3HXPA

Crystal structure of the fhud fold-family bsu3320, a periplasmic binding protein component of a fep/fec-like ferrichrome abc transporter from bacillus subtilis. northeast structural genomics consortium target sr577
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
272
structure length
272
Chain Sequence
YKAENGNVKIPKHPKRVVVMADGYYGYFKTLGINVVGAPENVFKNPYYKGKTNGVENIGDGTSVEKVIDLNPDLIIVWTTQGADIKKLEKIAPTVAVKYDKLDNIEQLKEFAKMTGTEDKAEKWLAKWDKKVAAAKTKIKKAVGDKTISIMQTNGKDIYVFGKDFGRGGSIIYKDLGLQATKLTKEKAIDQGPGYTSISLEKLPDFAGDYIFAGPWQSGGDDGGVFESSIWKNLNAVKNGHVYKMDPIGFYFTDPISLEGQLEFITESLTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron(3+)-hydroxamate-binding protein fhuD
publication title Northeast Structural Genomics Consortium Target SR577
rcsb
source organism Bacillus subtilis
molecule tags Transport protein
total genus 56
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2009-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 3hxpA02
2OV3A 4HMOA 1PQ4A 1G20B 3LI2A 1QH8B 3LHSA 4OXQA 4HMPA 4WZAB 3U7QA 3HJTA 1N4AA 5KOHB 1XVLA 2Q8QA 3MFQA 1QGUA 1M1NB 3PDIB 4WESB 1PSZA 2R7AA 1KAEA 3GI1A 4INOA 1K0FA 3AEQB 2XH8A 2X4LA 2XDQA 1QH1B 3AESB 4XPIB 2AFIB 1G21B 2ETVA 2PS3A 1L5HA 4B8YA 3AETA 1M34B 4TKUB 2PRSA 5HDQA 3K1AB 4TKVB 4OVKA 5I4KA 5BVHB 4CL2A 2WI8A 4WESA 3MINB 4MDYA 2AFHA 3PSAA 4PAGA 5M3BA 4NNPA 2WHYA 3ZK7A 1ESZA 5JOQA 2M6LA 2OGWA 5KHLB 2AFIA 1KAHA 4WNAA 1M1YB 2MINA 2PS9A 3HXPA 2XQVA 5KOJA 4HN9A 2XV1A 3MWGA 1EFDN 1FP4B 3AERA 3MINA 5JG7A 5M34A 1MIOB 3AEUB 1G20A 3ZTTA 2XY4A 1N2CB 3CX3A 3R5SA 1QH8A 4MLZA 4K3VA 4ND8B 3EIXA 4WZBB 4WZAA 2QI9F 5GGYA 5KOHA 4G07A 2RG7A 1M1NA 3PDIA 3BE6A 1H1LB 4WN9B 5CR9A 5AFSA 3AEKB 3R5TA 4H0FA 3NU1A 4UTOA 1K7SN 5JPDA 5M2QA 3AEQA 3G9QA 1FP4A 4MO9A 4PM4A 1N4DA 3HH8A 4G09A 1QH1A 3AESA 1KARA 5CX1B 5BVGB 2PHZA 4XPIA 1G21A 1M34A 4TKUA 1TOAA 3K1AA 4IRMA 4TKVA 5BVHA 3MWFA 4FKMA 3U7QB 4UDOA 3TNYA 1QGUB 2YNMD 2XUZA 3TEFA 5GGXA 2YNMC 4MX8A 4OXRA 2XDQB 1N2ZA 2Q8PA 2OV1A 1M1YA 3PSHA 4M7OA 4N01A 3MD9A 5JJ5A 4FILA 2R79A 4BBPA 1K75A 1L5HB 3ZKAA 3AETB 4GICA 4LJSA 4FI3F 3BE5A 4DBLE 1MIOA 3UJPA 3AEUA 3ZK8A 4H59A 4INPA 1N2CA 4UTPA 2AFHB 2OSVA 3TLKA 2PS0A 4ND8A 4WZBA 5M29A 3ZK9A 4HMQA 5B58T 3EIWA 4UDNA 4FNAA 5HX7A 1H1LA 4WN9A 4WNAB 4LS3A 4NNOA 3AEKA 2M6KA 2MINB 1K2VN 5FLYA 5KOJB 5CX1A 5BVGA 2O1EA 3AERB
chains in the Genus database with same CATH superfamily
1RFLA 1PWEA 2EVWX 3HGTA 3OPXA 3OQHA 4WTOA 4EM6A 4CMJA 4ZYUA 2CV2A 1WR8A 3EFHA 4HL6A 5AICA 1K8XB 5B3AA 2MSEB 4BQNA 3IFSA 1R0RE 2Y1XA 2OFXA 4N03A 3HDGA 2XSZD 4PHGA 2VUUA 2FSUA 4MITA 5TC4A 2I80A 3H5VA 4N12A 1J5PA 1JXOA 1KYTA 2FUEA 2IX9A 2YMLA 4N9QA 2NNLD 2VDMB 4QXAA 2NUTA 3USZA 3EZ9A 2EFJA 4E09A 1JVSA 3B2EA 5JH7A 3D5TA 4IPTA 2R1TA 3D3NA 4Y0NA 3BB4A 1WZ2A 2WNHA 1SUIA 3C97A 3G1UA 3OU6A 1Q3KA 3DJFA 4OEHA 4WK2B 3RC3A 5D3ZA 3BQMB 1XYVA 1RHKA 5ELXA 3KV3O 1JA9A 2YXDA 3BMCB 3CN9A 5DBFA 2QTNA 4D3XA 1MVLA 3MSCA 3P2IA 1Y1KE 4IGAA 4LKRA 5HE9A 1XRSB 3MTJA 3VHRA 3U19A 3ENKA 3T7RA 3D2BA 2WT9A 4P4NA 3VOSA 5T4FA 4GL2A 1SCAA 4EF6A 2B99A 2JGFA 4CKYA 4K9KA 5FWAA 3TTVA 1TM7E 4BAGA 2FPRA 4MJ3A 3SZGA 1D2EA 4RD4A 1OB5A 2G9RA 1GG9A 3WY9A 5CB4F 1GN9A 3JQ8B 4BFCA 4LV8B 4AWBA 2X1LA 1OIWA 4ZVSA 4DWJA 2UYCA 3P9NA 2H2WA 1JSLA 1H2RS 1M0WA 2M1XA 4JJFA 4DL9A 1OY1A 4DLTA 3R7NA 2OBFA 2WFLB 2Z2IA 2QN3A 4R83A 3NTRA 3H6HA 3R0QA 3HL4A 5HIMA 2IJGX 1VYVA 3HP1A 3ADOA 4MR7B 1T5DX 3K0AA 3NHYA 2V7WA 3IP3A 3WBJA 1H66A 2NWQA 5E9QA 1A4XA 1QH1A 4QATA 4L9RA 1YQXA 4U39A 1DADA 1Y3BE 3DZGA 3PQ3A 1S9DA 1MJGA 1T8TA 1ES9A 3LMKA 3QYFA 2H4FA 4TKUA 5IJWA 5JAZA 1THTA 4R3WA 3ZBQA 5T8KC 3RUDA 3P2YA 1E9AA 3W8NA 4US0R 1QAQA 3ESCA 3ZE6A 1OXUA 1C9DB 1RQ7A 6NULA 1QNFA 1TZCA 2V4UA 3DVAB 2NM0A 4C30A 3GEBA 3C3BA 1M2WA 4WN3A 4DJFC 3VSDA 4JJKA 2V96A 3QU9A 3MD9A 1DWPA 1ZRNA 1JR3A 5DTJA 4ZOBA 3ASVA 3FUXA 5AW7A 1T10A 3PD0A 1II8B 4RE5A 4F3CA 2X0IA 1YOVA 1TLLA 2IVFA 2AFVA 3GRRA 4G2TA 4TUYB 2EF1A 3E9EA 4K05A 1UPUA 1RMQA 2I2DA 3G7UA 2PO7A 3E3MA 4UCXA 4MV5A 4ZZ1A 5HCIA 1SZCA 5EXPA 3VR2A 4M9RA 3O6VA 3S2EA 2GXUA 1PE0A 2I8CA 1EM8B 3MS7A 1D3AA 2VHJA 1ORVA 1H1LA 2UUBB 1DT5A 5I5GA 1VFNA 3ZBUA 2RB5A 3EVEA 4DIKA 3MGAA 4MMZB 3I9OA 3L4SO 4BQSA 2NACA 3C16C 5KOJB 1KP3A 1U0FA 2QVYX 5HCNA 3OSZA 3ORSA 2ZVQX 3DB2A 2WWTA 1VHDA 1VE6A 2QI9C 3HSYA 2V7BA 3BL6A 4HH3C 5FX2A 3HJHA 1ZDMA 3R3XA 4ND1A 2ZI7A 3WBKA 5ALVA 3M6WA 2I3AA 1DEHA 1XZJA 2H2FA 2JIDA 2DUMA 4HMPA 2E3JA 2WNSA 3UPTA 2Z2XA 5K3FB 3C1TA 5LXTA 3E7WA 1A9XB 3F3SA 5EKDA 3JS5A 3HKBA 5TPWA 3H2YA 1W1UA 3LOQA 3P4YA 3VMFA 1US8B 3MT8A 2PRZA 3HI6A 4QPZA 3BGIA 4JIMA 4S1TA 3RT1A 3ZXUB 5PNTA 3WLMA 2VXYA 5FFFA 5KQPA 7MHTA 5FPQA 1X2BA 2WTEA 3KLOA 1T8YA 2ZCVA 2A9VA 1ZNXA 2F8LA 2QW8A 3DR3A 5CT9A 4J0FA 4MDHA 4B2YA 1NZDA 4GSLA 3BGWA 3C98A 1P6XA 4UBOA 2H7VA 3DHEA 4DTCA 4D4IA 1X6VA 1CNEA 4DE5A 4TZ6A 1UBSB 3NYQA 1E2GA 1QCDA 4L08A 4UARA 2JLUA 2IW1A 3T9BA 3KJHA 1RJGA 4R1SA 3MJ4A 4U6QA 3PYXA 4U7WA 4BCBA 1B14A 2P9EA 1Q1QA 3AFOA 3CTMA 1JLLB 3E23A 3D1LA 3K32A 3PWZA 1L5VA 3ASYA 4L0MA 3K0FB 2XQVA 2NZYA 3UH0A 1NWCA 2PZJA 1H69A 5EKXA 1HE3A 1C30A 2EQBA 2QIOA 2IHTA 3CWZA 3EQ7A 1E5TA 1FP4B 1XCBA 3ESYA 3OY7A 3PJDA 2OCAA 3QVUA 2EBWA 2RBGA 4BBJA 4DVJA 4F9FA 5BV8A 2YYSA 5CXUA 2GYYA 1DIAA 3I2IA 3FOAA 3JD3A 3VJMA 3DP9A 4B09A 3WGYA 4LOHA 6AT1A 1KYQA 2B36A 1YB4A 3HHPA 1FDTA 1J0XO 2BDUA 2PKYX 3E3OA 4OFZA 5IAJA 2WIBA 1A9RA 2I78A 3HTXA 2KBFA 1ZLYA 1ZI9A 4QRIA 1E66A 4EZIA 1HY3A 4YMTA 4TLAA 2BF7A 3QHAA 5JJCA 1V9SA 1O2DA 2HNKA 2Y4NA 4H27A 2ORYA 2DJ5A 2Y76A 3LRTA 2FW7A 5C2JB 3ZU2A 1NTRA 1NJSA 3B60A 4KAXA 4RF2A 3EVBA 3LVRE 5AM1A 5IZCA 5F73A 1GAQA 4FYHA 3IDSA 2NT3A 3IVCA 3CG0A 4N0PA 5E4YA 2X5KO 4TSRA 3BIWA 2FFAA 5T64A 4EHBA 1D03A 3ZUGA 2EKZA 4ZVOA 4YDSA 2GA8A 1U0SY 2FDRA 3FCCA 3UMMA 4AI6A 3IQZA 2AEJA 2B35A 3L0PA 3QITA 2IUYA 1Z62A 2AI3A 2O4CA 4RQUA 5KAMA 1DC3A 2I76A 3H2HA 4PXSA 1IOZA 2QTMA 2CMKA 2QBYB 4BO5A 1Z6QA 2GHIA 4BBPA 3DP7A 1HYGA 3GFRA 4ZQCB 2JLVA 1M8KA 4IX9A 3LOPA 1WUIS 2A5YB 2NSHA 2C4UA 1GKYA 2WIFA 4R8VA 1Q7CA 2OSBA 3BWYA 3VSEA 3GLKA 5FOXA 1BXRB 1PJSA 5B12A 1Z38A 1E2KA 3OQPA 4D3ZA 2FKNA 1F2TA 2JLBA 5F5LA 3H13A 3N5KA 1BC5A 1RYFA 3QVXA 4PG4A 1BHSA 2PX4A 4YI3A 4TQ9A 4HEJA 1A82A 2H1WA 2ZUTA 3QLUA 4EKNB 1U6IA 1L7MA 2O7NA 3G2HA 1G5QA 1H5UA 2WLSA 1TZ2A 3NTVA 2AUMA 1SHKA 2GD2A 3C70A 2D2IA 5CTJA 3D4PA 1NP6A 2C95A 4G41A 1U04A 2R6DA 2RH9B 1COZA 5I7HA 2PRIA 3Q3GE 4EPYA 1H8EA 3EXEB 3DEYX 1DBVO 3TZBA 2R5NA 1NMXA 2WJIA 2ZR7A 4ARUA 3WGGA 1HDGO 2K7ZA 4YDRA 4FKZA 4PW0A 1QKIA 3MRTA 2FPSA 3L7LA 1UT6A 4FEGA 5TEVA 3BE8A 3ZE1B 1VB3A 1W96A 1XUOA 3MJTA 1L5KA 2O3UA 4ZRMA 3BH0A 4YBZA 4TV9B 3K6SA 4LGMA 4RDHA 2YV1A 2FH5B 3U4AA 3A1WA 3PC6A 3WWDA 3AHCA 3C7AA 5JWHA 4B73A 3MOIA 4F21A 2PS3A 1AHHA 3IBGA 2A3RA 3TLGA 4LK2A 1N1DA 3GLFE 1V11A 1T9CA 3FKJA 4C7OA 4P0QB 4C2TA 1E5QA 4F6CA 4GRIA 4PLYA 3NBUA 4LJ7A 4ZO9A 3VDQA 4OK6A 4Y9UA 5E7QA 4DARA 2Y0BA 3N2ZB 4FGKA 2OGUA 4BX8A 4Q00A 5TS2A 1KFBB 3I30X 3DMFA 3R76A 3HJRA 4ER3A 1ESZA 3C85A 1KQGA 1LPNA 4YMVA 3CM0A 1UJ6A 4PO9A 4MARA 3IL2A 1FRVA 1TVKA 3E9DA 3UJ3X 2VYQA 4YJHA 1QR2A 2GUWA 4FBLA 3IE2A 4DSAA 4EF4A 1UQTA 4YQYA 1C8BA 3DLPX 3OCYA 3CF4G 3IV7A 4N0EA 4BTVA 1JDBB 1AGNA 1UT5A 3IA2A 3KJZA 2WAOA 4DLRA 4WZBB 4MCJA 4RTQA 1ZH6A 3MLAA 1A8UA 2A4KA 3TNFA 4ON9A 4IUBS 5EHIA 4NYMR 4KRGA 4W9MC 3R40A 2QTCA 2SICE 4MKGA 4X1IB 5EMJA 1AK2A 2PKRA 1I0IA 2VXCA 4RPKA 1E3EA 4D4GA 1MDBA 4WT7A 1J6UA 4HQNA 1A8PA 3K35A 5IKPA 5KUTA 3OOSA 4R1MA 3VR0A 3KUXA 2COUA 3SFTA 3ZVKA 5B57C 4Y2UA 4J0JA 1P8AA 4CDNA 3C3KA 3KVVA 4KO8A 2EIXA 3Q7TA 4LTDA 4PRYA 3UV7A 1K7YA 5DGXA 3R6DA 4UDOA 1QU3A 3A7EA 2A6PA 5JS1A 2P3OA 1RACA 4JI7B 2E37A 3THYA 3LHIA 4EO9A 2OGZA 3B6KA 1ZN9A 2QMQA 2PUHA 2R6CA 3OFNA 3PL1A 5EIEA 4WOCA 3V3KA 1AKWA 1P4SA 2FPPA 3WLJA 2XUKA 1SIWA 2QU7A 1O6FA 3HB5X 4RH3A 3BE5A 4TKLA 1LSUA 4FFMA 4XM0A 1O6CA 2ZIXA 4EYOA 4NBKA 3UCXA 2QVGA 4QEZA 2CHEA 1E63A 3PRYA 5AI5A 1L9XA 2QT9A 4D9CA 2ZRQA 4N0MA 5IN4A 1DRUA 1D1PA 1QQTA 2XVZA 3NTXA 1V8DA 3R6LA 3EG9B 4F4CA 4G5GA 1ODCA 1K97A 1YHYA 2X76A 4LJYA 3VVCA 2O8VA 4KXVA 4CG0A 1WCIB 1XZMA 5KYYB 4DZRA 2QUKA 2GEVA 2IYEA 4ND7A 1TEZA 3O8QA 1E2QA 2DTDA 2XA1A 3L4EA 2A9FA 3H2IA 3I1FA 2QZJA 4NABA 2YWJA 4QUDA 2VF4X 4G1MB 3U81A 1JDPA 2Q27A 2C2XA 3LUKA 4TLLB 5EWLB 3ZU3A 2WQ7A 1ZWKA 1ZSNA 3AI7A 2ZJOA 4AY3A 2C3UA 2QUAA 3EVAA 3FY4A 3HRKA 4PPNA 4WNYA 1QGYA 4YRCA 1MABB 3JD1A 2PL9A 3ZQJA 3GCGA 2GEUA 1U3WA 2NUAB 1CLEA 1RI2A 1EFRD 1N5RA 2J4FA 3ANTA 3BB3A 4KQJA 1F2DA 5FHRA 4PLWA 2ECQA 3F7MA 4OYRA 2J5BA 4RK0A 3VPFA 3LCMA 4MWSA 3DCYA 4WEOA 4B3FX 3FVWA 3V8NA 3MJFA 2C97A 4OSEA 1QAOA 4MKIA 3LPNA 1LU9A 5BW4A 3IC5A 5FQNA 3UOAB 5JALA 1WUYA 2NVBA 2HTFA 4FFDA 1OIVA 4CIAA 3KEMA 2WYIA 1KY2A 3HVJA 4JLJA 3WJ2A 1XMOB 1MQ9A 2HMYB 2QRPA 1IQUA 2Q4DA 3F6EX 3BWCA 1ZMTA 5LP6F 1C9JA 2Q6KA 3QZUA 2GRUA 1UPXA 3GELA 5TMPA 4F3NA 2QN1A 5IVKA 1DXHA 8GPBA 1Z6ZA 4NULA 3OE7D 2ZJAA 1I6KA 5JECA 2BEVB 521PA 1MAUA 1OIXA 1SBNE 4QOJA 3A2MA 4DA8A 2DWCA 2NLOA 2AEEA 2AXPA 6YASA 5A7FA 3K0KA 1GPNA 4DIOA 4R9SA 5JDIC 5CM9C 3HN7A 3KYDA 3PUYA 1ST2A 2OZEA 3AG5A 5HKBA 2Q9BA 4H9GA 3GDWA 3ZEIA 4MLZA 5ULLA 3HJGA 2CD9A 1CQJB 2IF2A 2RK4A 3D64A 1NKVA 2VWHA 3LL4A 2A78A 3D4OA 1S8OA 1T1EA 1Y3FE 3WOVA 3QENA 2UYGA 3BRWD 1SVNA 3ZNQA 1NUTA 2PFSA 2GZAA 2UZ1A 4C0AC 5DNVA 2OBMA 3CLSC 5ECYA 5FPYA 5I47A 1LBSA 2BC9A 4B82A 2RHHA 1LLDA 1V3UA 4NS1A 4JV5B 2CDCA 1FP6A 3R0JA 4OHWA 4C01A 3B5EA 5AJYA 4TQUS 3T7KA 4DRYA 4WJLA 5JSZA 3VR4A 4R16A 1H9AA 2YFHA 1GITA 3M9XA 3EZYA 1HM5A 4IIDA 4TV8B 5AQEA 1BNCA 1TUBB 1JI0A 1OKKD 2I2FA 4PLPA 4YACA 5EEGA 4LDJA 3ROMA 4R5HA 1G5RA 4MRMB 5TQ0B 4JR1A 4PZLA 3REQB 3BDIA 2X13A 3OH8A 3IQEA 4HSEA 2FFRA 3MQFA 2VYNA 4YJGA 4B3IA 3CKKA 4MS1B 1HZZA 1Z68A 5B3JC 4DR7B 4ES6A 6PFKA 4PNPA 3HA5A 4LYHA 4JYCA 5DW0A 4NYJR 1UBHS 2AR9A 3VISA 1J2UA 4H7PA 1JAZA 4WASA 3FIUA 3IHTA 2VLIA 2F1HA 3W5HA 1RLIA 1SPXA 2F3PA 3Q7PA 1R6VA 3ANNA 3G0GA 4WOJA 5GJWC 2H2AA 2XNHA 4DQDA 1AS0A 1UBCA 2WJZB 4LJKA 2ZE8A 3CVVA 5LB2A 2H8KA 4KJZA 4PZPA 6LDHA 3KR2A 1PVDA 4LWPA 5D3QA 1E0KA 1JR2A 1NMYA 2RGUA 2HFJA 3I9NA 2GILA 2FF5A 3S55A 1KO4A 3NC4A 2C4KA 2PMDA 3E2IA 2PH1A 4IX1A 3VNVA 1UBRS 4FNMA 1PSWA 3ZCRA 2AOUA 3ADKA 3CLHA 4OL9A 1XVTA 3AOGA 1C81A 1O3YA 2QLJA 3LI2A 1M76A 4U2KA 2TECE 4IDPA 4FHCA 4ZVTA 3K16A 2X0DA 2JFGA 4C07A 1LLQA 3K4HA 3IBSA 5LQNA 3FYUC 4XJTA 3RC8A 3KCNA 1SQ6A 2WILA 3EBOA 3COPA 3BSYA 3TIXB 2IBSA 5AW5A 2HWXA 1ACLA 1LBQA 3S1AA 3IT1A 3ZHRA 1SR8A 4LN1A 1M2VB 2QT1A 3WAKA 1QZ3A 1CJSA 3AETA 1QCYA 3KUUA 4FKBA 4TTPA 4DJ5X 4DCMA 3MUEA 1JMYA 3HCWA 3U37A 5CP8A 3EF1A 1QX3A 3GFGA 3OAAD 5DULA 2O7VA 1YAJA 1XA0A 1NXPA 2E6KA 5HKKA 2F8SA 3NEYA 4ZYTA 3SZ3A 1ZPDA 2G1AA 4Q9IA 4UKDA 3S29A 5IF3A 5JDCA 1E5XA 1UXIA 5KYVA 4ZK2A 4FI3C 2ID4A 5KU1A 4D4LA 4E7OA 1DQPA 4G2NA 1ICIA 1NVFA 221PA 2JZCA 2FY8A 3WLPA 4BEJA 4GOOD 3HC7A 3M83A 3R20A 4QNMA 4UE2A 5CDFE 1GTJ1 4BO2A 1JSRA 2FDXA 3H2JA 4OPMA 4AJ9A 2R4TA 1JA0A 1QLHA 1D1TA 1EB8A 3WDLA 2DC1A 4CCWA 2OO5A 4J49A 1KBOA 1E58A 1T5BA 5A7GA 2FEXA 4CMEA 4EY8A 2AKEA 2DJIA 2IZZA 3ONNA 4CL3A 2C3YA 4YBRA 3W7BA 2OHGA 2O2DA 3D02A 4OA5A 3FPAA 3MA0A 3AEKB 1K63A 2ZT6A 4B0OA 5IT5A 1SBZA 2FW6A 3OZUA 1T6XA 2GWHA 1AF4A 1DQYA 2CLMB 2KSQA 1YDGA 2X3UA 4NLLA 2JG3A 1QLWA 2HA5A 2RJ3A 4KFTA 4P93A 4O1IA 1JHOA 4FR5A 1JIKA 5AKXA 1JJAA 4BNWA 4HN4B 3VRHA 3UWDA 4BGIA 4E5NA 4BP8A 2YYAA 3A4NA 4LBVA 4S0XA 4A6XA 4CNQA 1GTG1 2ASEA 4EAQA 3IPCA 3KQWA 1PGPA 1BMFD 1VIYA 1QGUB 4FDAA 1G9SA 3UATA 2XYPA 4NPCA 1JECA 2ID8A 3WZLA 5KYXB 3VKWA 1RWXA 4JMPA 3HEBA 1U4NA 2XMBA 4W82A 3CVUA 1M54A 2Z2YA 1YACA 1XRQA 4OQQA 1NN5A 3FLAA 2OV2A 3IVXA 2CEKA 2X5JO 3TFWA 3I28A 1ESDA 2J5XA 1U2DA 3R8XA 4E3ZA 2O9JA 1RQNA 1ADJA 2CJFA 3W90A 3JVVA 1QV7A 3TPFA 3BQNB 1FFBA 1TM1E 1V2HE 3GMSA 2V3CC 1ACJA 4U6SA 3QE0A 4Q9KA 4FQ7A 2FSSA 1E2NA 1WY7A 1SU4A 2YJNA 1PR2A 1QPGA 5DYIA 4EGAA 4HJXA 2B4RO 1Y82A 5IT9A 2JKZA 2ZI4A 4RO0A 2E85A 1RC0A 2HWYA 4XWWA 1YB2A 3D6MA 1NN3A 1R8XA 2CFOA 3E9QA 4HQRA 4PTLA 3TQOA 2BH2A 1JI3A 2J4CA 3CLRD 3KR1A 3RYFB 4AMBA 1G9XA 3WLQA 5JTTA 1QYVA 1OILA 1VA4A 2X6RA 4XFKA 1RC8A 2FKAA 4DABA 1WXHA 9GPBA 4KFCA 4DUGA 2OFWA 4JQOA 2OL4A 1IYZA 1ZD1A 3OKAA 2WJHA 4PLGA 3D5EA 2HZBA 3CUSA 4LZJA 4HWKA 4RHXA 2FI1A 3DT9A 1ADGA 3K0CA 2NXWA 5H7XA 5J1TB 4YIHA 3F96A 3OZGA 4JITA 5C18A 2Q7DA 1MP0A 1KY5A 4D99A 4DZZA 1FUUA 2VJMA 4L8YA 4MLCA 2RCYA 1D4FA 3O21A 1TPYA 1W6RA 3CZMA 3FGZA 4URXR 4CQLA 3STWA 1IFXA 5JQGB 1G7TA 4M99A 3SF0A 4YMHA 5AIBA 2II6A 1U3CA 1PJAA 2XIJA 3BIFA 1LWOA 4ZI5A 2FP3A 1BVRA 3NH6A 1L4NA 4QOSA 5HMMA 2OILA 1X1RA 3QLVC 1JR3D 3VOAA 3TO5A 2Y4OA 1UANA 2PH3A 3KM0A 2KMLA 3LKDA 1Y63A 1OU0A 4KMMA 3OE5A 4R7TA 1EFVA 5EY5B 3CKLA 2RGXA 3QTBA 5EJFA 3BGVA 5BWLA 3KOZA 2WF9A 1R27A 4JMLA 4L27A 4PHFA 4EB6A 3BWBA 5K6AC 3I5XA 1YT5A 1LBEA 1UZUA 3VR2D 1TVMA 1WU8A 2A84A 2Q07A 2A67A 3IDOA 1RJDA 3BMOA 3I42A 4BV2A 2NIPA 4CV1A 2P62A 4RGBA 1I5RA 4Q1BA 2D7DA 3FBGA 3WTBA 1I0ZA 2N47A 1GARA 3C41J 4CKXA 4Q4AB 5GJBA 3D6VA 4MHOA 4XGQA 4EJ6A 2OXRA 3GRCA 2I4OA 3HQ4O 1NW7A 2R11A 5CEEA 2LTAA 2P40A 5AESA 3ZCSA 2BRUC 5DN6D 3BC1A 1BKYA 1XDGA 2SECE 5K3AA 1XQ1A 1O03A 1GYPA 3G17A 1AO3A 1UBEA 4NCBA 1LD3A 1E1RD 2EX0A 1T2DA 4H3SA 3MCWA 4N5IX 3OT1B 3T9DA 1XJCA 1ZC3A 2GDJA 5KWJA 2B2CA 3EQ6A 3A1UA 4H35A 3K09C 4EOGA 5AMXA 2AWOA 4JCCA 4AWXA 4TXHA 5FWYB 3TTXA 1X80A 1BYIA 3RGGA 4CF5A 1QP0A 3G02A 1Y9AA 4G65A 3X1XA 2VAXA 4YJFA 2FX2A 2G6TA 3CISA 7REQA 5E2BA 2AC2A 2PQMA 3DCIA 4XJXA 1CZRA 2W83A 3GQBB 3JD0A 4FVTA 1N7IA 4EO7A 2MSDB 2WIKA 3HCCA 2LCIA 3OP4A 4JVLA 5CVTA 3GV0A 3E27A 3G79A 1T13A 1KEKA 1SD5A 5ES4B 1OBCA 1PBTA 1PFYA 2CVQA 2OWEA 2PA0A 1N6NA 3LT0A 3UC5A 3K2BA 4QAJA 1Z6YA 1KVQA 1MIHA 4Z7JA 4BJ6A 4UDNA 5CJPA 1YL7A 1NRXA 1U2GA 1W85A 2CY0A 5KNBH 2A1IA 3HVIA 3T38A 3LL7A 1DAPA 3GJZA 4BMXA 5KDDA 4UBKA 1SC6A 5DDIP 2YW2A 3TLEA 4NZMA 1N32B 3A04A 2FP4A 1P7ZA 3S2ZA 5EFZA 1UKBA 3AF0A 1DPFA 4GOMD 5EIBC 1ILWA 4DEVA 4DG5A 2POCA 2BONA 1EG2A 3E8SA 2X9VA 1YDWA 3I4FA 1TZKA 2ZVPX 2Q0XA 1WBJB 4HDMA 2WUEA 3DO8A 1UZMA 3Q6MA 4JOCA 2Q50A 3T4UA 4NTZA 1OTHA 1TE2A 2IY8A 3A6LA 3H16A 2VAMA 4YP9A 3J81k 2LIVA 3GJ0A 3M1LA 1DEKA 1XZHA 5KYWA 4M9QA 3I9FA 1IE3A 2E9SA 1I7LA 2A59A 1GPUA 1Y8QA 2Q0SA 4IHJB 1XZCA 4R4JA 5DWDA 3WL5A 1RABA 5HJEA 2Z5VA 1KPIA 3RRXA 4BRSA 5KKNB 4MWTA 2QM0A 1VRCA 5H02A 2GN1A 1MO3A 2CNOA 1XFDA 5FQOA 1VYTA 4Z99A 3DD1A 2CEAA 5A2GA 1ZJYA 2FG7C 1Z6AA 3H0CA 2AV6A 3DPIA 2BP7A 3NX4A 4GLOA 4HGYA 4TVOA 3AVXA 3QLEA 3TXXA 3H8JA 1TCCA 4G5OA 4Q4HA 3BXXA 3ICOA 1WZUA 1EU1A 3K2IA 3GG9A 3AF3A 3GA0A 3NDRA 3OO0A 1CJKC 4LY9A 2C5EA 3RC9A 2W37A 3OM1A 3WYFA 3NVKI 4MVJE 4BBAA 1N0VC 5BYAA 3GLGA 2XV1A 4ZCMA 4RTRA 4Q05A 1PZNA 2QX6A 4N8DA 3MINA 1LNSA 3V4PB 9MHTA 2BDTA 2H4JA 2FSPA 5KQMA 5DX0A 1RJEA 4ZEOA 1X7WA 4YRNA 4UNIA 1CS4C 1FX0B 3FFBA 4TTIA 1H65A 1LPOA 3D3EA 2JBAA 3LQ4A 2XGJA 2FPOA 3FPJA 1D6MA 1M1NA 2RG7A 3BDAA 1EGHA 1H8ED 5JD6A 5MN4A 2WKWA 3IAXA 3KXKA 4H4DA 3U3DA 2NV6A 3ORFA 4DM7A 1I4OA 4F93B 2J9YB 3UJ9A 4R1LA 3LC2O 5TVKA 3CF6R 2GI4A 4PFKA 3K8OE 3K2EA 1UK9A 4KUGA 5DOZA 5DM2A 3T5CA 1D2HA 3W2TA 5AVZA 1ZR4A 3KT3A 2FJPA 1RI5A 1Q15A 1LS1A 1EE2A 5AUPB 2XTJA 3LLMA 4HWOA 5KYTA 1MAAA 1X0XA 5B7NA 2IU3A 2B94A 3WYCA 2BMAA 4IMIB 4ZP1A 4ENWA 1U5CA 2KBEA 4I1VA 1W76A 2RJOA 3TOZA 2AYXA 5AQ1A 4POOA 3OZBA 3OLQA 1XMQB 1IG0A 4RPGA 4UFNA 3ZE2B 3ZH9B 4PWYA 2PYDA 8ABPA 1X9HA 4J9VA 3MTBA 4DYDA 5B5SA 1JQLB 1KFJB 2Q3EA 3Q98A 3GJXC 4YASA 5JHGB 4O4HA 3C4JA 2XMPA 4AJIA 3CUYA 4MEJA 4RFVA 4RLFA 5GOTA 4DIDA 4DREA 4MULA 1HDIA 5F76A 2ZIWB 3BCSA 2WQ6A 1G5IA 1HE2A 3ITEA 2UKDA 4BX9A 4F38A 1K7CA 5BV7A 4E5UA 4AXXA 3CV3A 4GI3A 2E4AA 2HNBA 5HX7A 1GRVA 1MPXA 4WN9A 2M9MA 1F20A 5CDFA 3RHFA 1TK9A 4YLYA 4D0SA 3N39C 2EKLA 2MINB 4CCYB 1L7VC 2VJPA 4N9WA 3GH3A 4RQTA 4YAFA 5ERGB 1NKTA 3TS1A 3IIJA 5DCLA 4CM5A 1CUEA 4A8HA 5IHXA 4W1SA 1VCNA 2GFIA 5AJHA 3JZIA 3A2LA 4BFLA 4NX2A 3OY2A 4C89A 1WQ1R 3IIKA 4I9FA 3HVKA 1Y5LA 3R7WB 4OHFA 3O4IA 1VIVA 1GL3A 1TD1A 4C05A 3QE4A 5JIBA 1PV1A 4YYZA 2RC5A 4X85A 2HF8A 4NENA 4EARA 4MYHA 3IKMB 1L8LA 1WV1A 3VNBA 3F71A 2WV9A 3ZU4A 1T5LA 3L40A 1Y7TA 2Q8QA 4YCBA 5HE8A 5IYZA 4OMCA 3UZUA 1Y6GA 2NADA 3EA4A 3T3GA 4UUQA 3NJ8A 1ZJZA 1F3LA 1VG0B 5DZSA 2IBTA 5H1YA 1YH3A 3TQHA 2R8XA 2XVYA 4KO1S 3HBMA 2IHVA 1HT3A 5HK9A 3DBIA 3QJGA 4Y9DA 4KK4A 1Z6GA 1NJFA 4H3KB 3SN6A 1YVUA 2CN1A 3OFND 4EEZA 4Z2AA 3K70D 4N6NA 1WETA 3PEUA 3KALA 4LHWA 3ZE8A 4QPNA 1GPDG 1LI4A 1RLTA 4ZO4A 3TSYA 2JLQA 3KJIA 4MEAA 4MUBA 3WNBA 3ZY3A 3VKHA 1XNHA 1OAAA 3ETCA 4CFZA 2JCGA 1X1TA 1ISPA 2NSDA 1QPZA 3AR3A 1DEAA 1AS3A 4FQ8A 4B84A 2RGBA 1BMTA 2FMUA 1WHTB 1I7SB 4MA0A 2JANA 4OB6A 2WD7B 3ISJA 1JLHA 1CY1A 3CC8A 3I2FA 1ILEA 1MFPA 1PEAA 3PPVA 1CYEA 1RBYA 1TT5A 4IGIA 1YZUA 4O2BB 3BWXA 4TWRA 4V0KA 1DCKA 3RVJA 4AB1A 4C4YA 4F2GA 4E5YA 4YRIA 1C9MA 5DE3A 3EXIA 3W1WA 4P35A 3CVOA 3K0BA 1XU4A 3QYAA 4LSMA 4L8VA 2G08A 3Q8MA 1NVAA 1J2RA 3NETA 3E03A 3R5TA 4FHEA 3HP7A 2FSGA 5AOCA 1BH6A 3ZLVA 1PR4A 3OLXA 4IFBA 2HJVA 3ZCVA 1NNSA 2M32A 3KVRA 5BSHA 3K4PA 1VCHA 4BXOB 5JVDB 4HCJA 3UAYA 4X7RA 3HHEA 1GTRA 2F1KA 3BB1A 5M7EA 1XZKA 4CN8A 3RSGA 1O95C 3KZKA 1P81A 1PDOA 4FUTA 1FRFS 2HDHA 3HU1A 1TF2A 1EPUA 3H2KA 1Z73A 3N1UA 5CG2A 4U7PB 2JI8A 4YJ3B 4U2CA 2W42A 2DB3A 5IUJC 1VIAA 1N6KA 2CDAA 4PO1A 3W5UA 2D2VA 3BXOA 3QWBA 4ZVVA 3LP5A 1P4GA 4WY5A 1O94C 3C4VA 2XZTA 4PZEA 4QGHA 3DFZA 5K8JB 2O2XA 3KZMA 3OCXA 1QRTA 4U7JA 1GPWB 2B78A 3ZJYA 4MEBA 4QYWA 3FETA 4RXUA 5ED0A 5THKA 1RKXA 2I99A 6CHYA 1M2FA 5LLTA 2Q2QA 3IP1A 2L19A 4HB3A 5ADUS 1R8QA 1NBEA 3AF5A 4UPDA 1UWLA 5IJ9B 1QKJA 1E18A 1E3MA 2Q5LA 3TRHA 3TXAA 1RYHA 3DO5A 3HU5A 4FDMA 1N78A 1Y8RA 2PT5A 4KYTA 1OLOA 1V43A 1A5AB 4JLDA 4IJKA 1B00A 4I55A 3W4IA 5SZHB 4G8CA 1EUZA 1OLXB 3KB8A 4RGQA 4XDZA 5FPTA 2OG1A 3MXOA 4KBYA 3U7EB 4DT1A 2LGJA 3F7TA 1NI4B 3KAKA 3L79A 4I1SA 4EPTA 1H05A 4PNEA 1VLQA 5FBHA 5FTKA 4WLNA 4DMMA 4WZAB 3AGPA 3ER8A 3IIEA 2ANBA 3KJFA 3CRQA 1VB5A 4IMJB 5BSVA 4BJ1A 1LI7A 1P0MA 3RSZA 4ALIA 4D4HA 2BCGY 5FPKA 1SUDA 1O0SA 3N07A 1U2QA 3P97A 5C7OO 1QCCA 1DAOA 2I7DA 2W98A 5LBUA 5E3HA 2XJ4A 3I52A 1T35A 1HPLA 2DCMA 2B37A 4KGVA 3LD9A 4CF7A 4OQEA 1GEEA 5HGJA 4M88A 2ODQA 1QE0A 1VMKA 4JUAA 2M1ZA 2VYND 4TPKA 1BDHA 2BBTA 3NANA 3ORHA 4PLTA 4CKZA 5JBNA 4OI1A 1NQXA 4CUJA 5B36A 4FHDA 1A9ZA 3GBPA 3CLUC 2Z6QA 5C8YB 2TMGA 3PS9A 1CXZA 2RHCA 3BXEA 2AQKA 3QY9A 1A8QA 4H7IA 1AMNA 5E0KB 2HH9A 4HLNA 4H2DA 5JCJA 3NP7A 4CMHA 3HB0A 5SYAA 1KAHA 1Y9EA 4R71A 3P71T 5TVGA 3ICVA 2C31A 3ET4A 1FJ2A 4DKJA 1SIOA 1TEVA 5CLLA 2HF9A 1FDRA 3HB7A 3MNFA 1GWNA 2YV4A 4NBLA 2FF7A 3Q7SA 4O02B 4F9TA 2QT0A 3GIWA 4NJMB 1T4GA 2XE4A 1E3WA 3RR2A 3RIEA 2A9PA 1XK7A 4A92A 5A6SA 1RZ3A 1Z3CA 1HETA 4XVRA 4L8FA 5M5BA 3ZJUA 5JJKA 3QVSA 4J07A 1XDWA 2X23A 3F3YA 4IO1A 1S9HA 1AO0A 3Q88A 1K68A 2YHSA 4ZV7A 3UHOA 3HKEA 1KETA 5L53A 2IV7A 1SPBS 3PI7A 2G9UA 3EA5A 1DAMA 1RT9A 3OQ6A 4L07A 3Q85A 4G0QA 1OH5A 1IUOA 3ZDYB 1CKEA 2OAP1 3PHGA 4AX8A 4B3BA 4DZTA 2ZW9A 3KQSA 3KAQA 1HYHA 3MWEA 3SSNA 1M2GA 1Z18A 3CH6A 2B82A 5DBIA 1QZUA 5BVHA 4GZMA 1ML3A 1HE8B 2FMTA 1E1MA 4ZWNA 1Z06A 4KXLA 3KYIB 3YASA 4MVYA 2JPDA 3BRCA 4O4JF 4QOFA 4YJ2A 3OCWA 4EPWA 2GCIA 3PL5A 4FNGA 2BN4A 3ND5A 4TN1A 2QDXA 5HJ5A 1DS6A 3TBKA 2IDKA 3IILA 1GNVA 5HKKD 1XTPA 4ILEA 2R1ZA 2GK7A 1BU5A 1ODSA 2PJUA 5LWQA 4EPRA 4BNUA 1CQIA 3W5JA 4BIIA 4AKHA 4AUNA 1LDYA 3QKSA 3VYRB 5JSFA 5ENZA 5HFNA 1RADA 1ZW1A 4UCWA 5H3CA 1JG4A 2ZRBA 4E13A 2RGAA 2LKDA 4Z4IA 1ZVVA 3SBOA 2XF8A 2XWJI 2ONZA 4KQIA 5U1PA 4KIWA 2VP9A 3T5MA 4F4UA 4ACAA 4BX3A 4DJDC 3F8SA 2FZLA 3A8TA 1QO0D 2GESA 4QLBA 2LCFA 4IVNA 4OHUA 4Z6KA 1U0TA 2O0JA 1GKIA 3IA7A 4NFLA 4EA8A 1GR0A 1PW7A 1UFQA 3BFVA 1KDYA 1C1HA 2ILTA 3E7XA 5KVSA 2E2WA 2IA5A 3DTYA 1RLMA 3HFSA 3N0WA 3PA8A 1F9EA 2C92A 4HDNB 4I9GA 3TOCA 3PPYA 3ZWWA 3ELWA 3AP1A 4G9EA 5C4IA 4GP6A 2B8EA 4TM7A 1L4HA 2ZJ4A 3C3DA 1OWPA 1RLOA 1O54A 1TZJA 3U16A 5LA6B 1HR0B 1X7ZA 3NONA 2PLRA 3STVA 5A4DA 1E7QA 2ADMA 3L4JA 3AK4A 3M81A 4DQXA 3A31A 3HZZA 1UC4B 5JS7A 1C7EA 4AY6A 2WUGA 3LXUX 3A6GA 3RD5A 3V8QA 4JL6A 1EA7A 2X86A 1YVRA 1NW6A 4D3FA 2Q7XA 4PPFA 1NVWQ 2A5DA 2OTCA 1RWVA 4BNVA 3Q7IA 2X14A 1QS0B 1FYVA 2F67A 2M98A 3AR7A 4WCDA 4N5MA 5AP9A 2PUTA 4B32A 4RIFA 1OLSA 3PXBA 3B53X 1IIRA 4FWBA 1R0SA 3WYGA 4B34A 3I3SR 5FO0A 1F06A 2FWJA 4JFRA 5B1YA 1I3CA 3E48A 4NY1A 3W8EA 2M6SA 5I9BA 3A6EA 5DX8A 2AEMA 2B20A 4B33A 3KETA 4BNYA 1IZ9A 2FQYA 2WW8A 3TRFA 2AOTB 2JFFA 1TO1E 3EMVA 1JZSA 3L02A 1XF9A 3WDMA 2WP0A 4WZBE 2F1IA 2OVBA 4FFWA 1IRIA 3IP7A 1BU8A 2BMJA 3TEMA 1ZJ6A 4BV8A 3G82C 4BP9A 1USUA 3BZWA 5CIWA 5GJVC 1DE0A 1Q5PA 1G19A 1RDFA 4QTZA 3SQWA 1K8YB 2P75A 2ILVA 2IS2A 2ST1A 3TMYA 4LV5B 1P1BA 2FLKA 2KW5A 4QPCA 3CN7A 1KEEB 3ZJ5A 5DOVA 3IAS6 1ZD9A 1NUQA 3PHJA 2E4VA 1RWWA 1ZD3A 3PDHA 4AUKA 1G59A 3AJ8A 1CIPA 4OIMA 1C3EA 1MO5A 2IEYA 3UK1A 2CCGA 5J5AA 4DUGD 3FOFC 1JMVA 2Q5QA 3IO3A 2GPNA 2QXUA 2ACWA 1N2CE 2F48A 2FFHA 5K4GA 4J29A 4RY9A 3SEAA 3I23A 1EXDA 2J1LA 5E9JA 4BVEA 2H4XA 2OUIA 1WQ3A 3A4YA 5DM4A 1SOUA 3FPCA 3AR9A 4LUCA 4MQBA 3RG2A 3BMCA 5FORA 3I5AA 4IKPA 4Q21A 2XCQA 2NSLA 3IIIA 3P2MA 3QG5A 3Q87B 1R12A 2ZPAA 1O96B 4KIJA 2XUZA 1N6PA 2VTEA 1YZFA 3GAMA 5LIRA 7YASA 1X0VA 2VPWA 4JELA 3IMKA 1HV8A 4GEKA 4HLUA 4Z9AA 2VQEB 4OGWA 1K5GA 3AY7A 2WQZA 1JH8A 4GSYA 5C34B 1XVVA 4BC0A 1FF9A 3P5BA 3RTDA 1ESNA 3C6MA 3GA7A 2EKBA 2YICA 4UVEA 3ROEA 1YJBA 4QUAA 2IUFA 1FEZA 3PHHA 4EY4A 2REQB 3JQ8A 4REMA 5AXAA 1TM3E 4EY7A 4CR6A 1G4UR 1GG8A 2AFHB 1G8JA 4Z7QB 3BXHA 3I1YA 1XHEA 1SJ9A 3LX8A 5DBGA 4J1NA 2RHWA 1MPTA 3DFUA 4XJVA 3T06B 2N75A 5CT6A 2WYWA 5GZ6A 1B16A 1KA9H 1BVYF 1DKPA 2R2GA 3KEOA 2XEDA 3IMCA 2Q4RA 1CTQA 3LECA 3IAS1 3L7AA 1VBFA 4KN9S 5DNAA 1Z6PA 1AJEA 4OOFA 2VNSA 4ER5A 4B2IA 4EB8A 4MR7A 2I7VA 4K9MA 4R2IA 3BJMA 2X3FA 3GRZA 1ZVMA 4X64B 3BERA 3G2KA 5EXTA 2ZE7A 2ZXUA 4A0RA 5IKMA 3U7IA 3L43A 2OV3A 2SBTA 3PBKA 2NO5A 1Z0SA 2W70A 2JRCA 1PL8A 2CNBA 3R9XB 1VDZA 2PCJA 5IRCD 2PGJA 3HXLA 3A58B 1M5TA 4C5CA 1P74A 2QD5A 1U80A 3VR4H 3OOJA 2ZZNA 1MJHA 4MS4B 3UAWA 2XTAA 4CLXA 4N5LA 1M6HA 5T3UA 5ICGA 5A03A 1N3BA 4JY7A 4BO7A 1HE5A 1KFEB 1VP3A 5GV8A 3F5MA 5LZ4A 4LZAA 1HTTA 4F56A 4XB6B 4CDGA 3NKFA 5AJWA 5DKFA 3EZ7A 4ZXFA 3AI3A 1II8A 3FNEA 4LE0A 1FIUA 1JQKA 1YE5A 2FPLA 2P9CA 1OV4A 2L82A 4RAQA 2E21A 1Z8FA 2G9ZA 1I2DA 3VUFA 1ZESA 3LX6A 3LXMA 4GOKA 2A1TR 2YIVX 5TPZA 4GRAA 3KQHA 1E3LA 2IQIA 4R40A 5D01A 2DGDA 1MGOA 3V2HA 3QVLA 3BK7A 4BMYA 1BOOA 2Z3WA 9LDTA 4A73A 2EBFX 3IDFA 3EVDA 4CW7A 2ACVA 4F2HA 4BY9E 4QDKA 2F8MA 1VPWA 3H9QA 3LQKA 4JNKA 5KOJA 2GBFA 2OZLB 4CLOB 3NC0C 4PR0A 3QMMA 1SKMA 2G5GX 2XUFA 4TMWA 3GGJA 2ZETA 4AU1A 1EVEA 1IHOA 1TJ5A 2CNLA 2EKQA 3C8ZA 1SULA 1RQGA 3FZYA 3KRTA 3G3EA 4FYXA 4HLCA 4IDCA 4IIXA 2NNWB 4MVCA 4QGFA 5FNZA 4HLDA 4NCKA 1F48A 1OREA 1U2ZA 3F6YA 1WKBA 3LWNA 1AN0A 3H18A 2C9OA 4NP6A 2GAIA 4MPTA 4QULA 1HFKA 1T3TA 2PRYA 3LT5A 3Q41A 4Y6RA 5HMLA 5K3FA 3PQ5A 8OHMA 2Z04A 5IBCA 4ZN6A 1RRCA 3BYZA 3S1SA 4UTOA 5ENDA 3I6YA 5M2QA 3JQDA 4M7RA 4WK4B 1HDRA 1US8A 3CLVA 3D0OA 5BSMA 3R7AA 4D02A 1XYYA 5BUCA 2ZATA 3DCNA 3ZI0A 3PNQA 2GKGA 5I7EA 1VG1A 1RPJA 5K7SA 3NWEA 4OMUA 3IEPA 2NZXA 1G6HA 1P1RA 2PWPA 1SOAA 4ZVKA 4JS0A 4U7TB 4A0SA 3PQEA 4IRMA 2Y9PB 2O2JA 3EODA 3B1YA 3CSDA 2QYSA 3B5JA 3NBKA 5HIIA 3IPAA 2RH8A 3RJMA 4EVQA 3DNFA 3UJCA 5B7GA 1YS4A 4J76A 4AN1A 5IC4A 2C0QA 4N18A 2WPNA 1KIAA 1ZAYA 2G4CA 1CUGA 2YNMC 4FEYA 3TD6A 1N8KA 4L0QA 3R3ZA 1K88A 3U39A 2WT8A 3V33A 1VG9B 1NOJA 4B0PA 3WTCA 1OHHA 1JLLA 1UMCB 5I01A 4OX9B 2ZB4A 2HJSA 2HL6A 1E6UA 2C5AA 3K0FA 3H3JA 3RQSA 1L7DA 4M54A 5KOYA 1SHJA 2H9AA 1RAHA 3E1KA 2ZZMA 5E2AA 5C8VA 3T7JA 4I1PA 1YFJA 1Z2OX 2QD1A 1C7IA 4IQ8A 1H4VB 1XDZA 2XZLA 1FW8A 2J07A 2VWQA 2ICAA 3OMWA 5D1NA 1Q1BA 3ANMA 5DI3B 4W1QA 1UBLS 3WLAA 2ZIZA 5AHKA 3BWVA 1XQVA 3PYLA 4JI2B 4WUVA 5J9FA 2J08A 2G63A 4HGRA 3FTNA 4Y9RA 1QNLA 4BVKA 4UUOA 1AURA 3A25A 2PFGA 5EXDA 5G41A 3H9UA 2Q46A 2ENWA 1Y5MA 2QJWA 4HH4A 5G0SA 3WWZA 3PNSA 1MB0A 4KB5A 1PJCA 2ZT8A 1J07A 1SQFA 4JLVA 3U4HA 2ZRDA 7GPBA 3GG2A 1B6GA 3UWSA 4C3VA 1ZM2A 2JK0A 3N8HA 1IAVA 4MRNA 3PLRA 4OB7A 3TJMA 2HDNB 3ZWYA 3RBZA 3U7GA 1JWLA 2WAYA 1SK9A 2W2MA 5EUQB 2AJDA 2XYVA 2CUTA 5KINB 1CV2A 4G9BA 4LRXA 5GONF 4M1ZA 4Z0PA 4JI3B 1OXKB 2DRIA 4MLPA 3QE9Y 2QBYA 4GDFA 3JVIA 2VHQA 1XVIA 4NR0A 2PPLA 1Z5WA 4WLFA 1H23A 1PV2A 3KSRA 4IFEA 1UKEA 4MZDA 3DAHA 4G84A 4UNNA 2VRCA 1Z0FA 2P4QA 2H11A 3GLHB 3CNQS 1BXRA 1VC2A 3O8DA 2W6JA 4RM2A 3UMVA 5TLSA 4X91A 1XEXB 4X6UA 3L8DA 4JGBA 2WWVD 3BWMA 3NHFA 4R2KA 4JBLA 5ALNA 5A3VA 1QR6A 4NOMA 1OI2A 1N3IA 2FW0A 3RUFA 1T3ZA 2FPMA 3EARA 3G88A 3LUFA 1M34E 4IRUB 2FX5A 3KQUA 1TD9A 4EJ0A 1NU8A 4W9NC 2KLHA 4KQXA 2V7TA 3JVDA 3IO5A 1W88B 2PQ0A 4BJHB 3SXPA 1N5JA 2OQRA 4X8LA 2QTWB 2XNCA 1JIVA 3AHIA 3IERA 1Q95A 3EXEA 5KO2A 2YZNA 4PS1A 1YBVA 2DF8A 2O20A 1J0EA 1MA3A 4HNAB 5AVTA 4R7GA 1NY5A 3D0QA 4JJ6A 3WLRA 2ZAYA 4U8HA 1WO8A 1DBQA 2CVPA 5D6NA 4O2RA 1KY4A 1F17A 1MX3A 2O3SA 4TV9A 3M33A 3MWDB 3VC3A 4ERXA 4YAIA 1J90A 1BKDR 3OZDA 3PK0A 1ZUHA 2NAPA 2OORC 1G2QA 5F21A 3WLIA 4M0DA 4UVIA 1HYBA 3NW9A 3WYNA 2WWRA 4TTTS 4D8WA 3N6VA 2VF2A 4MPPA 4OREX 4X84A 4A8JC 4JC8A 1E9FA 1JKFA 4I50B 1XD9A 4DDWA 5CFQA 3KQNA 3BK1A 1YCDA 1XVAA 2HWUA 2QJOA 3HJUA 3PGLA 3PKJA 5AVVA 5I7UA 1PTKA 4HWSA 4PV7A 4F6RB 2Q9AA 1JG1A 3STYA 2QN6A 4Z51A 1OA0A 1WMDA 4CBVA 2Z5GA 4AF6A 2UVPB 1Z28A 2XBUA 4KYVA 4XUCA 1YE8A 4JSYA 2RGYA 1AHPA 4UASA 3FHTA 2P8SA 1DIGA 3GGGA 4LOKA 2YFKA 4C03A 4M38A 3V4SA 5L95A 2J85A 2ZSFA 4WCVA 5JRJA 3P27A 2KM1A 2OM6A 1XL0A 3FZEA 1LVGA 2V6GA 4GMFA 3E82A 3FMFA 3I34X 4I4LA 1PJLA 4I1YA 3DZKA 3EUWA 3RFUA 4DJAA 2VLBA 1QK5A 4EI8A 1PX2A 2QE7A 1EVZA 2B69A 4LYDA 1BJKA 2FN3A 4S1PA 4WA8A 4WZBA 2AX4A 5IKXA 3ETDA 1LI5A 3D6NB 3OZEA 4V2IA 1V8FA 3OUUA 4C6TB 4X1IA 4BVGA 2AG8A 3X2SA 3HA3A 3HY4A 2QTFA 3H9EO 3I8XA 2HU8A 4HHEA 4OF4A 5KTPA 5LP1A 3WDSA 5ILGA 1QX4A 2YWHA 4MTCA 4Q1AA 1RI4A 2NG1A 2OT3B 3NRBA 3PG5A 4N3CA 2P6NA 3TZHA 4BQIA 1NC1A 1QBGA 5TIIA 2EP8A 2J0VA 2Z2JA 4UOEA 2NTYC 3T94A 3FFAA 3KBBA 3T52A 3N7UA 2H4HA 4JXZA 4WZZA 3Q10A 2GJ4A 2R3SA 3GN2A 4BMDA 5IEBA 3RRZA 4QG3A 1M10A 5EGSA 2F62A 1X1SA 2DPLA 3H5TA 3T1OA 4IIFA 1IZ7A 3NBZC 4B6SA 1P1CA 3JQ7B 2HPVA 5FUVA 4EKDA 1IOLA 2Z08A 4UQPA 2BMEA 5CVVA 1CBUA 3HZHA 4D96A 3EG9A 1KZYC 4HSGA 3B82A 1JP7A 3QI7A 2HREA 4MW7A 3ZC3A 3DHNA 5KYYA 1WCIA 1A8IA 3QPVA 4YRLA 1EFPB 2X2OA 4DY4A 1DCFA 1EP3B 3CH7A 3EE6A 4PLVA 4RPJA 5EMKA 3QBEA 1EHIA 1SU8A 3STUA 5AK3A 2NU8B 2XNSA 1UBFA 4FS3A 5EWLA 2IHUA 3JASA 4B6JA 1EXVA 5KU7A 5EVCA 5JY1A 1YL6A 2FGJA 4GLFA 4QTUB 3R5SA 4YRDA 3VHLB 4Y2YA 2BDEA 1SHZA 2G09A 2W2KA 3IAAA 5K4AA 4QOHA 3SU8A 2HN9A 6ABPA 3PNBA 2GO7A 1E2IA 1M1YE 2HJGA 1SVOA 2NUAA 2ZEJA 2CLCX 3CZQA 3PFIA 4GKBA 4LOLA 4NZ9A 4R2HA 5DXJA 3S1LA 2V0GA 3AR6A 1GPJA 2CSUA 4JI5B 1U99A 2ZITA 1KDVA 3RBXA 3SZOA 4BLWA 2ZP1A 3SD7A 1ARZA 3HJCA 2HXSA 1EGAA 4M8KA 1EBBA 3MFYA 3KEFA 2XMDA 5EXXA 4KVFA 1B0AA 1GTZA 1SN7A 2XQGA 3Q11A 2PR7A 3PGVA 4N3GA 3K9NA 1NF9A 4RVFA 4BO4A 5FBVB 2X6TA 3AFIA 3ZWMA 2A1TS 4UC0A 2IU6A 3H5RA 5DGHA 1QFMA 3FGNA 4WDQA 1ISFA 3GPBA 4OHYA 1USWA 4HVAA 2R68A 1NVGA 5DP2A 1O08A 5SZJA 4BLRA 3WMEA 2FR8A 2HCTA 1YO6A 3HYSA 3AJEA 4K6KA 4AROA 3NGXA 2LPMA 3MEQA 2IXDA 2E55A 2BEVA 2HIGA 1N2IA 1N2ZA 3FMVA 2O8CB 4IDGA 2NT4A 2YMMA 1SC9A 1MRNA 4ZOLB 4BFVA 3O1IC 4EMBA 5JCJD 1T6ZA 2JIQA 3BBPA 1RHJA 3ROXA 2WF5A 4BEBA 4RULA 4QQRA 5AT1A 5LP6B 4IZOA 1CQJA 1G41A 1KC3A 1Z45A 5H80A 3ZY6A 3I2JA 1B8VA 1JEYB 1BRTA 4TWZA 1A9YA 4JL5A 2GD0A 2Q1SA 3UUWA 4HO1X 4JU9A 2D54A 3O8OB 4Y9SA 4LNHA 1QTRA 3QUTA 5ALIA 3RC1A 5KTYA 5K0FA 2YV3A 3VHXB 1EQUA 5AK4A 2XW6A 3WRXC 3JW8A 4HMOA 2BLLA 1MFZA 2N1BA 5L6LB 3VNUA 1RXYA 3COVA 4P1ZA 4AKIA 3FVTA 5E9WA 1JFLA 3QVKA 1D5WA 2O0HA 4IIUA 3WQRA 3S2IA 4BECA 1C8LA 3Q8XB 3NBAA 4FMCF 4TV8A 5FBZA 1TUBA 2IXGA 4F6LA 4UNRA 1I1OA 2J6HA 4DSOA 4NCJA 5TQ0A 2PFKA 4MRMA 3REQA 3P2OA 3IXLA 5GMOA 5T3YA 1TUIA 3F2VA 5ALRA 1CY8A 3FMOB 4NESA 4MS1A 1KMIY 3BOSA 3GFSA 2OQVA 4KNVA 2RBEA 1U31A 4LX8A 4UAJA 4KBFA 2I4IA 5TGDA 1CZNA 1UP7A 4PXYA 3NYRA 4FC7A 5IJAA 3X1KA 4ZOQI 3LE8A 1YS9A 2ADOA 2E4WA 5B1IA 2I6GA 3AZOA 2Z5LA 5KNDD 2LRHA 2YVQA 4DUZB 1QH0A 2H7CA 3WHPA 4A03A 4DBLC 3L7MA 4MYUA 4RMIA 3VDXA 2YZMA 4A15A 2VA9A 4WLVA 1WBDA 2H3HA 4EHNA 4DDHA 1U0BB 2Q3LA 4PGHA 1MNAA 4XTCS 1YR6A 1VGVA 3PFCA 4MVJD 3AHEA 4P7JA 3MF4A 1N7HA 1SXPA 1XEFA 1UL1X 1EYZA 4X41A 2IEBA 3TQCA 2JNWA 3W9UA 4HAVA 2ZE5A 3EFOB 2PX6A 4PCVA 1KC1A 3K72B 4LJ6A 1LNQA 3PDJA 1RXCA 1Z35A 3FPGA 3W3AA 1ZK1A 2ATXA 3QEOA 4ND8B 5ARDA 3WHIA 5IXYA 1JDVA 3NHBA 2EG9A 4AW9A 4E51A 3EQ2A 3Q0IA 4ASUA 5GOZA 4PVDA 4B35A 4FGJA 1RWKA 4WCFC 5B1SA 5B30A 3MMSA 4H0FA 4J6FA 5I9IA 1P3DA 1Z4NA 1IN4A 4HZGA 2C3PA 5K0LA 2XTMA 2YL2A 3PKIA 1I32A 1YS6A 3S5UA 1FYDA 2VNHA 1M2VA 1TKRA 4D46A 3FW1A 2BGWA 2HGZA 4PEVA 5IVPA 4LK3A 4LSZA 3JQBA 4JJZA 3T9FA 4HPJB 5HS6A 2N9UA 4II2A 2BH9A 3W9YA 1PI3A 3FUTA 1L5MA 3RRMA 4LXUA 3D4BA 4WXRA 3X1ZA 4KRXA 3ZHBA 2CBXA 3GRYA 4JYBA 1RC1A 3A9UA 4JLPA 4JUFA 5F3RA 3DTNA 1MJFA 2VHVA 1N75A 1NUSA 1J8QA 5KWVA 1G1AA 2QRKA 3GRVA 4KE6A 4LY3A 1YZVA 3UMFA 1QO7A 1SVWA 4NMHA 4NRDA 4QEDA 3VPBA 1AG9A 1OXBB 5T4HA 5AUOB 1I6MA 2R48A 5AVSA 3KP1A 4IQ4A 3ZXIA 2ONJA 2O2EA 2CFSA 4NEGA 4INZA 4AZWA 3MAJA 2CKDA 1G63A 2YZKA 4K1LA 3WBFA 1RRKA 3N58A 1WEHA 3WGJA 1IVYA 1FOEB 3D2CA 4OP1A 4GFDA 1CR6A 1QANA 3AEKA 1CZOA 3R3VA 5HP4A 1QYIA 5FLYA 1K89A 3PZRA 2FZGA 2GBLA 2J32A 1E9DA 2JFQA 3D8BA 3KTAB 4H6PA 4HH1A 4QU8A 1OWMA 2C4VA 1H3FA 5H8WA 3GJQA 3IEUA 4D6YA 2MR6A 2BV3A 2Z8XA 1IJBA 1JBQA 4G26A 4RCZA 1IUNA 3PI6A 3M3DA 1D9ZA 4C3ZA 4ZFNA 4EI2A 1D8TA 4AJNA 2RAFA 3MD0A 2QZZA 3TVTA 1QGUA 2VPYA 2ZTSA 3O4GA 4PG8A 3KO8A 4C6SA 3E84A 1VBMA 3FNQA 1ZN8A 3LYLA 1DQNA 1GR1A 2C0PA 3GJ4A 3H1GA 4CF6A 4EG3A 4DR6B 5BUSA 2QPTA 2IL1A 1H2BA 3M6IA 3S7TA 1ODJA 3V1MA 1IY1A 5L3SB 4IYRA 2VO1A 3WE7A 5CFLA 1C7ZA 3TG2A 2I1VB 3G23A 2PH5A 1T26A 3HADA 2AX3A 3LDAA 3MC1A 3RWMB 3T12A 1EJ6A 1AGYA 1U28C 4PAMA 3TTTA 3GZTB 1YMQA 4Q16A 2FN8A 5EIWA 4EPVA 1XP8A 4DDKA 1NVVR 2MYTA 4YRZA 1YB7A 3QIAA 4TQAA 1IZ0A 1FK8A 2J3DA 2YZ7A 1K3UB 2I67A 3CRVA 4RKYA 2AFIA 3P2EA 5AHXA 5C1BA 1GDTA 1XN4A 1ULSA 1EDEA 4WOBA 3JAKB 3TG8A 5FBLB 1T4BA 3GEPA 3HXPA 1QIJA 2NUPB 1PFKA 5MGBA 1USKA 3ZX5A 3RYFA 1M74A 4JYMA 3DMNA 3KSBC 2GLUA 3WGQA 1EXWA 4KO4S 1NI3A 3EXHC 1ZQ1A 3PFNA 3FUUA 5JLJA 1WOMA 1XF1A 1D2AA 2WVAA 3FOCA 4ME6A 5E6SB 3TB6A 2V7GA 1UFOA 1YNSA 1FS4A 2P67A 3FMPB 4W7SA 5EJ2A 1QRSA 4X9XA 1NYTA 3S99A 4IZHA 1DP4A 1YB5A 2VK2A 3HUFA 3NU1A 3QWIA 4ZALA 4ZT6A 2QTGA 1PJTA 5CUQA 1K4YA 5E6RB 2EGUA 1P3Y1 1BEEA 3E9CA 1DDOA 4N82A 4O25A 2L0XA 2RH4A 4DIBA 5LMUB 3OI7A 1RZRA 1IPHA 1Q14A 1U6JA 2CMDA 2XT9A 3LTNC 1PWHA 3DFFA 4NYIQ 2XUAA 1T3LA 3OE1A 4LRTB 3AJ9A 4IDAA 4EEXA 4Q48A 4KDCA 4HX9A 5DNYB 4Y1RB 1K66A 2VHXA 3O2JA 4LJ4A 1QZTA 2JZOA 3QKUA 1V6SA 3GRKA 4HS4A 3OEHA 5TPZD 5DYNA 3Q3EA 4XTRA 2OCIA 4Q4LA 1PL7A 5B58C 4G4IA 2DR3A 1OFUA 3RVPA 1T34A 3U48A 3OMXA 1MJ5A 4UNSA 5HVNA 3I0ZA 1V8BA 5ALTA 2G1PA 2IS6A 4URWR 1KVRA 2V6MA 4AYWA 3KTDA 3SIPA 4G89A 4F3YA 2YHIB 1QIDA 1UKAA 1ZUD1 3CZPA 1G3UA 1D7OA 3KPJA 3KXIA 3N8DA 4GE0A 4JJGA 1U81A 1WM1A 2SKCA 4BTLA 4TYYA 1AF7A 2OSVA 4QJIA 4Q4AA 2OO7A 3Q7EA 2UVQA 4ALNA 1ZG3A 2Z1MA 1R0XA 3WG9A 1II0A 3A26A 4WX2B 1Q17A 1SRQA 4JA2A 4WNAB 5HGXA 4X1YB 1DSSG 5THXA 3WV5A 2ZE6A 4ERNA 1O4WA 2KQUA 3V3TA 1DLJA 4BLTA 1OJ7A 3ZWXA 3SPXA 1KI1A 1L7RA 2GA9A 3I0MA 3RU9A 5DTQA 2RH5A 3VDRA 3UCEA 2PYZA 1ONSA 4DWWA 3OT1A 3NVDA 1ENYA 1QVZA 2FRXA 1VJGA 2OCPA 1JJVA 3DMTA 4MV6A 4NCIA 4Q15A 5EYPB 3G1WA 3CW8X 4FN5A 2VHUA 5ESWA 5LIPA 4CEHB 4PZCA 1OPXA 1L7AA 3G59A 3R6WA 2IE0A 4KI7A 3V1UA 2F9LA 2XXBA 4RTLA 5FWYA 2XH8A 4OP2A 2AB0A 5CBPB 4MWBA 1N0IA 3L8CA 3H97A 4JEIA 1KMHB 4ZAYA 1GGNA 1W5TA 3TL2A 3WFJA 3F7OA 3M7IA 1P0QA 4YMGA 2QS9A 4OP3A 1D0VA 1JLKA 3PQ4A 4UTZA 4UVGA 1D6JA 3TINA 3T3NA 3ZJTA 1OHHD 4HVLA 3MHTA 3KKKA 5EXSA 4WESA 3R9WA 1GU1A 4PTZA 3ANXA 1H0SA 2VT2A 2ZJZA 5EP2A 1PR5A 3TE6A 4MVJM 3VTAA 2RK3A 3T9AA 2GDZA 2BELA 2BCEA 4XASA 3OLYA 4CKEB 5I7WA 1H8HA 2I8LA 3PC7A 4A5SA 3F9IA 3MOGA 2F59A 4LA4A 4FYVA 2H48A 4QAQA 4BMNA 1U0NA 4LF6B 1PVOA 2GRAA 4UHCA 1IXKA 3ECSA 3PRHA 1SG0A 1DWQA 1ZRMA 3BICA 3FROA 4IJVA 4UM9B 2FQ1A 3ELBA 2Q9CA 3HCBA 3C5CA 3HVUA 4UNPA 5F9MA 1P2SA 5JMTA 2NMVA 1EUCB 3M0EA 2B1JA 2YS7A 1RJWA 3PNPA 3F2IA 3M2PA 3INTA 1PNRA 1ZL0A 1WF3A 2WMNB 5GVRA 3QA9A 2BR3A 3AMVA 4IHJA 3SHQA 1ZY2A 5EMNA 3S28A 4NL4H 5KC9A 3H42B 1MR3F 3NJRA 3WFZA 4B76A 4ARSA 1LVHA 3LXRA 4MUNA 1VKHA 1EDBA 3C6QA 4ZI7F 3C74A 3UH1A 2I22A 2GAFA 3MQ4A 1U2TA 3DVSX 4YWHA 4U2GA 1N9KA 2BKUA 5AOVA 5F4ZA 3LHFA 8LDHA 4TXMA 4QFDA 5F9HA 2IYYA 3A1FA 3VVLA 4XUGB 2EFYA 3FSJX 2Q0QA 3W9BA 2VZ8A 2XB4A 4A6PA 4YX9A 2F2TA 1ECPA 2VRCD 3EGCA 1LQUA 2AT1A 2D4HA 4CQJA 2NO0A 1C4WA 1SKBA 4OG2A 4PIPA 3HDTA 1K7FB 2QU8A 1ISJA 4R2JA 1G55A 4YDQA 3TQSA 1AK1A 3ZGYA 1VZ3A 2IYSA 2XE6A 8MHTA 2WAAA 3ZKWB 1JVBA 1UDWA 1TAGA 1R16A 3WGHA 1NM5A 1VSBA 1HT2E 2I4RA 4Y0AA 1KXJA 5K3DA 4XFDA 1TQDA 4B6GA 3HXQA 1N57A 4WKBA 1C29B 3B3GA 4JC0A 1GZ6A 2WTNA 3W78A 2QY6A 3A2NA 2J0EA 2Q1TA 2AGVA 2WJ4A 1AM4D 3AW8A 4BQOA 3B2QA 1AA6A 1USGA 1IQRA 3DKIA 3RFTA 4LPSA 4DV3B 5IMBA 3TB4A 2PV7A 1SCUB 1ZUNB 3PITA 2FK8A 3KPUA 4QWMA 3SQOA 3EPJA 4HLQB 2GM4A 4X1KB 1SXJC 1UF9A 3KJNA 4UFOA 3OQNA 3K94A 1U8EA 1N6LA 2X9QA 2QTVB 5GZ1A 2VJCA 3I05A 1DWOA 2YHBA 1PQ4A 1G20B 2H17A 3KQVA 4TQGA 4NOKA 5AHRA 1Z4IA 1A8SA 1J9GA 3C6KA 3WHLA 1Z4LA 2PL5A 5A05A 4QTYA 1OSNA 3L01A 5DIZA 4KPEC 3UJ7A 2YN4A 1NURA 3PA6A 4E5KA 2N46A 1RWQA 4NMLA 3GEDA 2PTGA 1JHPA 3MXTA 1J2JA 2BFEB 4YAEA 3WLOA 1GAWA 4OBBA 4OFBA 1LK5A 3HEAA 2OZKA 2I2WA 7AT1A 3DYIA 2GSWA 3QE2A 3WQBA 1V96A 1JLMA 5E1OA 2P0AA 4BMPB 2R8ZA 5KOIA 3UMSA 5FWXA 1Q12A 4I81A 3K5PA 3U4QA 1YUBA 1J7JA 2VUHB 1G3RA 1OV6A 3M5DA 4DMUB 4BPBA 1J39A 5K09A 1VCIA 3GLIA 4KKVA 1UR5A 1E5LA 2P77A 3CVYA 3DW3X 4C0BA 1ULUA 3D3KA 4NU8X 4JOQA 2XKKA 1PX0A 2GB4A 5KHLB 1KMCA 5JAIA 1E1DA 1YU9A 2LNDA 2MINA 4CCYA 1G64A 3L6OO 1NW4A 1CFJA 1KF0A 1E89A 5CFRA 4RKFA 2H00A 4Y2SA 5ESXA 3KQQA 4M9ZA 4TM8A 1XEAA 2LW7A 1ZHHA 1HYQA 2JIRA 3FI9A 3TFOA 2Y2VA 4N47A 5EG5A 4F9GA 3C15C 3R7WA 1P7VA 5LCXA 2D1RA 2IIQA 1Z26A 4ZO7A 3BHJA 3PE3A 2G82A 3WZ2A 4Q01A 4D1YA 2DQ4A 2CWDA 4L4XA 1V7PC 3N6RA 4CG3A 2H4WA 3KOXA 4LJ5A 1JDJA 1DO8A 5AIAA 1GNQA 4NK5A 5ELMA 3VH3A 4W5OA 2ORIA 4ADSG 2CLIB 3PVZA 3SDBA 3W1EA 4LRWA 5CX1B 2HLHA 2YWGA 1K8ZB 4V24A 1AKMA 4DA9A 1XMSA 2VJOA 2XTZA 3LBHA 4HAIA 1J20A 4JJAA 2CB9A 4MVJF 4NBWA 5L40A 3SX0A 1YMUA 1FRZA 3QFTA 3AUYA 1KOLA 1QWSA 3NKLA 3PXEA 2PXXA 3JRXA 3K6JA 4IJ6A 4RACA 4GDMA 5DH9A 1A3CA 1SA0B 5CU7A 1DZ3A 3W7AA 4AWAA 3DLTA 5C8ZA 2PL3A 1AKEA 1UXKA 4UOZA 1R8SA 2B3TA 3QY0A 4H6VA 4X6LA 4LF7B 4NCAA 1R0ZA 3AB3A 1F6BA 3FCUB 2QG4A 3Q6NA 4QNNA 3RADC 4PG7A 3V8MA 2EU8A 3C1AA 4G5RA 1RCFA 1WHTA 5KSZA 4PC6A 3OCCA 1PWZA 3L8YA 2BHRA 2Q0HA 3S2UA 2PQ2A 4R68A 1W4AA 2WD7A 4MK4A 4BQPA 1JTVA 6GPBA 1UMDA 1CUBA 3QI2A 3SY8A 4ARBA 5DNUA 3JD4A 1UPCA 3SEZA 3TNDA 1I1HA 2I1WA 3IKVA 4GLBA 3V5NA 1IG3A 1XD2B 4O2BA 1HLDA 3B6IA 4DEYA 4CQMD 1DFGA 3O8BA 5FR2A 5IKEA 2ZRIA 5AI8A 1QYRA 4KVGA 2Z0MA 4BZWA 3SBXA 3UGQA 3CO0S 3EHEA 1E6WA 1ZICA 2B6NA 3DKPA 3UWMA 3VDNB 2P5YA 4YCCA 3UHAA 4BXOA 3I62A 1CRLA 2O1EA 3H84A 2NZWA 2UDPA 3C6ZA 1Q74A 5BMVF 2V9CA 1XDDA 2XCIA 1WZIA 3MBOA 3IV9A 4XI9A 1JXQA 1I3KA 1N2EA 2DULA 2Y1WA 4B4OA 1X9IA 3RUCA 3ZWNA 4G0OA 3MWKA 1KDPA 3B78A 2ACEA 3MCAA 4TL8A 3UJNA 4KV9A 1NQWA 2WPDA 4O4IA 3G5MA 1X15A 3RFVA 4EK9A 3NHKA 1IN8A 4PHCA 4LJ8A 2NVWA 1U8YA 4KR7A 1KZHA 2XCRB 3BE4A 4KWCA 3I58A 4HG2A 1MX1A 4IBOA 2GAOA 4PZZA 4JWKA 1X8JA 3SNHA 3L8EA 5GV7A 5EZYF 2WC1A 1DRKA 4BFYA 4RGVA 2JGIA 4KAAA 1ZH2A 2RHJA 2Z30A 1WXEA 2DPMA 3CMMA 4OYYA 4W5RA 3RBAA 1YZGA 1W73A 3M1YA 3HDJA 3JZDA 3MWLA 4EVIA 3CVWA 1LPMA 5IJ9A 4ZU1X 1CUZA 3JQ9C 1B26A 3UAGA 1POXA 1UIMA 4H4CA 4FCTA 5FH9A 5IASA 3BL5A 2GTHA 2I03A 3I64A 3TL3A 1K5PA 3FE2A 3SKXA 1YKGA 2DBRA 1NJ6A 2EGGA 4H31A 1OLXA 5LLDA 1YC5A 4NKRA 2IEGA 2MR5A 1A9OA 1PG5A 2I4LA 3GARA 4IWXA 1NI4A 1NJ8A 1ZRSA 3EEFA 1AXEA 3HEMA 1FMCA 4IUDS 3U2QA 3ZTTA 3TCNA 1RTKA 1I3LA 2VIIA 2GCGA 4Z54A 2WMYA 4WZAA 4J3NA 2R47A 3WK6A 4C4AA 3BTOA 3NBMA 2FGKA 4YUAA 3EPHA 1ANKA 1KP2A 2DY1A 3JQFA 3AIKA 5EJAA 2C5SA 2H08A 5JXGA 4LF4B 2J09A 2X5XA 4AMGA 2DH6A 1X9GA 4D6PA 1U0GA 5AVQA 1LC0A 1QP8A 3NWPA 1TQ2A 4DMHA 2P6MA 5DWVA 3EH1A 2N1MA 4PWZA 2ZRMA 3GVHA 1B2LA 2BGJA 5F2OA 3B1WA 5KX5B 4Q7JB 1Q22A 3THOA 9LDBA 2YKGA 1IONA 1VMEA 1PK7A 1UXGA 3RSHA 3M5CA 3UTDA 5C8YA 3G0IA 2DBZA 4XWYA 2JGRA 3SHWA 2HYIC 4GT1A 1WA5A 1TL7C 5I4CA 5JADA 3BVPA 3WC4A 4DJJA 3ST7A 4PHTA 2BIFA 4ZU6X 1ZCFA 1FE8A 4C4TA 1UM8A 3ERCA 4V0RA 2QP9X 4H7DA 3TBFA 1P1HA 3IVRA 2EP7A 3HE3A 2VZLA 2HHJA 3B8HA 4RHYA 1V45E 1DTSA 4GO1A 5JPIA 3SE7A 4DSZA 5ALYA 1AT1A 4UFPA 4RDCA 2L69A 2VQ6A 1SQ0A 3FNRA 4P7BA 4NJMA 4E70A 1RM5A 4N1AA 2OV6A 4GD3Q 1AZTA 2NV2B 2YOHA 2CLKB 1ZN7A 3O8NA 1ISMA 4MI3A 3FGOA 2CJWB 2ERYA 3U3ZA 5I8PA 3DZDA 2YXEA 2ZUWA 4PSAA 2CSXA 4X54A 4Q4JB 4TUYF 4CNBA 1C80A 5K0SA 4J75A 4QOEA 2QRUA 1P2VA 3GJ5A 4XYGA 2YXLA 4KLZA 4AN4A 4AT1A 5IX8A 1A72A 4O8CA 4A1OA 1AN9A 1IPFA 5ICSA 5JMWA 3EK2A 1GVNB 1NFQA 1YA6A 4IDQA 1A2BA 1P4JA 3IXMA 1JEAA 5CCDA 1K2WA 1JJBA 2WK1A 3CPJB 2HA0A 1XZLA 2OA0A 1DBIA 1E5DA 3I2YX 3FLMA 1M2NA 2HSDA 4YO7A 3V6LA 3GLHE 3A4MA 3HB9A 4B45A 2J3KA 1UEJA 2A9RA 2IYWA 1XNJA 4UW9A 2C84A 3VBEA 1P75A 1OASA 5F78A 4MGKR 3HBFA 3PNKA 4JBIA 2AQIA 3QMWA 3G13A 1L8QA 4TWAA 1EUDB 2ZS9A 1Z6TA 5KI6A 4AY4A 5C37A 2AR7A 3FOEC 1J21A 4CMCA 1QOQB 1PZMA 4YT8A 3LHKA 3KR9A 1W25A 1NUPA 3GGPA 4M0FA 3CUWA 1XXLA 1CRQA 3CO5A 3AL0C 4JT8A 1H42A 4LBYA 4AF8A 4E4YA 2CNWA 2MT9A 5ALJA 2HOQA 3ANLA 5IK2A 4C29A 4GPAA 4YMUA 5A3QA 3VOTA 4HDNA 4UHFA 2ZCJA 2Q5CA 3L06A 2R5WA 4GVXA 4HYEA 1UZAA 4GH5A 4AO8A 1KERA 1QP7A 2L2QA 3ESZA 4UXHA 2Q1WA 1JIQA 3FMIA 2OAEA 5EHXA 3P32A 1GUYA 3BCRA 3KKEA 1BX1A 1ZSYA 5LA6A 5B6IA 4Q5IA 5JC8A 5JNUA 5ANRB 2AKYA 3NOOA 4ESOA 3S2GA 4WKGA 3PIRA 4G07A 2C7OA 4ER7A 4OHBA 2R00C 4KITB 3RC2A 2E18A 4UUPA 1EM6A 2P7IA 4R8MA 3QVGA 4HZIA 5KJ6A 4X65B 1S5PA 2D06A 1AQLA 3JQQA 2O5RA 4HJRA 1BYUA 2ZBFA 1C1YA 4OI2A 3DM5A 1QS0A 3CWQA 1C9KA 4YP0A 5A3RA 5D86A 3F46A 1C4KA 4KQWA 4TWJA 1E1KA 1Z83A 4FCCA 6ADHA 4FGZA 2OEPA 3BQ9A 4ER6A 3W2FA 3VZPA 4Z1OA 1PGJA 3T3EA 5BSFA 5J4VA 5EUMA 2AYZA 4LDNA 4NYMQ 1A50B 4GGOA 3OFSA 3OQBA 2PUWA 1VL2A 2PN1A 5IDVA 4CKBB 4F4FA 5B7PA 5GADl 2C5HA 1MG5A 3FKSA 1KJIA 1DG3A 4PRLA 5EJ8A 4AURA 5IH7A 1PDWA 2LWIA 2AOTA 1C3VA 2X4DA 2C94A 1P1FA 2XDQB 3GRUA 1EHYA 5I45A 5K0BA 4EENA 3SQLA 1XO1A 3LPLA 2FQXA 2IF0A 2J9RA 1TJYA 4IV0A 1Z75A 2HYDA 2XUQA 1AMOA 4EBFA 2P2ZA 3FPLA 5FPSA 1SVSA 2ZI9A 3QXXA 5B2ZA 3WWOA 4B6OA 3GUVA 2WUWE 3NALA 3A70A 3P9QA 4NBTA 4M87A 4DR5B 3QM1A 2X77A 5F1OA 2V1UA 3IJEB 3KHUA 2PBFA 3HYNA 1JFFB 2YOGA 4AZ3B 3FWYA 5BV0A 2DUJA 3GP3A 1QTIA 2XEXA 1KEEA 2D5AA 4D43A 5L3ZA 4Q37A 2C9ZA 2WM2A 4TTJA 1MD9A 1DJMA 2BM9A 4F85A 1P5JA 2K5UA 3W5BA 2OVFA 2IOYA 3OJ0A 4KXUA 3QWFA 2W6ZA 3SVLA 4L5BA 4RF3A 2QMEA 2OFPA 1UPTA 2XCOA 4L85A 3JU3A 4M1SA 3TRKA 3OUTA 3HRIA 2B8WA 3L82B 1UZNA 4PZUA 1AC5A 3RTCA 4E5MA 4EL0A 1DARA 1Z5NA 2OYRA 3WWCA 1MORA 5IG2A 1LW6E 3GEEA 4U4AA 1AQIA 5FOTA 1AUXA 4DAEA 1EK6A 1XTBA 1XWIA 4B31A 5B6JA 3HO1A 2H59A 4HAOA 2ZB3A 2J46A 3MMZA 4V2UA 1O8BA 1O96A 1JJ7A 2G8NA 3AVTA 3N74A 4G4JA 2WF8A 5LQKA 1E2BA 1PZGA 3EMDA 3TN7A 1KAGA 2J33A 5KTOA 4FT4A 1MAHA 1FY2A 1TRKA 2MYUA 4HWPA 3ZCTA 2EL7A 1TCUA 2EZ8A 3PXXA 2B5WA 3X1JA 3OEHD 1NMZA 1DCTA 2O52A 4ZVQA 1CQWA 1SVKA 2O05A 4KQ1A 5KS2A 1SEPA 2REQA 4M1WA 5EE5B 2AFHA 4WADA 4P98A 1QB7A 2D1SA 4W1PA 4M1YA 3WK5A 4ZVMA 4Z4GA 3NTUA 1M6VB 4KWIA 1FUYB 2DUWA 2NAFA 1G0OA 1R0BA 3G0BA 3PFHA 4KYIB 1U8ZA 2HT6A 1IEQA 4Y67A 3VR5A 1JQAA 4E6EA 1KO7A 1LC3A 1TU4A 2C8JA 2WOOA 4UHBA 3TOSA 3SJ7A 3UENA 2RAPA 2W2OA 1B74A 1R9MA 3GF4A 3SIXA 3GP8A 4ZIRB 1OR8A 1TU0A 4B4UA 1Q16A 3OTWA 3UN1A 4C3OB 2IITA 2TYSB 4E30A 2J3JA 4M8SA 3FOZA 2F1OA 3R9XA 3IUYA 3OEEA 4IV5A 2JLWA 1Q7EA 1QHNA 1RBQA 3KDAA 3RT7A 4ZRDA 4KH0A 2VF5X 3DS8A 1Q20A 4TT3A 1CG6A 1MVNA 4XH9B 4RCYA 1YRHA 3NHAA 3JTMA 4JOBA 1N5MA 5BW6B 4BN4A 5BT9A 4F5YA 1QV9A 2P3LA 1YIDA 3JTEA 1TF5A 4FFRA 4JP1A 4OHMA 4BN5A 1KZ1A 1CUXA 1KH3A 1HC7A 2EYUA 4MGEA 4V3BA 3UUGA 2P78A 2GPYA 2WHRA 2O7QA 1UOQA 1XJQA 1XV5A 2PWYA 4OBEA 4QJ4A 2VPXA 3A1NA 3K9BA 3M4XA 1P7WA 4QO8A 3EY4A 3MWFA 4O4LF 4DCJA 5KVAA 4AJHA 3CNOA 1T9GR 4X1OA 2IUSA 2HRZA 4ZO6A 2PD3A 4UEOA 2A0WA 3T5PA 4V0OA 1GZ5A 3D3WA 3WP0A 1MGPA 1BMDA 4X45A 4QGBA 2FSFA 5EMLA 4MWZA 3O8RA 2Q62A 4GW3A 2OHOA 5HWSA 3EIEA 3QFRA 1NPTO 2ZBRA 2RJNA 3TPCA 1CS0B 1HTBA 3Q3HA 4CLOA 4CQNA 1U8XX 1GDHA 3LC7O 5CYPA 1QQ7A 1QWOA 1OFIA 1DI0A 4XDHA 2C1XA 2ZWAA 4Q3CA 4RYDA 1TO6A 2CD7A 4C2UA 1ND6A 4Q4DA 1XPUA 4TXNA 5HM8A 3ENNA 3HXOA 5IC6A 3I92A 4V39A 4PPYA 3W3AH 4B81A 3X1DA 1NT4A 1YR8A 1ZINA 3X1MA 2FE1A 2DFNA 2JFZA 1WZCA 2G17A 4FONA 3QEBZ 2VF7A 4NYJQ 3CIOA 4A1FA 2Z9CA 3GBVA 1SBTA 3TZQA 1DUIA 4RHUA 3FZGA 5A71A 2XPCA 1MB9A 4LHVA 3T4XA 5KB3A 4UAUA 3K70B 1GVHA 5CT4A 3R4CA 1LTQA 1PFWA 4C0QC 4ARIA 2B7LA 1CZLA 2O2GA 3AUSA 3NG1A 3IEXA 4FOPA 4YP1A 1G8YA 3EJWA 5JRDS 2P1RA 3AV0B 2JH3A 3AVPA 2CCKA 4GPZA 4PIMA 1WUHS 3GUZA 1CJVC 1WTCA 3LC1O 1X70A 3S70A 1TMKA 3UFBA 5JWRA 2M6RA 1UMCA 1Q0SA 2XWPA 4L28A 2PU5A 5DNWA 3U4MA 2OMEA 1NZFA 3QP9A 5BW8A 1QMPA 1QJCA 2BSAA 3ETGA 1YZLA 4LECA 3PQ7A 4Q02A 2VSOA 4K6FA 1RCUA 1D4AA 2MSNA 4CR7A 4MP6A 4OQPA 1J00A 2IRWA 4ZQBA 4QBTA 4DA7A 1ZZGA 4K8OA 2QXTA 3ZZUA 8AT1A 4BUCA 3KXLA 1I9CA 1FFDA 2IEAA 1CR1A 2AJLI 3L0OA 3SGLA 2D13A 3SOZA 1CUYA 1FSSA 1N9GB 2G36A 2JD0A 2UUPA 2ZBVA 5DI3A 2BFNA 2IPAB 3W2HA 1U2EA 4O5OA 3SYNA 2ZYWX 1SUSA 2WSIA 4ALKA 4ARAA 1RJ9B 1G8HA 4OB8A 1VHTA 5K8LA 4PLFA 1L5SA 3EZ6A 5EZQA 3N8KA 4Q12A 1AY0A 3GFPA 3NBFA 4QUKA 4AX4A 4BEVA 3K09A 3GGCA 4DJTA 2R7KA 5T4BA 2ZSUA 4TXLA 2JFNA 2VDWB 3EMKA 2R5FA 4MB6A 4XYBA 5CAEB 5D3KA 3ZY5A 3WGNA 3CF4A