA 1SFRA 1MV5A 4IHKA 3TZHA 5LWHA 3NYQA 5KKNB 1TUGA 1USIA 1DCFA 2BI4A 5IWCA 2CHGA 4J1QA 4WFJA 3AX6A 1JLHA 4AMZA 5JECA 4PZUA 5J5VA 4JITA 4ZU6X 2B34A 1MAWA 1R0WA 4DTCA 3FUWA 5FYDA 1OE0A 5FWNA 4IDCA 3IQHX 4IIBA 4CM4A 4LMPA 1PSWA 1A77A 3ORFA 4RELA 3NHZA 3IQXA 2W90A 3ESYA 3UCXA 3BSWA 3Q2OA 2X8AA 1H3FA 1TF7A 3PD7A 2GFQA 3ZXUB 4AX8A 3TZBA 4ZOEA 2Q46A 2Y27A 2ZPAA 4XCVA 5CIYA 1V8FA 2ZIAA 5A3QA 3KXIA 2JBAB 4CF5A 4AICA 1V39A 3UAWA 1ISSA 4ACAA 3KHSA 2WFLB 3B3FA 3PGA1 3LY9A 5DKFA 3T9CA 5AW2A 4RVDA 4TYMA 2YWFA 4ZZ2A 3IELA 1TZMA 4D8VA 1WQ4A 4HK4A 3VPXA 3SVTA 4BVAA 3MWKA 2HX1A 4PRLA 3LLUA 1CQIB 3VDNB 3WIVA 5KREA 5GADl 1PV4A 3D6NB 1P17A 2GYUA 3F78A 1TIBA 2PO7A 5BY2A 2B1GA 3V33A 1EXVA 1U9YA 1Q7BA 1JI3A 2FPXA 3H11B 3IHKA 5BP7A 3PDCA 1CNMA 5G4LA 2H0AA 2NPIA 5EQFA 2IIQA 4Z0TA 3CU5A 3BBPA 2FW6A 3K16A 1RCUA 2CXRA 4B09A 1V6SA 3OM8A 4QQFA 2WSIA 4E14A 5DT9A 3KKNA 3U4CA 2J7PD 3MD9A 4NHOA 4E5VA 3THOA 3JQAB 5ERYA 2R7NA 1M33A 3BILA 2OORC 2GRAA 3RKSA 4BP9A 5B4UA 7ADHA 2BBTA 2XHEA 3DQPA 4WV3A 3RRMA 5HM6A 1XVLA 4HRAA 1MEJA 1JQKA 1UDWA 3QEOA 5C8YA 3VC1A 1X6VA 3KBBA 2FPRA 2VQSA 3WMRA 4O6VA 2GWRA 3EXHC 5JYDA 1HYBA 3JASB 1TFUA 1KFEB 2IYAA 4YRRA 1M0EA 1P1RA 2ZSEA 4J2TA 2D54A 1E62A 3I37X 4XIFA 5TQ0B 1NXQA 2PVSA 3U56A 3OJWA 3VNVA 4WKCA 2PLNA 4IFIA 3FBTA 3WWOA 5BW6B 1Z75A 4KACA 5JSFA 2V54A 3GQBB 4CE6A 4HZGA 3DQQA 1B8UA 4NYJR 4P22A 4D4GA 4E07A 2W8BA 2ZI6A 3AC0A 4CIVA 3PKIA 4IV0A 1QXSA 2KPOA 1NIJA 4PGAA 5BSEA 1EFRA 2Z2IA 2AT1A 5B53A 2V6BA 3AKDA 5KJCA 4ID3A 1MQ9A 1UK7A 4YDQA 3HKBB 4JXJA 4IF4A 1M34B 3QXHA 3L8MA 4MZXA 5A4FS 3OFVA 5EUQB 4K26A 5M04A 3WAJA 3GO4A 3JV7A 2ZM6B 3LHIA 3U4QB 1YJ5A 3T7RA 4YMVA 4IGKA 1Y5MA 1DEKA 2ONKA 2W98A 3BGIA 4KXWA 4F4CA 4ZO6A 1TK2A 1WKCA 1XJWA 2BRUA 5DK6A 5IK2A 3W5AA 3PDIA 1E6WA 1R0ZA 5FPSA 3V9AA 3CX8A 4PLCA 1N6IA 1Y9JA 3ETCA 5C34B 5AW7A 4BRZA 1QWOA 1JI0A 4GL2A 1AXEA 4ZCLA 1RRCA 4CFYA 3VDMA 1FOEB 4OK6A 3ZZMA 1T9BA 4DZTA 5LSAA 3C43A 3KHUA 3MMSA 2D2VA 1UFQA 4OM7A 4JI7B 4BGUA 1FRQA 1QV9A 5E9WA 3WB9A 1E5DA 4AFNA 1FNBA 1QRSA 2DB3A 1Q7RA 2REXB 3K2EA 2RJ3A 4YAOA 4F21A 1H1LA 3MCZA 4JJ4A 4K8OA 4O5AA 4OJMX 3GAMA 3DG9A 3UPTA 1HUQA 2XMPA 4O4LF 4BRWA 2R00C 4EPYA 2CGEA 2CMGA 2PUEA 2X4LA 4EEXA 2O19A 3E3AA 4UUNA 3NIDB 4YO7A 3L4SO 3A1EA 4MW2A 3PE3A 1EFKA 4QDUA 7MDHA 4C29A 4PRZA 3BPSA 1NT4A 2NYRA 4Z9FA 4JGGA 2WT4A 1L5LA 4BAZA 2JJ2D 1GRNA 5K3SA 3PKJA 4IUYA 2R6JA 2QGNA 3JAWA 4BNIA 4Y1RB 2ZWPA 4ERNA 2IRWA 4ER7A 2R4UA 3OX4A 3RSSA 2HXGA 3FIUA 5TQJA 1QF9A 4TVKA 2JZNA 4Q1AA 1UM9A 3O9ZA 1H2XA 2FZKA 2VDPB 2RIPA 1S9DA 1LNSA 3DQZA 1T0BA 3EVGA 4Q9HA 5FLYA 1ND5A 4BFCA 3P5SA 3WWCA 5EKSA 4PAGA 1U0NA 1XA0A 4M37A 3PRHA 4X20B 5F4ZA 4W5OA 2NU8A 4OBXA 2W83A 3WXMA 1ZY2A 5LKAA 2QRZA 2WKRA 4GW3A 4NG5A 3ZUGA 4EHLA 2JATA 3BM5A 3Q0EA 4GXNA 5AK5A 4PSDA 2BGRA 1J21A 1ZW6A 3GUHA 5J3JA 5MN6A 1EHYA 4R1QA 4LKOA 5E7QA 4N5MA 3WMWA 3E8MA 1X7WA 4Y98A 3TFQA 1DO2A 5AVWA 2GMWA 5AH0A 1UM8A 1FLAA 4PO9A 4PS1A 1GGHA 2GSDA 1JNYA 2V7VA 4BMNA 4E1AA 4E70A 2E6UX 3W3AH 4UUAA 1I4OA 3HABA 1RLTA 5ALUA 4NBRA 3SR0A 5F52A 2XTZA 3SZMA 3SM9A 2W0MA 1EVYA 3I53A 3Q8XB 3PZRA 3ZEAA 5FL7A 5K0CA 4LZAA 2YHAA 4MQUA 3DMHA 1XMQB 4PFSA 3ESRA 3VSEA 5FCDA 3NBXX 1JZQA 5DI9A 1A9YA 3OFJA 1WD5A 3L9WA 4PZEA 2FEKA 5CRIA 3TSCA 4IIDA 4CMJA 3QFHA 4RFSA 4EELA 2J9GA 3E9MA 3TL2A 4EFDA 4RIFA 4DSZA 4NBTA 2PMBA 1LTQA 3AO0B 4D9NA 1SJ9A 3FZYA 3BHMA 1XD8A 3WZLA 1SAYA 2JRLA 1Q0UA 1YHNA 1Y33E 1Z7YA 3QX9A 3MMZA 4RFLA 4CR8A 1V8ZA 3EXG1 4Z49A 1XJCA 3N0TA 1UBLS 3JALA 3THXB 2GGSA 1SNYA 3IXMA 2OYRA 5AW8A 3G2QA 1ADBA 1X7HA 3GJ5A 2XCQA 4HN2A 3QNMA 5ARCA 2YFHA 5AJTA 4EJ6A 3G2KA 2RK3A 1OZ0A 4NMXB 4J4BA 1QVVA 3OQ1A 5BPHA 1M73E 2QXUA 2WABA 3MT9A 1I13A 4IX1A 3SM3A 2WFMA 2V7EA 2V8BA 4NV0A 5AI6A 2DOKA 5AW5A 3IPRA 5SYAA 1YI0A 1XIVA 2AE2A 1I0LA 2J4CA 4XARA 5KU1A 5CHYA 1U1DA 2BEVB 4F93B 4MPDA 2AHOA 2ZIGA 3WO0A 1FDTA 1A9TA 2IHBA 3O4GA 1T36B 2WKSA 3CY6A 3HM9A 3B20A 3UAGA 2CVZA 3BMCA 3NRCA 4FFPA 3T7TA 2OENG 4GC5A 5AJYA 1KP2A 5HILA 4L22A 1BKDR 5JCXA 4DPKA 1NBIA 5CX1A 2X41A 3AI3A 4P5PA 1PW5A 3BMNB 4HX9A 4HWSA 1NP3A 3BXFA 3PT9A 2E85A 4B2PA 2ADFA 4J0EA 1N1GA 4S2UA 1P7PA 4G1MB 4WCVA 4BO7A 4E5DA 3COJA 1LVUA 4X00A 4RJTA 1SHUX 2IUSA 3UJ6A 1QOQB 4KXQA 2FV8A 1D4FA 3OETA 1U9JA 1XLUA 2NZWA 2CVPA 1XXHB 3GLGE 1WDLA 3RUDA 5JSQA 3P5BA 1DELA 1ZAYA 3AETA 4GGPA 4Y2PA 2PS1A 3LA6A 2FPGB 3FR8A 3AESB 1YZVA 4TXHA 4B80A 4X85A 3EPPA 3FFAA 3C14C 4HJXA 3CONA 2A58A 2G9RA 1HNZB 3L6BA 3PKZA 3R3HA 2I2DA 3CF4G 1G0NA 3LUCA 1UJCA 2MYPA 1KZYC 4H4CA 2FEXA 2AEJA 3KKEA 1OAAA 4EENA 2Y1CA 5FDFA 1EVLA 3I42A 3DZIA 2OXFA 1X74A 4B4DA 3G89A 3L0ZA 1MX3A 2D13A 1E2FA 3LC0A 5ESWA 4CIWA 1W76A 3BD7A 3FHLA 5BSMA 5F7JA 4I3HA 1Q0HA 1VDZA 2OORA 5FD8A 1NBMA 1NJ2A 2OZLA 1UPFA 2WUGA 3CYFA 4DWOA 5FUQA 5LMUB 4CLRB 4C03A 4CTOA 1HDEA 3CJQA 3KQYA 2QN2A 1PEAA 3GOHA 3L8DA 2A5GA 3RTDA 1NMQA 1ZD2P 2YWBA 2QN1A 3N8KA 4B2YA 1R50A 2L42A 4IAOA 4EITA 2I87A 2XQGA 2R44A 3EAFA 3U3KA 1Q3TA 1SHZA 1XZIA 1Y7TA 1ZLYA 2X3UA 3IGFA 2AC4A 2OGSA 3GNTA 1IHXA 3IAUA 1DX4A 1E1DA 5CIQA 2CZCA 2I34A 2Y0BA 3L93A 5DYGA 1WCYA 5AVOA 2X0EA 3V97A 3BIFA 3IRVA 3KLNA 3Q3GE 3QXXA 2P0EA 3IQZA 4PPGA 3JRXA 4IXMA 4XOIA 1I2DA 4HX2A 3A27A 2GJ8A 2CJWA 2OV4A 4GM0A 4JSYA 2JJ1D 4ZQCB 4Z9XA 5KOJA 4JX8A 2HPAA 1R6XA 5JBIA 3HLKA 1AQUA 5G53C 1XRNA 4AJIA 1VPVA 3I58A 1MV8A 1F0KA 2ISCA 3IV7A 3LHKA 1Q0LA 4DUYB 1LH0A 3ER9A 2HQBA 5CFNA 3LP5A 2WJPA 3RYFA 2HJHA 2CMFA 1HFKA 4UTZA 4YLEA 4BN0A 3RC1A 4F12A 5IUNC 2J5KA 3O8QA 3OJCA 4I08A 1XQYA 2P2GA 1JHMA 2C61A 3PPWA 4COOA 2PUGA 2Q3FA 2N1MA 3UMJA 4C14A 3JWGA 2IGTA 3HB9A 1JL3A 3W34A 1TM3E 5K09A 3BQNB 1UC5B 3OF5A 3QV1A 1H23A 1A2QA 4I3FA 4W82A 1E9EA 3WL8A 3WRXA 4HAIA 5E0OA 2PGAA 3C97A 4LVOA 2QX9A 2HBYA 4NOMA 1XJ0A 5JQGF 3EWAA 2EYQA 4LNHA 3TM4A 2E4UA 3H3FA 3UFXA 4Y6LA 4UMDA 2RGRA 3R3WA 1T8TA 4XQEA 5TMPA 4WESA 3U0VA 3H4MA 2OOSA 1KWKA 3ORHA 3AHFA 4UULA 4BLRA 4EBFA 3RJ5A 3IHLA 1HWYA 4ZOLB 4GLOA 2QR5A 4BNXA 1D6NA 1ORIA 1P4GA 2PKQO 3S40A 3T0FA 4Q9LA 1DBQA 1H4TA 3GWZA 1Z36A 4L85A 1YQXA 5BYKA 3GLFA 2HCBA 4IXWA 1OGJA 5AM5A 4YK7A 3VOAA 3C3EA 5AUOB 1V16A 2LRHA 2EFEB 3RT7A 1QLJA 1UFOA 1ZQ9A 4HN4B 4IIHA 3TSYA 5HS4A 2ZVPX 1GGJA 3NASA 1A7JA 4D79A 3SEZA 3OO1A 4O63O 2G17A 1OLSB 1GRRA 2A6PA 4MVJA 1XNQB 1BQ4A 2I9KA 2IUTA 2ZBQA 3IUYA 4YJHB 3ZNQA 3E9NA 4QASA 1US8A 4UNIA 3OTIA 1V3UA 3VR6A 1YU6A 2O06A 4WFKA 1SH7A 3SQMA 2V7QA 5K0NA 4FYIA 4I99A 4UEJA 2ZFUA 2FWAA 2Y1OA 4KO3S 2XUFA 4S0XA 4O4HB 3QBTA 3GJTA 4D3XA 4KHPB 4U7GA 5F3WB 4R0NA 1J99A 1L5VA 1U7TA 3CFYA 1SK8A 1WUHS 2HJVA 4B2IA 5CVEA 1UXKA 3IUEA 1MDFA 4H17A 2F1RA 4FYWA 4B8YA 4CQLB 4FILA 1VA5A 3LVBA 4PNEA 3GLSA 5AOVA 3CSSA 1ZFNA 3ZKWA 4KV7A 1EEHA 3WLEA 1YWGO 3WLJA 2O9JA 3NB0A 4OQPA 1SKAA 4EEKA 4LQDA 5CW1A 5JEEA 4H7DA 1W96A 3CLKA 3EQ8A 1X7GA 1T24A 4HNQA 2WJVA 5C8YB 2C2YA 2IYUA 2VA8A 3R0IA 4P4LA 3ZE7A 4EFNA 2JFUA 3W6OA 3JASA 5AVZA 1O6FA 1FDUA 1OC4A 3PHCA 1CIPA 2DM6A 1HE4A 2AI2A 5ARDA 2IYXA 3L8HA 1H4VB 4WKGA 5I4KA 4MINA 2H0RA 2XZPA 3BKXA 5FEUA 3V6LA 2QQFA 1MNQA 2C8LA 1O8CA 2JFHA 5AXCA 1P0CA 2ZCVA 2IWRA 3PIDA 4BLUA 1T9CA 5A4IS 5FYQA 821PA 4AW9A 5J23A 4JEUA 4KSYA 4AF6A 2RCNA 3K0FA 4LHVA 2W8BB 4P3NA 3N0RA 3HCPA 3UT0A 3VYWA 2Y1FA 2ACEA 3LGXA 1JP7A 3L8YA 2BN4A 2WHRA 2WYVA 1KH1A 4OHCA 2HMSA 3RS8A 1IXRC 4PG5A 2CKDA 5IEJA 3QUQA 3A9SA 1Q1ZA 3I28A 5AW1A 4BRSA 2WM8A 2X5KO 5DHUA 1Y4ZA 3N2IA 2PSFA 4J4HA 1KC1A 4PQEA 5TMBA 4PLGA 4UM9B 5EFOA 3OHMA 1JYSA 1WVGA 3L84A 2ZXFA 5T8KC 4BVEA 4Z3KA 1RADA 4NBWA 1XD9A 4EFMA 4DDWA 4MR9A 5L4NA 3AVUA 3LBAA 4MW5A 3G59A 4BMSA 2WWTA 3RRBA 4D9GA 1FIUA 5I6DA 2IHTA 1SGWA 5B3JC 1QIIA 3UGKA 2C7PA 3QUCA 5LZ9A 3O5AA 1IBLB 4US2R 3F4BA 4RENA 4XVQA 5K8JB 1GU1A 4N48A 4NS4A 2I4IA 3JARA 1QE3A 2BFEB 1UJMA 4F85A 1S4MA 3DZCA 4W1PA 3S8EA 3AR9A 2A1IA 2GA8A 2HA5A 3FLEA 4DM3A 1Z83A 2G0NA 3AV0B 3BHJA 4LJ7A 4N54A 2P2NA 5DTJA 1Z3CA 3O21A 5HF9A 2GA9A 3RS2A 2ZZKA 3ABSB 2ZWOA 1PFUA 4I8DA 4DWJA 2QLNA 3KE9A 4R98A 3OQVA 2AFHE 2JASA 3MWGA 1R4MA 2OBFA 3PPYA 5FTJA 1SXJE 1L9XA 2XDQA 4RYLA 5C0OE 2R87A 3RK1A 5LKRA 4W5NA 1PFVA 4FWBA 1H2FA 5D3KA 1GR1A 1EM8A 3K8ZA 4REQA 3A1TA 1L6IA 1CQWA 1DKPA 4EKYA 4J2OA 1SOWA 1GQFA 2V6IA 4URYR 2DQSA 5GY7A 4DFDA 3T5PA 3KQQA 3QVLA 1J39A 4NTZA 1SB8A 3WTCA 3I9MA 1KK3A 2EGUA 3I01A 2YCBA 4GKAA 2CEAA 4LA4A 4M0LA 1NBWB 4DQVA 1ZMTA 4YO8A 3U13A 1GFSA 2GHIA 4H3KB 3H9UA 1R6VA 3IEPA 5CFOA 3THYA 3IAS6 4CL2A 4GOKA 2C07A 1NF3A 4ZI7B 1XAGA 1V8DA 3CUKA 1TT5A 3KNZA 4B44A 1L8AA 2NSYA 3MZ0A 3T1YB 4BWVA 1E3DA 2JFXA 4IKOA 3EODA 4B6JA 2H57A 2WVAA 4O4JB 2WIBA 3WHKA 3I6BA 3V3KA 2FPOA 3CZMA 3DKKA 1FYVA 5ALYA 4I9UA 2ZJ8A 4E5KA 2CVQA 4R2KA 1FNCA 1ZL0A 2IPLA 4DIOA 1UMBB 2FN8A 3TLGB 2NO0A 5KNDA 2XDQB 3GGOA 3UJDA 2HQSA 4YA6A 2H9AA 4HB4A 3W8DA 2AQIA 2FSHA 3Q4GA 4FCCA 2DTDA 4REQB 1P4AA 4M8IA 3ZNOA 5HX7A 3IDSA 5E9JA 1CJVC 1PD1A 3DC2A 1ZR4A 4HR7A 3UY4A 1NXVA 5T7BA 1OXVA 2OGWA 4JYPA 4MUXA 1WXEA 2JLXA 2PKEA 2FZVA 3M3DA 5CVJA 3QPUA 2B7BA 3TI7A 3LWBA 4V2UA 1H2EA 4JH0A 3GJ7A 1GKUB 3OIWA 5ELXA 4DCGA 4ITVA 5CNIA 1T8SA 4AMBA 1EZ4A 2QUAA 3KT3A 3V80A 1OW3B 2VJBA 4FFLA 3KVOA 5CLGA 1XA3A 3LXMA 3TEFA 3ZDXB 4FINA 5L6LB 2R00A 2Z4SA 3REOA 1Y3HA 2H4XA 2FJPA 1FRZA 3GB9A 2BP7A 1RLMA 3IERA 4P0TA 3UB4A 4BFYA 4BZXA 1ECLA 1U0JA 3R77A 4UQLA 2CLHB 1IUKA 5AUNB 1NPDA 3F1KA 1IB0A 2PWAA 3PNKA 3R5HA 5JASA 1ORDA 3JD4A 2OCAA 5J58A 1AKRA 3A1WA 2V3CC 1NI4A 1I5EA 1Y4SA 1JPVA 1KFCB 2HTEA 2V5AA 1SKBA 4UD6A 1UKAA 4ZP1A 4YGXB 3VV3A 4IH1A 3BWDD 4JC0A 4JCOA 2JFBA 2N42A 4CDRA 1RFGE 1Y7LA 3I4LA 2IXDA 2YY6A 4GI7A 4G5OA 3HRKA 4IMIB 1TKAA 1N3IA 2H5LA 4MCAA 4XUGB 4C78A 5B58C 5CA1B 4O2BF 1G41A 1KJWA 3PDWA 4EMBA 3NHUA 3H2GA 2X0KA 2BZSA 3MGGA 4TWRA 2FMFA 4D4JA 3L8CA 1KDPA 1TZBA 3AIKA 4F3NA 2J9FB 3RYHA 4P08A 4LZWA 4AJPA 1TJ5A 3DVLA 3I0MA 3WL3A 2R6FA 2WDPA 1MC5A 1NXPA 3FYTA 2GPBA 4R1TA 4FB5A 2C98A 4AT1A 3D4OA 1NGSA 4ZYZA 5B55A 2DTXA 5A6VA 5JXWA 3GZTB 3F46A 1QH1A 1RZUA 2UVPB 4P0QB 3VYTB 2MSWA 3ZW7A 1R4NA 4WOBA 1YTLA 3UKOA 3EC2A 3KZMA 1SOAA 5HTKA 1FXUA 1YQUA 3G2MA 4MQFB 1KDYA 4RPHA 2JDIA 2PKWA 4RKWA 2B3TA 4P80A 3DEZA 3PNQA 4IDDA 3FOWA 4UCFA 4JLVA 3RSFA 3AOEA 1CHDA 1P61B 2F3RA 2Y92A 1PR1A 1PN3A 1G19A 1M1YE 3GH3A 3TNFA 4KDFA 2OQVA 1S0UA 2NM0A 2C9YA 2RHJA 2ES4A 2ZP1A 3QTTA 1I1HA 2IBSA 1P4RA 2VNAA 2W6PA 4ZQBA 5CFQA 4U39A 3ZUPA 4TVBA 2AFIE 4KIWA 1KBQA 5ALKA 5L3SB 3H97A 2Q27A 1SBTA 2WWGA 4UBLA 4M0MA 3EW7A 1WXFA 2B92A 3FX2A 3D0QA 4U7JA 1S5PA 1XNJA 1JTEA 3LL4A 3RSZA 1C0KA 3I3OA 1WVIA 1RYHA 1E3IA 4H27A 5AM1A 1O95C 1WCV1 2A0WA 1E7QA 1R4NB 1RM3A 2JIQA 3OJOA 4F4FA 4BVGA 4KRXA 3FTCA 1XYYA 3G1TA 4OXXA 5B37A 5AVKA 1LBEA 2XWSA 4U2FA 4BMXA 5CLHA 4U5QA 1NG9A 3C6QA 3CZQA 1JHYA 4ZYVA 5F1KA 4H7JA 4RZSA 3C3XA 1KEVA 3AM4A 3B85A 2IYRA 1ZO8A 2B0CA 2YWHA 5G0WA 5F73A 2C84A 3C3KA 3GT0A 3U49A 3I2IA 4MGHA 1K1EA 1EM6A 1PFWA 2QYHA 2J9YB 5H02A 4ZDWA 4CTMA 2QTZA 4I4IA 5AJUA 4AJ2A 4FC7A 5GVRA 4OHPA 5TJHA 4AM8A 4NARA 1CJSA 2QPAA 5AKXA 1N6RA 3DCJA 5JNWA 2EQAA 3O74A 4N47A 1BROA 4UHHA 2GZHA 4G4JA 1H2YA 2CK3D 2X2FA 2DQYA 3HDVA 2RKOA 2YVLA 2WSBA 1E5QA 2XE7A 2DLDA 3A7DA 1O3YA 4HDCA 4IEEA 2WHQA 3PWZA 4PWYA 2YV4A 4W8HA 3ROEA 1NUSA 1X7ZB 3VA7A 1AD2A 4P7GA 4DPMA 1GAQA 2GF2A 4I6EA 3G7SA 4FIZA 3HI4A 2HL6A 1PV2A 1IEVA 3JQGA 4UVDA 5ALNA 4Z4CA 1NHGA 2X8BA 1ZK4A 3A6GA 4D4LA 1G2QA 3NVMB 3TOZA 2HK7A 4CU2A 3KUCA 1VKZA 4PO3X 4KIFA 2PV7A 2YZ7A 4KE7A 3X1JA 1MHPA 3WL7A 3F3YA 3UC9A 1VE5A 1T6ZA 4MUYA 1IN4A 2IPXA 1ORWA 3PQ7A 4OP1A 1K7CA 3AUAA 1ICEA 4OKNA 5JDCC 1QR6A 2CCJA 1Z37A 3IPYA 3U81A 3AV3A 2LCFA 3H86A 4UASA 2P0YA 4JLSA 4HFMA 3EPHA 2VA9A 1UBKS 4ACBA 1QTRA 1U2EA 1KI1A 5TMEA 1X9HA 1T2EA 3P9SA 4TL9A 3UT6A 1IZ7A 4X3CA 1RZRD 2OCYC 1R0RE 4Q7MB 4QG7A 2HY7A 1WMBA 3CXRA 4IIEA 1JH9A 4JQCA 4Q1FA 3RYCB 2FPIA 4I5GA 2WVJA 2C0QA 4A1OA 4RD2A 4CQMA 1NZFA 4RSHA 4W4TA 1CY2A 1UZNA 4EUEA 3KCNA 2AOVA 3VC3A 3FSEA 4L02A 2NOAA 1VL1A 2H92A 4ZV7A 4OHZA 2C31A 3TDKA 4EIWA 4DV5B 1TM7E 1XAIA 3FUTA 4EI8A 2FW9A 4RKYA 4IICA 2A9VA 3GMTA 1R4AA 3OO0A 1PYOA 1L0BA 3GNSA 3PXXA 4BPRA 5F7XA 1KEKA 2BF4A 4LWPA 4X8MA 2BBOA 4F9EA 3HCDA 2YY7A 3TFWA 2DY0A 1ONOA 3WRXC 4I55A 3N7UA 1XWWA 1Y9ZA 2DKOA 3FPGA 3PTLA 4XWOA 4MGKR 2R6GA 3JQ8A 3K1AA 3PUYA 2PRYA 4WSOA 4EB8A 5IVPA 2INGX 3GRCA 2IH4A 3EXG2 4F6RB 3UOWA 3ND5A 2PXCA 4YAJA 5CM2Z 5FPTA 3TQQA 3WY9A 3MCWA 4DQ0A 2PDAA 2YYYA 2XYQA 4AJLA 1RXEA 2A57A 4P34A 4MR7B 4OLJA 1VHWA 2XODA 4ESHA 1RLUA 4QUKA 3SC2A 3Q3VA 3MJCA 4DBLC 1QUFA 2CNNA 1QE5A 3ANXA 1A96A 3AGQA 1LY1A 3MUOA 4CEHB 1RW4A 1QO0A 3QQPA 3RTAA 1SA0B 1YCFA 2QZPA 4Z4EA 1N3BA 1JFFB 1QWSA 2H29A 1U3TA 3RSQA 2OBXA 1HYQA 1E96A 4WJZA 1A2BA 1QIGA 1UPUA 2R96A 4IIVA 3TKAA 3PNOA 1QVRA 4JLAA 5DM0A 2Z4RA 4E03A 5HP4A 3UXHA 1Z0ZA 4G37A 4UCWA 2QI9F 3B5IA 1TKBA 4F72A 1QHHB 4F8YA 4UZEA 3HXQA 2VQFB 2PVPA 1YBFA 3GH1A 3LP6A 4V0NA 2Y9MB 5DASA 1GXSB 5E7JA 4WOJA 3RIEA 3RJ9A 3EZ6A 3WHLA 2IW1A 4BXOA 1OAKA 3P27A 5IABA 2JCYA 2P5UA 3RK0A 2ZSUA 1KR5A 1T0UA 5EJFA 5T5QA 3ILHA 3ZWKA 4DJ5X 2YVQA 3STHA 1II9A 1D1PA 1N2HA 1TQ8A 2QENA 2PS9A 3VR3A 2JKYA 3U0BA 1UUFA 3GJQA 1NF8A 2DT5A 5A5EA 1F0YA 4DV1B 3MYYA 1TYZA 1Z6TA 2ZB7A 3ZS9A 4X92A 1QKJA 2V65A 1J7JA 1GARA 1U2DC 4YJ3A 4RD4A 2ZRIA 2WM9B 3AF2A 2AN5A 2C42A 5J4HA 2J45A 4II7A 1BOOA 4DJAA 1J2YA 3JW8A 4KN8A 4M7WA 4D0LB 2PL5A 3MD0A 1KZ6A 3FXAA 3V46A 4L4ZA 3JRWA 1T1IA 4HVCA 4JLPA 4DV2B 1IM5A 1RRMA 2DBZA 1LX7A 4UDYX 3W04A 1LTHR 1QHHA 2XGGA 4ED9A 5IYZF 5CAEB 1R6UA 4XIYA 4B3TB 3VNAA 1F60A 4BXOB 4OFZA 1JT9A 5G1NA 3SE0A 4NPHA 2XUKA 3QSYA 2Q5CA 4QXOA 2O0LA 1FVXA 3OEED 2ZGVA 4J03A 3BMXA 3NR2A 4M98A 3AWIA 4QX6A 1KXZA 2P6RA 3HC7A 5DTEA 2IPAB 1JDVA 3ON5A 4X94A 5JCOA 2I6TA 4LRTB 1W47A 4NI5A 4DCNA 2XNKA 4FFRA 4LRWA 4KDCA 3WWYA 1KWGA 2BWJA 4Q24A 4J91A 3TGLA 1HDOA 2QRPA 2KI5A 3LPNA 1YCDA 3SZLA 1JDNA 1WMDA 1F48A 1UMBA 1HK7A 3NC1C 4KWEA 4WBXC 1DOHA 3L7MA 3RROA 3S70A 3V4VB 3QWIA 3ZBPA 3HBNA 3LW8A 2GM5A 1O89A 2VJKA 3MTEA 1GLVA 1SXJB 2V0GA 4Q9IA 3ZE1B 4RPIA 4BKQA 4DN6A 3PC8C 3H87A 4DB2A 4MRNA 1XC7A 3V8EA 1AMNA 1J8YF 5CAEA 3B3AA 5K8TA 1SVKA 3T9AA 1T9AA 2ZB2A 3AF5A 1A8HA 3O8OB 3KT8A 1X9GA 5HK8A 4FZ3A 4M1OA 3F7TA 4HF7A 1C80A 2WQ6A 5HRUA 2QRKA 2F90A 2CD7A 1N8TA 1QK5A 1SZJG 3RU9A 4JOSA 3TTUA 2E7ZA 2WIDA 1ORHA 3NCTA 5CB8A 4MVYA 1NOJA 4DY4A 3U09A 1NUPA 4Q4AA 3E70C 2OHHA 2WLTA 1LK0A 3AY0A 3ME5A 4L8LA 1Q7CA 4Y6SA 5EJ4A 1UXJA 4I6GA 1XZ8A 4ALNA 4EKEA 4LF4B 1ESDA 2BP7B 4NZMA 1IHPA 2BH9A 2NPOA 2WAMA 2CL5A 1NYLA 1NQUA 3RTGA 3T3DA 1HH4A 2P2SA 1U2ZA 1AURA 3C3MA 2HHCA 1ZUD1 4LUCA 1Z7BA 1JSRA 3LRTA 3VZBA 3MINB 3U40A 4XDZA 5AKGA 2AFRA 3EIUA 1N9ZA 2R86A 3QEMB 4ER6A 2J7PA 3R0QA 4PLWA 1MN6A 3IT2A 3VU9B 5JOQA 1U7HA 4MQBA 6ABPA 5I4IA 2ENUA 2QTAA 1S8OA 2OSVA 2QSYA 4WCFA 1CQPA 4FEGA 4OJKA 1B7GO 2EG5A 2GD6A 1C1HA 1IY1A 1EUCA 4DA6A 3BH6A 2WE7A 2QTMA 4BMYA 1LJ8A 2DHRA 1Z6ZA 4KOEC 3QEKA 4FDUA 5LDDC 3NNSA 4I7EA 5JPCA 5FWYA 2X86A 4DEVA 2RHGB 3WDMA 2Z1NA 1RPTA 4KBGA 2CXPA 1TYBE 4C30A 1O94A 5BN4A 4JFRA 2RONA 1EGMB 1OTHA 2WB4A 1OJ7A 2JFOA 4EAAA 3RYHB 1KP9A 1H2ZA 3T6KA 1J8VA 1B8OA 3KU4A 3WNVA 1CUHA 1G8KA 2JHGA 2R1TB 4M1QA 4TRNA 4ETWA 3SLKA 3SNKA 4HKTA 2IYEA 1KGSA 1X2BA 3X43A 3R9XA 2A14A 1ZKMA 4MI9A 3QEMA 1KEPA 4OYRA 3PC7A 1JJIA 1W88A 1YB4A 3SX0A 5LQKA 3OQIB 3TF5A 2OV6A 4NESA 4PM4A 2Q07A 3AEQA 4C9BA 4A26A 1L5HB 1YZLA 3BGOS 1I9GA 5FV4A 3FRHA 5C8VA 4FK8A 2WRZA 1PJZA 4LE1A 1XLVA 1F51E 3H2JA 3D31A 3LU1A 2R97A 4IS3A 1IRXA 1FTGA 3AJAA 1NBHA 4G9GA 4JA0A 4ARZB 4BGDA 5J43A 2ROQA 4OX9B 4RJJA 5CA0A 1DJMA 3TECE 5CTJA 5J47A 2JLSA 2PBFA 3C98A 1FSZA 3SXUB 3MTDA 4C22A 4F8EA 1VMAA 5GOZA 4Q34A 3USZA 1Y5RA 3EQZA 3CH7A 4E3WA 3EQ9A 3TGPA 1GTMA 5IXJA 2C9MA 4R0MA 3QFFA 3RIYA 3EFOA 4NEGA 2IODA 4I50B 1W73A 2VR1A 3GJSA 2GK6A 1LPPA 5IMSA 4RQAA 5D3QA 2O3TA 1R8JA 3MW8A 5JCZA 3IIKA 2COKA 4YJGB 4HAVA 2CDRA 1QNFA 5CCDA 1ZINA 2QVGA 1G1AA 2O6HA 3IP5A 4BNFA 1RRFA 2I2WA 2PG3A 1QRDA 2DUJA 2HPHA 1LNQA 2JFNA 2FSPA 1Q3KA 4LWOA 4IDAA 1N1DA 1UIRA 3MTBA 1SVLA 1Y3FE 2PGXA 3Q87B 4ZO4A 5TS3A 5IKEA 2XRZA 3GNLA 3KKLA 3Q8WA 4JLKA 2BGIA 4CM6A 5JZ9A 4WRRA 4DJTA 3G02A 2F4VB 1WXXA 2BUCA 2DQKA 4P4UA 4MUEA 2JK1A 3AHJA 1E3WA 1F3LA 3PHIA 1K7YA 1HDZA 2Q1SA 5CA0B 3RKUA 2ATCA 3HUUA 3HFGA 1P7YA 5IJ0B 3AVOA 2JHPA 4GPD1 1PF7E 3IILA 4FEYA 5HRCA 4ENVA 3ILSA 3CB4A 4R5MA 1GCGA 1KZ9A 1D0SA 1QQ6A 2JIDA 3BQ9A 1THTA 4TQ9A 5HZKA 2WWFA 2ZK7A 3PXCX 4OGFA 2A84A 3RC7A 4FONA 1Y8CA 2V9CA 5ISMA 1V37A 3DT6A 3NETA 3I61A 2QMUA 3NW9A 4NBLA 5TPWB 3K9FC 1B3BA 2YOGA 3KJZA 3ELYA 4IJQA 4RPGA 2FPLA 3VI3B 3NTVA 4RTPA 1GPNA 1AKEA 3BKWA 5EPUA 4DJDC 3L1HA 4GQIA 2AN3A 2DFDA 2AOTB 3EXIB 1M6VB 5KQLA 2ZRDA 2A5YB 3RJZA 1C7ZA 4RS4A 3WSWA 3KALA 5B30A 1N2CE 3R0XA 5D3ZA 1NQ5A 4K03A 4US1R 5F4BA 3LK6A 2BZ1A 2G04A 1P8JA 2R1VA 3DW1X 3IOCA 3VO8A 4CKZA 1ID8A 1ZD1A 4DNFA 3A2LA 1I51A 1PR9A 3G79A 1RWQA 3HU1A 5K51A 4C7MA 5CLLA 1NDHA 5HFJA 3D7LA 3PX7A 4OHWA 1GCAA 1OZGA 2BY4A 1GV0A 4KFTA 4D9JA 4XWKA 1EDDA 3OIVA 3AG5A 3OOEA 1JIKA 1GTZA 5IJXA 2IXBA 4IRUB 1M1ZA 1RAAA 2D59A 2ZRMA 2GJAA 4PYKA 4N0MA 3U44A 1POXA 1ICIA 2Y1GA 4IQGA 5EG5A 2O8CB 1JHVA 2E37A 1XFDA 1G0OA 3A25A 1JKXA 1G1MA 2OFXA 2WG1A 3EPKA 4ZALA 2PV0A 3ZIAD 1BCRA 4UTPA 3ONVA 1ZBDA 4J9VA 1Z47A 2UUOA 4FYMA 3Q88A 2VEOA 3L07A 4KW7A 4ZYXA 2P77A 5EPOA 2PBRA 3W8FA 1CUWA 1T6YA 4GFDA 2LGJA 3VSBA 4QTUB 3LBNA 5EYPA 4TQUS 4LKRA 2GN8A 5JO9A 3JAKB 4Q3KA 4YRBA 3DUWA 2P6NA 3DS8A 2XJ4A 4B9AA 4FJ0A 2NXNA 4CQMB 4QKQA 4LSMA 2D7JA 1ML4A 4V3CA 3VHLB 1SQ5A 4UBOA 1Y0BA 4GO1A 4KSCA 3ZHVA 1TYEB 1CUUA 1IFXA 3TSWA 2IF2A 2RHTA 4PX5A 3I6ZA 1RABA 3KSRA 2JLWA 4KODA 4AZTA 3C1TA 2CLCX 4NFYA 3UAXA 3LS2A 1L3IA 1U63A 3NVKI 1DU4A 1JVSA 1XYGA 5EIEA 1WULS 4PW0A 3U44B 1PGOA 5DTRA 5MN4A 3DMFA 3O8BA 3C1UA 1PVDA 4Q47A 1ZWLA 2PH3A 2WC1A 3DEKA 3QYJA 4Y2QA 3IAS1 1SIUA 2B4KA 3AKCA 1Z9BA 2B21A 1SQSA 3A04A 5FPYA 4NY1A 1TCVA 1YRYE 4AN0A 1D2EA 1X0XA 2J8ZA 2P68A 4P35A 5LA6A 2FFJA 1U0TA 3LVQE 2RH4A 3KAPA 1Y6JA 1T10A 2Q9UA 3QA9A 1C3EA 1Z5GA 4F71A 2NV0A 1THZA 4WIAA 1YQWA 2CUNA 3OH8A 4YCDA 4BO8A 2JLVA 3U37A 5T64A 1T2CA 3AONB 1V2GA 3ZGZA 1G64A 3ERCA 3ZYZA 1NU6A 2W8ZA 3DEFA 3L4EA 1BMQA 1GGEA 1FFCA 4W1SA 1RIIA 5E2BA 1KQGA 4DR6B 1GKIA 2V1UA 2R60A 1VYUA 3CF2A 1Y7PA 4BTLA 1KEUA 1JF8A 1KI7A 1XTUA 2Z30A 1S3GA 3A2NA 1NYRA 4OXNA 6GPBA 1HE3A 3NT4A 4PC3A 4RHUA 1HDCA 4TS4A 3TCNA 2B8JA 2P1ZA 4QYMA 3VJMA 3I64A 2FJ0A 1JDTA 2JIRA 2XWQA 1YBMA 3M9WA 4GI1A 4B1FA 2FWBA 2QQEA 4ZZ3A 2COUA 3VPAA 1Q22A 1RC1A 1FTNA 2A94A 5EUCA 3RFVA 6Q21A 1QQ7A 2G0AA 2I91A 4LFBB 1YDEA 2V59A 3FWHA 5GMOA 4HQNA 3RPEA 5BN3B 2GNAA 2ZWIA 3BEOA 3UKDA 1SRRA 3AERB 1N7HA 3CKYA 3OF3A 4EFLA 4EG1A 3ZXIA 4MVJG 1H69A 1ZNWA 1J2TA 1LRLA 3ADKA 1GNTA 1W44A 1IBSA 4WLNA 4DQKA 1BVRA 3GEGA 1CE8A 2G6BA 2VH2A 4JDUA 1W94A 4D98A 1UL1X 3DOIA 1JDPA 2QLLA 2IYSA 2V7UA 2VLIA 3F6BX 3GK3A 3KJHA 3OA0A 3FPFA 1AUQA 3WSVA 1Z82A 2VZ0A 4RD3A 3TBFA 3FOCA 2OBMA 2A9OA 4YUXA 4QECA 3AVTA 3PUJA 1PDVA 1RQPA 3H3XA 4X24A 4BB6A 1Z5WA 3G2JA 4PFKA 4LSWA 4ZHQB 4FGWA 1HLGA 2AEFA 2G80A 4EL5A 3DL0A 1A2OA 4WAUA 4O3MA 1GL7A 1LPSA 1BFKA 3MCTA 2HADA 3H1PA 3EVDA 4HNSA 2NQ2C 3GA5A 4MO2A 2B69A 1QX4A 4ER0A 1CP3A 2K6GA 1XB2A 4PGMA 4R2XA 1CS0A 4IZIA 1LPOA 2FZWA 3ABIA 2A5LA 3GFBA 1WE2A 2V1XA 3QMPA 4XSGA 4YMSA 2CLIB 5DGCA 5CP8A 4P83A 4C0QC 4B3SB 1X1CA 5H83A 1MABA 3KD2A 4AZ3A 5E6UA 2WWWA 4KR3A 2XD4A 3TOCA 4DABA 1RLJA 3B6IA 2JZCA 4XM2A 2GAAA 1JYEA 2OFFA 2WFAA 1G20A 3OZEA 4HLUC 3BWMA 5L53A 4PO8A 3ONDA 1M2NA 3C8UA 4JN6B 1PZFA 4IBOA 1FDRA 1M1YA 2QPOA 2Z43A 4P7JA 2CHQA 4RUKA 3WLSA 2PGDA 4FQ5A 4DLPA 4EI2A 2RE8A 1HM5A 4GUAA 3KE8A 3KYDB 3MWDB 1P18A 2QA5A 3SHOA 4EECA 1ZSYA 4D4HA 2ECKA 3C7KA 3NFRA 4YXWD 4IINA 1H1DA 5BT9A 4JYCA 2R6AA 4FKMA 2ETVA 1AH2A 3EEBA 1T1EA 1K3FA 1V8PA 1KRWA 3IKVA 1NVWQ 2GYVA 4QVGA 4XDHA 3E61A 4URUR 2ID8A 3E35A 3RASA 1N2CB 1QYDA 2NT3A 1QB7A 5HS6A 5BSVA 1JAIA 4FGZA 1U3DA 1T9GS 2R8PA 2ZUDA 2P4EA 3KYIB 2DP4E 4GMXA 3EYAA 4KK4A 5CYPA 1MABB 3K53A 4AZ3B 4JGBA 3S7TA 2TMYA 2WVGA 3BL6A 4IWNA 4YIHA 5THQA 3PE4A 3HMQA 1TO6A 1NBMD 3ODGA 1GDDA 4QBGB 1TMYA 4KVZA 1P2UA 3C70A 3THXA 1QCZA 3VU9A 2QVYX 4EHBA 3DFIA 3FWNA 1XKLA 1SY7A 5TSDA 4HUJA 5GWXA 1XMJA 1RM0A 2I9PA 4HGNA 1A9SA 2IUEA 1EUCB 4BV8A 3ILYA 5I7WA 1V48A 1WMAA 1C7IA 1I1NA 3I73A 2Q2QA 1IJEA 4AP5A 2ZU0C 1DRVA 1E7WA 3M82A 4YALA 3ZGNA 3DD1A 4Q66C 4LOKA 5FA5A 2ATVA 4I4LA 4TKMA 2VDLB 4OU5A 3TXYA 1N6NA 1IOLA 1NV8A 2GCIA 1VOTA 3R41A 4LGMA 4TSRA 5KNDD 1O6ZA 3BG5A 1U7UA 1YB7A 3D02A 4OKIA 3AR2A 2XGJA 1TVCA 4KXVA 4F1KA 1M8FA 1ZOLA 1XRSB 3VTZA 2QI9C 3FKSA 2BSQA 5CB0A 1ZH8A 2I1WA 1MH1A 1QANA 2Q5IA 1E9SA 1KFBB 4PG6A 4LF5B 1R12A 3OCVA 1HL7A 7REQB 3G5UA 3F8SA 4NLLA 3C5VA 1SN7A 1QG6A 5J2TA 4BRUA 3DZKA 4FZJA 4BFWA 3IEMA 1TU0A 1ECBA 2BFBA 4KGVA 3FFWA 1JKJB 3DLIA 3ZD8A 4MQEB 4BEWA 1PR4A 2Z95A 2VN8A 3DFMA 1TUIA 4TXMA 1CC1S 2ZR8A 2RGAA 1GSHA 3FSJX 3FYUA 2VP2A 4HZUB 1EE1A 1UT5A 4K87A 3AETB 4F2PA 1NVBA 1EXNA 3VO9A 2WMYA 5B2FA 1GPYA 2ZAOA 3H1BA 4C43A 1FSSA 3HHEA 3HVIA 5FP0A 4BMPB 3MYRA 1YB6A 2YQ4A 4RBNA 4HAZA 1ENPA 1NJ1A 4LG1A 4CCWA 4DG8A 3OQHA 2H52A 1N0HA 5FO1A 4C6TA 2VT6A 4G8JA 1DWUA 2YOFA 4IIXA 4LIPD 1I4WA 1S3IA 1Z0UA 1Z5ZA 3QXSA 1BXRA 1IJKA 1TQ2A 2WQ7A 3KWFA 4DRZA 1J4AA 1RM4A 1S96A 2VDUE 3D2AA 2P9JA 3NAZA 4AO8A 4QYXA 3LLMA 1QYCA 3A4LA 4MJXA 5BUZA 3L8ZA 3HTXA 3BICA 3S1LA 4ZDKA 4JYZA 4KQ9A 1O54A 4OJYA 2HT1A 4CQJA 1K8YB 4NG4A 4Q9JA 4AWAA 4R7GA 4EO4A 4KXXA 1JKJA 1C8VB 3MRVA 5E1MA 1N25A 1AS2A 4YPOA 2HJGA 3MWEB 3QHAA 5HJ7A 1NPTO 4MS3B 4U02A 3UXYA 1R10A 3I6MA 1Y5LA 3NHAA 4M76B 3LQ2A 5K8LA 2W2LA 2N75A 1Q0TA 1M8JA 2WIGA 2DWQA 1V2HE 4QUDA 1TGYA 1Y7HA 2GVNA 2QYSA 4MX8A 4XB1A 5I9BA 3S29A 4IDFA 1XP8A 4F2DA 4G6ZA 4O2BA 1XZMA 4NQZA 3WNQA 3QJYA 4MUMA 3SXPA 3K2QA 2JI7A 4XIJA 1KI9A 1MRZA 3DPUA 3W2TA 1JQ5A 3WB1A 1D03A 2WV7A 1E2LA 1GNVA 1GZSA 2PKRA 4KQWA 1SBZA 2YJTD 3HU3A 3EGXA 4N3GA 1XTJA 1YOVB 3L1VA 2FETA 3PWSA 4U2EA 4HFRA 3DO6A 3OM1A 3TIIA 4W5JA 1SUSA 3DVAB 1BHO1 2ZRPA 1TCBA 3E5MA 3VH1A 5EE0A 1R7RA 2H17A 1DJQA 3B82A 4DC0A 3F98A 1OBFO 2Z8YM 3PQEA 3RRJA 3G8DA 5KNBD 3WK4A 1D07A 1YZFA 1LDEA 1KYWA 3GGDA 3DR3A 1Z4QA 2IELA 5BV7A 2P3SA 1KI4A 1ZN9A 2DRIA 5BYJA 1OIWA 3S6JA 5DCWA 3FA2A 1UXOA 2BELA 3W7VA 3TLEA 1TJ4A 2GR9A 3CUSA 3O4IA 4HXYA 1W0KD 3KCQA 1Y37A 4C3VA 3HS3A 1I6KA 1CNFA 4BV3A 3EDCA 3RUHA 1SKUA 2TS1A 4P3OA 4ZRMA 1LBHA 4DUZB 1R0BA 1RPJA 1VJTA 5G41A 3UA3A 4UHDA 1EBBA 2BEUA 4HUQB 4DMUB 1PS8A 1E4YA 2BKXA 3ROPA 3L7KA 2X0IA 5CFMA 5ADWA 4QPPA 1H0SA 1GGNA 3QOWA 4QGFA 3LA8A 4LDRA 1M1UA 5C8DA 4A91A 2Y1WA 4KXMA 1VGVA 3KEFA 4L16A 1SUWA 2ZBEA 4JODA 1P44A 5KWJA 1P2TA 1FY2A 1Q19A 1KAOA 3AKEA 4E0BA 1R5BA 2QQGA 3BDAA 4FOPA 3H9JA 4M9UA 2JLYA 1UMDA 1JLLA 5B3KA 2NUTA 5JSKA 5IJ0A 1U0OC 4CLHA 2AX3A 4IIUA 4P1ZA 5EYPB 3K5PA 2Q7OE 3E3MA 2B61A 3CZPA 3P9RA 4J49A 1T9HA 1DKMA 4QXAA 2FFBA 3RAGA 4NAUA 2F3TA 4DR5B 5D8DA 5T67A 2QMOA 1JU3A 1YZHA 2GN6A 3MQFA 2X4GA 1P73A 1VJGA 3HGQA 4RLSA 1BWSA 3TD2A 3VOSA 2OILA 2FP3A 3L02A 1CD5A 2EEPA 3NGLA 4OQYA 1Q1EA 2XWPA 3I8XA 2XRFA 4D80A 2O7QA 3LQQA 5G2OA 2ONJA 2OO3A 5GJBA 3IJ5A 3IV9A 2MYTA 3E82A 2EX1A 3GUVA 1N6LA 3TW0A 1DG1G 4U7TB 1NVTA 1J8QA 4CTKA 2WTAA 2X1LA 3TD9A 2GPYA 5IS2A 5J2UA 3RGWS 4TTIA 3QM1A 1TTTA 2WW8A 1AKQA 1NVDA 3AVPA 3LOUA 2J67A 2WIJA 3G1WA 3IV6A 1APBA 1XROA 2XUZA 1ZXLA 2YZKA 3DXXA 5E4TA 1I80A 1J06A 1WHTA 1XTTA 3H8JA 1JB1A 1UEIA 2WA1A 5CK5A 1I33A 5KBYA 5FTNA 5CBPA 3W79A 3P45A 2H2HA 4QFDA 1IZZA 3DHWC 1HPLA 3NWJA 4XVCA 1OHHA 3KVVA 1SBQA 4TSFA 5HZGA 3PFHA 2AC7A 4PC7A 1SC9A 1AN0A 1JLSA 3KFXA 2BW0A 1R27A 5LFAA 2RH8A 2FMUA 1EB9A 1ULHA 2O7NA 5TT1A 3QEAZ 3FI0A 2QYTA 2VNIA 4DPLA 1J20A 2X9NA 4LQLA 2DH6A 1COZA 3PNPA 5F5XA 1DAIA 5AKLA 3AU8A 4A8JC 2QX7A 2Q3HA 1RBZA 4A2CA 2HPVA 4B75A 3VPFA 9LDBA 4EVIA 1NNSA 1GPDG 3DHNA 5HDQA 2R2AA 1YL7A 4IKEA 4KO2S 4RZUA 4Z4QA 1KTVA 1KORA 4IMJB 2IHVA 3ELBA 3LDGA 2QV0A 4M0EA 5LMCA 2QZSA 2AWNA 5CT6A 3RGGA 5DU2A 3OCUA 4TL7A 1G6KA 1UBNA 3TJRA 3V5NA 1IPFA 1Y3AA 3HZRA 4GZMA 3O3NB 2W93A 1CF2O 4UUPA 2RBEA 1VMDA 4RDCA 4PQYA 1NJ8A 5ICSA 5HNKA 1FDIA 5DM70 1XMSA 2SCUA 3I1JA 3H5TA 3TRJA 4RGVA 3LKDA 5DGXA 5IXSA 5B5SA 3OE7D 4OAPA 4G0YA 2BV3A 1XYVA 1U0LA 1QPZA 1KVQA 4Q4HA 3ZI4A 4JJ6A 3RSOA 1JMYA 5CA1F 3CV3A 5KYYB 2P9YA 3DTVA 2QL7A 1SXIA 4HNAB 3AHCA 3RG8A 3WYAA 1XN4A 4AG3A 2IQIA 1CUAA 3KTAB 1DJOA 2RCYA 4POAA 3W6PA 4JD5A 1OVMA 4KQIA 3EPRA 3B60A 1ZD8A 1JUDA 1K6JA 2V8OA 2F1OA 3JYPA 4LZNA 4UDNA 3WGLA 2O50A 1MTZA 2B82A 4JLDA 4MYSA 3AM3A 3E9EA 2FZCA 2F1KA 2QZ4A 1GGVA 2Q3CA 3REQA 3NBYC 3LWZA 1KYTA 3DZFA 4MW6A 2Z1DA 5HGJA 4Z9AA 5KU7A 3JSXA 3HR7A 1WW3A 4RCVA 1KPIA 2ODNA 4AJOA 1ZOPA 2J46A 3NC0C 4HD8A 2ETXA 4LY0A 4R9VA 2ODQA 1ZCAA 2LP4Y 2QJRA 2Z98A 5ESXA 3U4DA 1XPOA 3RU3A 1U3WA 4DDMA 4ZA2A 1JTFA 5EAIA 4UOZA 4G0ZA 2PQ2A 2Q3MA 3SHFA 1NMZA 1Z2PX 4N1AA 1EUDA 4FHEA 1IQUA 1W0JA 4OLFA 1U9ZA 3L04A 3P9PA 4EATA 3HO8A 2VHUA 4DLWA 1ESEA 4LF8B 3ZH9B 1E6CA 1U94A 3VHXB 4FGLA 4GS5A 2RAFA 2BGLA 3ZDCA 1JHAA 3MQ4A 3X1DA 1D6MA 4GGMX 4NKRA 1TF2A 5HSGA 2C4HA 1KTIA 3SVLA 4FP9A 1RKXA 4M54A 4UOEA 2XD9A 1M2VB 3IBGA 3HU2A 5FOSA 3CH5A 4I46A 2ICAA 3IAFA 2PIDA 2WEKA 2AG1A 2YNMC 3GWGA 3REQB 3HJCA 1JEAA 3H9CA 1P0FA 3OIDA 4DR4B 2CLOB 3SIXA 1VPEA 3L8GA 4JUCA 5ALRA 4R9SA 3IIIA 4I1YA 1YKFA 4FBMA 4RVHA 1QGAA 5JMPA 2V6FA 5EERA 1LPMA 2PZEA 5EJ8A 2VZEA 3GFPA 4ZAZA 1R8XA 4JB2A 3INNA 1N2EA 4UPDA 2OT3B 1HKHA 4XYEA 4DMHA 4BBJA 4RF3A 1N9GB 2G1PA 1J23A 5GONF 4MI1A 3B8HA 4TUYB 3W2IA 3IP8A 3RIGA 3V4RA 2Y3IA 4NFSA 2JFFA 4LZZA 2Q8NA 2WHEA 3GJ4A 4BNLA 1GPAA 3V1UA 2JCSA 1OFIA 3DXFA 1FSGA 3QVOA 1QDEA 4DR2B 5TF4A 5FIUA 2BJHA 3E9RA 4OUDA 2RARA 3AOEC 4V0SA 1AB5A 4UVIA 1LPNA 2HRDA 3VKVA 4BKOA 1QORA 5FBRB 1AK2A 5JNVA 4IDOA 1UZMA 1V4NA 4H7PA 1EBFA 1VL6A 1KSFX 2OD9A 1F0PA 2WSYB 3GIDA 4HY3A 4Z9YA 3T5CA 2DLNA 3UICA 1AG9A 1PZXA 2IV7A 4ER3A 4BYMA 5CJPA 3QE3A 4B7CA 4XUCA 2VUSA 3E8SA 3V7FA 1UQUA 1BE8A 5LLTA 3I04A 2EX0A 2E4VA 2M6LA 1VKNA 1KNXA 4L5JA 2QE7D 1NE2A 1PT9A 3KXDA 3M6IA 5CEFA 2BFWA 4D43A 2GJ4A 2UVPA 1DBRA 2HDHA 3A05A 3HDTA 3L4BC 4HAYA 4JVOA 2OYCA 4TUYA 1XRJA 2NXEA 1IPEA 3KZ1E 2QT9A 1WBDA 3LUAA 3I3SR 3CG0A 3H5IA 1X3SA 1NMSA 2XB9A 5DM4A 3EISA 3KDAA 4BV9A 3FTEA 1YQGA 4WH0A 1RHKA 5K3AA 1FFXA 3EF1A 4CV2A 4DGSA 1RLOA 2FEPA 4M1KA 4G5YA 2QNRA 3FPEA 4ZGBA 1QC5A 1RQRA 1ULAA 2V7GA 3EXEA 4LJLA 4E33A 3CHYA 4BPBA 1MBZA 1OVGA 3HVKA 5D87A 3EC7A 4D9EA 3DSRA 3LX8A 4PLZA 5EZYA 5LR6A 1NUQA 3A6LA 5CURA 5KQRA 4J7CA 3U1TA 3CLHA 3RF7A 4HQ6A 4GVX