3HYBA

Crystal structure of rbcx from anabaena, crystal form ii
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
115
structure length
115
Chain Sequence
SSGLVPRGSHMNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLALWLHNFSAGKVQDGEKYIEELFLEKPDLALRIMTVREHIAEEIAEFLPEMVVTGIQQANMEKRRQHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RbcX protein
publication title Coupled chaperone action in folding and assembly of hexadecameric Rubisco.
pubmed doi rcsb
source organism Anabaena sp.
molecule tags Chaperone
total genus 46
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02341 RcbX RbcX protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.210 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3hybA00
3HYBA 4GR6A 3RG6C 2PEQA 2PEJA 2Z44A 2Z46A 2Z45A 3Q20A 4GR2A 2PY8A 2PENA 2PEMA 2PEIA 5BS2A 2PEOA 2PEKA 5BS1A
chains in the Genus database with same CATH superfamily
2LIUA 1QVFO 2KWLA 1VQLP 3HZQA 2CNRA 4U0CA 4QKOA 2K92A 2M8PA 2PENA 3G4SP 1VQ4P 2FVAA 1GXHA 2KG8A 1JJ2O 3CCVP 2JYGA 5F2KA 3G0VA 1E6JP 3CCLP 2GZIA 3RG2A 2AFDA 2BUOA 2X2BA 2OTLP 2EG5A 4M0IA 2FQ1A 2N5IA 2DGYA 1ACPA 2VLPA 2KW2A 2LPKA 1EMVA 1VQ9P 2M8NA 2OARA 2KOOA 2N5HA 3P05A 1VQ8P 2FADA 3VRLC 2WPTA 2K0DX 3GJNA 4U0AA 3CPWO 1ZMBA 2CQ8A 5KP7B 3B5IA 3CCUP 2PEKA 3DTJA 4U0BA 4IPYA 5EJDA 4IZ6A 4BPHA 5HGOA 4BPFA 4COPA 1K73Q 4XFYA 5KP8B 5HV8A 2XZ0D 2E1MA 2PEMA 2M5RA 1NJIQ 1RNIA 3HYBA 2VLNA 2GZJA 3DS4A 2QA4P 4PWVB 5HGLA 1GXGA 3CCJP 3EJBA 1X3OA 2L9FA 5I4TG 1VQOP 2VSQA 2K94A 2LL8A 3NTEA 4XROA 3RG6C 2Z45A 5HGNA 1IUQA 2JB0A 2LTEA 2KGEA 1EOQA 2FAEA 1K9MQ 2K5XA 2MVVA 4U0DA 4DG9A 1HQBA 3LMOA 4R0MA 2AFEA 2DNWA 1K30A 2N6YA 2PNGA 4WYMA 1NQ4A 4PXHB 3OW2O 1Q86Q 3DS1A 5KP6B 5F2NA 1UJZA 3G6EP 3I55P 1L0IA 3WBHA 4U0EA 2NO8A 4CA3A 3GKLC 2K0YA 3LRYA 1DNYA 2LMLA 3GZMA 3CC7P 1YI2P 2GZGA 2KGDA 2VLQA 3DS3A 3EJEA 5HVCA 2GDYA 2GDXA 2GZEA 2AF8A 4BPGA 3CC2P 3H0DA 1YIJP 3MGEA 4U0FA 2ONTA 2FVEA 2EHSA 2CG5B 5HGMA 2K2QA 4XFZA 1VQ5P 2XXMA 3G29A 2FHSC 1A43A 3B4QA 1YHQP 2K93A 2M8LA 5EW5E 2Z44A 4GR2A 2OTJP 1RO2A 4H2WC 1AF8A 2LOLA 4H2XC 2N50A 2XV6A 2L0QA 3I56P 3G71P 1VQNP 2P9XA 3EJDA 2PEQA 3H47A 2JGPA 1YJ9P 3CE7A 2ERHA 3NY7B 2JU2A 2LKIA 2N6ZA 2AVAA 1N8RQ 2VLOA 1A8OA 3E2DA 4UHPB 2KGAA 2BHVA 3G28A 2JU1A 2CGQA 1QVGO 1YJWP 1VQKP 3CCQP 2QNWA 1T8KA 1M6NA 1EIAA 2PEJA 1OR5A 1L0HA 3G1GA 2MY5A 1KLPA 3CCRP 1D1DA 1AYIA 1KC8Q 2JAZA 1K8AQ 2K0XA 1DV5A 3G1IA 4PH0A 1VQPP 2GDWA 1CEIA 1VHNA 3M1MA 2FACA 3GZLA 2EHTA 3DS5A 3G21A 4XFXA 1Z6MA 1BXIA 1F80D 2QEXP 2KG9A 7CEIA 1Q81Q 2LIWA 2MR8A 2JO0A 1BAJA 1VQ7P 3CCEP 2KOPA 1VQ6P 2PEOA 1KD1Q 1QRJA 2Z46A 4COCA 4GR6A 3H4EA 2FQ0A 3CD6P 2MR7A 1FR2A 4QNBA 2JYLA 2MF4A 1VKUA 1RO0A 3G26A 2JQ4A 2KORA 1YJNP 2KOQA 1UNKA 1HY8A 2L22A 2GZFA 1IMPA 2EIAA 2MVUA 1Q82Q 4MRTC 2EFJA 2MD9A 4NEOA 3CCSP 3DS2A 5CZDB 1M74A 1KQSO 5DCKA 2KGCA 3CXCO 2KOSA 2XT1A 1ZNVA 3DPHA 1IMQA 2FVFA 3Q20A 1S72P 2FQ2A 1M1KQ 5F2OA 2ROQA 3CC4P 2PY8A 2N98A 1GPJA 1M90Q 2XZ1C 4F37A 4HKGA 4XRQA 1W2BO 2L4BA 2L6EA 2GYKA 5JPAA 3U43A 3CMAP 2PEIA 5BS1A 2KODA 4H2YC 2KG6A 1YITP 3DS0A 2KR5A 2LF4A 1Q7YQ 1E0HA 1VQMP 1MZ8A 3CCMP 2JBGA 2CWOA 1M6EX 3CMEP 5BS2A 1AUMA 4PH1A
chains in the Genus database with same CATH topology
1BAJA 5HGMA 1VQ7P 1QVFO 3CCEP 4XFZA 1VQ5P 2XXMA 1VQ6P 2PEOA 1KD1Q 1VQLP 5I4TG 1VQOP 3G29A 3HZQA 1QRJA 2Z46A 4U0CA 4COCA 1A43A 2M8PA 2PENA 4GR6A 1YHQP 3H4EA 3NTEA 3G4SP 1VQ4P 2M8LA 4XROA 3RG6C 2Z44A 2Z45A 4GR2A 3CD6P 1JJ2O 5HGNA 1IUQA 2JYGA 3CCVP 2OTJP 1RO2A 4QNBA 1EOQA 2JYLA 5F2KA 3G0VA 1RO0A 1K9MQ 1E6JP 3G26A 3CCLP 4U0DA 2BUOA 2XV6A 3I56P 1YJNP 3G71P 1VQNP 2EG5A 2OTLP 2P9XA 4M0IA 2PEQA 1K30A 3H47A 2EIAA 4WYMA 2DGYA 3OW2O 1Q82Q 1YJ9P 2EFJA 3CCSP 1Q86Q 3DS2A 3DS1A 1M74A 1KQSO 5DCKA 1VQ9P 1N8RQ 2M8NA 2OARA 3CXCO 1A8OA 3E2DA 3P05A 1VQ8P 3G28A 2BHVA 2XT1A 5F2NA 3DPHA 3VRLC 3Q20A 3G6EP 4U0AA 3I55P 3CPWO 1ZMBA 1S72P 1QVGO 1YJWP 1VQKP 3WBHA 3B5IA 3CCQP 1M1KQ 1M6NA 2PEKA 3DTJA 4U0EA 5F2OA 3CCUP 4U0BA 3CC4P 1EIAA 2PEJA 4IPYA 3G1GA 2PY8A 3LRYA 3CC7P 5HGOA 3CCRP 1M90Q 4COPA 1D1DA 1YI2P 4XRQA 1KC8Q 1W2BO 2L6EA 1K8AQ 5JPAA 1K73Q 3G1IA 3DS3A 4PH0A 4XFYA 3CMAP 2PEIA 5BS1A 1VQPP 2KODA 1YITP 3DS0A 3M1MA 3CC2P 2E1MA 2LF4A 2PEMA 1NJIQ 3DS5A 1Q7YQ 3H0DA 3G21A 1RNIA 1YIJP 3MGEA 3HYBA 1VQMP 4XFXA 3CCMP 3DS4A 2QA4P 2QEXP 1Q81Q 4U0FA 2ONTA 5HGLA 2CWOA 1M6EX 3CMEP 3CCJP 2JO0A 5BS2A 1AUMA 4PH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HYB A;  4GR6 A;  3RG6 C;  2PEQ A;  2PEJ A;  2Z44 A;  2Z46 A;  2Z45 A;  3Q20 A;  4GR2 A;  2PY8 A;  2PEN A;  2PEM A;  2PEI A;  5BS2 A;  2PEO A;  2PEK A;  5BS1 A; 
#chains in the Genus database with same CATH topology
 2LIU A;  1QVF O;  2KWL A;  1VQL P;  3HZQ A;  2CNR A;  4U0C A;  4QKO A;  2K92 A;  2M8P A;  2PEN A;  3G4S P;  1VQ4 P;  2FVA A;  1GXH A;  2KG8 A;  1JJ2 O;  3CCV P;  2JYG A;  5F2K A;  3G0V A;  1E6J P;  3CCL P;  2GZI A;  3RG2 A;  2AFD A;  2BUO A;  2X2B A;  2OTL P;  2EG5 A;  4M0I A;  2FQ1 A;  2N5I A;  2DGY A;  1ACP A;  2VLP A;  2KW2 A;  2LPK A;  1EMV A;  1VQ9 P;  2M8N A;  2OAR A;  2KOO A;  2N5H A;  3P05 A;  1VQ8 P;  2FAD A;  3VRL C;  2WPT A;  2K0D X;  3GJN A;  4U0A A;  3CPW O;  1ZMB A;  2CQ8 A;  5KP7 B;  3B5I A;  3CCU P;  2PEK A;  3DTJ A;  4U0B A;  4IPY A;  5EJD A;  4IZ6 A;  4BPH A;  5HGO A;  4BPF A;  4COP A;  1K73 Q;  4XFY A;  5KP8 B;  5HV8 A;  2XZ0 D;  2E1M A;  2PEM A;  2M5R A;  1NJI Q;  1RNI A;  3HYB A;  2VLN A;  2GZJ A;  3DS4 A;  2QA4 P;  4PWV B;  5HGL A;  1GXG A;  3CCJ P;  3EJB A;  1X3O A;  2L9F A;  5I4T G;  1VQO P;  2VSQ A;  2K94 A;  2LL8 A;  3NTE A;  4XRO A;  3RG6 C;  2Z45 A;  5HGN A;  1IUQ A;  2JB0 A;  2LTE A;  2KGE A;  1EOQ A;  2FAE A;  1K9M Q;  2K5X A;  2MVV A;  4U0D A;  4DG9 A;  1HQB A;  3LMO A;  4R0M A;  2AFE A;  2DNW A;  1K30 A;  2N6Y A;  2PNG A;  4WYM A;  1NQ4 A;  4PXH B;  3OW2 O;  1Q86 Q;  3DS1 A;  5KP6 B;  5F2N A;  1UJZ A;  3G6E P;  3I55 P;  1L0I A;  3WBH A;  4U0E A;  2NO8 A;  4CA3 A;  3GKL C;  2K0Y A;  3LRY A;  1DNY A;  2LML A;  3GZM A;  3CC7 P;  1YI2 P;  2GZG A;  2KGD A;  2VLQ A;  3DS3 A;  3EJE A;  5HVC A;  2GDY A;  2GDX A;  2GZE A;  2AF8 A;  4BPG A;  3CC2 P;  3H0D A;  1YIJ P;  3MGE A;  4U0F A;  2ONT A;  2FVE A;  2EHS A;  2CG5 B;  5HGM A;  2K2Q A;  4XFZ A;  1VQ5 P;  2XXM A;  3G29 A;  2FHS C;  1A43 A;  3B4Q A;  1YHQ P;  2K93 A;  2M8L A;  5EW5 E;  2Z44 A;  4GR2 A;  2OTJ P;  1RO2 A;  4H2W C;  1AF8 A;  2LOL A;  4H2X C;  2N50 A;  2XV6 A;  2L0Q A;  3I56 P;  3G71 P;  1VQN P;  2P9X A;  3EJD A;  2PEQ A;  3H47 A;  2JGP A;  1YJ9 P;  3CE7 A;  2ERH A;  3NY7 B;  2JU2 A;  2LKI A;  2N6Z A;  2AVA A;  1N8R Q;  2VLO A;  1A8O A;  3E2D A;  4UHP B;  2KGA A;  2BHV A;  3G28 A;  2JU1 A;  2CGQ A;  1QVG O;  1YJW P;  1VQK P;  3CCQ P;  2QNW A;  1T8K A;  1M6N A;  1EIA A;  2PEJ A;  1OR5 A;  1L0H A;  3G1G A;  2MY5 A;  1KLP A;  3CCR P;  1D1D A;  1AYI A;  1KC8 Q;  2JAZ A;  1K8A Q;  2K0X A;  1DV5 A;  3G1I A;  4PH0 A;  1VQP P;  2GDW A;  1CEI A;  1VHN A;  3M1M A;  2FAC A;  3GZL A;  2EHT A;  3DS5 A;  3G21 A;  4XFX A;  1Z6M A;  1BXI A;  1F80 D;  2QEX P;  2KG9 A;  7CEI A;  1Q81 Q;  2LIW A;  2MR8 A;  2JO0 A;  1BAJ A;  1VQ7 P;  3CCE P;  2KOP A;  1VQ6 P;  2PEO A;  1KD1 Q;  1QRJ A;  2Z46 A;  4COC A;  4GR6 A;  3H4E A;  2FQ0 A;  3CD6 P;  2MR7 A;  1FR2 A;  4QNB A;  2JYL A;  2MF4 A;  1VKU A;  1RO0 A;  3G26 A;  2JQ4 A;  2KOR A;  1YJN P;  2KOQ A;  1UNK A;  1HY8 A;  2L22 A;  2GZF A;  1IMP A;  2EIA A;  2MVU A;  1Q82 Q;  4MRT C;  2EFJ A;  2MD9 A;  4NEO A;  3CCS P;  3DS2 A;  5CZD B;  1M74 A;  1KQS O;  5DCK A;  2KGC A;  3CXC O;  2KOS A;  2XT1 A;  1ZNV A;  3DPH A;  1IMQ A;  2FVF A;  3Q20 A;  1S72 P;  2FQ2 A;  1M1K Q;  5F2O A;  2ROQ A;  3CC4 P;  2PY8 A;  2N98 A;  1GPJ A;  1M90 Q;  2XZ1 C;  4F37 A;  4HKG A;  4XRQ A;  1W2B O;  2L4B A;  2L6E A;  2GYK A;  5JPA A;  3U43 A;  3CMA P;  2PEI A;  5BS1 A;  2KOD A;  4H2Y C;  2KG6 A;  1YIT P;  3DS0 A;  2KR5 A;  2LF4 A;  1Q7Y Q;  1E0H A;  1VQM P;  1MZ8 A;  3CCM P;  2JBG A;  2CWO A;  1M6E X;  3CME P;  5BS2 A;  1AUM A;  4PH1 A; 
#chains in the Genus database with same CATH homology
 1BAJ A;  5HGM A;  1VQ7 P;  1QVF O;  3CCE P;  4XFZ A;  1VQ5 P;  2XXM A;  1VQ6 P;  2PEO A;  1KD1 Q;  1VQL P;  5I4T G;  1VQO P;  3G29 A;  3HZQ A;  1QRJ A;  2Z46 A;  4U0C A;  4COC A;  1A43 A;  2M8P A;  2PEN A;  4GR6 A;  1YHQ P;  3H4E A;  3NTE A;  3G4S P;  1VQ4 P;  2M8L A;  4XRO A;  3RG6 C;  2Z44 A;  2Z45 A;  4GR2 A;  3CD6 P;  1JJ2 O;  5HGN A;  1IUQ A;  2JYG A;  3CCV P;  2OTJ P;  1RO2 A;  4QNB A;  1EOQ A;  2JYL A;  5F2K A;  3G0V A;  1RO0 A;  1K9M Q;  1E6J P;  3G26 A;  3CCL P;  4U0D A;  2BUO A;  2XV6 A;  3I56 P;  1YJN P;  3G71 P;  1VQN P;  2EG5 A;  2OTL P;  2P9X A;  4M0I A;  2PEQ A;  1K30 A;  3H47 A;  2EIA A;  4WYM A;  2DGY A;  3OW2 O;  1Q82 Q;  1YJ9 P;  2EFJ A;  3CCS P;  1Q86 Q;  3DS2 A;  3DS1 A;  1M74 A;  1KQS O;  5DCK A;  1VQ9 P;  1N8R Q;  2M8N A;  2OAR A;  3CXC O;  1A8O A;  3E2D A;  3P05 A;  1VQ8 P;  3G28 A;  2BHV A;  2XT1 A;  5F2N A;  3DPH A;  3VRL C;  3Q20 A;  3G6E P;  4U0A A;  3I55 P;  3CPW O;  1ZMB A;  1S72 P;  1QVG O;  1YJW P;  1VQK P;  3WBH A;  3B5I A;  3CCQ P;  1M1K Q;  1M6N A;  2PEK A;  3DTJ A;  4U0E A;  5F2O A;  3CCU P;  4U0B A;  3CC4 P;  1EIA A;  2PEJ A;  4IPY A;  3G1G A;  2PY8 A;  3LRY A;  3CC7 P;  5HGO A;  3CCR P;  1M90 Q;  4COP A;  1D1D A;  1YI2 P;  4XRQ A;  1KC8 Q;  1W2B O;  2L6E A;  1K8A Q;  5JPA A;  1K73 Q;  3G1I A;  3DS3 A;  4PH0 A;  4XFY A;  3CMA P;  2PEI A;  5BS1 A;  1VQP P;  2KOD A;  1YIT P;  3DS0 A;  3M1M A;  3CC2 P;  2E1M A;  2LF4 A;  2PEM A;  1NJI Q;  3DS5 A;  1Q7Y Q;  3H0D A;  3G21 A;  1RNI A;  1YIJ P;  3MGE A;  3HYB A;  1VQM P;  4XFX A;  3CCM P;  3DS4 A;  2QA4 P;  2QEX P;  1Q81 Q;  4U0F A;  2ONT A;  5HGL A;  2CWO A;  1M6E X;  3CME P;  3CCJ P;  2JO0 A;  5BS2 A;  1AUM A;  4PH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...