3HYSA

Structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
275
Chain Sequence
ENLYFQGAMDPEFRVINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein Rv0554, putative Bromoperoxidase
publication title Structural and functional analysis of Rv0554 from Mycobacterium tuberculosis: testing a putative role in menaquinone biosynthesis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 97
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.11.1.18: Bromide peroxidase.
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hysA00
4E46A 1FFEA 4G8DA 4PQEA 4Y2XA 1LPMA 4OD0A 3AZOA 1XZCA 1XZGA 5LYYA 3B5EA 2OGTA 2O7VA 1ZIYA 1EDDA 2CUTA 1MNQA 2GBFA 1JJBA 2QUBA 1E8DA 4JEIA 1QIHA 3H2JA 5ALXA 2BGNA 2UZ0A 4Q3KA 1CFJA 4QA9A 5AK6A 1N8SA 2XE4A 5CBKA 3IUJA 3L1JA 3V9AA 2ES4A 3WWOA 2RIPA 2H9YA 1VA5A 5ALMA 1RYYA 3ESBA 5E4TA 4OUKX 2QXTA 3DOIA 5AKKA 2HM7A 3C70A 4DMFA 5CT5A 1T2NA 3O95A 3TEJA 1UWCA 2C0PA 3G8YA 2ORYA 1QO9A 1G4HA 1LPOA 4UBLA 2AJ8A 1E8MA 3HYSA 3FSGA 1H2XA 4BCCA 4LXIA 1LZLA 5DYYA 3QPAA 4U2FA 5EHXA 4N5IX 4BATA 1L7QA 1JFRA 4B84A 3A6ZA 4CG3A 3RM3A 1LGYA 2RI6A 5ALNA 2JGLA 1QJ4A 5AKGA 4KE9A 1QO7A 2XQJA 1WPRA 3FLBA 3IB3A 4UFPA 2XUDA 3AFIA 3VJKA 3LCRA 2XMBA 3I2FA 1CUYA 2HFJA 4P08A 1ODCA 3CCBA 1FJ2A 2GZSA 1DWPA 4UHCA 3H2KA 5AO9A 5DNWA 5CT4A 4L3WA 3A2NA 4MQLA 4MXDA 2BUAA 4EB0A 4BVJA 2JGKA 4UUQA 3FWHA 3WZLA 5FPQA 4N8SA 4Y2UA 1EXWA 3FSGD 5AK5A 1GKKA 2Z8XA 1JJIA 1YCDA 1W6RA 5JZ9A 6YASA 4G8BA 2PVSA 3JW8A 1XKLA 5LKRA 1YA4A 3QZUA 1CV2A 4OYYA 4OYLA 5AOCA 1XRPA 1XRRA 1QE3A 5E2IA 4P92A 1ZICA 5FUMA 3GUUA 2J4FA 2CZQA 1L7AA 3ICWA 4CG2A 3R41A 4RE5A 1Q84A 5BWCA 1AURA 2PUJA 3A2LA 2YXPX 1VZ2A 4CIBA 4MYSA 2XQKA 3HACA 1BN6A 2O2IA 2WU4A 1JU4A 4K5QA 4CI9A 2PU7A 5ALTA 3DYIA 1QGED 4F21A 2HDWA 1XKTA 4U2CA 2VJBA 3G02A 4A5SA 4AN0A 1Y7HA 5C8XA 1XZBA 4U2EA 5FKJA 4J3JA 2I03A 2QZPA 1K6EA 4H7FA 5HQ3B 2OGZA 4A23A 3AUKA 2WJ4A 5LZ2A 1VE7A 2AXEA 5AJHA 3SX4A 2XT0A 4YK7A 3G0BA 2WJ3A 4GWLA 1E3QA 3FVRA 5C8VA 3V48A 1BEZA 1AX9A 2XMGA 3HXKA 1QIIA 4KRYA 4DTCA 1NU6A 3ZLUA 1QIMA 5DNUA 4B80A 1DT5A 4XVCA 3AILA 2E3JA 2ONCA 4BZZA 5IVDA 1R50A 2I3DA 4KE8A 4BTLA 2B9VA 4PF1A 3R3YA 1F8UA 4HRXA 4WJLA 4BC0A 4X92A 3G7NA 2VAXA 4L0CA 3ESDA 5HF9A 4ZI5A 2ZYIA 3O4GA 4DYHA 3BXPA 3WWDA 3WKAA 2OXEA 4DMHA 4N5HX 4LYEA 3WKCA 1UZAA 3F8SA 4JNCA 1J2EA 2EEPA 5FP0A 1FFDA 2PSDA 3I2KA 3QH4A 1L7RA 3R3UA 1BE0A 2ZYSA 4FNGA 3ESCA 4BBZA 4O08A 2BCEA 5AM0A 5ALIA 1QIEA 2B4KA 2RHWA 4C4XA 2HA5A 1TKRA 2OG1A 2RHTA 3FYUA 2VT7A 2HA3A 5CT9A 3F67A 2WLSA 2QM0A 2V9ZA 4FBMA 2OQVA 5F4ZA 4MWSA 4Y2YA 4AXBA 5IVIA 3Q8WA 1CUGA 4H77A 1GXSA 4MYDA 1CRLA 3SWWA 1CEXA 1ACJA 3BIXA 3HJUA 4ZWNA 1XQWA 3AIKA 2G63A 3H1BA 4QWMA 3C87A 3OTQA 3QITA 2DHEA 4ZV7A 2PPLA 3TRDA 3W9BA 4OSEA 3VKFA 1EI9A 1FFAA 1DQZA 4H7JA 2XI4A 1AC5A 5T4HA 5ALYA 4FLFA 5ALGA 1CQWA 1H2YA 4AO7A 1WB6A 1ZJ4A 3RLIA 5AM4A 2HHAA 3DLTA 3EQ8A 4X7BA 1W76A 2WFLB 1VA4A 2RGUA 4AO8A 1F0PA 2CMFA 1OCEA 5DLPA 4EHBA 2OCKA 1GPNA 4DM7A 1P0PA 1QONA 1CUZA 3N2ZB 1LBTA 4X71A 3WYDA 1UK9A 2HA2A 1EVEA 2OLEA 4GHWA 2PSJA 2IX9A 1MPXA 1T4MA 4AQDA 3C45A 5E4YA 4FFVA 1RP1A 5ISMA 2JIDA 3H2IA 3IUNA 4B9EA 3BWXA 2XUKA 4F5ZA 3KSRA 1W1IA 4LXHA 4OB8A 4ZV9A 4OB7A 1IUOA 2B61A 3NOXA 4Y2VA 3FBWA 5AHXA 2WTMA 3WL6A 1GPLA 1QIGA 4B85A 1UK7A 1EDBA 1CUEA 1XLWA 2R8BA 1FFBA 4FLEA 3U1TA 1ZOIA 1HBJA 2WSLA 3G9XA 4X6XA 4UHFA 4IH9A 1KU6A 1QTIA 5K3DA 3QMWA 1R1DA 4X97A 4Y2SA 5ALKA 4K6GA 3I2HA 1TIBA 2Q0XA 5DNVA 5AM5A 5AKZA 2V96A 4HXFB 4XX1A 1G42A 1XQXA 4BTVA 4Y2TA 5CT6A 1Y7IA 3I6MA 3PUHA 1GQRA 3C8HA 5ALSA 1LPSA 1TRHA 1JKMA 5FPPA 1EB8A 1EK1A 1HL7A 4IO0A 2PX6A 3G9ZA 5BV7A 4JUIA 4QE3A 3FVTA 3B3QA 2QUAA 1XZAA 1TCBA 4UFOA 5SYMA 4BP8A 3UUEA 4HRYA 1ORWA 2HA0A 3G9UA 3WJ2A 4XWGA 2XUAA 4HXGA 3HC7A 5DJ5A 1UXOA 4HS9A 2ACEA 4G5XA 5CXXA 3L1HA 3PFBA 1X2EA 5JD6A 1Q0RA 1FSSA 3DD5A 4J0KA 3U0VA 3H1AA 3STXA 5AK4A 4AZ3A 4EY5A 3E1GA 3TJMA 1CPYA 1XZLA 4Y2QA 1JJFA 3G9TA 4AMYA 1DX6A 4ZRDA 2BUCA 1WB5A 1IVYA 3STVA 2WFZA 2XMDA 5KWJA 2H7XA 2V97A 4W1QA 2XMQA 5AP9A 5JATA 4W63A 1AMNA 1D07A 3LIPA 5BWBA 1MAHA 2EDCA 1ZI9A 3A70A 2JGFA 5HKAA 5JD5A 2Z5GA 3WQHA 3PI6A 3D59A 1C7IA 1USWA 2HA7A 4V2IA 1H22A 4IH4A 5YASA 5HZGA 3DOHA 3WWPA 4TGLA 3FOBA 2WM2A 1MAAA 4OPMA 1ACLA 1CQZA 2D5LA 4PW0A 4ZREA 1AUOA 1XLUA 2QRUA 4BVLA 3I2GA 1XLVA 2O2HA 5LIPA 5ALWA 5I8PA 4QZVA 2XQGA 5ALVA 4C6HA 2H1IA 2DFPA 4LHEA 3STYA 3W2TA 1QTRA 2XUPA 4H7DA 3PUIA 5CRIA 2WKWA 1YB7A 1UK8A 4I4CA 3H18A 3MGAA 3R3XA 3O9MA 4J0JA 2XUJA 4KAAA 3WK8A 1UKAA 4WFJA 3F97A 5T4BA 5JZBA 1CLEA 4WFKA 5EGNA 3GZJA 5AI8A 4M0FA 1P0QA 5CURA 2VT6A 4X85A 3TGLA 2OPHA 1SCKA 4M0MA 3BJMA 2PKYX 2IIVA 3WZMA 1OXMA 3K6KA 4FOLA 5I9IA 5E4JA 1OILA 5EIAA 1SOMA 3RK4A 4BYMA 5AKXA 5ALFA 3L1IA 4I19A 4KAJA 5JAHA 2AJLI 2FJPA 3GFFA 5K3AA 4H0CA 5CXUA 3EQ9A 4GECA 2JEYA 4UHEA 2DSNA 4C4ZA 3D0KA 3R3ZA 5D3KA 3HABA 3FCYA 5HQ3A 4MEBA 4OCZA 5EI5A 3BJRA 4YPVA 2OCGA 5AIAA 3UUFA 4A16A 3ED1A 4KJXA 2VEOA 2HADA 3VDXA 3I2JA 5HFAA 2OQIA 1Y37A 3PF9A 3KWFA 2HA4A 1EH5A 5AI6A 1QFMA 4Y7DA 3MVEA 3QPDA 5LZ9A 5C81A 5CH5A 3QVMA 3NUZA 3EQ7A 5AKIA 3H04A 4BE4A 4QNNA 2PM8A 3WWCA 2GBCA 1X2BA 2QR5A 2ZYRA 1MJ5A 2NW6A 5CH8A 2AJDA 1DWOA 3O4IA 3V1MA 3V1KA 4WDRA 5FXMA 5JAPA 3GA7A 3WKEA 4IQ4A 3H0CA 3MUOA 2VAVA 1BEEA 1VE6A 2Y6VA 3KOOA 4AO6A 4DMKA 1JMYA 3D4LA 3WJ1A 3PDCA 4GW3A 2WILA 1XFDA 1GGVA 2XUFA 2XUGA 1XZKA 3C43A 5AH0A 2HU5A 3YASA 3ZWQA 2JGEA 3F98A 1H23A 2GBIA 2PL5A 2YASA 5LZ4A 5CH3A 2ZSHA 2HRQA 1AQLA 2Y2VA 1X70A 5CTAA 3C5VA 3W04A 4RPCA 3RARA 4M0EA 5DYTA 5ALJA 1K63A 4X6YA 4G4JA 4GLBA 1GT6A 4C87A 5T4EA 1EB9A 2QS9A 4CFSA 3VJLA 4X95A 3KWJA 1MNAA 2C7BA 3C6ZA 1H2WA 4EY4A 3QMVA 4G8CA 3VISA 3K2IA 4EY6A 1UK6A 2JBWA 4QDOA 5ESRA 2HFKA 2D0DA 3WYNA 1MX5A 4I3FA 3P2MA 4UFNA 4EUSA 1THGA 1AKNA 2XQIA 1XRNA 1SCIA 4X90A 4ZXFA 5I7UA 1QIJA 1XROA 3E3AA 3H17A 5CW2A 1PFQA 4G9GA 3BDIA 1A7UA 4P9NA 2WFLA 2BGRA 4X6UA 1XQVA 4WDQA 1XZJA 1A88A 1Q0ZA 3R40A 4DNQA 4NVRA 4Q1VA 5DYWA 4X93A 2AJBA 3O9VA 1MN6A 1ZD4A 1ORVA 2PSEA 4BDTA 1R9MA 4BCBA 2WG2A 1GQSA 4EY7A 2BFNA 1CUWA 5LKAA 2IITA 2C0QA 2DHCA 4PSCA 4L9AA 2XMZA 5K3FA 2DCMA 2WG1A 4WY5A 3LLCA 1P0IA 1QIKA 4HZGA 4KRXA 3M81A 3G0GA 3K9BA 3H19A 5AKEA 1YS1X 1DQYA 1SC9A 3STUA 4UPDA 5IH7A 4CCYB 3BIWA 3GELA 3WKBA 1Q83A 2CJPA 5JASA 4NMWA 2WHPB 1W4LA 3JWEA 1ETHA 4K6HA 4JYMA 1CUIA 2HIHA 4C88A 2GYUA 4B0OA 2BAGA 4CCWA 5EHZA 4UBNA 1ZD2P 3HZOA 3DDUA 1J1IA 4Q3OA 1SCQA 3WL7A 4XJVA 3QYJA 4X3CA 2P8SA 1MO2A 1TAHA 1EHYA 5CT8A 3EF3A 3DKKA 1EINA 1VXOA 3I6YA 5IVHA 3DCNA 3WA6A 2G5TA 2WHQA 3FNBA 4J0DA 4BP9A 2ZYHA 4AN1A 4ETWA 1IZ8A 5LZ8A 4CIAA 2QOEA 3M3DA 4Q82A 1CUHA 2X8BA 2PSHA 4OU5A 2WIDA 4Y2RA 3I6ZA 4UBJA 1DU4A 2ZJ6A 1YAHA 3M83A 5AI4A 2QXUA 2B20A 1HPLA 2WUEA 3M82A 2ZJFA 2XDWA 1ZD3A 2Y2UA 4H7EA 1H2ZA 3EIOA 1CUCA 3WK4A 2JGIA 1DX4A 5ALDA 4W1PA 3IBTA 3W05A 5A2GA 2WIKA 3H2HA 4C01A 3WMRA 1W75A 2GYVA 5ALEA 5A6VA 3PE6A 3V1LA 3CN9A 4GEGA 1GPKA 4UBOA 4EZIA 2QJWA 4DSAA 4C4YA 5FRDA 4J0HA 5KREA 1QZ3A 2I78A 3IIIA 1C7JA 3S8YA 2OAGA 1KU0A 2XLBA 3WK5A 3NGMA 4X94A 1G5FA 2FX5A 4J03A 2FJ0A 1R3DA 1WM1A 4E11A 3WK7A 1CVLA 1S8OA 3W9UA 1XZFA 4P93A 1E89A 4FWBA 2WQZA 4PO3X 1CUBA 3UMJA 4QLAA 1XZDA 3DEAA 1EK2A 2DQZA 3O4JA 7YASA 3VVLA 2WIGA 3AIOA 3SC2A 1TCCA 2WTNA 2PBLA 3OM8A 1B41A 2W22A 1J07A 1WPXA 2JEZA 4TVKA 5JAOA 4H35A 5KBYA 2J3QA 1LPNA 1ISPA 1YB6A 4MJ3A 5K3EA 1XZEA 4KR0A 2XMRA 5JALA 4GI1A 4W9RA 4BAGA 3DL4A 2CB9A 5AKJA 1BCRA 3DS8A 2VF2A 3X3HA 1JI3A 4PNZA 3STWA 4Q3LA 1TCAA 1WCYA 2HU7A 3BE8A 1EX9A 2VSQA 1QLWA 3F9CA 1BROA 5AIBA 3FLEA 4QWWA 2J4CA 4Y2JA 4J0GA 1B6GA 2ZJ7A 4DNFA 1HQDA 4UBMA 4AX4A 1CIJA 3PFCA 4FKBA 1YASA 3I1IA 4EY8A 4EBBA 2X76A 1TQHA 3Q0TA 4IH1A 2O7RA 4Y9SA 3B12A 5AICA 4DSZA 4BAZA 4AMZA 3FCXA 5HF8A 1HDEA 4BC1A 3FYUC 3A2MA 3QM1A 4HAIA 4BRZA 2OGSA 5JYCA 5AOBA 5C8ZA 3IA2A 2VA9A 5AK3A 5AOAA 5LZ7A 3HSSA 3AIMA 1IZ7A 5AM1A 2V98A 5AKLA 1M33A 1LNSA 1ODSA 2XQFA 1FFCA 5AM2A 1XQYA 1XZIA 3H2GA 4QLOA 4U2GA 3C6YA 3DNMA 2I3ZA 3PICA 1K8QA 4K6KA 5EHNA 1CUVA 5HK8A 4RGYA 3O4HA 3OG9A 1A8SA 2BKLA 5D3ZA 4D9JA 1Z68A 4NZZA 3IDAA 4BAUA 4UHBA 5K3BA 1QOZA 3T52A 2GBGA 1ZGBA 1DINA 1RWQA 1VOTA 1CUJA 1MX1A 5DTIA 5A7FA 2HRRA 3PF8A 1PV1A 5JANA 3DKRA 5ALQA 3DQZA 5HCUA 4E15A 4DIUA 1ZJ5A 1XRQA 1BU8A 1QIFA 2JGJA 2OCLA 2OAEA 3DJYA 1MX9A 3D2BA 1BN7A 2XLCA 3E4DA 2Z3ZA 4TPKA 1XZMA 1NX9A 2QVBA 1XRMA 4HXEB 4J0IA 4E14A 4GXNA 1XZHA 3BL8A 2BJHA 1LPBB 5ALRA 1U2EA 3DYVA 4FBLA 2BUBA 3C6BA 5ALLA 5FLKA 4ITVA 3ANTA 5IVKA 2OCIA 4LKOA 4B0PA 4H7KA 4N8EA 4MQMA 2DHDA 2CEKA 4ROTA 4YX9A 3D7RA 3ESAA 5AM3A 4KEAA 1R4ZA 3FAKA 3WL5A 3IULA 1F0NA 2G5PA 3IVMA 2DQYA 4MEAA 3C5WP 2WJ6A 2Y6UA 3QMMA 4N8DA 4G4IA 5K5EA 3BDVA 4RNCA 3D3NA 4UHDA 2ECFA 3AINA 2VJDA 1YR2A 2XB6A 4AZ0A 4BCDA 1WB4A 1U8EA 5JARA 4UBIA 4B7ZA 1EDEA 3EBLA 4Z49A 1CUAA 3KXPA 1WHSA 1YAJA 5K3CA 3ZLTA 3D2AA 1J06A 1LPAB 3KDAA 5JZSA 3G0CA 2X5XA 2WIFA 4BZWA 4B9AA 5AKYA 2XUOA 3CXUA 1MTZA 1I6WA 1N5MA 4FFWA 5EHQA 5EIHA 2XMCA 4AB1A 4JH0A 4GBGA 3ZI7A 5JIBA 4LYDA 2ZVDA 1LBSA 1WHTA 2GYWA 4H7IA 3CCCA 5FDFA 1UOQA 2WUDA 5JAUA 4BRSA 3O0DA 2HL6A 4INZA 3OURA 4RE6A 4B6GA 4FMPA 1ZD5A 1DWQA 1LLFA 1R9NA 4XIIA 3HRHA 3OPMA 5LLSA 1U4NA 4HTAA 3STTA 2VQ6A 2JF0A 3MUNA 2QJRA 3LS2A 4PSDA 1LZKA 1UOPA 5ALHA 5ALPA 3GROA 2HU8A 4FTWA 1N1MA 2Y1KA 1XRLA 3IURA 1LPPA 3QBJA 3G0IA 1K4YA 1NU8A 4B82A 1BCSA 4X00A 4C89A 4CCYA 3VVMA 4UBKA 5JADA 5AI0A 4H18A 1N5RA 4ARAA 4DMCA 5D6OA 1G66A 2RAUA 2WHPA 3HEAA 3WKDA 3C8DA 3CN7A 2VJCA 4B81A 3V1NA 4HVTA 4QDXA 5ALOA 5LP1A 2Z8ZA 4K2AA 2WIJA 3IUQA 2QKYA 1DTEA 1JMKC 4B83A 3WIBA 1DT3A 4Y2PA 4QDTA 2CKMA 1CR6A 5SYNA 4DNOA 5HFNA 3VXKA 2QMQA 4F0JA 3R3VA 4G4GA 3OC0A 1JU3A 1IMJA 2C58A 4G1FA 2PUHA 4OU4A 1A8UA 4KE6A 1AGYA 3FLAA 2K2QB 1QIDA 1VXRA 4PV7A 3HLKA 5DTJA 1A8QA 4OB6A 2C5FA 2WFMA 3KD2A 3FYTA 1UFOA 2C4HA 3T4UA 1HLGA 2FUKA 2QTBA 4NS4A 1UKBA 4JYPA 4W1SA 2GZRA 4FHZA 1MU0A 1PJAA 2XMSA 1W52X 3HI4A 2YYSA 1IUNA 5JD4A 1UOOA 1CUUA 5A7GA 5HF6A 3QPCA 1THTA 5D7BA 2WUFA 1ODTC 3G0DA 3WIOA 1SFRA 5EFZA 1E5TA 4H7HA 1E8NA 2ROQA 2ZSIA 1IUPA 4FNMA 3SK0A 2H7YA 3FYUB 2VATA 3WLAA 4ARBA 4DNPA 5ALUA 5FOQA 4Q05A 3W06A 4BDSA 4KAFA 1GKLA 3JYHA 3RKSA 3DL7A 3I2IA 3R0VA 1AZWA 1R88A 4J7AA 1CUDA 2PU5A 4DGQA 4U2DA 2DR0A 3S2ZA 4DLNA 2AJCA 5H3HA 4IHAA 4GDMA 3ZV7A 1TK3A 3AJAA 2EDAA 2PSFA 2XUHA 2RONA 2YH2A 5K3FB 1K5PA 4FDMA 1O6GA 4QDUA 2WUGA 4KE7A 1CUXA 2JGMA 5BOVA 3ILSA 3GBSA 5C7YA 3C6XA 5IKXA 2WU3A 3NWOA 2WHRA 4KACA 5CMLA 1C4XA 3WL8A 1BRTA 2ACKA 3AZPA 1F6WA 1VLQA 3WI7A 5KWIA 1O6FA 2VJAA 5AI5A 4CG1A 1ZIXA 4S0XA 3E0XA 4UHHA 1BS9A 1GZ7A 1HKHA 2VTVA 4EA6A 2G4LA 3WK6A 3OOSA 4MWTA 2QT9A 3ZPXA 1P0MA 5HKBA 5HF5A 3LP5A 1MT3A 2J3DA 2R11A 2O2GA 3ANSA 1YA8A 4ZGBA 1EA5A 3AZQA 5DWDA 4L72A 4LIPD 4BVKA 4U2BA 1ZI6A 4WFIA 3D2CA 5LZ5A 4QDZA 3WWEA 1KEZA 5A7HA 5HK9A 1E66A 4YASA 2HA6A 2H7CA 1VKHA 4J0CA 2CBGA 5FV4A 4PSUA 1CUSA 3LIIA 1ZGCA 1QFSA 5A71A 3D5EA 4G9EA 1VZ3A 1ZI8A 4LXGA 2Z3WA 4QEKA 2W6CX 1YSCA 5EIEA 4KYVA 4WY8A 2C5GA 2LIPA 3ZLVA 3BF7A 3WA7A 3I1YA 3VJMA 1UT6A 1JT2A 4F60A 5AKHA 3I28A 1U65A 2XUQA 3R3WA 4BB0A 1YS2X 3WK9A 2XUIA 1WOMA 5T4FA 3N0TA 3F96A 4Q34A 4WCVA 1CUFA 4X91A 1UKCA 5ALZA 2WG0A 5AI9A 1EVQA 3IUMA 5A62A 4FLMA 3ICVA 3BF8A 1VJ5A 4W1RA 4BE9A 5J3JA
chains in the Genus database with same CATH superfamily
3O4VA 3ZIAD 4DLXA 1PJLA 3W5BA 4A6PA 1LH0A 1N2JA 2A88A 3IHTA 5JUWA 5J2UF 3T1YB 3N8IA 1MG0A 1V43A 1F9EA 2LE0A 4I66A 4OD0A 3AZOA 3PFFA 1XZCA 5ULLA 2D6FA 3SC4A 2FN7A 4ME6A 4Q3DA 4BBJA 4CKCA 4URXR 2O7VA 4QG3A 3SQWA 1DFHA 3UBTA 3PIRA 3VO8A 3PLRA 4LV5B 1EDDA 2QENA 3T4PA 4BNDA 1GT91 4MPTA 5TJ9A 3QVLA 2VL7A 1WZIA 4HZUB 3NDJA 4DDKA 4J4TA 4XH9B 4JR2A 2Q8QA 1JJBA 3IDOA 4H27A 1E8DA 2WU0A 2EKBA 4JFRA 4M0CA 2C2XA 4O2BB 5CTJA 5LU8A 1PF7E 3AL3A 2P27A 1L4MA 1CFJA 3ES9A 3PVSA 3GLFE 3EC2A 4IWNA 4UUMA 2XE4A 4C5BA 5CBKA 4ES6A 2N75A 1YULA 2NYUA 1J5PA 1OWNA 4TN5A 3T3GA 2VJOA 3RSGA 5LQSA 3IUJA 4EKGA 4QTZA 3M6XA 3Q5DA 3PA6A 4P2GA 4H1WA 2XVAA 1E7WA 3QJYA 3VPHA 1AZTA 1HNWB 4BO0A 4ZI2A 5U4QA 2FPKA 4NH4A 4HAWA 3WWOA 5JFGA 4HWGA 4EENA 1IB0A 3DLCA 3SFVA 1M6VA 2UVPB 2Z1DA 4HQNA 1ORIA 5FX2A 4GX1A 2IZ7A 3HL4A 1UBFA 3L4EA 2ODPA 3DMFA 4TRMA 3WFIA 3FPEA 5DEIA 4ABYA 4KHZA 5HKKD 5E4TA 1LC0A 2R6DA 3C97A 3W6UA 1Q0HA 2O4CA 4AY3A 1ZVMA 3UQYS 3DPUA 2HM7A 4AZ3B 1V8OA 3HY4A 4W7SA 5EIBC 1JHQA 2GR9A 2WD7A 2B4YA 4Y9DA 1FY2A 1RAFA 4I50F 4BIIA 3AEKB 2A9PA 3TOVA 2MR6A 4FE7A 4URFA 1GTZA 4CMBA 1SBYA 1UWCA 3G8YA 3TLKA 4EL0A 4B8ZA 4CEHA 2R8OA 4JY7A 4OREX 3NYIA 3P20A 2PX4A 1STOA 1LPOA 3HPQA 1O5TA 4M9CA 2Y4OA 5KTKA 1H2EA 3VFDA 5KC8A 1ECLA 4BCCA 2Z6VA 3FRJA 3KYDA 4QEDA 4IMPA 1SB9A 1AD2A 1P4GA 3MRXA 4XGKA 4PZEA 2IYYA 2ZGVA 3ICOA 1FP4B 4BHTA 2JNWA 2KS6A 3RE1A 2P9BA 3AV0B 1DAFA 1YB2A 2FGKA 3M6LA 2J09A 5JOQA 4G84A 2IEZA 3LUKA 1B6TA 4U2FA 4XOIA 5FPSA 3S2SA 4YCMA 1M1YA 5EHXA 5LFAA 2ODTX 3ZHXA 2R1TA 1BYIA 3F49S 4IHAA 1L7QA 4KITB 2W00A 3QQ5A 4KGVA 1TKBA 2QU7A 3AW9A 3BS4A 4XWWA 1NF9A 1NOIA 2B4TO 3LW7A 4YPOA 4B84A 1TTPB 2F2TA 3A6ZA 1LV8A 4S1TA 2JJ2D 1U4OA 1YA6A 1U0EA 5K2MA 4BVFA 1LK7A 1FSFA 3PNSA 1E7SA 1ZLXA 4OHCA 2FU5C 1I51A 4YQEA 1W49A 2GF0A 5L3SA 4EF5A 1S02A 2GM5A 2HK6A 5TC4A 1C41A 2NQ8A 1QVZA 3E9EA 1IOVA 5ES4B 1VMIA 2H2FA 1IZZA 2WWHA 3IB3A 4KMOA 1KOLA 1NBEA 4FGWA 1U9YA 3VJKA 1RAGA 4Q7MB 3LCRA 2H2HA 4GMFA 1QX4A 4BUJA 5J23A 4DC0A 2H07A 2L2QA 4IG4A 4BB6A 5LA6F 2BGTA 2V7XA 1F51E 2WSMA 3FUWA 3Q87B 2ZUEA 2G9RA 1Z34A 4ZVNA 1EUDA 2YMLA 3Q2OA 4DLBA 5D7NA 5LWHA 6AT1A 2JIRA 2WA2A 3FNHA 3OETA 3VU3A 1NN0A 2CLDX 1RC1A 6GPBA 1XK7A 2FG7C 5CBPA 1BXKA 3GLHE 2ZSBA 5LQCA 2BEJA 2BD0A 3ILVA 3H2SA 4HEJA 4PG7A 3UJ6A 4UHCA 4A2PA 3H2KA 1ZJJA 13PKA 4ER3A 1HLFA 3MD0A 2ONJA 4K03A 4UEWA 2D1QA 3DP9A 1PEKE 2BEKA 2BGMA 2ZBUA 3EQ2A 3IV7A 4PR3A 2P6PA 2P62A 3I3OA 1LK5A 3W5UA 2C92A 1JHUA 4GRIA 1JDJA 4X62B 2A3RA 5KDLA 2JGKA 1F2UB 3K70C 1W87A 2CF5A 3FWHA 3AFHA 1AQ6A 4URUR 1P3Y1 4FFBB 1NR7A 2ARKA 5FPQA 4U63A 4PSKA 3W9YA 3ZCXA 3EA5A 5FUWA 1EXWA 2X6TA 2HK9A 4ZMSA 3BAFA 3AMVA 4EO9A 4YCNA 1LA2A 4MW7A 3S44A 3TJZA 5TQ2B 2CXSA 3D6NB 3KB8A 1JJIA 1YCDA 2E21A 4NY1A 3QLUC 5FD8A 1HOTA 1LNQA 4WCFB 1CNFA 4KDFA 3HJTA 3CHYA 1N2SA 3JW8A 4G8BA 3T3DA 1VKRA 6YASA 1QFYA 2WZBA 2DQKA 2Z08A 4MWZA 1MAWA 4Z99A 1SOUA 2F3QA 3HFRA 2C5EA 4RKQA 4TQAA 3WVNA 3I61A 2C4WA 2PKEA 2WHEA 1K27A 5AOCA 4RXUA 2JLUA 3KPWA 2EZTA 1EVYA 3OEHA 1JZTA 1SXJB 1XRRA 2C20A 1GUAA 2RBKA 1A98A 2JK0A 4JMLA 3VR6H 2HXGA 1DBPA 2VNJA 3T7SA 2HMAA 3BREA 2V0NA 3GUUA 3W7AA 1RWPA 3KOMA 5CDGA 5FUMA 4GLLA 4Z6KA 2CSUA 4ACBA 3NMUF 1YKSA 3U7QA 3ICWA 3O3OB 4CKBB 4BNTA 3PV0A 4OGGA 4OQMA 5HG0A 2Y1GA 3MLEA 4L07A 1E0JA 1FS5A 4W99A 5TT0A 1GAEO 1N2XA 1RAEA 2A9RA 4WEOA 5CNKA 3U09A 5SZIA 4TZKA 4MYSA 4E51A 1U2GC 4H31A 4S2UA 1R6XA 2QQ0A 1C7FA 2FUNB 3VSEA 4J1NA 2NO5A 1BN6A 2O2IA 1Q1EA 2WU4A 3AJEA 1YIDA 1NVXQ 1IQRA 2YHIA 3C98A 3G2NA 1BVRA 1UXJA 2V7PA 1LX6A 3AJ8A 2QLFA 4YRTA 5JPCA 4S05A 4NG4A 4W8HA 1XEWX 2CZCA 3OIFA 5EE1A 1WCXA 1GOTA 3CTPA 5ALTA 4YT8A 2UYHA 3ZY3A 2QE6A 1PW7A 2J33A 1GSHA 3FW1A 1QGED 1RFGE 4FPXA 4CG0A 4K0KB 4F21A 4UTVA 3EVNA 1I7PA 4A5SA 3L1KA 4FHEA 2FK8A 1V8ZA 5FFFA 3ZN2A 1NW4A 2D1YA 4LRWA 4JOSA 2VPXA 5FKJA 1YQTA 2RC6A 3JYLA 3F5QA 2GVDC 3FNQA 2WWTA 4J6EA 4US0R 5C8YA 3ROXA 2DFVA 8ADHA 2V7GA 3KOWA 3D0RA 3ODGA 5ELMA 7REQA 3ZU2A 5ITVA 2VH2A 1YJQA 4EWLA 1QC5B 1VBFA 2VHVA 5HOQA 1C3OB 1SIBE 4FN4A 4QG7A 1XAHA 1Z0UA 4ENVA 1N7HA 3S99A 3K0EA 2O50A 2X0KA 1ENPA 1CCWA 2HRDA 5IXSA 2V6JA 3HYNA 1HDYA 4JBNA 1O95A 2BEUB 3EULA 1T5LA 5MF6A 1YQXA 4J1TA 1I7SB 2C29D 3RIEA 1XZ8A 3LOQA 4D5EA 1QIIA 4NDZA 4R40A 3JQBA 5K01A 5I48A 2JFNA 1NU6A 3ZLUA 4Y7CA 1WDKA 4MGEA 1V2GA 3U2QA 3DKPA 1QIMA 1WSAA 1T8WA 3FB4A 5JDCC 3EDOA 4A4DA 2E2WA 4JYBA 3AILA 3L8DA 4RVHA 1Q1NA 1XXHA 2PUCA 4K6OA 2HSDA 3LDGA 1Y8ZA 3Q8XB 3SIXA 4YH1A 1MABA 4BZZA 2HWKA 3OZEA 1R50A 2XSZA 3AEUA 3WGQA 1EWVA 1U7DA 2MWMA 2RHRA 4UD2A 3WGIA 2RD2A 2DHRA 2BR4A 5F98A 4QJBA 4NV0A 1QZZA 5CNMA 4D9MA 1CNEA 3QNMA 3IR7A 3CB4A 4IJMA 4LI0A 4WJLA 2B69A 1V8BA 4GFDA 4CTNA 1B1AA 4TQ9A 4BC0A 5KCZA 2C9DA 3HUUA 3PDJA 2QM3A 2O3QA 2O5EA 2VAXA 2WAXA 1XU9A 2YOHA 4L0CA 5HF9A 3QLTA 4OIMA 1OXTA 2PDAA 2WYHA 1WXQA 3HZHA 3Q0EA 1NMYA 2YMQA 4RQTA 4QELA 2A8YA 5BW6B 4IOKA 3AHDA 1XEWY 1S7CA 1NE7A 3QW2A 3TRFA 4GR5A 4WV3A 2ZG6A 4P5EA 5K0FA 1C4WA 5A9TA 3S81A 3MCAA 3GLSA 1CS0A 1W25A 4O2AF 3QWFA 1IBRA 2VAPA 4LE2A 4MITA 1TFUA 3OE1A 4FX5A 1UZAA 1GLGA 2VCYA 4PAOA 3F8SA 5FNVA 3DMYA 3WDLA 4PYNA 3TE6A 4LF9B 2WSYB 3KWMA 4YP6A 1RYDA 3GW8A 1J8QA 1S2LA 4NK4A 1PDWA 2EEPA 3KZCA 2IDZA 4JHLA 3OZAA 4AAYA 1QH1B 2DXIA 2VDMB 3ZKWA 5I5EA 1JJ7A 3SHTA 1MUUA 3PEWA 1MR3F 3QH4A 1KDVA 5LDGA 4FNGA 3NB0A 1D9XA 3QLJA 4BBZA 2OMKA 3EY4A 5CVEA 2AD5A 3DZJA 3CO0S 5TS3A 1JHOA 1H3NA 3WMXA 3ZDEA 3TLEA 1G21E 2I91A 3ANXA 2E6UX 2NVWA 1AKEA 5LQUA 2HA5A 2H08A 1TKRA 3BMCB 3EWIA 1Q7TA 3F6PA 2OPBA 2ABWA 4M2LA 1UMDA 1Y98A 4LN1A 5SZJA 1W5EA 2XRYA 1JH8A 4K9RA 4TYMA 3E5MA 4JL6A 1CEQA 4RPLA 3RV4A 4KLRA 1S2NA 2DJIA 2JH9A 3H9BA 3I1FA 2F9LA 4MUNA 3AG6A 1H65A 2YQ5A 4C0SA 3T0GA 5CT9A 5KJ1A 1V37A 4LFCB 5L3VA 3O8OA 4JIGA 4ZAGA 4FBMA 5F1OA 3K5HA 4YQYA 5G0WA 4C1NA 5FWNA 3MBKA 3NW9A 2VCEA 4MRAA 4AXBA 1GZ4A 4ND2A 5K20A 3E35A 1F20A 1CUGA 3Q8WA 4DV0B 2NUAA 4AUEA 2J46A 1NBHA 1Q12A 2ZXFA 1IG3A 1T0IA 3V1UA 1RHRA 1GXSA 1Q3HA 4TL6A 5L7YA 2OZVA 5CIYA 5IAGA 1JHDA 3VZBA 2W6IA 2WUWE 4U0KA 4R0VA 3ZWCA 3U16A 10MHA 2OOKA 3MB8A 2JJ8A 2X4IA 4M6WA 4IIYA 5ESWA 4C4SA 1R0SA 1VPEA 3P9SA 3COPA 1ACJA 4LHXA 3EXAA 4R3NA 5I8ZA 3DZHA 4FIZA 1GZDA 3A0RB 5B7NA 1NURA 2FUCA 2R7MA 2ZDHA 3DPIA 4QFBA 1E7YA 5B3JC 4ZWNA 3E81A 1EMDA 3SQNA 3ZNPA 3S2IA 4EI8A 4KMMA 1DG1G 2FN9A 3L84A 4QGBA 1BKDR 2PUTA 2RGBA 3BE5A 4TT3D 1TQ6A 4QPPA 1BS1A 4WBXC 5B1IA 3ZHTA 2GI4A 5EXDA 2P2YA 4D3YA 2HQ1A 3TSOA 1YDGA 1XBTA 3UWKA 1BX1A 3CB2A 5EZYF 3SM9A 3W9BA 2QLBA 1DTWA 4EKEA 1N1DA 3KKQA 2HY7A 4AYTA 3FWPA 1MVLA 1IJKA 3R3JA 4MA5A 2W70A 3VKFA 3KHTA 4TL9A 1EI9A 2ODNA 5J1SB 1FFAA 1R9JA 1DQZA 1EWKA 3B3GA 1I2MA 2R5WA 4OBBA 1CU1A 4UNSA 2UZ4A 2XXAB 4GYJA 3ZCRA 3MBIA 1K4KA 2BZ1A 4TMFA 1ODFA 1V6CA 1ECFA 4OAOA 5ALGA 3PGJA 2OORC 2OGWA 3DVQX 3DDZX 1COZA 4N5LA 1AE1A 1Z29A 4CM6A 5IK2D 1ZJ4A 3U7JA 4W6QA 3VPFA 4UAVA 3N0RA 5ABPA 2FR0A 2H00A 3L5KA 1NKSA 1TZJA 4C5AA 5JH7B 2AF3C 4O0MA 5KHAA 3LO5A 4X41A 3CVWA 4MP6A 1XZQA 3OF5A 4JC4A 2BLLA 3HFGA 2ZBVA 1PJCA 3M70A 4IUDS 2ZAOA 1SZPA 4KXVA 4EB6A 4FMDB 3OHSX 3KVNA 4JT8A 3FHCB 3CLRC 4DCJA 1U28A 4ZO6A 2CLFB 2G25A 1OFGA 1X3SA 3OQPA 4JUFA 3L8YA 4TLEA 1CY0A 1K4MA 2QL9A 4U2KA 5FEMA 4AW9A 5BWNA 2AOXA 1TQ4A 3WLSA 4XJXA 1I14A 5KNBA 5LD2C 4DM7A 1P0PA 1QONA 1FUIA 1GG2A 2MMGA 4BLVA 4IZ6A 1LI5A 4ENRA 2PLNA 4LDRA 3BIOA 2BKUA 2PX8A 2QRHA 1SQ6A 5DHTA 1LBTA 1I3LA 2YWEA 3W2EA 5TF0A 3CRW1 1Q1AA 3WYDA 1PL7A 3ZLJA 4DCGA 1EVEA 1JIKA 4GHWA 3JAWA 3S40A 2O8EB 4GOXA 5KU7A 2G9UA 5IDYA 2AQ8A 1NNUA 2OAP1 3EIFA 4I1OA 4AQDA 2XZLA 1X9GA 3FSJX 2JD1A 4FFVA 2B2CA 3M0EA 2O6LA 1RP1A 2BBTA 4K81B 4XGQA 3VVBA 3BK7A 2D2EA 2OZPA 2JJ1A 3Q15C 4OP1A 3H2IA 3MJTA 4OP2A 3UXEA 4AFNA 4DF3A 2CNWA 5COQA 2ZJ3A 3CC8A 5HUQA 1IG0A 2BY4A 4A7PA 4LXHA 3ZCVA 1C3VA 5IJ0B 1B15A 1XDZA 5IMBA 2EU8A 3G68A 3GGOA 3BWVA 3M3PA 1EM8A 1VLHA 4BPRA 4A92A 1WMBA 4JDUA 5IM5A 1GNRA 2HGSA 4ZCSA 5K0LA 5KOHA 4U7GA 4YJHB 4UW9A 1QPBA 3AVQA 3EW9A 3HR4A 3ZNOA 4ZDIA 1PEDA 5AHXA 1VTKA 3VH2A 2IZ1A 4IMIB 1GPLA 5CLGA 2MINB 1DIHA 2WINI 3GJYA 4YGXB 2J9GA 5FAXA 3WYCA 3KOXA 2BH9A 4CUJA 3NM5A 3GRZA 3LGAA 4YONB 1X1RA 2R79A 2PUBA 3EXEA 1SHJA 5TPWB 2WF9A 3BSSA 1M6HA 1XTKA 5TIIA 3RJZA 3BGOS 3DFUA 3DEZA 2PRKA 1KDPA 3QWBA 1ZOIA 4RTPA 3MM4A 1V1MA 4X6XA 4Z4CA 2PWPA 5KQSA 2CV1A 3V4VB 3WNVA 4OI0A 4UKDA 4I9UA 2XCTB 5DFAA 2HCFA 3QPUA 1JHVA 3ZJTA 2PNJA 4GKAA 2EJCA 5HW0A 3JYPA 2AT1A 2G9QA 4KQKA 1TPZA 1CQJB 2QZ4A 1J23A 2E87A 5EXEA 1OJLA 3HKEA 2H2DA 2XNCA 1BAPA 2D0IA 3ND6A 3NHLA 4UJ3A 3GCWA 4UNPA 4AX8A 3D6AA 4DVJA 2BPOA 5JSKA 3JYNA 3EFEA 4K6GA 3AQ4A 3CRRA 3W7VA 4FSXA 5A1TA 2V5AA 4NJMA 5AUPB 1TIBA 2VQ3A 3E7DA 2G72A 4F2WA 1J2UA 5AKZA 1CETA 3GFRA 2I8LA 1JDVA 4YMSA 4XX1A 4PYOA 1G42A 3LLSA 3BC1A 4YPFA 3MLBA 1H42A 4G81A 3R74A 4HVCA 4GAEA 2PR7A 1A0OA 1X77A 2RI1A 3IUBA 4RPJA 4Y2TA 4A15A 3I6MA 5KYWB 4TSFA 2RDMA 4JIMA 2X7XA 1Z5UA 2ZIXB 2LIVA 1LS6A 4JELA 1QFZA 3TZLA 1YR9A 2ZR7A 3M6VA 5ALSA 1KSGA 4D92A 4MDYA 1YI1A 2B82A 2ZPUA 4X64B 2NSDA 1ZO8A 3LYHA 3H9CA 5FPPA 4S04A 3HM9A 1ZAYA 1QCDA 1B73A 1CJKC 4ZIRA 1PS8A 4S1WA 1HL7A 1NQUA 3IHLA 3A31A 2WTXA 4YALA 1PQPA 2R00C 3DXZA 1IN6A 3GLUA 3L7NA 4IO0A 4IV5A 3RK0A 3WLEA 2PX6A 3G9ZA 1E94E 1M2JA 2G70A 3BQMB 3IVAA 3V7WA 4JUIA 3ZU5A 1MAVA 1TLFA 4QPDA 4F2GA 2HJSA 5EA2A 5E6RA 3B3QA 2BGGA 1RHJA 3P9KA 2HMSA 4IF6A 1WTAA 2IWHA 4ZICA 4HRYA 4N47A 2TECE 2V7EA 4GVLA 1OA0A 3PD7A 3T7AA 2QLJA 3EC7A 3FDXA 2O5CA 3W9SA 1LD3A 1U3DA 1YDWA 1UMCB 2P41A 2XODA 4HG2A 4D9FA 4CEIA 5DJ5A 1GG8A 3EYWA 4IIGA 3I05A 3OOHA 2AI1A 3KR9A 1I24A 2FWAA 2R8XA 3IMCA 1SBHA 5JPIA 3TEFA 3PLAE 5IULC 1OBHA 5AW5A 1NXOA 4G5XA 2VK2A 3JQ9A 2CFSA 4WOJA 1E96A 2WMOB 2XVXA 5ENZA 2RHLA 1P2FA 5CXXA 1HSOA 1KXZA 1PLKA 4I81A 3LBAA 5IAAA 2B3TA 3L1HA 3PFBA 1JHMA 1H6CA 2R8ZA 2QX6A 4LJRA 2ZRDA 2DTEA 2JCYA 1Q0RA 3WB1A 4XXHA 3GBVA 4HGPA 3OFSA 4LBVA 1FBTA 3EA0A 4EY5A 4F06A 3Q5GA 2IQIA 5KYKA 3GJSA 2BRUC 3FMGA 1Q3KA 2NVUA 3WGHA 1CPYA 4YR7A 1O3YA 4FYVA 4M49A 2AK3A 4MKHA 3R0IA 1VJDA 3EGCA 1Y3IA 4Z54A 3I30X 3V42A 4B44A 2WYWA 1LDBA 1TLLA 2FR8C 4ZRDA 5CLFA 1S3FA 3BIFA 3AI2A 1OTHA 1K5HA 4ND4A 3UWMA 2PK3A 1XCBA 4ZOLF 4ZVOA 5JAMA 2WFZA 1TVKA 3JQDA 1X19A 2FWRA 3PWTA 4GLFA 4GZMA 2VJLA 4GM4A 1DZ3A 4HUTA 3THWB 2QD2A 1NSTA 3OP1A 4JKIA 4WNAB 3GLGA 2YIDA 3N7TA 2H7XA 2IELA 2VR1A 3OVMA 1BDBA 2O2DA 1GSOA 3H42B 2QUJA 2QAJA 2VJNA 5AP9A 4B6PA 5A9SA 5EWMA 3COWA 3LIPA 4W4TA 1MAHA 1RLUA 3FOWA 3MYYA 4ZHQB 2EDCA 2QZJA 1E6EA 1ZI9A 2OB1A 2E4VA 1O77A 4Z0NA 4A0GA 3IR5A 3A6DA 1DL5A 5GADl 3PX7A 1IAQA 1T5IA 5DP1A 3WHKA 1VCIA 3KT8A 2JZCA 3RB8A 4BB5A 1DCFA 4FD2A 2A33A 4X20B 3ISJA 3IOCA 1XCPA 1HNXB 1D6NA 3CLKA 4V2IA 5FA8A 3OP4A 1ATIA 4KLNA 1FLVA 3RQSA 1WVIA 3I23A 2QSUA 2ZTSA 3LGXA 2E5LB 3VR5A 3MIIA 1UFRA 3KXDA 2EIXA 3BHJA 3E22B 2NSJA 3JQFC 4P6VF 5C34B 5E7QA 5HZGA 2BI7A 4IIJA 3K16A 3LT0A 4UAGA 3ZCUA 5IBCA 3NVKI 3T4EA 3UV7A 4D26A 3HKDB 2QVZX 1SVUA 5BN4A 4QPJC 1CZUA 3H1FA 2Z8YA 3QF4A 2PH7A 4GRAA 4YJKA 4OO3A 2G1UA 2XTNA 4A0SA 1EAYA 4IMRA 3NT5A 4UUBA 2X0EA 2W2OA 4U7WA 2D3WA 1AUOA 2DFLA 5J4LA 5CD9A 3TR6A 1DTSA 4YP1A 4A6XA 3K0FB 4JROA 2YV3A 3VYRB 4BO1A 2JI6A 1A4XA 2IUUA 4BVLA 3I2GA 1I4OA 1VDMA 4UU7A 4ZPJA 1RRCA 1WP4A 1KAQA 1MIHA 2V0GA 5I8PA 4L85A 3WYFA 5KAMA 5JS1A 1H2BA 4IFIA 4LNHA 3W1VA 4YMLA 4UVEA 4RSMA 1BCRB 3TLZA 4TYNA 3GDGA 1T1EA 2H1IA 4WGGA 3ZV4A 1CE8B 2XZPA 2J5RA 2XB8A 3G0HA 2Y0PA 4LHEA 1D1TA 3QVSA 4ZAVA 4ETMA 4HYYA 5KDOA 1SBIA 1IONA 5JFOA 3QXXA 5TVKA 1CRZA 5D87A 4G1BA 5JXWA 4XDHA 3PUIA 5CRIA 1N5LA 1TUBB 2RGWA 3WLJA 3EIEA 2HHJA 1TLTA 1EUZA 1YB7A 1WWKA 2YFQA 4I4CA 4C0AC 4RA9B 4W5WA 2VP4A 1UBHS 3KUDA 1BEUB 4NESA 3WK8A 4EZBA 2PAFA 4KWCA 3R6LA 3GLIA 5FLYA 1T13A 5FWYB 4WFJA 5T3UA 1XEXA 1VSQA 2J07A 1I4DD 4EMSA 2FPUA 4RS4A 2XBMA 3ANNA 2YN4A 2WYVA 2VNKA 3L43A 4R5HA 1ZDMA 3OLXA 5EGNA 5JSYA 1NVFA 2QRMA 1QF7A 5AI8A 3TFWA 3HQ4O 4TUYB 1V7QA 3NWBA 3C3DA 5CA0A 1P0QA 2ZWAA 1SXJE 3QNUA 2PGOA 4B6QA 3OQOA 1LF0A 1FTYA 4P3OA 2BF7A 1N9KA 4LJAA 2H5IA 4MCIA 5H1YA 5MFZA 2K6GA 1VJCA 1AMUA 2J85A 1D03A 1ZMTA 1Z3CA 4RF3A 4V3BA 4WNCA 4XIFA 5CGQB 2GJ4A 3CGGA 5J1TB 1EGVB 1E6CA 4IQFA 5EKXA 2OPHA 5KTRA 2IS2A 4V0MA 1TGYA 3Q6MA 4AYWA 1ZBQA 3U7EB 2XDAA 1SBNE 4ZZ3A 5M04A 4RLHA 1GSIA 4DREA 1WQ3A 3C39A 1TIPA 3BJMA 1WF3A 3MMSA 3QHPA 3FM9A 4RJIA 5KJEA 5L3ZA 3RFFA 3HCNA 2PKYX 2IIVA 2I6XA 3WFJA 2EOAA 5KTYA 3WZMA 2YRXA 3I01A 4FOLA 4UCWA 4D3ZA 4HATA 1MC4A 4JMPA 1RVDA 2A1UA 2ZUWA 4HDKA 5E4JA 4IBOA 1SOMA 3VDRA 4C7XA 1L8QA 2P5SA 3EXHB 3HCWA 3HDJA 2F1RA 3HE3A 1TZ2A 5DXFA 3VUFA 1OWPA 1TECE 2FFRA 2IPMA 2IF0A 2W2LA 4R98A 4F6CA 3JVEA 2UYQA 3SX0A 2XHEA 4TZ6A 1U02A 1SPBS 4YI5A 1MJFA 2AJLI 4GZ5A 4HV4A 3KLPX 1JHYA 1OZ0A 2QJOA 1T36A 1F8FA 2RJ3A 3BGSA 3HJGA 4LF4B 1Y5IA 1CW2B 2OHIA 4JCCA 2JEYA 4IDHA 2DSNA 4D42A 3EXIA 3DZDA 5LXTA 5FUYA 2X8JB 4P22A 1VBKA 2CE2X 2FLVA 3EGWA 2C2YA 1HZJA 3V33A 3LM8A 4BZXA 1MC1A 3E5HA 1J8MF 1RKVA 4X44A 5AJWA 5AVOA 4XASA 1TZCA 1WLYA 3X44A 4OQLA 1PEAA 4TTSA 4CZ2A 2ZJ4A 2C99A 4OXNA 3D64A 4LPKA 5AIAA 2F8SA 5CITA 4GLJA 1KXJA 5I6DA 1Q92A 1KMQA 5DGHA 1YDEA 2I2AA 1U9JA 2G82A 4A16A 3ED1A 4PZZA 1RRVA 3UJDA 3GPIA 4QAQA 2PT5A 4UVDA 3VI4B 4PN3A 3K9HA 4KTVE 4DLTA 1N6KA 4YJ3F 1JKJA 3PQ4A 4CEHB 2C5LA 5AVQA 4I5IA 2FFQA 3PF9A 5AI6A 1DKUA 4LC1A 4EEKA 2V6GA 5BUQA 1TK2A 3LO8A 3U4DA 7MHTA 1N9GA 4LZOA 3MVEA 3PQ3A 2OHVA 1DADA 2C5SA 1UBCA 2YC2C 3C8ZA 3KYDB 5E3HA 4YXWD 5H4GA 2E49A 2B0JA 3U9LA 4FHFA 4BVGA 2G0AA 1DIAA 2W0MA 3QVMA 2CCKA 1KK3A 1FSPA 2DWUA 3GN2A 1E59A 2C78A 3DT8A 5D5PA 3WOHA 1JPVA 2ID7A 1KHTA 3EQ7A 3UMCA 4UDXX 4CJXA 4GZ3A 5F35A 4C5CA 2H5JA 3ZV5A 5C35A 2PL9A 2G9VA 3G5LA 1JG4A 3UB2A 1YQGA 1YZQA 1EJ0A 3OBBA 2CXHA 2VF8A 1P4JA 3HBNA 5F7OA 1EZ1A 1QB7A 2O05A 2W2KB 4IS2A 1K7XB 3FNIA 2QAIA 3ZLBA 5DMXA 4C21A 1MT0A 4MQ5A 3NAZA 3I2YX 3RSLA 1MENA 3VDQA 3CVYA 4IIVA 4BMPB 2B1IA 2D3TA 2FMKA 2ZYRA 2E5FA 3THSA 3OO1A 3HGQA 4TLDA 4HAOA 5LDHA 2OHJA 4LRQA 1JJAA 4DADA 3OLZA 2IXDA 2L0XA 2NW6A 4WKGA 1KWGA 1JEYB 2LRHA 3DE1X 4C7KA 5DKFA 1P0FA 2FW6A 1JAHA 2HZ7A 2R6JA 3LQ1A 2JVKA 3NEPX 3PB3A 5IAEA 4DC1A 4Z7OB 3GT4A 5TMBA 3CUSA 3H8JA 4QNRA 3VH3A 1CTQA 1BQ4A 4QOHA 3ADCA 1J1UA 1C9MA 1NMZA 2CXXA 1SZJG 3H0CA 3N07A 3WKEA 1E5DA 2KE5A 4JKYA 1Y5RA 1LY1A 1MF7A 1BEEA 1QO0A 3KP1A 3D4LA 5B58C 2P2GA 1ENOA 3DO5A 3ZW8A 1QUEA 2YNMD 5EAIA 3DOUA 1M2OA 2GZ1A 2EZ4A 2QVXX 1N33B 3JTEA 1MDBA 4ZK2A 3GJXC 3GDHA 1Z8HA 2XUGA 2YMPA 1RKBA 3C43A 3L0ZA 1TX4B 1D6JA 3DMPA 4GKBA 4ZC8A 4C0JA 5CVDA 3CURA 4P58A 3QP9A 1YL7A 1I5RA 3U31A 3UAOA 1H23A 3LPAA 2YASA 3S8MA 1L7NA 3RRXA 3H83A 4WT7A 5LZ4A 3AF2A 5CH3A 2ZSHA 3WXBA 4CKWB 2PL3A 1AQLA 1QHIA 4ZU3A 4ZJPA 3HTXA 2Z4TA 4R8LA 1X70A 1QOQB 1K1EA 8ATCA 1OMOA 3W04A 3MZ0A 4X3OA 1JLSA 2ZANA 1NJGA 4DWOA 2P4SA 4EAAA 2O8DA 1BA2A 3QEOA 4M0EA 3G88A 2I87A 3L7OA 5KVQA 1K63A 5B2ZA 5K09A 3AVWA 1SC1A 1X1EA 2YZNA 4DA9A 3OCWA 5FA5A 4O3MA 4NV3A 2O8FB 2DPGA 3N2IA 2ZW9A 3LFTA 4Q7LA 4URHA 4Q9HA 3TXXA 3ZE8A 5BYJA 5K6AA 3PNYA 2X6RA 2FFBA 2WAAA 3KYBA 5KX5B 4V1CI 3TMYA 4CFSA 1RJ9B 4JJ6A 4KTTE 1BFKA 3VJLA 1MNAA 3C6ZA 3KB2A 2UYGA 2A0WA 4QVKA 3WMFA 5M7EA 4GZ6A 2D7DA 2BEVB 3QMVA 2B6HA 1TW3A 1LSOA 2PJZA 2ZR9A 3B53X 3KXKA 4B17A 1TQ2A 2AS0A 3W8EA 3DTNA 3MN1A 2DUJA 3FOCA 3LVQE 4KDRA 4HAYA 3TSZA 3VKGA 5DK4A 3FVQA 3A14A 3K2IA 3JD0A 2Q1YA 4WTOA 5DW0A 4PHTA 1CT9A 1B8OA 2LDBA 3A9CA 1RZRD 1J6UA 1UK6A 2J1LA 4Q3CA 3VZPA 3OSUA 3NQ41 1OHHA 5ESRA 3JVUA 4MMXB 2C4TA 2R1UA 1GTJ1 1WZEA 4QIHA 1L8LA 2BM8A 1GARA 2NO7A 2NZXA 1E1KA 2GFIA 4Z7QB 3QEMB 4X1KB 2MSLA 5ICMA 4TV9F 2IP1A 4I3FA 1KHHA 1IEXA 2F64A 4PGMA 5TGZA 1FDWA 2DPLA 3IERA 1VG0B 4JQOA 4EUSA 1UP6A 1IHDA 3GMDA 5BN5A 4EATA 2XQIA 5JS7A 1X8XA 1WU7A 3BYZA 3GJ8A 3M1LA 3SQOA 2QNRA 4X1IA 4KOAA 1PR9A 5CVCA 1L9XA 2CNBA 3AH8A 3GARA 4C4RA 3FTDA 3JATB 1XTZA 4UDOA 3W1WA 5CW2A 3IRVA 3SE7A 1VG8A 1ZIPA 3TTUA 2H4XA 3U3MA 1HQCA 4E2XA 4X66B 5JEEA 4NBUA 2WFLA 4BECA 2GTIA 3ADPA 1PZFA 4WCDA 5KVSA 1P1IA 4P4GA 1A88A 5DLQC 1V45E 3OJWA 3PNVA 1NN1A 1MORA 1VJ0A 2NU7A 4P8RA 1WHTB 3JQCA 1P1CA 3QOWA 2I8CA 1RAAA 4FDUA 4GWKA 1ZN9A 2E4XA 2OMEA 4H2DA 4RHCA 5KIAA 4HGNA 2QR2A 4MDFA 2Q0SA 3O9VA 4UOZA 1UDWA 3WNBA 3KEFA 1JB1A 3ZXIA 3RFCA 4MVJH 3CMMA 2AD1A 1XA0A 2JLVA 4JI4B 3R7AA 1IWOA 4ZYWA 1K8XB 2BFNA 3UA4A 4CDNA 1FXSA 3TZCA 3V8QA 1RHQA 3TTXA 4PG5A 1NBOA 1WMSA 2P1RA 5IJ9B 2DHCA 4RACA 5A1JA 1SHUX 1DJNA 1NYQA 4H0FA 1UJCA 3E9CA 3F4KA 2XMZA 1SKYB 1VPVA 4KQHA 4L9AA 2PGIA 3IIEA 3MJSA 1DBQA 2GO7A 1T29A 4HBZA 2WG1A 1XXHB 4HNAA 4P36A 5IXYA 1M5RA 2VBFA 4P33A 4Y2PA 4HLNA 1OLOA 1Y33E 4ND7A 4BMNA 4IGEA 4LZPA 2IHJA 4CF4A 1GTG1 2I1QA 3EOZA 4HZGA 3S6JA 1XC7A 4PLCA 2ZRNA 2C31A 2QPAA 1KYXA 2HK7A 3I52A 3I9NA 4YAOA 4KQGA 3IXQA 1L7XA 2BJVA 1Z4OA 2CFRA 2FEOA 3K9BA 3PXUA 1M8PA 4LSWA 3ZDFA 2FQQA 4ZI7B 1R4AA 1DDIA 1K3TA 1C4OA 5BMOA 4DZRA 3U4QB 2BL4A 2OC4A 4F92B 5JT1A 3IQZA 3VO9A 5A2QA 1DWUA 1R6UA 2PH1A 1P6QA 2HPHA 2NAPA 1XX6A 5AQEA 5JBIA 3O94A 3ENWA 1P5ZB 1E1RA 1Q83A 3DF7A 2VDRB 3KDSE 1KSJA 2TMDA 1KEVA 3G85A 1A1SA 1S4MA 3JWEA 2ZDGA 3UJAA 3ZV3A 5C7OO 2GCNA 2I4IA 3VDNB 2QNBA 2L69A 1IMOA 2YJ3A 4JJ8A 5E8RA 3NBKA 5FNVB 4C88A 4CM8A 2GX6A 2UUCB 2EATA 2WM3A 2ZYTX 3QUTA 1J8YF 2FSUA 2GUGA 4Q1EA 2ZM6B 2GN6A 2QWXA 4MUKA 2OBNA 1RM5A 1JVBA 2C77A 4J29A 4L0MA 2P2NA 4P81A 5E9WA 2ZUTA 3VC7A 3ZK9A 3BK1A 4A82A 5KZMB 3I5YA 4KAXA 1B00A 2GKSA 4CHGA 2FN4A 3DDUA 3NGXA 4HT3B 1YKFA 2ZTUA 1CR1A 3EPHA 1WMAA 3O1IC 2P67A 4FXPA 1TJ4A 1QYDA 1TYBE 2VFAA 4F9EA 4MI1A 4DV7B 1T6ZA 4O63O 5KSOA 1FU4A 1H9CA 1ORHA 2AN4A 3KETA 1N2GA 3CT4A 4K87A 3VYSB 1ZH8A 3OTOB 5JJIA 1SXJC 1EHYA 3LQKA 5CT8A 5HBGA 4TMWA 1E4EB 1XB2A 3JD4A 1SR8A 3I6YA 3NTOA 4Y67A 5BSHA 3DCNA 2WWXA 4DIOA 1XDWA 1WW3A 3K20A 2RAFA 4ITUA 1SHLA 3ZZ0A 4J0DA 3FNBA 3K92A 2PT9A 1Q7CA 1RYZA 4PBSA 4U5QA 4KGZA 1Y9EA 4HQLA 5C46F 5JZMA 4BP9A 5CDHA 3HVUA 1JW9B 5JDIC 1L4HA 4R1UA 2X1VA 1KBOA 5DM2A 3G7SA 2FOXA 1SVSA 4NBRA 3GJTA 1P1FA 3D54D 2ECKA 2QOEA 4LISA 3V2IA 4LYFA 1E9DA 3E5NA 1F5SA 4Z9YA 3Q3IA 1OTXA 3L77A 1GXSB 4GNRA 3LBFA 1V5IA 421PA 2RHCA 3W5HA 1OXXK 3AERB 3EGIA 3I9V6 1KY4A 2R8EA 1DU4A 4K8OA 1YAHA 4HPXB 5DTMA 2H4YA 2QXUA 3UIEA 2PWBA 5CB4B 2B1QA 3AUSA 2VHJA 4QUKA 4DKJA 1XMOB 2Z0MA 1PS0A 4MB2A 3M82A 3D0OA 2XDWA 2CY0A 3L4JA 1ABEA 5JSFA 2H31A 4JENA 4FM9A 1H2ZA 3MYRA 3LX5A 2HU2A 4PCAA 2ZJ2A 2QTAA 3WK4A 1GGFA 2JGIA 2I7TA 4UHKA 2Q5FA 5HMMA 2G06A 3CNEA 4JODA 1NRXA 1DX4A 2AUNA 2HREA 3RFXA 2CZGA 1JECA 4EH1A 2CDCA 3IBTA 3LAWA 3OZRA 4N0PA 3EGXA 4MR8B 5A2GA 1L1RA 2C7GA 5EMLA 4EFKA 3GB9A 2WDZA 4FE4A 2GYVA 5CPBA 1G7TA 3PE6A 4ZEVA 4WKNA 1DZIA 1J09A 2C5BA 3CN9A 4LZWA 1UBUS 5JNUA 5K8UA 5LQNA 2V7UA 4UBOA 1Q19A 1XMPA 3DOJA 4BN5A 3L07A 4EZIA 3ME5A 1L7VC 4C4YA 1M6WA 1W30A 4RGQA 1D6MA 2ATCA 2FUG6 2C4UA 1EVIA 3ITEA 1DKRA 1Q44A 3B2EA 4J0HA 2CMHA 5KREA 2JHCA 3MWLA 1QZ3A 2GJKA 2IGTA 2XTMA 3IIIA 3O8DA 1MOSA 2ZAMA 4M98A 2UXDB 4DWWA 1JEOA 2OAGA 3RJ5A 5IS2A 1N5KA 3BOSA 3MINB 3F6CA 2ATIA 3OWOA 3RBXA 3G13A 1FXUA 1WUKS 2B3DA 1PX2A 3NGMA 1KA9H 4RMIA 1MQ8B 3WK5A 4IDEA 5IEJA 2FX5A 3P9NA 4J03A 4DT1B 3EA4A 3LY8A 3CG4A 3AYZB 3GLRA 1NN5A 3D4PA 4QUHA 1ZWKA 2X58A 3K72B 1OW3B 1VE3A 1WD5A 3OPYI 3WGYA 5CFLA 1CVLA 2HT1A 1Y4UA 4I1UA 4C30A 2JFVA 3W9UA 2JGRA 4HQRA 4RHYA 4C0HA 3DB1A 4FWBA 2WQZA 3EVAA 2P2ZA 3THXA 2R68A 4M0PA 1EFPB 3KTDA 1XP8A 2PTHA 1Z4PX 2ZE7A 1F8GA 4IKPA 4NFLA 1DKNA 1T9ZA 2XE6A 3JQAB 4PBRA 4XYMA 1QRUA 2V03A 5BT9A 3ILHA 4M86A 3IIKA 1EXMA 3RYIB 3UMGA 3ZW9A 1KJQA 1S7GA 5HIKA 2JH3A 4AKSA 2WIGA 2Q5CA 3ORHA 1BWQA 1TCCA 2QYTA 3SC2A 4I50A 2I80A 4UASA 1JVNA 4N82A 4Q4AA 1XJ0A 1KZ1A 1U04A 4B76A 1B41A 3L7CA 5JCZA 3TS1A 1J07A 2JEZA 3L46A 4MR9A 4RVNA 4DA7A 1T35A 2E48A 1IXSB 2H1VA 3AM5A 3DBRA 2H2GA 5EHGA 4YMVA 2YVUA 4H35A 3TNFA 3SDZA 4A0HA 1R0ZA 2YL2A 2C8LA 4MVJF 3UA3A 5ENVA 1LPNA 3TVTA 2R8RA 4F9FA 2OFXA 1DX9A 2MTBA 2J5BA 3VC2A 1RQNA 1YV9A 3OQMA 3CUVA 4CDRA 3TK1A 1A7AA 5ARCA 2LW7A 3OZWA 4CF6A 3HV0A 4NFYA 2GF2A 3RTDA 1PQWA 2WF5A 3RAJA 3RI3A 5JALA 4GI1A 1R8XA 3GUVA 4I5FA 3AXTA 3AVPA 5I7SA 4W9RA 1GZ5A 2ZIZA 1IWPB 5JQWA 3TM5A 3DL4A 4NCKA 3MPOA 4YT5A 4B3IA 2PQMA 3G2IA 2ZYGA 3DS8A 2VF2A 4QL3A 1HL3A 1W59A 2HB6A 1IM8A 3DBLA 3X3HA 1X0XA 5C5IA 2X5NA 4JZYA 3RLFA 5D6NA 3PHIA 1JI3A 2Q6IA 2ZETA 3JWHA 1TCAA 4XEUA 3P2OA 1GDDA 3E1KA 3GRPA 5HKKA 2Z6QA 5LQAA 2HDNB 1FSZA 2VP9A 1YZLA 3BHIA 4QKQA 3RVKA 1XYVA 3DC2A 3I9FA 1RYMA 1VGVA 2GJSA 2XV1A 3KJZA 3WMEA 3NH6A 4BNNA 1GLNA 3H3XA 1HEUA 1MB4A 5C7LO 4JLDA 5LA6A 4KC0A 4WOBA 4IHQA 4OBWA 1CZNA 1IHUA 3I4CA 2GD1O 3HK2A 1ZG3A 2IEIA 4Y2JA 1FYFA 3P2KA 3IP8A 3NTLA 3OZGA 2NU8A 5A4KA 5HS6A 4YRAA 4IIUA 5C52B 2WLTA 1DLJA 1Q77A 3KKZA 3V2HA 3PXGA 1M2GA 1PGJA 3V4SA 2GUWA 5TF4A 1M2NA 2QGNA 1PYGA 1CIJA 3RBZA 4G85A 1RJEA 4AJIA 4JYZA 1QH8A 5CDUA 4C7OB 1VRWA 1YASA 5FUBA 5K0GA 2GRJA 2NVOA 2QR3A 4KPYA 3MCZA 1C1XB 5JTUA 2QTLA 2UDPA 1L1QA 2X76A 4L8YA 4N6OA 1LLQA 4B3FX 1H5QA 5I45A 3PNQA 1JHXA 2C8JA 1OB2A 1JTEA 3F9IA 1ESEA 2FSFA 2DUNA 2BGLA 4HJXA 5AICA 4IZHA 1ZOPA 2ZRAA 2F1KA 2QIPA 3C3PA 2ZE8A 1OGYA 4QJ5A 4DLLA 4XDGA 3N86A 3M4JA 5HQJA 3VR4H 2C7RA 4FOTA 5E6RB 4DR7B 1ANKA 1QYXA 3QM1A 4NFSA 3TQHA 3ZD9A 2H65A 2PAAA 3LY7A 3BGDA 1Z0AA 2FMIA 5AOBA 4BU1A 2EG5A 2MSDB 2FE4A 5FBVB 2I99A 3ANYB 1PEYA 2ZWIA 1PFVA 2DQSA 4KBGA 1HK7A 1OIWA 5ECGC 4RY0A 2XIQA 2YHSA 4MV8A 1P2BA 2RMKA 1YACA 5AKLA 2A3NA 4DCMA 1PGPA 1XZPA 2J5XA 3VC1A 5L3QA 3SSOA 1M33A 2XQFA 4PIVA 2HGZA 1FFCA 3D1LA 2DC1A 3K5IA 4O6VA 2ZM5A 1XQYA 1MG5A 1YS9A 1XHFA 1ZN7A 2A6PA 3KPJA 2AFHA 1XZIA 4XIGS 1R8QA 3REGA 3ETLA 1I32A 1AQIA 1QBKC 4KXYA 4ZVUA 4B4UA 4D25A 1E3WA 1DCTA 2DBZA 4EQ6B 4O1HA 3H7AA 3I0ZA 3RRJA 4TMKA 3W6ZA 2AC4A 2YWGA 1RZVA 3ZJVA 3OFVA 3S3TA 4AJHA 2I55A 2ECPA 1SA0A 4BVHA 3S8EA 1ST3A 3D4OA 1IM5A 2PGNA 2X9NA 4S35A 3VOAA 1RI4A 5B3LA 1U8AA 5CDFA 3AP3A 2PUEA 4ZQBA 1HRDA 1NQ5A 4IVNA 1SWVA 1KL7A 3C74A 1UXIA 1FYVA 1OI3A 2CXQA 2JFHA 3GEPA 3BXOA 1H93A 2CCJA 3KG2A 1ZHHA 1L1FA 4D9JA 1Z68A 3N58A 1RT9A 3D5QA 4GH5A 4EFNA 5FJJA 3UV6A 1DKLA 3RVOA 2O59A 1PZXA 2FF5A 3CIOA 2Q2NA 2GBGA 3EH2A 4IP0A 1ZGBA 1OYWA 3LCVB 1KI1A 4YWJA 4KL8S 3RADC 2XD9A 3HU2A 4RPKA 2IOQA 4CCAA 4N0QA 1RWQA 1L5WA 2EV9A 2R60A 1XO1A 1T9AA 3EY9A 4TWAA 4IHJB 4F97A 3GGGA 3MJFA 3PHGA 4N3NA 1B43A 4WZAA 5TS2A 1VIYA 4EKYA 1NMQA 3LT2A 1R00A 5DTIA 5EWMB 4D8YA 3N7AA 4OQFA 4KPFC 2JLZA 5JANA 4D46A 3LKVA 3ETGA 3DKRA 2O3JA 1II9A 4JC0A 1ZUIA 3HB9A 1LI7A 4KLZA 4O4LB 5FBHA 5JROA 3RAFC 2GD2A 2OHOA 4HX2A 1CDEA 5BNWA 5HCUA 3BXEA 3WQSB 3UXYA 1E1LA 4XUDA 3ROKA 5K3SA 2IV2X 2ERYA 2LKDA 3SXJA 1XRQA 4FXOA 2PIDA 4GX5A 1K86A 5BVGA 2AEFA 2P77A 1I94B 5KNDH 4G23A 1YJAA 2OAEA 1IOZA 3WB2A 1U9IA 1OE0A 3L92A 3OZSA 2QQFA 1U3WA 3F4LA 4HWRA 5DM0A 2HV8A 2AR0A 2YFHA 1C3EA 3NPAA 1YZGA 2CGEA 4GQBA 1A95A 3DEIA 4HDMA 3VHXA 4E5PA 1Z12A 1DELA 1DEHA 3GEIA 4E14A 3BCHA 3UCEA 1NJ6A 3GRKA 3IYLW 4RYLA 1T91A 3EVEA 4N18A 1AQYA 3RQIA 2BJHA 1TMGE 2WTAA 1I6LA 5IASA 4MQFB 2IUTA 4OKNA 2JI4A 3IFSA 1PFUA 1U2EA 1UP7A 2X15A 3EOBI 3NUGA 3K09A 1LNZA 2I22A 4L22A 3FTQA 3GDFA 4Q12A 1I7QB 4GVPA 3RS5A 5CM8B 5ALLA 3T3HA 2JL1A 1ZUHA 1PZMA 1K68A 1VL1A 2NNLD 2OBYA 2WOOA 3A32A 2PVCA 3V4PB 3UXHA 1II8B 3BD8A 5JTTA 3NNSA 4DSTA 1NJ1A 4O2AA 4R54A 3U7RA 4ROTA 4YX9A 2UKDA 3TMAA 1N3YA 2X41A 3ML1A 1N9ZA 2COEA 3P27A 1NTOA 4CMGA 4B3CA 2GZDA 3JASB 1GM5A 4KEAA 3ANMA 5JHGB 1R4ZA 1YTUA 2JKZA 1V3TA 1A96A 2I1LA 2Q29A 3W6OA 1U3VA 1C9DB 2G0TA 4K9LA 3TKYA 2DU8A 3TLMA 2VEDA 2X42A 4QVIA 3JARA 1UKVY 4B3MB 3FG9A 3LUBA 4P2BA 2BISA 2AOUA 3IVMA 1PR1A 1KJJA 2DQYA 1EFCA 2GCOB 4HMPA 3SHWA 1CJMA 4JC5A 4MEAA 4C4TA 3FWZA 3VR4D 3CGWA 3IAXA 3LBYA 2QY6A 2Y6UA 2IXAA 4MLZA 1W35A 3QMMA 3T7KA 4RFSA 1DUVG 1L3BA 1WBBA 4RNCA 4M7WA 2CL5A 1H2FA 1I3CA 1W9MA 1TA9A 2ECFA 4WZZA 3V55A 1KSHA 1YR2A 1G3IA 5JARA 3H5OA 5FOSA 4B8YA 4EGJA 2C0CA 2ZBEA 4KLAA 2NACA 3OBIA 4MV4A 1PSWA 5SY4A 5BV2P 1BJKA 3SDBA 4UQOA 4ZYVA 3DMNA 3LDUA 2D4AA 4XUGB 2JA2A 2JD0A 2HNBA 3ZZTA 3NYRA 2LXNA 4UNIA 1E2DA 2XOKA 2A94A 1JLRA 3C3YA 1KK1A 1LPAB 1PL6A 2P6MA 4P7FA 4WXHA 3B48A 3G0CA 1P7WA 5EJFA 5BV1A 2GCPA 5IC6A 3RVNA 1Q7RA 4BZWA 2IZZA 3M5CA 1DJPA 2IEAA 4QJIA 3WLNA 3WZLA 1K75A 3I3SR 1FDUA 3K94A 4MIKA 5KHLB 2JLWA 4KHPB 3RIMA 1GQFA 4RZIA 1HMYA 3SBDA 4EGSA 3NKLA 1ZGAA 2QX9A 1I6WA 1LJUA 1NW9B 1RIIA 2GAOA 3UHOA 2CLSA 4R1TA 1U0JA 4UDYX 3PI7A 2HMVA 4BMVA 1T9DA 1X6VA 4UUNA 1FLNA 2NU6A 1Y8QB 3FUTA 4JH0A 4FILA 1N0IA 3CPEA 5FYDA 1S3SA 1J9GA 2Y4NA 3G89A 4M9SA 4GBGA 4IYRA 3ZWOA 5A0TA 5JIBA 4LYDA 3RVSA 2D7JA 3H16A 1RI5A 2ZVDA 5IDVA 4ZYLA 3AHHA 4G5RA 2JARA 3K1AB 4BX8A 4YYZA 1MEEA 1A76A 5EZYA 1GL9B 2Q2OA 5E6UB 5ADVA 3A8TA 1JDNA 2PD3A 1VPTA 4ADSG 3N8KA 4CMJA 5JY6A 1J00A 1RM3A 4H7IA 2P6UA 3PC8A 4QYIA 2XYGA 3E6AA 4PGFA 4AP5A 5LSAA 3RYCB 3QFRA 1VYVA 4BRSA 2PA0A 4EELA 1WCIA 3NONA 4OM8A 1IZYA 1KZYC 4L28A 4IJVA 5DF1A 3MT7A 2NLOA 4DG5A 1Y63A 4PEVA 4NNJA 2CV2A 2V0CA 4I55F 4M87A 1FBNA 1JIIA 2NYRA 3VR6A 5FA6A 4CM5A 4BQRA 2JIQA 4OG2A 5BPHA 4KOEC 5BY2A 5DX8A 1LLFA 3QXGA 4XIIA 2NGRA 1P7CA 1N36B 1QYIA 3MD9A 5HYVA 3E7PA 4ZQGA 3HHPA 4HTAA 4ZCLA 1SKYE 2VVTA 5T8KA 3F1KA 2VQ6A 3KJEA 2NU9B 3FWNA 2NQ2C 2F1OA 4EHDA 5KNDD 4X1YB 1XXHE 1USVA 1XKQA 4HGZA 3LS2A 4M1MA 5CJ2A 4BJ3A 16PKA 1U8UA 1UOPA 4N3GA 1RXIA 2VHEA 3F5MA 5ALPA 5HRAA 2ZIFA 4EP1A 2BFBB 4OGLA 2Y1KA 2JAPA 2F55A 2OLJA 4NECA 3IURA 4JI6B 5F7JA 4WEQA 5U9CA 5I3ZA 2ISQA 5AYVA 4B82A 1M7GA 2Q6KA 2NPOA 3TLGB 1NXTA 4RK6A 1ONPA 3QSYA 3E53A 4Q21A 2W8BB 4LJYA 2H9AA 4CCYA 1NOJA 1YZVA 1JDUA 3LRPA 3VVMA 5A4IS 5JADA 4L4ZA 4W8GA 1V2HE 2PGDA 2Z83A 3CZPA 4FHCA 4H18A 3MJCA 4TT3A 5IARA 3VSBA 5HHTA 2EP5A 2GCIA 4HMQA 4Y0NA 2ZTMA 2VP0A 3EK2A 4PFKA 4CG2A 1QKIA 4YAJA 5IW8A 1HYGA 2QVGA 2V45A 4YRNA 2WHPA 1NIPA 3C8DA 3VR1A 2H9IA 2VJCA 3GL9A 3SQXA 3UHAA 1D04A 3NTVA 5G0VA 1ULTA 4HVTA 3P0EA 1IN1A 5ALOA 1BFUA 5H83A 2QMYA 1X86B 1ODLA 2Z8ZA 3OLYA 4TTTS 4U0JA 3IKLA 5EOVA 3GN1A 3TSYA 4KNVA 3A4NA 1K5DA 3VI3B 2QKYA 4LX8A 4WUTA 5ARBA 5BMVB 3OWXA 4P0TA 1JMKC 2H48A 1HXHA 1O57A 1DT3A 2QJTA 2VP2A 5G1PA 1LDMA 2BZ0A 2IZ5A 3TI9A 3WFZA 1UANA 2CDBA 2CKMA 4ATNA 1U3FA 3R6GA 4HLCA 2PJDA 4BO3A 1RHKA 1VG9B 1O96A 3QKSA 3ADDA 3MS7A 4ALLA 3X1WA 4TXMA 3CQ9A 1TA4A 2KMLA 4LC0A 5JYBA 4G1MB 4L78A 3GMSA 3R3VA 1EE1A 1C7RA 1IMJA 2G07A 3T38A 4E1AA 4NULA 4WERA 2C58A 3NTUA 3CJTA 4RESA 1UEXC 1A8UA 5CK4A 1MJNA 4PHGA 4Z1MA 4DA6A 5K4HA 3HM2A 3DKIA 3N2LA 3M6AA 4OA8A 4QOSA 5F33A 1GGNA 2JLRA 5C32A 2XEXA 1NBMA 4P5DA 1CQIB 3A9VA 4MS4A 4RQAA 1RAHA 1VXRA 1KP9A 3IAM6 3WL4A 4JT2A 4BV2A 1KI6A 2AXPA 5FADA 3V32A 2LCFA 4CUZA 3KQHA 1HI9A 4ZCPA 5EC8A 5IM4F 4G0NA 2VHYA 3QUSA 4L2IB 1ZJZA 4U9HS 1IBKB 1V3UA 2BKVA 4MZXA 2EFGA 1BWSA 2WFMA 3IVRA 3PYMA 4RAQA 1VCMA 1YR8A 3Q12A 1W1WA 4LY3A 4NMHA 4O02B 4NE7A 5FPYA 3SAJA 1UFOA 3AOEA 4V24A 4RBNA 3S4YA 2H18A 4G0UA 5KYYA 1KEPA 1KF0A 2BMFA 1WW8A 4H9GA 2QTBA 4MVJP 5JMWA 4CQNA 2MYTA 3I12A 3E8XA 3DFMA 4RSGA 1V7ZA 1TT5B 3DE4X 3FCCA 2XTAA 5JW6A 3ZDQA 2YIVX 2ILVA 1H9AA 3DL0A 3WYAA 3TQOA 1E3TA 2XMSA 3KXLA 4HHEA 1Q2XA 2IDKA 2P5UA 3HI4A 4D3DA 2GPSA 2Z09A 4FU0A 3RASA 3TQCA 3A27A 4KXWA 2DMRA 1ZM9A 4V0KA 2Z43A 4IXTA 3MAGA 4V3CA 1UJ5A 2VTDA 3CRMA 2A35A 4C7VA 2QN8A 4UPVA 1WAMA 4MEJA 2BYTA 2OSVA 2KX7A 2YXLA 3KPYA 1W36C 4AJ4A 3G2QA 4JB0A 5EFZA 3NHFA 1G19A 3HUFA 4O2LA 1J21A 1KVSA 5IP5A 3UEOA 4BXOA 1NR5A 2Y9MB 3KPVA 4H7HA 3SNKA 5BSUA 5CLJA 4EFMA 2CN1A 2IU3A 3B9RA 1G20B 5EUMA 4BE7B 3OJCA 4Y3UA 3F7NA 3ZUPA 3NKVA 1V4VA 3FYUB 4OM7A 4WK0B 5CLQA 1YT5A 4AJKA 4YP0A 1BKSB 5IZCA 1D2HA 1XTBA 3TKAA 1BE1A 4DNPA 1BO6A 1KOGA 2QL6A 5E3JA 3B6KA 3W06A 1V47A 2VH5R 2XCQA 4LBWA 1V26A 4OIFA 3WGLA 5BSGA 1WG8A 5H80A 2GN8A 5KQRA 4R1OA 4IGIA 1ZR4A 4A0QA 2A9FA 4HGYA 4YAGA 5KOIA 1XA3A 3JYHA 1MH1A 3DDNA 3I2IA 5C53B 1Z0JA 3PHJA 4NOJA 1CUDA 1GY8A 4HYEA 5EKDA 2Y1XA 1H85A 1X80A 3A37A 4KYUA 4P4NA 1VSTA 4DGQA 3PENA 3H0EA 2VDWB 4TLAA 3TN7A 3W8DA 3S27A 4E5NA 2FW7A 1TIKA 5G3YA 5D86A 3KXIA 1M7HA 2AJCA 1XJ5A 1GZUA 1ZCJA 1DV2A 1SUCA 3NALA 2FEAA 1JAZA 1FDTA 2K5UA 2Y3IA 3BKWA 3FOAA 4M1TA 5F12A 3ZV7A 4ED9A 1TK3A 1RQXA 3OTHA 3AJAA 3BHMA 4YCSA 2PSFA 2HPAA 1TAGA 2XUHA 1E6MA 4QUIA 5JH7F 5C9ZA 1M54A 1MC8A 1G9XA 5BR7A 1K5PA 2O3TA 5LNK6 1BOOA 3OT1A 4FCCA 2GPWA 3CEJA 1B14A 5BSMA 1A5SB 2JHFA 2V5VA 3FCOA 2VSFA 2IC5A 2R65A 2ZQ5A 3MLAA 4FMDF 4HNVA 1PLJA 2GXAA 1CRQA 4Q47A 4ZEWA 1J39A 4JVSB 2CUZA 5FPKA 1IJFA 1E0DA 1SXPA 2XRMA 2YYZA 4ZOLA 3A2KA 4OK6A 5A0FA 3K8QA 1F60A 3GEGA 4DXDA 2Q7OE 3K2BA 1IUKA 1WSWA 2Y99A 3BGWA 5BOVA 5SY6A 1KAMA 4GG1A 5C7YA 4XEHA 3HYLA 3RJTA 1N0WA 4E3WA 1UPXA 1YL5A 4IJQA 2WU3A 1USUA 3RPEA 4BFCA 4U5XA 4DIDA 3RUFA 3RC3A 3THXB 4S2EA 1ZGJA 3UK6A 2ODAA 2IIBA 5DTEA 3FPGA 4DUZB 1BRTA 1HF3A 4MV1A 1A9YA 4HGOA 4BNWA 4B6RA 1VBMA 2VJPA 3KYCA 2Z8YM 3OE7A 4MS1B 3ZI0A 3WRXC 5KWIA 1H05A 3K2QA 5AI5A 2VJAA 4P3YA 5DASA 1ZIXA 4S0XA 4YQZA 3GRFA 5AVVA 2R84A 5HS4A 1U2GA 1RYEA 1E62A 3WXMA 1TNDA 3VZSA 4ERXA 1HKHA 4N41A 5HEKA 4S1OA 2IHVA 2ET6A 1IY0A 4LDZA 4OI4A 2LUOA 2Z9DA 4K9DA 1H94A 1PL8A 4LYYA 4AM8A 3F1LA 4EA6A 1QJCA 4EOGA 3HVJA 4BV9A 3EGDB 3OOSA 1YRBA 1SC6A 3K96A 1LRLA 4COKA 2OO7A 3FFBA 3VOSA 5INTA 4R6WA 4FWTA 4RPIA 2AN5A 2PFKA 4FGSA 5ECDA 3GUYA 2E82A 4WA8A 5DGXA 5M34A 3Q85A 5C7IO 1LBQA 1TO6A 2IW3A 3AUYA 3F7OA 2O2GA 2GZMA 2X8WA 3TM4A 1E61A 1P60A 3AZQA 3HJCA 1JBQA 4Q9IA 5KQMA 2OOSA 4BFYA 2VNIA 1QVWA 4D45A 4RYDA 2NV2B 1IQPA 2FA9A 4MV0A 1CB7A 1YO6A 2WF7A 1ZI6A 5JNLA 2F7SA 1X7XB 4QDZA 4MYRA 2P4EA 4M9RA 3AVUA 2G17A 3TTYA 3WIDA 4FW9A 3WWEA 4HH0A 2ZIGA 2ZJ1A 2H1CA 3RG8A 3RIHA 2MSNA 4JVMA 2Z95A 4G5QA 2DVMA 3ZIDA 1JE0A 4G5OA 4TLMB 1LRKA 1O97C 1L5HB 2J5QA 1KMHA 2RGEA 1RBMA 4IIEA 3P2EA 1HYHA 1ZUNB 2BHTA 3ETEA 2Q3LA 1AXEA 1C3LA 1U7UA 3IL2A 1IRIA 1ZGCA 3EXFB 3HCPA 3HXOA 2PXHA 3KOYA 4BMXA 3EGVA 2LR0A 1SD1A 2V8OA 3UAYA 5A71A 3KB6A 1ONBA 1Q0LA 3ENVA 4M38A 4OHUA 1XYYA 4OXYA 4YDSA 5DTRA 5J40A 1VZ3A 1NI4A 1I9CA 1RW4A 1ZI8A 2I76A 1NUSA 1E79D 3DFFA 4H3KB 1P9WA 5BQPA 4E2ZA 1Z4NA 2YJ4A 1Y6ZA 1RBZA 2BTOA 2FCAA 3A4LA 4H16A 2CYCA 3FCAA 3U6BA 4IOJA 4HRAA 2P0AA 3IR6A 4RHXA 1KQFA 5K05A 3I01M 3OMWA 4JOQA 4EG6A 1ULSA 3T5DA 3BFJA 2GLUA 3KR2A 3KYIB 4HX5A 3D6MA