3HXQA

Crystal structure of von willebrand factor (vwf) a1 domain in complex with dna aptamer arc1172, an inhibitor of vwf-platelet binding
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
201
structure length
201
Chain Sequence
PPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords von Willebrand Factor
publication title A structural explanation for the antithrombotic activity of ARC1172, a DNA aptamer that binds von Willebrand factor domain A1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/blood clotting regulator
total genus 69
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2009-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3hxqA00
1PD0A 1LFAA 1ZOPA 3E2MA 3BN3A 1XUOA 1UEXC 4MMYB 2VDLB 5HDBB 4C29A 1MQ9A 1IJBA 1N9ZA 3F78A 1CQPA 4UM9D 4HQKA 4PN7A 1PD1A 2NVOA 3T3MB 3Q3GE 1JEQA 1JEQB 3ZDXB 4BJ3A 4M76B 1AUQA 4F1JA 1M2VA 3EGDB 1RD4A 2I6QA 4UM9B 5E6SB 4C2AA 5KYUB 3HI6A 5KYWA 2NUTB 3QA3E 1ATZA 3TVYA 1BHQ1 1QC5B 4Z7NB 4IXDA 5E6UA 5KYYB 3K71B 2I91A 1FNSA 1U0OC 3N2NA 1ZONA 1YVRA 1IDN1 2VDKB 3EGXB 2VDQB 4CN9A 4NEHB 2WW8A 3EOAI 4HQFA 2QTVA 3BQNB 5ES4B 3K6SB 3V4VB 1V7PC 2XGGA 4O02B 4WK2B 4CN8A 3NIDB 1MJNA 1U8CB 4WK4B 5LN1A 1MF7A 3EG9B 1IJKA 3EGDA 5E6SA 5KYUA 1MHPA 1FE8A 4G1MB 2NUTA 2VDPB 5KYNA 3TXAA 1XDGA 1SHTX 2ODQA 5HJ2A 4XW2A 4WFQA 1N3YA 3ZE1B 1QC5A 1AOXA 1OAKA 1L5GB 3PPWA 1M1UA 3BQMB 2VC2B 2M32A 2ICAA 3F74A 1DZIA 4CNBA 5KYYA 1TYEB 4MMXB 4A0QA 5BV8A 1CK4A 1M1XB 3TCXB 1YVPA 3EGXA 2NUPB 3ZE0B 3K6SA 4IGIA 1RRKA 2B2XA 4FX5A 4UM8B 4DMUB 3VI4B 4Z7QB 1RS0A 5KYXB 3EG9A 1Q0PA 1MQAA 3IJEB 3EFOB 1JEYB 5E6RB 3PPXA 2X5NA 3FCUB 4Z7OB 1RTKA 3HXOA 1XDDA 3ZE2B 3V4PB 3HXQA 3K72B 1DGQA 1MQ8B 5HGJA 3GXBA 4NENA 4NENB 4C2BA 2ADFA 2IUEA 2VDMB 3PPYA 1T6BY 1SHUX 1NA5A 1AO3A 3ZQKA 4HQNA 4WK0B 3ZDYB 2WINI 2VDOB 1M2OA 1PT6A 2O7NA 2XWJI 3RAGA 3ZDZB 4F1KA 1U0NA 1T0PA 1M10A 2NUPA 3EH2A 4HQOA 4WJKB 1BHO1 1M2VB 1SQ0A 3PPVA 3IBSA 1JLMA 2I6SA 3VI3B 3NIFB 2VDRB 3TW0A 1PCXA 5KYWB 5KYXA 4G1EB 1JV2B 2XWBF 1IDOA 3EFOA 4IHKA 5E6RA 1JEYA 2VDNB 4MMZB 4HQLA 3FCSB 3M6FA 3EOBI 4JDUA 5E6UB 3T3PB 1QCYA 3EH1A 3NIGB 2ODPA 1ZOOA
chains in the Genus database with same CATH superfamily
1EZ4A 2G71A 2J9FB 4Y9UA 1E2PA 1SVIA 1UBRS 4JASB 4S1PA 3OE4A 2JAOA 5AHWA 1HURA 3VXKA 3WK4A 2PMBA 3F1LA 4U02A 4E5NA 4GKVA 2A59A 2XXJA 1L1EA 3O83A 5HKAA 5CA0A 4AYTA 4ROTA 1D6NA 4AW9A 3PTAA 5IAKA 2ZS7A 2QVCA 3OQIA 4PS1A 4RKYA 4UCXA 4BNZA 5JATA 2O8FA 3BK2A 4C0AC 4BNIA 4B81A 3P2OA 2WV9A 1NQXA 3RSHA 4Z2YA 3U61B 1ORDA 1T9BA 3LKDA 2R62A 1JEOA 2DQZA 4W9RA 4XGKA 1WSWA 2QNIA 2HV9A 2UVPA 4UUBA 2O8NA 1H9BA 4LJAA 1KZHA 3H6HA 5AR1A 2DB3A 1D0IA 2QR2A 4FXPA 2IHZA 4YDSA 1HFEL 1W34A 1DUIA 1QFJA 2JAQA 1U2PA 4UW9A 1U0OC 3RIXA 3UCFA 4D3XA 5C80A 1RMYA 1KR2A 2XA1A 3IV9A 4GLBA 2YUTA 1M2KA 1WDKA 2VHQA 2P35A 3NBFA 3RS9A 3ZGLA 4DQDA 1NQAO 3RTEA 5E9WA 1IG3A 1O95A 3V46A 4PZ9A 1Z0DA 1SCUB 5KWJA 4ARZB 2YCBA 5EKSA 4MLCA 4CFSA 2TYSB 4EQ6B 4QBIA 4PQGA 4COKA 1D07A 3C70A 4LVUA 2IUUA 2P7HA 1WV1A 3NFRA 3QPAA 5JCOA 1ORTA 3QMMA 1IEWA 1QB7A 1YGYA 1IBRA 3THYA 2BMWA 2HF8A 1RQPA 4MVWA 4EYQA 4R5MA 5JPIA 1D2EA 1H2WA 1K3TA 3BE4A 3LPNA 1TMGE 1QHEA 1Z2CA 4YRRA 2DQSA 4EYGA 4YP6A 1CUHA 1LV7A 4I8XA 4XWYA 1JH8A 4Y6OA 1DEHA 1NW9B 1L8XA 1XALA 3D9QX 3EEFA 4FZJA 2W58A 2CLEB 3P9XA 4TUYB 4L74A 1CP3A 5AK3A 1L4HA 2K87A 2NX2A 4DTCA 1VGVA 1YJCA 1QHFA 5DSZA 5J2UA 3ILHA 4OKNA 1PDVA 2PA3A 2REBA 1KAHA 3P19A 4RH3A 4YH1A 2R6FA 3ZTTA 2AOUA 3P2MA 4RIEA 5DI3A 2XTZA 3BD8A 4QOGA 4AO7A 3PJGA 3NTRA 2PKEA 1TYAE 5E38A 1XA0A 5D2CA 5IJAA 3BJEA 5CA1F 1E98A 2Y66A 3ABIA 1DFIA 1GA6A 3T7TA 3UAWA 1UZLA 2QYOA 4H3KB 4Q3EA 1X7YB 1YQTA 2HT6A 3UTCA 5HGJA 2FW6A 2XF8A 2VRCA 2WG0A 3L77A 1D7AA 3DF7A 3O7MA 1RKQA 2P6MA 5H3HA 1KEPA 3NTLA 4ENVA 4LMAA 5JUWA 3R3VA 1KWGA 3MTEA 3G5UA 2IE0A 2QL5A 2XQGA 3IIMA 3MW8A 4FEEA 4LHEA 1MD9A 1S8OA 5F73A 3ZDYB 2CNKA 3JYLA 2X8JA 1ZQ9A 2Z08A 1BKSB 1Z4JA 1TT7A 3FMPB 1QFYA 1PIWA 2H7VA 5DM2A 4LJLA 2CE2X 3TLCA 2QUBA 5LXTF 4JP5A 4PZAA 1MO2A 4BNYA 3HUDA 1VDZA 2KX7A 3FGNA 2BL4A 1COZA 1NNUA 3R6GA 5FULA 3WFJA 3PHJA 3VU3A 1LBSA 4DA6A 2WTEA 3WWEA 3G1TA 1HEUA 2HTEA 3N3AC 4G4IA 1PF7E 2I7TA 4HEQA 1QGED 3QHQA 4X1YB 1LVUA 3EOBI 2I8CA 4QGBA 2GJ9A 2PX6A 3AFOA 5DFAA 1OXBB 2FHPA 2F9FA 2PTGA 4BWVA 2AG1A 2AJBA 1QONA 2WT4A 3RK1A 3I1IA 2Q4TA 4IQ0A 5J1TB 1PLLA 5KUTA 1IZ8A 1YRWA 1YBFA 4IOKA 1W44A 1B6GA 1XXHE 4KLRA 3GAAA 1GO2A 1JRLA 1VPVA 3VZBA 4DABA 2BSQA 4N0DA 3OZEA 2HHHB 4MRNA 4W5QA 2NU8B 1NM5C 4JUAA 3DYBA 1N6OA 1RJWA 5K3AA 2DFPA 4BC1A 1DV1A 3DZJA 1CCWA 1JF8A 3LZDA 4UM9B 1A9ZA 3EDMA 4FYMA 3D1VA 4QOEA 1KZYC 1U5AA 2XT9A 3FVWA 5L51A 4HMOA 3A6GA 1JLLB 1V3QE 2NO6A 4Q1DA 3STUA 4R2IA 3M82A 3N05A 4EG8A 2BTQB 2AV6A 5DNUA 3IIIA 5AVZA 1T10A 2XEDA 1WUIS 2Z1DA 1QH1B 4Q4HA 5CLQA 3VR4D 4EW2A 2AZXA 2RGNA 4Y67A 4AJHA 4IQ8A 2X3FA 5B30A 4IFIA 3DE1X 2Y1DA 5HIIA 5IJWA 5M04A 4LCEA 2OCBA 3IPRA 3T3NA 1T8WA 1YIDA 3LH5A 1OASA 4QQ8A 3T7EA 1Q15A 1JALA 2AC7A 2X19A 4Q3NA 1JAIA 4HLNA 2N1BA 4DR7B 1T29A 1VE1A 5ECGC 5BWCA 1Z3IX 3BD9A 5IF3A 1C8LA 1H2BA 3B1YA 4G0ZA 3H3JA 4H59A 2IYZA 3UPTA 5JY6A 3NWJA 2ZYRA 3K5PA 2FPIA 1SIUA 1SD1A 4GBMA 1KI3A 2DCMA 2UYGA 1DIGA 2ACEA 2ZETA 2JHFA 4P08A 9LDTA 1GUYA 4ZDIA 5D6NA 2FDXA 3SHQA 3Q40A 3ACDA 1GL7A 4XOIA 3E48A 2EG5A 3ETJA 1CKEA 3HEMA 4N6GA 1MAAA 4DQUA 2BC9A 1TTTA 1POXA 1NVXQ 3Q3CA 4O25A 1Y5RA 1JFLA 1J25A 4Y2YA 5TPWA 3GT3A 8GPBA 5AOBA 1H2YA 2G9UA 3DO8A 2DHRA 4BRUA 3DAOA 4I3GA 2NU9B 1OFVA 2IEIA 1P73A 1GDDA 4JSYA 4FK8A 3ONNA 5K4AA 2DPYA 1NSTA 4N3AA 4N18A 3LDHA 1TA4A 3KUDA 5LR6A 1YB1A 3DS8A 3NTXA 3EMKA 3MINA 1JMKC 1POWA 2QU7A 1U7PA 2CVZA 2NXCA 4RMGA 3UH0A 2VT2A 2G6BA 4QXRA 1U1CA 4TTVA 2IPAB 3VVLA 1E96A 1Z7WA 5CFNA 3VMFA 2EFGA 4KP7A 4MW5A 4DKJA 1KRHA 1EAYA 1TYCA 2E1PA 4CUZA 5AESA 1KHHA 1TGYA 2A4KA 2J3EA 2O2IA 3LUBA 3G5LA 2VUHB 1E4VA 1RXUA 4GKBA 4NDNE 3VJKA 5CFZA 4N0EA 4PYQA 1E79A 1EE1A 1M2VB 2DX7A 2YXNA 2M98A 4ER5A 3RIMA 4E2XA 2JLXA 1T2UA 4PHHA 2XZDA 1E69A 4Y2UA 3T9BA 3W2TA 2C5SA 4MO2A 2AOTA 3SHOA 5KOJA 1VKHA 3A6DA 3INRA 4JDUA 1ZUHA 3HLTA 2WM2A 1SHLA 1AZLA 1O96B 4JCCA 5TQ0A 3USCS 4YRKA 3BRSA 2JHGA 3PHIA 3RFUA 2YY6A 3QBVA 3TKYA 2OG1A 3BMQB 2PKYX 5TXGA 1P6UA 3M7IA 2CZGA 3E0XA 4PQYA 1CZKA 2Q5JA 3FCOA 4DLLA 5GP1A 5H4HA 2OD9A 4OFWA 4WZBE 1GCUA 2HF9A 2ZLBA 4RM3A 4X61A 3WKDA 4EB6A 5JANA 3KR1A 2IPLA 4F8YA 2XHZA 5DASA 3S81A 3Q3GE 3E9EA 2J3MA 2JFNA 2XUGA 2ZRCA 4H7IA 2D5LA 5A6VA 1C80A 1NF9A 3THRA 4FBGA 1RD4A 4ZWNA 3WO1A 4HDNA 1I3MA 5E6SB 2BRUC 3HI6A 4W4TA 1VHTA 2V4UA 4DV1B 3UXEA 4O8ZA 1T8UA 4ZQGA 3TVYA 4D4JA 1EIZA 1QDUA 4NBSA 3ZWDA 4ED9A 1U81A 4M98A 4ACAA 2ZBFA 3GBSA 4OK3A 5BN4B 5BUCA 5BRAA 2PSSA 3WBKA 4HDRB 2CFRA 4EFNA 4NZ9A 1QOPB 3IDZA 4OB7A 4Z1OA 4K9MA 3U3ZA 3GYGA 4DRXB 1J6UA 2HHLA 1IM2A 4UAJA 1RAFA 5CLIA 3GRFA 1WP9A 4RNCA 3PC4A 1V4VA 3WRXC 1UZNA 4DPMA 4KG7A 3ZU4A 4BQSA 3G82C 3S2IA 3WGQA 3U7JA 1GLGA 5K3FA 2ZBEA 3EHEA 3FB4A 2AFIE 2AOVA 4AN1A 4JODA 1ETUA 1Y6JA 5T57A 5LBIA 2P2ZA 4RIIA 3W05A 3TXAA 1MG5A 4Y6GB 5FUXA 2ET6A 3R8FA 3IMKA 2EJVA 4FQ7A 4U4AA 5EHNA 2NM0A 4JCOA 4E4RA 3LLMA 1ZL0A 1KVTA 1OI7A 3H75A 3VNQA 3TFOA 1JKIA 4BKRA 5FUVA 3NRCA 6ABPA 1X2BA 2B8TA 2XLCA 4A91A 1NXPA 2R2AA 2WJ3A 2OQRA 2H92A 1SWWA 3LLCA 4JLWA 4RAQA 2OMKA 4O3FA 2PFKA 4A1FA 1PQUA 1H4TA 5CHYA 3GLGA 3UMJA 4I5DA 3BFXA 1I2AA 1ODTC 4Z2AA 3KRTA 1ZNZA 1CRQA 1OTYA 2G36A 1BDBA 2Q8PA 4W9NC 1GN8A 5EJGA 2GCPA 2WVAA 3LCMA 3ZWQA 4BN5A 2V74B 1JEYB 2H5LA 3DDSA 4PCUA 1FC0A 3O1LA 4MCHA 2HZ7A 4KIWA 4E30A 1AA9A 4F9FA 2ONYA 3SF8B 1G5RA 1HDZA 1Y3BE 1I2DA 1MQ8B 3C16C 3KPUA 4FVTA 4W5JA 4IDPA 2OYRA 3ZU5A 2FRDC 2IF2A 3OZBA 4UHHA 2BEJA 1R6UA 3E0QA 1GDHA 3TGWA 4EJ6A 1A8QA 3ETDA 4OUKX 1NTOA 2R8YA 1SFRA 3MFYA 3MT8A 2C84A 1TZJA 3F4KA 4GYYA 1B8VA 1Z82A 5EWMB 3T7CA 1C30B 4JXJA 1K7FB 3WV5A 4K3VA 4MR9A 1HH4A 4NLLA 1Z15A 2J31A 2Z8ZA 3KAJA 4GP7A 4TXNA 5HDQA 3AX6A 4D5EA 2FN9A 4DLWA 5J4YA 5JY1A 1BXGB 2Z2YA 3OZIA 4QPZA 3ES9A 1DAKA 3IYLW 2CDNA 2ILVA 5GJBA 2EKPA 4NE7A 4RZ2A 5AHXA 4ZREA 1P61B 4QNMA 2FPWA 1DRUA 3QWFA 3TNFA 3WRVA 1IHUA 4MQEB 3C0KA 1QCYA 3IHKA 4UBNA 4OHWA 1TC2A 1RRMA 4RLFA 4RIGA 4PZ0A 2PL1A 4KXUA 3VKUA 1GARA 4TUYF 5G3YA 3Q3VA 5KMGA 4EKEA 4GT1A 3DMGA 1QGUB 1J24A 1TK2A 2PAFA 4IS3A 1B26A 4QGGA 2OZKA 3NJRA 2VPZA 1EFDN 2I8AA 3EZXA 2AUNA 3OU6A 1ZD1A 3R5XA 4UM5A 3H5RA 4BYGA 1LBTA 5KYTA 4OQYA 4CEHB 1JR6A 4WXYB 4Q1VA 1G2OA 3CT6A 2P5SA 3CW8X 3KSMA 5CK5A 3ZI4A 5FEUA 5I9NA 2PSJA 4X54A 4PG4A 3RVPA 4NOLA 1XZCA 2ZVQX 3BIFA 4TSKA 2RHRA 2ZSHA 2CEKA 3C6KA 5JWHA 1V9SA 1SB8A 4PANA 1MLDA 2Q29A 3F9RA 1E1DA 1UOPA 2FSUA 3FUCA 5EZYB 2CJWB 1U9CA 5H3CA 1FRNA 2C5HA 2CMKA 2I7XA 3OP1A 1W30A 3UK6A 3HDQA 3LCUA 1F4VA 1XJ5A 3MMSA 2ZRGA 3NNNA 1ZGAA 4IKOA 2UYYA 3DCJA 3W2IA 1OX4A 3LU1A 1RQXA 4NBLA 4P3NA 3ZE9A 3HL0A 3DMRA 3EZFA 1Q1GA 4BQRA 4CM6A 2EX4A 1YRLA 5E2AA 3BXFA 4OIMA 2HREA 2VT6A 3AI3A 4M0CA 1IE3A 1RBYA 4LVNA 1QQAA 3BXXA 1C5KA 3W5JA 4XX1A 2ZGVA 1E7QA 3DT8A 2BI7A 2JI8A 3HNOA 1LKZA 1K98A 4GYKA 4EKYA 5I01A 4GI7A 3AOGA 3BB1A 3KYCB 4UFNA 3TIGA 5CVTA 1UKVY 1YS2X 1E6UA 1Q16A 4P3XA 1BFKA 1G2PA 2JHPA 1P45A 1E1QA 2ZJ0A 3CF4G 3SXPA 2YVQA 3PI6A 3U3MA 4Q9DA 4AU1A 4C4OA 2HCRA 1XTSA 3QYJA 1G64A 3H9BA 1KERA 3AV3A 4MYHA 1TUBB 4K40A 1QHNA 4EMTA 5AVTA 5EHZA 3AR8A 4FINA 2F17A 1N6RA 4ZVMA 4TWIA 1PHPA 1EX9A 5AP9A 2UKDA 3PQ5A 3LC2O 5ANRB 1RWXA 3WZ2A 3ZGYA 5KYKA 1XP8A 5FA5A 3QY0A 4FOTA 5ESXA 3T5AA 1GFZA 2H16A 2JASA 2WHXA 1EJBA 2D62A 3BJZA 1UC9A 3N2YA 5ENVA 2GBGA 3KZMA 3IQXA 4KUEA 3SDBA 4S0ZA 3HVJA 2C2HA 4RESA 2YV3A 2BYTA 1L3BA 3K9HA 4TV9A 4B6SA 3G7NA 3MWJA 4L15A 2X4GA 5B5SA 1ZD3A 3WC4A 4ZQCB 4DG9A 1UMCA 3I9V1 3K72B 2WWVD 3Q3IA 2WF7A 1XTQA 3TE7A 2DPMA 4D4KA 4C2BA 4J0JA 1IHYA 5CA0B 4BFTA 3AL0C 1C8BA 2EF1A 4IOMA 1W9HA 1X42A 3TB6A 4B7UA 4GECA 5D3QA 5DRYA 3DQZA 3FPKA 1SVNA 1JQ5A 1P29A 4C05A 1WKCA 4G01B 4NFHA 3OCUA 4TRMA 3S8EA 3OQIB 4ZC1A 2WFMA 4HHEA 2GESA 2XYGA 5JAMA 1AKWA 2NO5A 2M1ZA 2VN8A 1ZA1A 3PIDA 1WMEA 4Q7LA 1Q19A 2E82A 2YVKA 3QTTA 4WGGA 3SIRA 3TW8A 3JQQA 4R1PA 2YWBA 3TBHA 2GNOA 1ZEMA 2UVPB 3BWVA 2AKEA 4BLRA 5KVCA 4RVGA 4QGAA 2ZI7A 2ISCA 5AXCA 2OP1A 3CMMA 3PUXA 4ZCMA 2CYBA 4EA6A 3HFJA 5KPJA 4Q9IA 1HV8A 1M1YE 1ANKA 1W25A 4HPJB 5KJ1A 2VYVA 5FPSA 1HC7A 5IEJA 1YZQA 1U28A 2YJNA 4OQFA 1N2IA 3SQMA 2VKQA 1B42A 3GFTA 4J0CA 2GZSA 1TZMA 4YGXB 3CVVA 4HS4A 4B2IA 2CVQA 3IVAA 4ALNA 4OH7A 3X2SA 5AQ1A 1AUQA 4P31A 5C3MA 5C52B 2OENG 4U5XA 3S70A 5JH7F 1NASA 1S8NA 4JFRA 4AMZA 1NG9A 3GJ6A 5FLYA 3WHPA 2CUTA 3IXMA 4I6JA 1IWOA 1OA0A 1TEHA 4JV5B 1M8JA 2ZRAA 2C7BA 3S2SA 4Z9XA 2IUFA 1E9CA 2CVOA 3WGJA 3IT0A 1FQWA 4JLDA 2YKGA 3UENA 2MWMA 3CVUA 4MINA 2R68A 3K2QA 3ORHA 1VRCA 5HEKA 2H08A 2YX1A 4ZI7A 3EA0A 1MAWA 2ATEA 3DOFA 3PC8A 5JZOA 1NYTA 5K8IA 1H2ZA 4GR4A 5J2UB 4RPKA 1DJOA 3ESZA 3LHFA 1P5JA 4ALMA 3PDWA 1Q7GA 2V45A 1Y1TA 4JYMA 4Q7MB 4AJ4A 2AOUB 1JKJA 5DI3B 3ROFA 4WKOA 5J40A 4F5DA 4V38A 5FBVB 4U3JA 2IHJA 3R8XA 2KLBA 4KQWA 1VFPA 5LP6A 5F64A 2XV1A 3OX1A 1VE3A 5EP3A 2KE5A 1AMNA 4CZ2A 2OZVA 1PEAA 4MUNA 4UEKA 4YDHB 1Z4PX 3M6AA 4E31A 5C8ZA 3ZPXA 1Y1KE 2FSSA 2HQSA 4CMHA 4MI6A 2C5GA 3GCDA 4YUZA 2P11A 2OB2A 4IXNA 3E82A 4Q21A 2G9NA 1Z0KA 1GUBA 2XE6A 3HHEA 4AJNA 1U80A 4EHNA 5IANA 5HMLA 3N59A 2X8JB 3OZUA 2A30A 3KJZA 1UK7A 3FYHA 3WKBA 3ELBA 5ETJA 1O6FA 1O89A 2D0PB 2GARA 3DKKA 4NF2A 4O63O 3WO0A 4KUHA 1H2XA 1SC3A 4IJWA 4M2LA 1ILEA 4NCAA 1T2FA 4INPA 3GA7A 4OX9B 4MH0R 5A4DA 2BEKA 3LXMA 1FY2A 2PS3A 2GRJA 4LJ6A 5LQSA 1LQ2A 3KOYA 4HFJA 2BGWA 5FLKA 4I36A 4GMXA 4ZYTA 4KH1A 5EQJB 8ABPA 2VNHA 1ADCA 2WVHA 5B2ZA 2EL7A 1AQ6A 1Q0UA 2VRWA 3USZA 3PR3A 4TXJA 2QW8A 3U9TA 2B4KA 1X92A 3MC1A 2ZI6A 2RBKA 1EHIA 1J8VA 2Q6IA 2CBGA 2RGBA 3UJDA 5JVDF 5HW0A 3SJAA 4I0WB 1VZ3A 4NQZA 4P1ZA 4WXMA 5CW2A 3JQDA 5JSFA 1AZSC 3TG8A 1CDOA 1IHOA 1QLJA 4DV0B 1T0PA 4HQOA 1DARA 2WJWA 5DULA 2IWRA 5KTNA 3IILA 1KSHA 1NVGA 3KKEA 2QTMA 1O95C 4MEAA 2VHJA 5ALOA 5EP4A 3JQFC 1GNSA 2GXQA 3RIHA 3SIWA 3SZLA 1X1TA 2PGIA 3B6KA 2D06A 3D7SA 3NHYA 5IH3A 3ZV4A 1US8A 1ST2A 1KDPA 3LPLA 2GDZA 4LYEA 1IOZA 1XEWY 3H1TA 3VTAA 2OM2A 2VDNB 4ITRC 1N6LA 1FSSA 1UT5A 3EK2A 1M5UA 4Z6KA 2P9EA 1XJ0A 1QIJA 3BVPA 3LFHA 2HU5A 4A2PA 1U1DA 2F3PA 1PD0A 1LFAA 4Q4HB 1RJFA 5FQNA 5HF5A 4D9JA 3CU5A 1YUNA 4OQLA 1Z36A 2HWXA 5EY5B 1HTWA 4QUEA 4YK7A 4ZPXA 1X7WA 3P2KA 4RK4A 3RTCA 3HCRA 4JQYA 4Y2TA 3TDMA 2FSVA 2K5UA 1CNMA 121PA 1D2RA 1I6WA 1YR1A 2J9XB 3KOOA 4JA0A 4O1IA 1I4EB 2I65A 3BGSA 1KO4A 3GI1A 1CDZA 1TJ4A 3T7IA 3U17A 4PO8A 2ZTMA 2ZRPA 5AM0A 1P4HA 5EE5B 4A8HA 5IWAB 1ADYA 1YZKA 3VYWA 5LOVA 2IVZA 2DT5A 3EW7A 3NG1A 1ZK4A 2GBPA 2O1SA 2WEKA 3AEUA 3RVJA 3WYNA 3B7GA 4BVKA 4J0FA 5AKXA 2FPIB 2WE8A 3AOEA 3HFSA 5MGNA 3ZR4B 2M6LA 5C35A 1JKMA 4H0FA 5FORA 5C1DA 4N76A 1PS8A 2KSQA 5B58C 1E3JA 4MUYA 3CFYA 3OAAD 2MR6A 4O59O 3E3LA 4L02A 4ETMA 3WK7A 3ZY2A 1R4NA 4DCTA 2AD5A 1PGJA 3QUTA 5AQEA 1KK0A 1PAUA 4ER0A 3OZDA 1G20A 2Q62A 2GRUA 4M8LA 4R1MA 1Q50A 1QGAA 4PZZA 2PAAA 3ENQA 1RPAA 5TPWB 4FGJA 2BMAA 1VG1A 3NUZA 1QMGA 5BP7A 2ZTVA 1CY7A 4CDRA 1GTG1 1M2GA 2JJ2D 1ZRNA 5FPHA 3ACBA 3BGDA 4UXJA 4OQDA 3FUUA 4UD6A 3HVRA 3LECA 3B2EA 2RHBA 4L75A 2PJDA 4FFSA 1E5TA 4GDMA 3SS7X 5HUQA 3IR5A 1E94E 3MINB 4O4LA 1O5IA 4K03A 3AZQA 2IZZA 4U1RA 1AOXA 1WDWB 2KB0A 2HKIA 3MJTA 2OB1A 4NP6A 3SJCA 4ZTBA 4UDOA 3EQ6A 5KDLA 3DQQA 1JU3A 3GEEA 3OMWA 2XNDD 4FEGA 1S8AA 3FROA 3TCXB 1TPZA 2XITA 2YINC 4BVBA 3ORQA 1P91A 4GMDA 4LE0A 4Q01A 1AK9A 2GILA 2IYYA 2ASVA 4JLMA 1TQ4A 3SLKA 3IOYA 2OHHA 2E4AA 1M2NA 1QTIA 4NRDA 1E3QA 2Y92A 4NYMR 1KYXA 3B6MA 4YXWA 1BWPA 1GVHA 1Y1SA 3AB7A 1NY6A 1UP7A 2AOTB 2GR9A 3RK4A 1DXYA 1JR3E 3M4ZA 4KIFA 5T4EA 3UMFA 5IBCA 4FNMA 5KOJB 3G8CA 3O3MB 4PFKA 2N1MA 5TQ0B 1IPFA 2X0EA 3X1ZA 1KFKB 4BN0A 4IP0A 5CNJA 1GZHB 3BFKA 1Z56C 3QXGA 1MORA 2CL5A 1KETA 1CUJA 1ZIXA 2VDOB 1PL7A 5FOXA 4BQOA 3RDPA 2RGNC 1SXJD 4PQFA 1DJLA 4QU0A 4EB6B 1NVWQ 3A31A 2R8RA 4RDXA 1OXTA 2QGZA 4IIDA 2W22A 4I2VA 1STOA 3AW9A 1LS1A 2GEDA 2PRIA 3DWFA 3UJ6A 3WJ7A 5B4UA 4HDNB 3ANXA 4H4CA 1XKXA 1EHCA 1WY5A 2NTYC 2PKXA 4JAVC 1FFYA 2BGLA 4WAUA 1LQUA 2C4KA 2ZUUA 4QX6A 4Y6LA 4AJPA 3R75A 1X1QA 2QSZA 3VR5A 2QG4A 1L5VA 4EARA 2MYPA 1YE3A 4HDMA 1H9AA 2YH2A 4PCVA 4EG7A 4MSUA 2OVBA 3Q2IA 5ALPA 5E7IA 1OILA 3PQDA 4M1QA 1Z7EA 3ISVA 4O08A 2ZUCA 4ZU6X 1E59A 2FR1A 5LIRA 4RVHA 3KAPA 2GBFA 4DCMA 5FAKA 1N9ZA 1SBQA 4GBED 1W94A 1PJ3A 1Z6GA 5C37A 2LIVA 4YT2A 2XCUA 3IQEA 4JL6A 4KXFB 4D9KA 3SGLA 2X8WA 3FKJA 4F1JA 5K3FB 2JBWA 2OD2A 4POAA 4AY5A 2W2MA 1DADA 1I1HA 1ZJ6A 2PBFA 2QAGC 3G85A 3H3XA 1L9KA 4MIKA 2IGTA 1N8NA 1YQXA 2O14A 3FDFA 3QPDA 2XEXA 5IASA 3KVRA 1JHXA 4JLVA 2B83A 4OAOA 3MYRA 1XL0A 1EA7A 3TPCA 5HZMA 2IRWA 4JGIA 3CNBA 3QEOA 3EFEA 3C45A 2C95A 2G80A 1WLYA 1GA4A 2X8BA 3IXLA 3M3DA 4D4IA 6LDHA 5K6TA 2XOXA 5JCZA 1AGRA 4XB2A 4ND7A 1FXWA 3BAZA 2WLSA 4K0KB 1GPAA 1YZYA 2VXOA 4L7VA 1J2EA 4LXUA 3SDSA 3ZBTA 3CGWA 3GLGB 4DA4A 1Q7CA 2ZYUX 1W0JA 5HS6A 3BCRA 1IAQA 1JYFA 1CSEE 1S9HA 1U8CB 2Z0MA 3NHRA 1H2FA 4M1ZA 4YRPA 1V26A 2AR9A 1HKUA 2PCJA 3HWWA 2R1VA 2D1RA 3AJ9A 2OFFA 1YZLA 3WLAA 4CV0A 3ZOZA 9GPBA 1M2EA 3RGWS 1XK6A 2JFWA 1XTJA 1TM7E 2NSDA 1DRKA 1N6PA 2L69A 3O74A 2GFQA 4WGFA 4X7BA 2O3QA 1VJGA 3LWBA 2GBLC 3IIEA 1SUFA 3UJBA 3RYHA 2GO7A 1RIFA 1DUVG 4KNYA 1XTUA 4BNWA 1YVPA 4XZ3A 5MFPA 3K9FC 4MR9B 3EMVA 1FQOA 3OH8A 3TZ6A 3CLTC 2LDXA 2WNSA 4IDHA 1RRKA 4OJQA 2Q5FA 4ZYYA 4CHGA 2QZ4A 4EECA 3GJYA 1J39A 1XAGA 3HGMA 4IIBA 4L0DA 4OBEA 2Q5OA 1MC8A 1I0IA 1T3ZA 1YR6A 3JX9A 4JGBA 3FIJA 4RJIA 4YUVA 3L0BA 2XVAA 2O2YA 2E48A 3LBAA 1A9RA 1F8XA 4FR0A 1VKJA 2XOKA 1R2QA 4WX2B 5ALXA 5KYGA 4N82A 2CC2A 1IMOA 1Z2AA 2HJVA 3AJAA 2HQRA 3OIUA 4WE3A 4EMSA 5A7FA 1R5JA 2VR1A 5KMGB 1G291 4LJ4A 3EQZA 4O0MA 5CJJA 2BBTA 2FMTA 1PWEA 4X1OA 5HQJA 3VNVA 1RYZA 1NYQA 2IYQA 1VE7A 3Q10A 4P54A 4BLUA 4G4GA 1DEKA 1UOQA 3GBVA 3ZDZB 4QYMA 1L3IA 1P4RA 3R5SA 2I4NA 2WKPA 4EJ0A 1JN0A 4WACA 4M1WA 2YMQA 4UDNA 4BNDA 1VGRA 2H31A 5AUNB 5C31A 1T2VA 4RS4A 5SZHB 3GNLA 3FOAA 4PYMA 4BAGA 3OZXA 5AJYA 3CHYA 4UOEA 3MNFA 2BWJA 3K70B 1TQ6A 2NZUG 3Q88A 4AIIA 3Q8MA 3OBIA 1BXKA 3PV0A 5BYKA 1V37A 2VPQA 1BEEA 3DOIA 3GNQA 2X22A 1U8AA 5JRJA 1OX4B 2PLWA 1PGOA 4LDPA 3L1HA 3ZW7A 2PGAA 1X8LA 3NALA 1IB6A 3T7JA 2RK3A 5AKJA 1KDZA 2QOEA 4LYHA 3DL2A 3H65A 1HQYE 3ECAA 3PRJA 2DHQA 4AFNA 4EITA 4OU5A 1IY1A 2IOFK 1KDOA 1TLLA 2RFLA 2VSFA 4OREX 5L3RA 3IDOA 3V2HA 3FR8A 4DSZA 1AKRA 1UBHS 2QV0A 3EISA 1ONNA 3MK31 3QXCA 1PLKA 3KZCA 1XKTA 4JJ4A 4EGCB 3VSEA 2JGJA 3BSYA 2WU4A 3O1JC 4IDGA 4GGPA 4M86A 2UVDA 5CT5A 3PPIA 4AY6A 2PUJA 3OC0A 3WDMA 3F3YA 3IODA 2ZQZA 4JENA 5JARA 2H1LA 3VZCA 1V7QA 1JIIA 2J9YB 3FPJA 2ZATA 2PGXA 3GGJA 5E4TA 5CDFA 3UN1A 1XKQA 2P2CA 3DZGA 4OBWA 2VQSA 4BO3A 4DDMA 4EJFA 5B2EA 1G38A 3HBMA 2ODAA 5CVUA 2E5LB 3GQVA 4E33A 2ZM6B 3NP7A 1JDJA 4F4IA 4MDHA 5A6SA 5I7EA 5HSGA 2Z9BA 2VBCA 3H2IA 3WYAA 4BQEA 4RD2A 4RLQA 4DLKA 3LQRA 3SP1A 1OGJA 1SU4A 2F1OA 4BQIA 5IT9A 4X62B 2WJYA 4TV9B 3WK8A 2JEZA 3SX0A 1S1MA 1G6Q1 2O3UA 3THXA 1LPPA 3PEYA 4O5AA 4LDZA 1UMCB 4KSYA 2OFPA 3L41A 4LHWA 4QVKA 3ZYCA 1IBMB 3UW3A 1UL1X 1N33B 2DQ4A 1KDVA 3MA0A 5A0VA 4ZD6A 5C1BA 5CR9A 3LGXA 1NAHA 2W9XA 1TA0A 3PE6A 1DWUA 1AD2A 3OKPA 3GBPA 3ZEIA 1MAUA 4WRRA 2RKOA 4P5DA 3ZUPA 3HRHA 2RG1A 4WXEA 1IUOA 4AICA 5EJ6A 5KWEA 3A6KA 3HB0A 2Z98A 2AQ8A 2O8VA 1W4BA 1BX0A 4UUNA 5FTWA 3VNBA 3TW8B 3UG6A 4V0LA 1VHJA 3LV8A 5IABA 2R3SA 2VJCA 1Z8FA 1GUDA 2WAXA 1Z75A 1KXJA 1Z4LA 1NJSA 2ZRMA 4FHFA 4YRGA 1Z08A 1MRNA 1NV8A 1XZAA 1Z8HA 2JANA 3M6VA 4Q4DA 2IU0A 3B48A 3RAEC 1II0A 1F9EA 1NQ5A 1F5SA 3EXAA 2AB0A 3IAHA 3OHPA 4WZ6A 3UYKA 4XEUA 4M8IA 3VR0A 2AQHA 1A69A 2P9JA 3FPLA 1TTHA 4RDIA 2RHLA 4LGCA 3K70C 2YJZA 1SU8A 1B14A 5J5AA 1SHKA 1SHUX 1T9GS 1X14A 3AFIA 3ET4A 3DZBA 4HY3A 3WGNA 3WGLA 3QNWA 5L6MB 4F72A 1J9EA 2PKCA 3NGLA 4J2HA 1WU8A 2J5QA 1G8AA 5AJHA 2E37A 3RVRA 2GK7A 2J33A 4L9AA 4RZIA 2ID9A 1G60A 4QC2A 1SCBA 2QUIA 3C3BA 3O3NB 2DSNA 3NIFB 4TV8F 3HO8A 2MSDB 2R8XA 3TIFA 4GI2A 4B43A 1UINA 4A82A 2AGVA 2XUDA 4AZVA 4RK7A 4AF7A 3RAFC 3W5UA 3BTUA 1RXIA 3M5DA 2QMZA 1KH3A 1N3IA 2D4HA 3UG7A 4UTOA 2YMLA 4ZZ1A 5LQKA 1JHUA 2BMJA 2QUKA 3EASA 3DYIA 3RROA 2W2QA 5JV5A 1I0ZA 5AM2A 4ZI7B 3F1KA 4IIHA 2EW2A 3NQ41 4FU0A 4WA8A 3O8QA 3T5BA 1P3DA 1ZOIA 3BF7A 3GNSA 3QLVC 1U1IA 4LN1A 5IDVA 3BD7A 5SYMA 2DZDA 4AKTA 1C7ZA 1JKJB 2P65A 4NHEA 3GT7A 4G2TA 1FLAA 3PS9A 1Q1EA 2Q6LA 4U3JB 1NBMD 3WYDA 3JD4A 2G83A 3A2LA 5LP6B 1L7XA 4R2LA 1I7DA 1B0PA 1JZTA 5KAMA 2A33A 1KFEB 4TWBA 2Q46A 3KPVA 3NYIA 2ZKIA 4LFBB 4KXLA 4D9IA 4MWCA 1D5WA 3H99A 5E1MA 3QLUA 3LYHA 1KQNA 4L0CA 4HI0E 4N5LA 2EW8A 1FB5A 1OU4A 1U6JA 2D8MA 2CL0X 4NYJQ 3D6TB 5JRDS 1J56A 1W7AA 4B9AA 4MV1A 1DWOA 5LC1A 1G3RA 1SVLA 1V7ZA 1NJ6A 1UJ2A 1JQLB 1X80A 2R2GA 3C8UA 3DEIA 2MHCA 1ID1A 1J97A 5FB3A 2QN8A 1W4RA 4U39A 3T12A 4Z0PA 2CCGA 4DJAA 3JYQA 1LCIA 1QE0A 4ALIA 1DMRA 4YJ2A 2CNLA 5C4MA 4HRYA 3DFZA 3CC8A 3EGIA 4HO1X 5ARDA 3DNPA 3N0XA 3PRHA 1FE8A 4PX3A 2IXEA 4MQBA 3AI7A 3HFRA 5AVOA 2C42A 3DB2A 2IKQA 4DJ5X 3RRYA 2VL7A 3WYFA 4RMIA 5DDIP 3CZ9A 2ZB3A 3IJPA 2PUEA 1YS1X 2QPLA 3N75A 5EJ2A 5HCNA 5K7SA 1OX6A 1DAIA 4HRXA 1CERA 3ZG6A 1BFDA 4C0SA 2NQ2C 2PIAA 1TQDA 3ODGA 5HM8A 4LVOA 8LDHA 1NXVA 2J6CA 2P8SA 4GO1A 4KIGA 5T4BA 3SS8A 1VJTA 4IGEA 4BP3A 1PYDA 2WFAA 2PD6A 2H4XA 2YZGA 1NVAA 4URVR 1I5OA 3KE9A 3W2GA 3I45A 3OA0A 5B55A 4N41A 1US8B 2V98A 4DMCA 4MCJA 1W8DA 1TTQB 1F8GA 2I3BA 5K8LA 4Y0NA 3WLQA 4F04A 3L7NA 3ISJA 3KU1A 1ODCA 1X7HA 3VPBA 3RS2A 5HKKA 1IL0A 2JKZA 1WL8A 3OQVA 2ADFA 4AMUA 2OWEA 5DT9A 3ZQ6A 2WV7A 4YS6A 5TPZA 2P6UA 3E35A 4M49A 3U37A 5BV7A 3PQ8A 2SCUA 2VUIB 3CLUD 3K1AA 4MDEA 3E1SA 1X7WB 1YL5A 4D3ZA 5K3EA 2IDZA 4F4DA 3AM4A 5CK4A 2VUTA 3M5WA 3A1VA 3DVQX 3IA2A 2Z4TA 5TRTA 2EFYA 4MPDA 1ARZA 3S0JA 4KFCA 4WSOA 5LOVB 4O29A 4OA5A 5AUPB 3AEUB 2DRIA 1ULHA 2HMSA 2FSIA 2REXB 3Q0TA 4RA6A 5LP6C 5E1OA 3CX6A 4IG9A 3UB4A 3DE3X 2ZWVA 4P9NA 4QXPA 3R8CA 1JNYA 3ND8A 3HUEA 1N7IA 4G89A 4OLFA 3EXFA 2HDNB 3P45A 2GZ2A 4POOA 3FNIA 2WUEA 4W7HA 1S6YA 3WLRA 1UWLA 3EC1A 2YHIA 1GHTA 1CLUA 1R4NB 3PGXA 5EP1A 4ZT5A 4WBXC 4ZVKA 3R9IA 3AHDA 3EY4A 4ZARA 1C7EA 4DIFA 1G20B 1I7LA 3HS3A 4XYEA 3CWQA 4IWXA 3G02A 4HDAA 1MJFA 3BILA 1JHQA 2JLWA 1C3LA 5F4ZA 3H13A 1CZUA 1Z5WA 2C97A 5ED0A 5JCJD 2VJBA 4OKSA 5T5QA 4G9GA 2P2GA 2VZ9A 3PC2A 4DC1A 4JR2A 3TN7A 2IYVA 1ST3A 1GGHA 1QG2A 1IJFA 4TKLA 5LD2B 1OYOA 4O4LB 1FPMA 5HK9A 2HU7A 9ABPA 1NZJA 3WLKX 3ZWOA 5BQPA 4I1YA 4YT8A 2JGDA 1E4YA 1O9GA 4QUDA 1TC1A 4RS3A 4KQKA 5IX8A 1TQHA 3KXPA 1RZUA 2VOEA 2CLHB 2R8BA 4LWQA 4AN0A 2ZRFA 3AERA 4L27A 4U7JA 5A3SA 3TZBA 1H6AA 3TLBA 4DN6A 5A4MS 5F77A 1BCRA 1E62A 2C94A 4HQFA 1UBMS 1Y3FE 4NZNA 4PHCA 4Q9NA 4FYKA 3X1WA 2FDRA 1D4FA 1I24A 3RSFA 2ZXFA 4XA8A 4DLSA 1X8KA 2RJNA 2OOSA 2B4QA 4BCCA 4CG3A 4EI9A 2XW6A 3SE7A 1FW6A 4U8GA 5AI6A 4BFZA 3L43A 5LA6A 3VV2A 3UKOA 1C14A 4HATA 3IEVA 1OWPA 4D56A 5A9TA 4H9GA 2DKNA 2BGNA 4DSNA 4EK9A 1PNRA 3HCAA 4G67A 4XVHA 3Q11A 1OUMA 1UKCA 3NBAA 1CUCA 4ON9A 4P5PA 1XHLA 3MJFA 2B8NA 4XB1A 3LUAA 3EQ2A 4TVBA 4DNQA 2XUPA 4DLTA 2J6BA 4LYDA 3H8VA 3W7BA 1KJQA 1ONSA 2XBUA 1V48A 1C4WA 2AI3A 4LJ9A 4UE3S 1F51E 5TV2A 4FFWA 1PR1A 1LX6A 4J0DA 4PLCA 4REQA 1PBNA 1NTRA 4Y2PA 2FSVC 5DI9A 2W6OA 2I3AA 3O8CA 1SKQA 5CFOA 2VJDA 4OHBA 1YRHA 4FFVA 2FG5A 1P0FA 5DM0A 3LX8A 2Y4OA 1JLHA 1EK5A 2H9AA 4I3HA 3VNSA 4C7XA 4DUGD 2VJMA 1R8XA 5IF9A 3ZE2B 2QA5A 1JQEA 4LFCB 3GJZA 3VC7A 5JJCA 1RBZA 4HDMB 4ITUA 1S2MA 4OXQA 5CNMA 3K1ZA 3H9GA 2AOWA 3U26A 3AOEC 1PVVA 3T4EA 2WMYA 3DE5X 1X38A 2B6NA 3ZZ1A 2FKAA 1HDIA 2A6PA 3AIMA 5KTSA 2WMDA 3LTEA 2Z30A 3DE2X 3AY6A 1PE0A 1UQRA 2AEMA 2AXEA 2I2WA 1B1AA 2QR5A 3MZ0A 1MEEA 2C03A 3C6XA 4IGFA 1YA6A 3FW1A 4LG1A 1JLSA 3IKMB 1ZN8A 2XKAA 2NACA 3B13B 3OZWA 5BN5A 5FBZA 1GNTA 4OX9Y 4FQ8A 1NQUA 4OJMX 4TMWA 2K7FA 3MAGA 1EK6A 4B4OA 2NZWA 4GMFA 5EWLA 1JXAA 1Z7YA 1H5QA 3ETCA 1G21A 1R6AA 4GQAA 4HH3C 2C77A 2XTJA 1UADA 3VGPA 4NMMA 3I61A 5BSGA 1NMYA 1GUAA 4UCWA 5BYJA 1PEYA 2A9FA 5BOSA 1PUXA 4P3OA 3W7AA 5LD2C 2JFFA 3O31A 2X5JO 4CLEA 3WG9A 3W5SA 1NI4B 1WF6A 4OU4A 3KKZA 4OYYA 3AI1A 1FXSA 3RT9A 5JXJA 1EBFA 1LLDA 1MJHA 5LB4A 5IHPA 5IG2A 2NIPA 4MARA 4Q7KA 3EQ8A 2P2NA 5GM2A 3S1LA 1N7JA 2ZM5A 1QBGA 2QRKA 4BB9A 1Z0IA 3UMSA 1GM5A 4IDDA 2JD1A 4KYIB 1R3UA 2B7LA 3HEBA 2H63A 4XYMA 3I04A 4W1SA 1TEZA 2R1VB 3MERA 1ADGA 4PPGA 4Y9DA 2XRMA 2OV1A 2IELA 2ZU0C 1HQDA 1XPJA 4Y2GA 4CQNA 221PA 3SNKA 4YI5A 3N87A 4O5OA 2BLLA 1PJRA 3U56A 1T9ZA 1ZLXA 2YV4A 1PGPA 1S89A 1M2JA 1AY0A 4JQSA 1SOUA 2IT1A 4M38A 3EIEA 4EL0A 2WSYB 3RYHB 1FL9A 1YVRA 1Y0BA 4Z86A 1TO6A 2DBVO 4DJJA 2XMRA 2JCXA 1UDXA 1L3CA 1HDEA 5AVYA 3PJRA 1N2BA 3E8MA 3VPGA 4EUSA 3F8TA 5K0FA 1NXQA 2C96A 2RGGA 2QZJA 2QXTA 4BMVA 1GCAA 1E2QA 1XZKA 3OP4A 4M0KA 1KQGA 1N1DA 4XUEA 3UAVA 2PUBA 2Z09A 3TS1A 3C3AA 1L5WA 1LVHA 4DR4B 2OAQ1 4PN3A 1B8NA 3A04A 4TL8A 5CMLA 4C3OB 2G72A 3AUXA 4G0QA 4HB4A 3TNLA 5K8UA 1HSZA 3VDMA 1O0BA 3HSKA 4HLDA 2WF6A 4UHJA 2J0EA 5D7NA 5I5GA 2YS6A 2XTMA 3FRIA 5IDWA 1BOOA 1L8QA 4MDYA 3LX6A 4JBXA 1V8BA 2B8JA 2ICAA 2MDTA 2O2DA 5EESA 4RSHA 1GQ2A 2F4VB 3LT5A 2IYSA 1BRMA 421PA 3TM5A 1FMFA 2D2IA 1JS1X 4D8XA 4XD2A 3VX4A 3PHGA 4NPAA 1LV8A 4G0VA 5TE9A 1UIMA 1T15A 5KHLB 1QX4A 1MW8X 1FFXA 2C54A 4MLDA 3PZRA 3RTGA 1DAEA 3P2EA 4BNDB 2CXPA 4DNOA 2BJHA 1Y1QA 4H4DA 3V6LA 2GX6A 2P5YA 2E0IA 3S4YA 1Z0SA 2C8VA 2JIDA 3L49A 3L7LA 4B35A 3MLAA 5FKJA 1C3XA 1W75A 5IBQA 3P20A 3PDCA 3GLGE 1V95A 5JIBA 4GPAA 4KDRA 2VQFB 1K63A 3ZDAA 2FPGA 3UJAA 4EGAA 4KBGA 4M8KA 3E4DA 4PVDA 5E9AA 5M29A 4M1KA 1QGOA 2BONA 2FRVA 2ZE8A 3IV6A 1W35A 3HCNA 3B5EA 4TLCA 4YUYA 2XWJI 3QV1A 4OFZA 3CKMA 2JLRA 2ZUBA 2QRLA 4DIBA 2DULA 4IVPA 2FP3A 2OWDA 1XHFA 1J5XA 1OXVA 4G97A 4WCFA 5F21A 1URPA 3EGOA 4CTNA 4R7ZA 2JK0A 2WZQA 3AQ4A 1ONOA 1EWRA 2D5CA 1B41A 2ZYDA 1XTIA 3VJRA 3OZFA 2IZ1A 5K0BA 1PJSA 1GUZA 4GXTA 1D1PA 5BMVF 1JHRA 5CLLA 3VAYA 4E14A 3I32A 1WMFA 5ESWA 10MHA 3EZ6A 4P36A 1W76A 3D4OA 4NZOA 3OU7A 4BQPA 4IJ5A 2A3NA 5EP2A 4AQ7A 2A5DA 1T9CA 3ADOA 1UEXC 5A1TA 3HYRA 4BJHB 1KYQA 3TQHA 4INJA 5EVCA 1H0RA 1P5ZB 1BJKA 2Q0QA 5ALYA 3N28A 3NT5A 4I81A 5A6SB 3BKWA 1RT9A 2YHUA 3JVUA 3O91A 3PNMA 2ABWA 4N7JA 4MGEA 3RH0A 4OXNA 4RULA 4WK6A 4KYVA 1CRWG 5JTTA 3ZNOA 4FHGA 3THXB 3GJXC 3WIVA 2PT5A 4MVJP 2IF0A 5AW5A 4ASUA 1S0UA 3PA6A 3VVBA 5AH0A 4MV3A 2VPYA 2BGJA 3ZDRA 3EVGA 9LDBA 4OP2A 2VI5A 4RTPA 3SPXA 5FFFA 2WM8A 2IEYA 2OXRA 2PU5A 3H11A 2W83A 3HBNA 5FO0A 1QIKA 4KR3A 3B9BA 1QKKA 2LCIA 1GKYA 2ORYA 4RD3A 3S5UA 4URHA 1HMYA 2PTHA 2CL6X 1K0UA 2NSJA 5K3SA 3I5YA 1DO0A 3D6AA 3EPRA 3G2PA 3GC6A 3CNOA 2HSDA 5F76A 3B2NA 3L6CA 2BDEA 3ZK8A 3L7YA 3VZSA 4DEVA 1E6MA 3VYRB 4QJ3A 4RFSA 4ZOLF 4Q24A 2ZJYA 2VHWA 4BV9A 2R7KA 4BP8A 1SBHA 1HNWB 2D59A 3C74A 5A9RA 4DA8A 1NOIA 4P84A 2QXUA 3NBZC 2DLCX 1Q95A 1J5PA 4WLFA 4EWLA 4MJXA 3RASA 3MQ4A 4WD3A 3EUWA 3QE3A 3VR3A 5D5QA 2GPAA 5WRFA 3JSAA 3QVOA 5AK5A 4BZQA 3VVMA 1HM5A 4A0QA 4IF6A 4ZEXA 1YVEI 1SOAA 1ORVA 4XGRA 3UGKA 1F14A 3AP1A 3HO6A 3ZV7A 3ER8A 3LF1A 2RSLA 3BL8A 1F9AA 1SH7A 3CCCA 3OCYA 4X41A 2Q0HA 3ZY4A 3R76A 3HY3A 1N2ZA 1P77A 4BPRA 1T5DX 1HE8B 4QBTA 4TTQA 4UNNA 1GN9A 4EB3A 1RPZA 3ETHA 3T4XA 4RFVA 1MABA 4G1FA 2FEKA 4J3JA 2JBHA 5B37A 5AXBA 4RF5A 4PR3A 1HK7A 1VI5A 4UHEA 3SBOA 5AW0A 3V4PB 4XIFA 4IBOA 4DCGA 1YHNA 3A4MA 1OHHD 3VBCA 1EI9A 5AVVA 4PIMA 5IH7A 3TCKA 4URWR 1TQ2A 3IIKA 4JB2A 3VC1A 3ZHOA 2VDMB 3RANA 3D3JA 2WSSD 5GJWC 3A7DA 2C5AA 4MWSA 1F0PA 1L4LA 2FZ4A 1IXZA 3O8QB 3RAGA 1D09A 5M5BA 5LMNB 1EX6A 5EXTA 4G0WA 5HPYB 3ER6A 1L8OA 2WOOA 1IU9A 3CUEF 1L1QA 3C3EA 4RK1A 1WNFA 2KPOA 3E2PA 2YASA 5BSKA 3V80A 2P90A 1VBKA 1SZPA 5JBIA 5MN4A 1BX3A 1VG8A 2I6SA 1JPJA 1HDRA 4UFPA 1ZITA 5ALWA 5BQXA 1XEAA 4LJ8A 3V7UA 2OR3A 3GN2A 1J4AA 2W6MA 2XZLA 4J16C 2YZNA 4PHGA 3G1WA 4H27A 3I64A 2DWPA 3QELA 4MP3A 3ZYZA 2VAVA 2XQIA 3OSZA 3T35A 4G8CA 1EJ2A 5MN6A 4BCBA 1BSVA 4FGWA 5HJEA 3GJ0A 2RIPA 1FNMA 1HT0A 4PW0A 4EI2A 2XZOA 1KJIA 2PH1A 4IXWA 1X80B 3QMVA 3H4VA 4C0QC 4L08A 4UVEA 4ZT3A 2HXSA 4S1TA 5IU6A 2FLWA 3WGUA 3NEYA 1E6WA 2X0JA 1KAEA 2XCRB 2BGTA 1E9FA 2E6KA 4OEHA 2YZ2A 4E5YA 4YJ2B 4GMGA 4AJ9A 3L92A 4YV0A 4F4JA 1PK7A 4B6EA 4PLYA 2JIRA 4KQJA 2Q45A 3DDZX 5FBRB 1GPKA 4P86A 5BUQA 1F8FA 4TMVA 2WD9A 3MUOA 5DCYA 5EZ5A 1ZM4A 1DC8A 1RLTA 1NF3A 1EKXA 4ZTUB 3DUFA 3GRCA 4FNOA 1A5AB 4B4KA 4DFDA 1KEEA 1D7OA 3QF7A 3EW9A 4CCAA 3UHAA 4LHSA 3DF9A 4HH4A 3E4CA 4PSUA 1SD2A 1NPTO 2X9GA 1EUCA 4D96A 4K9PA 3P0EA 5CPBA 1HF3A 2EP8A 1RYBA 4I4IA 5ADUS 2CJFA 4EF5A 3I05A 3N76A 3KOMA 3RREA 1RYEA 2ZJBA 2RKWA 2HSJA 1USVA 4KPGA 2HHCA 2IYUA 1Y4ZA 2NV2B 1ORRA 2OGZA 2VJAA 4CXMA 1J8DA 5LJIA 4RK6A 4LW8A 1JA1A 2E7ZA 2WIAA 3O92A 4FS8A 2Q3JA 3EIQA 1LW6E 4C22A 1E2NA 4JI4B 3O90A 1RQRA 1YZUA 2X1HA 3S7TA 4TM7A 3ROTA 4OA8A 2E3JA 5F33A 3IT2A 4Q7QA 5CEJA 1ZY2A 2IP2A 1XZDA 2W98A 3K8QA 3KZVA 4HAOA 4KGXA 4ND8A 3LD9A 3ZWVA 1WCV1 2VTKA 2FW9A 4N9WA 4LYFA 3ASUA 1TW3A 3BSFA 5HF9A 1MOPA 5GY7A 2WYVA 2SCUB 4YMLA 3K1AB 3F5SA 1U7WA 3LNCA 2EYQA 3PXUA 2OQ2A 4AYWA 5B7PA 5A0FA 3JWHA 4OV6B 2AX4A 2P6PA 3LY9A 4NNOA 4ND2A 4CDGA 2R1TA 3CUKA 5HS4A 1LI4A 4IEEA 4WIAA 2WIKA 5HM6A 3OJXA 1Y3DE 2CJYA 1NVTA 2OKGA 4IQGA 4XM0A 1YQUA 2BM8A 3I37X 5FYQA 2IA5A 3B51X 1TZCA 1AUPA 2E9SA 4RA6B 1Z0UA 5FIUA 2CZQA 2VF7A 2VT7A 2QVBA 1X1SA 3HV2A 3FBWA 3ZTWA 1I80A 5BPHA 4GZ3A 3EXFB 2PXXA 2V7BA 3CW9A 3FLMA 2VP3A 3GXBA 3NHMA 3LTNC 1FTWA 3QLUC 3JY6A 4MTLA 2YHIB 4QD3A 5I3CA 2HN9A 1T5HX 2RCYA 4ARBA 2WM9B 3KDPA 2Z58A 4WK0B 1D2NA 2VDJA 3HJUA 3WA7A 2Z5LA 1HT2E 1Y63A 3Q1LA 1JWLA 4CF3A 5H9VA 1CJTC 2GF0A 3RQIA 3CS3A 5CUQA 4MQ4A 1YZGA 5JZSA 1FVXA 3HWX1 1DKOA 5I7UA 4J1NA 4IOJA 3J7AC 4D9NA 1ML3A 1ACMA 1GAEO 2G67A 3IHLA 2P75A 4K9RA 1Q21A 2Y9MB 1P31A 3T99A 1G8YA 1CQIA 1WS6A 5JW6A 3N58A 3STTA 1JG7A 2Y05A 2AS0A 3QW4B 4XQEA 1OPXA 1A04A 3KLPX 3KUUA 4J29A 4RMNA 5EIBD 4XPIA 2AQKA 2ZW9A 4ANFA 4TS4A 4RM2A 5AVUA 2JGDB 4R71A 2VHYA 3K92A 3ZY5A 3PUYA 3IB6A 5KNDD 3ZJTA 3RRNA 1CF9A 1E5DA 3T3OA 1ZM9A 2RGDA 5EJFA 1KI2A 3P27A 2X14A 1TM1E 3AERB 4CYMA 5J43A 5E0OA 2XQJA 5DP1A 4RWZA 4DM4A 2C2ZA 1BCRB 4FIZA 3PD0A 4A2WA 1KZGB 2GEJA 3DMPA 2YXEA 2C9ZA 3IP6A 1DLJA 1F7VA 3ZU6A 4A15A 1TMKA 1Z6YA 3C15C 1F3OA 4PRZA 5EG5A 4B3CA 3T5CA 1XJWA 3CIFA 4O2AF 4PS0A 1EINA 3G5AA 1D3AA 3IDFA 1WUHS 1F6BA 5CT6A 5LA6B 1N75A 2ORIA 1JMYA 3MUFA 5FHQA 1LF5A 2B0CA 3B6EA 2BFNA 1J2TA 4HX2A 3TIVA 1LJLA 5ICEA 1BHQ1 1A2OA 4B6GA 1YS9A 2P4HX 4YMVA 4G86A 2B92A 2O6HA 4J0IA 5FH9A 1BRTA 1RJEA 1GFIA 2ZIUB 5JXGA 1ISSA 3H9QA 1P18A 4N0MA 1NW4A 4RLSA 3RVDA 3PITA 1GTL1 2J3KA 4I08A 3WSVA 5AKKA 3D43A 4B6OA 4WKPA 1ZCJA 2PPVA 1YQGA 3BB3A 4GE3A 2P1RA 2QD4A 2Y6UA 2GAOA 4REQB 5KWIA 3T5PA 2YCLA 3I8XA 3KEFA 1YZNA 4BBPA 3F8SA 2XD9A 4JHXA 4N01A 1ENZA 1V0JA 3W3ZB 3ZQJA 4DIEA 1IJKA 4JLBA 4BKUA 1JWBB 2FRXA 1YL6A 3C1OA 1HNXB 4G0UA 4I50A 3T1HB 1F60A 2Q1YA 2VJMB 4AS1A 2IOQA 1K8QA 4L4SA 1G20E 1FS4A 1NN3A 2EFJA 3SBDA 2GLUA 4FCTA 4BKOA 3GOHA 2ZYWX 4Y1RA 1T9KA 1N3YA 3KWMA 1AB6A 2QLNA 3K09A 3PKJA 4IIYA 1KO5A 3GLUA 1GXSA 2MJLA 1IN6A 2VJLA 3IE2A 4YQZA 4HV4A 3IR6A 1QHYA 5CDYA 4GOMD 1VB5A 1ZXBA 3FG9A 4GX5A 3WMXA 4D9MA 3N86A 4WJZA 4U00A 4CLHA 2C99A 2KWIA 4XUGB 3IUMA 5BN5B 1I14A 3BT7A 3QMWA 1T4CA 1I01A 2X4DA 2GYWA 3PUIA 1ZD4A 4IO0A 4TTRA 5EWLB 1GYPA 4BEVA 1T3TA 2AKYA 1G21B 4TYQA 1E7RA 2X7HA 1IAVA 1W5BA 2I78A 2J59A 2WICA 3K6JA 3OM8A 4RZQA 3PGA1 5FCDA 4DREA 3C3JA 3FCUB 1LJUA 5BOSB 4NK4A 1XSEA 1ZZEA 2QR3A 3ESCA 2AN1A 1L7PA 3W8DA 3RJZA 1Q3TA 4FFMA 1MVLA 2Z8YM 1ETHA 2WWWA 2ZOSA 2NLOA 4LYYA 2PH7A 1XRSB 4UAVA 4TWZA 2V7VA 1IUPA 1WG8A 3FJ1A 2XE7A 3G59A 3OOWA 5DV9A 5FL7A 5HVNA 3IOCA 2WG2A 3EF0A 1YASA 5YASA 3IE1A 1JJFA 1DHTA 3D02A 2XSZA 2B2CA 4KK4A 4ARCA 3E9ZA 2BPOA 4ZT6A 4CIYA 1O97C 2QRVA 4LRUA 2BFEA 1P17A 1G63A 2GKGA 2VK2A 3K0HA 4KIUA 2F90A 3B6ZA 3PVSA 4YASA 3RE1A 5IVHA 1AU9A 3UWDA 5J58A 1P2FA 3WNVA 4OQPA 1R7RA 1JFTA 1VOTA 4DG5A 1JE1A 3A1DA 1Q1NA 5CT8A 1W59A 4Q7JB 2R6HA 5DMHA 1XZHA 1WSAA 1FYXA 3PIRA 4ME6A 5FWDA 4LV6A 2GF9A 2IZ0A 4EYEA 1H85A 4NU8X 3WGTA 2PFGA 3OCJA 3HA3A 4PLZA 1IULA 3GLRA 3HXPA 3N0WA 4OOEA 4YAJA 1PJCA 2O9JA 3KQTA 1CUVA 4DBLC 4ZEOA 2BFOA 2O2JA 3NBMA 3RS4A 3BWYA 3T3MB 3UICA 3LP5A 4LF7B 2KJQA 1VZ2A 4V03A 5EUMA 5DPMA 1JI0A 3W4JA 2WTUA 1Z2OX 5TVGA 3OKAA 1OX5A 2Q1XA 3E8SA 5TQ2A 3WLTA 1CUUA 1IOLA 3VHXA 1PS9A 1NBMA 4S24A 3HC7A 5DBIA 1QWSA 1E92A 4MQLA 4C4YA 1OCEA 3T6KA 1I9CA 2ZPUA 2WQ6A 5L9AA 4I4NA 4MIYA 4KWCA 1P1HA 1VHQA 2G82A 2GCIA 4KV9A 4WL0A 2NP6A 3W8NA 2QLTA 2I8LA 1UMDA 3EOAI 5CIYA 2JFHA 4MUGA 4XJSA 1U65A 2EGGA 4IJUA 5FD8A 3WRYA 2GLTA 4QICA 1M75A 1M7HA 4BE4A 4UARA 1FFXB 2AG8A 5ENZA 3WWCA 3ZNQA 4FE7A 4F92B 3TGPA 4IYRA 4BTLA 2I1WA 3TIXB 2H2FA 4QOIA 4U7GA 5G40A 5GVSA 4FLFA 4Y2SA 3F73A 4PPNA 3DCYA 1QDEA 1HX7A 5LYJA 1UJCA 4UFOA 3LDUA 1UBGA 3P94A 3VQTA 3QU9A 2DEUA 3CCFA 1Z5NA 4FJ1A 2I7CA 5FBLB 3II6X 2FPGB 5IM4F 5LQUA 2K2QB 1A2KC 1PNTA 1NJFA 3CX4A 2J7PA 1Q17A 1UJBA 1E9RA 1QHIA 3HDHA 4P7BA 1GPH1 3SKVA 2EWWA 3HP1A 4XVUA 1G8JA 1Y37A 2OBLA 4K9NA 1GZ7A 2NVWA 2XX3A 2F3SA 3AVQA 5HXAA 4DCNA 1T3SA 4WCFB 2UDPA 3S2EA 5C1OA 1CY2A 3DDCA 1VIVA 3MCTA 5F3WB 4EUEA 3I0NA 1FTNA 1UOEA 1Y42X 3G0DA 3GVHA 2BM9A 4KZPA 3CVOA 2O20A 2VHVA 1HYHA 2GJKA 2DFLA 3NM6B 3MIIA 1MX1A 3ESXA 1R0WA 3HCDA 5D3MA 4EEZA 4EFDA 2VH5R 2FWJA 3CN7A 1VKNA 3OKFA 3W06A 4LI0A 4QTTB 2JHAA 3CWCA 3EGCA 5B7GA 1DRJA 1J90A 3HCFA 4HN4B 4WBNA 2UZIR 2EIXA 1GY8A 4QIHA 3FRJA 2QROA 1VPTA 4QT0A 3I4LA 3ORFA 4KJXA 4OHXA 1PT5A 4YP5A 3U4IA 3DD1A 3P0HA 2X1MA 3PWKA 4I1UA 4CIDA 2JIOA 4E2WA 3RTDA 1K6JA 5DW0A 1MV5A 1XMVA 4N8SA 2AWOA 4YRIA 1JKXA 2C0QA 2KBFA 3PG5A 2VXCA 4MKXA 3OIFA 4WCVA 5L95A 4YT4A 1FQKA 4H1UA 1A7UA 1SIOA 2G09A 2FETA 1J1ZA 2PZFA 3DEAA 2EZTA 1Z0AA 4D44A 3KQPA 2DGDA 2OGUA 4G1UC 3H11B 1Z8NA 3ZXIA 4R9SA 2J0UA 2YFKA 5H16A 4BO2A 5JCXA 2JB9A 2IJGX 1GRRA 2GJAA 1EUQA 2E6UX 1Z33A 4UQLA 1L8AA 1NNSA 4HZIA 4D97A 4BGIA 4YCNA 2G0NA 3SZGA 3LK7A 4BJ1A 3S7ZA 1FU8A 1P62B 4CQLA 1RQLA 1FTYA 2POQX 3ILYA 2YWHA 4BLSA 3ERCA 2F7SA 3MM4A 4RFSB 2I6QA 4KQMA 1VLLA 3HADA 2MMGA 4XWOA 1GL6A 3Q15C 1JIKA 2OCXA 1UF9A 1V5EA 3G5MA 2J3IA 4YRCA 3H1EA 3HA2A 3W6UA 5K05A 2J7KA 4FOOA 2YZMA 1PL0A 2BZGA 2QRZA 2CVPA 1U4OA 1N2XA 3BF8A 5DK6A 3SY8A 3VOTA 2JJ1D 3NOQA 1YNSA 1JHYA 1SCNE 3JQBC 3KBOA 2V7UA 4OGGA 1BE0A 1U3VA 5I7OA 1P72A 4N3NA 3TWOA 3QIAA 2BKLA 2QD1A 3H2HA 1SG0A 4ZVNA 2YWCA 3EPHA 4OXKA 3E05A 1SUWA 3CKKA 3D6VA 3PX3A 4LZLA 4NZMA 4OMDA 4ZVOA 2O8EA 5DGXA 1VL6A 1KORA 1TRKA 3QOFA 1B3BA 3E8XA 3KZOA 2C88A 2G5CA 3GJ7A 2OBNA 5A62A 4QGFA 2WTNA 4EFLA 4LMPA 5EZSA 1MABB 2YDXA 5CDFE 3WSTA 4ESEA 4QGSA 4WOJA 2ZJAA 2HMTA 4G1MB 1G5TA 4I5EA 4D74A 4B3TB 1N2JA 4E6PA 4XRRA 3P4XA 1S2IA 2HJGA 4H7HA 1B3RA 2GM3A 3QLEA 4R8MA 5ITSA 4D0NA 1Z2DA 4L4RA 2NZ8A 3RHTA 3RJMA 2GTHA 3UJHA 1DTWA 3B78A 2FPXA 4YUAA 4HGPA 4C0XA 1CIPA 4X6UA 2E4VA 4C4XA 2ECPA 5A5VA 3VPAA 1T1EA 4PU0A 4GLFA 1H3NA 2N75A 4G4JA 4HWKA 4RKWA 3D31A 1QIIA 4MVXA 3PNOA 3OT5A 4HAIA 4RPHA 4DIMA 1B93A 1C41A 4E07A 5F23A 4IH9A 4TX1A 1OE0A 4IL5A 5KYVA 3QELB 3B53X 2X2OA 3OI7A 2VSXA 1XQWA 4AZWA 2WWYA 4HKTA 3NEJA 2SBTA 4G0OA 3UA3A 4F6LA 5BPFA 1U3DA 2VNIA 2X1VA 4BATA 1DJPA 2MINA 4RA9A 2E55A 2IEDA 2A0UA 3H1PA 5CD9A 3TUIC 1EFPA 2EFEB 1M73E 2Y0CA 3BDVA 1HNNA 4EHFA 1X1AA 1ZHOA 1OT5A 3HBLA 1ODLA 3COPA 1NMSA 2CT8A 3KOZA 3VZQA 1IQUA 2C9DA 3WAJA 4S1OA 1ZZGA 2GBCA 5M2QA 4K6MA 1KA9H 3AJ8A 3HVUA 3KQKA 1XYVA 3L8MA 3WYGA 1N2CA 2VDRB 2WIBA 4Q1AA 1I2MA 1BJTA 1PL8A 4BYMA 5KX5A 4GKJB 2YN2A 4MULA 3V9AA 3VYUB 1IDOA 3IESA 1P81A 3Q8KA 3DUFB 2YJ6A 1KEEB 4I5IA 2VAWA 4DSAA 3KO8A 5JAQA 5GONA 3WISA 1T3LA 3QKUA 3WXBA 4UNSA 2X9QA 4URXR 4GI1A 1U3UA 1XE3A 1Z16A 2ZANA 3LVQE 2YNMD 4RTSA 4G5RA 1HFKA 1EUCB 3NHJA 5K8TA 1USKA 1EK0A 5DSXA 4M0LA 2GERA 3KSDO 2JAWA 3CLKA 3R3WA 1MX3A 2O57A 3IURA 2K4MA 5JH7A 4R8VA 1EQUA 2NTJA 1E1RA 1E5QA 3B2QA 4FYHA 2CNWA 2MT9A 1PZXA 4EO9A 1WPRA 5CVEA 2W93A 2XWSA 1V6AA 1PR0A 1R9GA 3LUPA 4X65B 3DCNA 1G19A 1G16A 1IIBA 4BMPB 3GA5A 4C5BA 4UBKA 4YJDA 4HNTA 2XZTA 4ND8B 2G9VA 4JJKA 2PBRA 2PLRA 4FZ5A 1ZC4A 4GI5A 1BHSA 5ENDA 2O07A 3RWOA 1QO0A 1CF2O 2OSVA 2QY6A 1UIRA 1DHRA 3A3NA 1SVSA 2Q2VA 4JYPA 2YJ5A 4DMKA 2PLAA 5F9HA 1DC4A 3PQ3A 3SZOA 4B5KA 4MW1A 2R1TB 3N0TA 5DYYA 2ADMA 4KCGA 2NZ2A 4IMIB 2Y3IA 1SCKA 2IYEA 4WK4B 4EA7A 1VMIA 3AGPA 1HZZA 5JJBA 3O84A 1SXJC 4EY3A 3GZTB 1CTQA 5D5HA 1TK9A 2F3UA 4OGKA 2Z6QA 4AF8A 5JD3A 1E2HA 4FFBA 4G56A 2ODBA 9MHTA 2V1XA 1NYLA 3VKHA 2UVQA 2VBFA 4IFTA 1UAYA 4YJ3A 1LU9A 2GHQA 2B1JA 4CU2A 3LSTA 2EGUA 4JSRA 4JA2A 1JSCA 3OFND 4UVIA 3R23A 2WG1A 1R6BX 5ALRA 3L79A 2RH9B 4LAFA 4OSEA 2HLDA 4QOJA 5TDHA 4B0PA 5LXTB 1X1CA 2RAFA 3SZ3A 3L0SA 3WL3A 3G23A 4DSUA 3PLRA 4FHEA 2WWXA 3H5OA 3VOAA 2IOHA 3O26A 1IZYA 3H0CA 3S44A 1WO8A 1O03A 4WTOA 3JVIA 1CQIB 4RENA 3W5BA 4B7XA 4HLUA 2ZIFA 5FV4A 4XPIB 5FDFA 5CB4F 1J1IA 1TU3A 4K9LA 4D3SA 5D7BA 4DDKA 4ZKDA 5F7OA 1UR5A 1YE8A 1ZUNA 4XFDA 1N8TA 4V0QA 5F1YA 3ZX4A 2L0XA 1W5AA 4GM1A 5K2OA 3KP1A 5BV1A 5BOVA 5AXDA 5C46F 4TKZA 5LVAA 4OVKA 1FJHA 4BNNA 4XD7D 1SVMA 1R8SA 4L2IA 1LK7A 3N74A 1LEHA 3OO0A 2DUMA 4KAFA 5K2MA 1ZMOA 5IAAA 1W6UA 4XWKA 3TDKA 3L84A 3G0BA 5F5LA 3RKUA 2J1LA 3C4VA 5BNWA 4UREA 2UZ1A 5FXMA 4URYR 4D1YA 2Y77A 2GAFA 4LJYA 2WRZA 4EX7A 3K2EA 1JLMA 1JAZA 5TS3A 4P4NA 3TW0A 1IZ7A 1HQKA 2PL5A 1FTSA 2Y76A 2ORED 1WKVA 4QVGA 4NIMA 1A7AA 3DTVA 2C82A 3EUEA 4G0YA 4PICA 2E5FA 2H2AA 2WKSA 3A6FA 1JQDA 3DXXA 3OPQA 4X60A 3FZEA 3QU4A 4TQAA 4C4AA 2PQ6A 3CB4A 4B82A 2ID7A 1CE8A 4EPTA 3V5NA 4TMXA 3I5XA 4MHOA 2D1TA 5T6BA 4HZUA 1L5MA 3DKVA 3SZRA 4B6FA 4E1AA 1N77A 4JI7B 2XQVA 3NT4A 1D1SA 3IUJA 4WNYA 2CFCA 1G5QA 4JOCA 3PF9A 4LNHA 4XDGA 2GT1A 3W5VA 3F78A 1UJ5A 4A0FA 2O3TA 3MT0A 5AJUA 4HGYA 3KU4A 3FPBA 3N2IA 3V8EA 3WYBA 1DDOA 2M9MA 4C9BA 2QEQA 5KJFA 4BLWA 4IIEA 3AKCA 3F6BX 3NVAA 4U0JA 2QD3A 3REGA 5JNTA 1X86B 2OXTA 1NR5A 5AKIA 4JBGA 4I50B 1OXSC 4WT7A 2Q6TA 2RI1A 1PJ2A 2WUWE 4ZVQA 2R97A 3HKEA 2GLXA 3N2KA 4YROA 1QQBA 2FW0A 4QUAA 4OF4A 1VBNA 2QTAA 4Y1RB 3MFQA 4LZJA 4N7RA 3IPAA 2ZVDA 2GVDC 5CIQA 2AEFA 3EGVA 1A7JA 4KPUA 1XV5A 2EQBA 4IZHA 2IZ7A 3OTGA 1GXSB 4HDSA 2QVYX 1ZS9A 4JS0A 4KXMA 3JQAA 1U3CA 3DBVO 4EKNB 5AW7A 4CM9A 4BY9E 3FDJA 3HDVA 1E3WA 5KQMA 2X0NA 1VIAA 2A14A 2QP3A 4C06A 3KQOA 1R0KA 3FSGA 4RVOA 5IDXA 1T4CB 2WNHA 3C8ZA 3CN9A 1MC1A 2B4RO 1U31A 1TAHA 3OZGA 2PGJA 2VNSA 2WA1A 3WK5A 4QARA 4H4EA 5A4AA 5BVHA 3CVWA 1JFVA 3CBQA 3G2QA 3JVDA 2NUTA 4LDQA 4V3CA 1DE0A 3CLRD 1T4BA 5BVGA 2R66A 4GZLA 1PFUA 4WY8A 3M8KA 3PFHA 5HOQA 1OB2A 4GE0A 1Z37A 3EWAA 4Z9YA 3EHDA 2ZKLA 4QUBA 4BKPA 2FI1A 1YV9A 4HUQA 4J9UE 3A27A 4QXQA 1NURA 3EE6A 5HTOA 4REOA 3RBXA 3EG5A 4BUZA 4PFSA 2VTBA 1U90A 3R44A 4D0LB 4MVJH 4L9RA 1X7XA 3R3UA 1A8SA 4FSHA 4HBGA 4MQ6A 3RC9A 2QRVB 2Y6VA 1JDUA 4RPJA 1ZISA 3N0VA 2BFEB 4YDQA 3X2EA 3O4IA 1JG6A 3HYLA 1COWA 3REQA 3VR6D 4EG3A 1KAOA 3QIVA 3IKTA 4ZVTA 2ZXUA 3KJIA 4MZDA 5FTMA 2IUYA 4D25A 4DBLE 4MKHA 2MTBA 3TI9A 5DTMA 5ICSA 1XTVA 5C7OO 1DVRA 3DAYA 4MYSA 4ZA2A 2JGAA 5DN6A 1BE8A 2QQ5A 3U4GA 2EQ5A 4GNRA 2QVZX 2Y1EA 3W6PA 4Z4FA 1EWVA 1YZFA 4IVNA 4Z8YA 1VL0A 2WJIA 2ZT6A 3K8OE 3MG9A 2HK9A 3TAXA 3TPZA 3TSZA 3G9TA 1CHDA 1X77A 2X86A 2VQDA 2B4YA 4JOBA 3ZCSA 5TJHA 2IYFA 2OCIA 2FDCA 1EPUA 3ABSB 2NNWB 3TVDA 3ZD8A 4F1KA 1HEYA 3O21A 2NWQA 4QQKA 2WY2D 3K9NA 2H0QA 2R00A 3C6BA 1G4AE 4KBYA 3GLKA 3H5NA 3ZJ4A 1GPDG 4WJKB 4RV5A 3CA8A 1A98A 3PB3A 3I2IA 4A10A 3WLIA 1L5KA 1C4OA 3WL5A 1A9YA 1DT3A 1EB8A 2GN0A 3PLNA 2AZ4A 4MWTA 1MAHA 3E22A 4L5YA 4O2BA 5IAGA 3OWHA 3VHXB 5AW4A 2JAPA 4DXDA 3KYJB 3GF4A 4Q34A 4JXXA 4Q9LA 1RHQA 1BCSA 3K9BA 1FFAA 1E7SA 1IMJA 4AKSA 3E70C 3VGJA 3QU2A 3WNBA 5AOVA 1T24A 4ZOQI 4C4SA 4YMWA 1T25A 4I55A 4WKGA 1VIMA 1G21E 4DDVA 3TD2A 4Z7JA 4JMPA 3VTFA 1UMDB 2QRPA 5CM2Z 1GNVA 4DRZA 1HR0B 4TLDA 4UM9D 2YYYA 4YO8A 1UXOA 5JASA 1LXCA 2FQXA 2W8BA 3OTWA 1KK1A 5I7AA 1B8UA 3NOOA 4B4VA 2EZ4A 4LQDA 2AK3A 5K4GA 3LT0A 3MGAA 2V3VA 1EFLA 4NCKA 5LYJB 2R6DA 2BUBA 4P5EA 2OGWA 2D5BA 3VZDA 3LA8A 4I14A 1U0FA 1NQOA 1YI1A 3H8WA 1JR3D 2ZZKA 1DAHA 3KTOA 3PL5A 3UK0A 3AGQA 1BYIA 1H8HD 1PQPA 1T9DA 1WY7A 2X4LA 4PC3A 4DCCA 1ZW6A 3PDUA 4C7OA 5HILA 3DHYA 2B98A 4K5QA 5JHGB 5EJAA 1GL9B 1ZNXA 1Z4IA 2BY4A 4I4TF 2D4AA 4E5PA 1GCIA 2BELA 2ACWA 2PZLA 5P21A 2W2LA 1GV0A 1V5IA 2H07A 3LRPA 2P9GA 3NHKA 2V4MA 2DHDA 4L6IA 4KR0A 4HGNA 2HCJB 4LXXA 4PG6A 3OJFA 3Q0EA 5K0GA 5IBPA 4GPEA 2FZ5A 3I0ZA 1X7GA 1FNDA 1WMAA 2ZXEA 5D3MB 1ZAYA 1TYDE 1R6XA 1XDGA 4GOND 3HACA 1Z17A 3H16A 3LLVA 1H2EA 3TZCA 4AUKA 1IWPB 2OD7A 3TRKA 1M1UA 1ZINA 4NDAA 5H9WA 4WBNB 2AJCA 2ZRBA 3C3WA 1FU4A 3HDTA 3KX2A 5TF4A 2QVLA 4CQMA 1NRWA 5K3CA 4NJOA 3RC3A 5KVVA 1Y8QA 2NO1A 3HZRA 1EVKA 3P9QA 4LZZA 4EY6A 2V3WA 2C31A 1WVMA 4PX5A 5TF0A 2VDWA 2DTXA 4JLUA 4S3MA 5CH5A 2G07A 3PFNA 4BTEA 2CLSA 2IFTA 3AHCA 4CLRA 1U2ZA 2H5EA 2HSEA 3GMTA 3LBIA 2AXNA 3QU7A 4MV4A 3VPSA 1UBFA 1ZCAA 2ETXA 2GD1O 3MF4A 4MV7A 4UXHA 3IAS1 4EMBA 1AJEA 3GFPA 2LZ0A 2X7XA 4NENA 2X2PA 1VCHA 3O0DA 4OHMA 4QFMA 4Z1MA 1UBTS 2J0UB 2EWVA 3MT9A 4NPCA 3PPYA 3WMRA 2XVMA 4M88A 1GV1A 5TQJA 2RI0A 3HVKA 4Z4HA 3F7MA 4D99A 4W1RA 3EVTA 3QEAZ 2VK4A 1TW2A 2WPNA 4CLXA 2PNFA 4DEXA 5LWQA 2YQ5A 4W8GA 4W5HA 1EFTA 2P2SA 1JUDA 2OO7A 1OWNA 1PJLA 2PZMA 1BFUA 3DE7X 1E5XA 3H5WA 4K6OA 4CQLB 1BDHA 2IIBA 3KYIB 3DVAA 1N5KA 1RFGE 2CNNA 3QBEA 1EK1A 4PYNA 4L0MA 3PQCA 3W2HA 4BO1A 1G9XA 2NV6A 1JVBA 3LT1A 4G1EB 4HSGA 5TMBA 1N9GA 1ZOSA 4Z54A 1HE5A 4WNCA 3V8MA 5C8YF 1CVLA 3ZCUA 5LNK6 1ZNWA 3W3AD 3AKZA 2B9VA 3H3FA 3TMYA 4WERA 5FR2A 2WSIA 4U2FA 5FRDA 2XWPA 1B23P 5AW6A 3PNKA 3S1SA 4BU0A 4ML3A 3NORA 3SBEA 1R88A 1X2EA 4RH1A 4YRMA 4LTNA 1ZMXA 3DR3A 2QRMA 3N8GA 5DU2A 4L76A 2DG2A 2C9MA 3GVXA 4DQKA 5IHXA 3I0MA 4EPXA 4RTJA 1YSCA 1GKLA 3SDZA 2O8EB 1NR7A 2DFTA 5CT9A 1PSZA 1T1RA 1ZH8A 5BWNA 3ZHQA 2Q3EA 1JEQB 1T4GA 3O2SB 2JBAA 2BN4A 1JJ7A 3PNYA 4H18A 2W6ZA 1CZOA 3QXSA 4W6QA 1Y9AA 1XWFA 4DNFA 3JD1A 2HR1A 2BFFA 1A1VA 4UCFA 2AJLI 4RXUA 2F6RA 1NF8A 4MJ3A 4HADA 2ZWOA 3KNZA 1NHWA 5B1SA 4AL4A 3GDHA 4ZO8A 1W0KD 1UKEA 4B44A 5IJXA 2ZIGA 3FLEA 3NTVA 3W6ZA 3INTA 1HTTA 3FE2A 4QBHA 5CTAA 4CF7A 1DTWB 5JQGF 3FX2A 4ZAFA 3M83A 4DM3A 1R5NA 3LKBA 3HLYA 3T9EA 4Y9RA 1LW7A 3U09A 1C4KA 3U80A 1JTVA 2ZJ2A 3I2JA 4PG7A 2DUUA 2VDUE 4RQAA 1CRZA 2RHTA 3TSWA 1LPMA 2PYDA 2HHJA 2WVJA 4WMLA 2B6HA 3PEWA 1XZ8A 2FMKA 4JOSA 5D5PA 3Q9LA 3R7LA 1WXDA 2QN1A 3EX7C 2RGRA 2PKRA 2WWRA 1YR9A 4Q15A 4XDZA 5DRTA 1X7DA 1JHZA 4A8PA 4XB6B 3LO5A 3NIBA 2MINB 2VNKA 4BO5A 4RA9B 3MTQA 5G3ZA 3IQGX 4FKBA 1EFPB 2B21A 3RRMA 1RJDA 3UYLA 2CDCA 3RIEA 3IC5A 4HWTA 2PUHA 2VHCA 3HXTA 1PW5A 4C78A 2C0CA 4JDPA 3L6UA 4UZFA 3TG2A 1PT7A 4R1LA 4AM8A 3SS9X 3HEAA 5HZHA 2Y0DA 3N8DA 4PEVA 1EDDA 2XE4A 3P52A 1V9CA 1NN1A 4KVAA 3WP0A 1QNFA 1ZSYA 3O3OB 4CUJA 5CITA 2NO9A 4BO9A 5GZ1A 2J9ZB 3UMVA 4CETA 1N2CB 1AMOA 1GTJ1 2E18A 5KX5B 2PBLA 5AI5A 4OG2A 2FOXA 3KHTA 4LF8B 3L8HA 3G2OA 2GM5A 2HLHA 4Z7OB 3DL4A 2Q2WA 2XGOA 1OOEA 2WPDD 2CEAA 5GONB 2BMVA 1SBIA 2DF8A 3BH6A 4NZPA 2FR8C 1VPLA 4OAQA 2Z83A 3V4FA 3EDQA 1FYDA 1W2WB 2PD3A 3CPSA 1KDYA 4AMYA 4CT5A 3KETA 4IO1A 4HQNA 1IVSA 2AT1A 2AKAB 1RZRA 1HFJA 3HYTA 2DYKA 4JUIA 4CR7A 5DNVA 4D8UA 1TVEA 1G8PA 5JH7B 2IU3A 1QHHA 3EPPA 4OB8A 5HIJA 3UUEA 5TGDA 5L7WA 3JAMA 1ZVKA 3TCNA 1D8AA 1CB0A 3GIWA 2D00A 3GD7A 5KVQA 2IIVA 3MWEA 5CTJA 2VEDA 2V1UA 2WI8A 2IS1A 1LRLA 1DQPA 1OREA 2GN4A 2B8EA 2P3LA 4RJ2A 4X95A 4E11A 3NKVA 4EG4A 3HHPA 5DLPA 2B5VA 3NP9A 5EHQA 4EENA 1NUHA 1PYGA 3CM0A 2MIIA 4LNAA 2W0MA 2R4TA 3OIGA 1TKAA 5CVJA 4D0SA 1T3HA 3R41A 4KIJA 4M46A 3IMEA 5I7SA 1SIBE 2JCYA 3GD5A 3GLSA 3TYXA 4RV4A 1E9AA 1PFKA 1SRRA 1ZKDA 2K2WA 3E23A 1AHHA 3DO6A 3IAM1 3P9ZA 4GEGA 3RWMB 3UF0A 1NNEA 2HV8A 5FYDA 3QW2A 3NAMA 3UZUA 3OEEA 5AVKA 3B7PA 2FQWA 4IIGA 3WQBA 4GMHA 5C0OE