3HYSA

Structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
275
Chain Sequence
ENLYFQGAMDPEFRVINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein Rv0554, putative Bromoperoxidase
publication title Structural and functional analysis of Rv0554 from Mycobacterium tuberculosis: testing a putative role in menaquinone biosynthesis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 97
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.11.1.18: Bromide peroxidase.
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hysA00
3I6YA 2DQZA 4EHBA 4C88A 4CG2A 4MQLA 4NS4A 3WI7A 3GBSA 4QDZA 1JFRA 3W04A 4BBZA 2OLEA 4YASA 5AP9A 5AM0A 1HBJA 1IUOA 1EDDA 1W6RA 3G0CA 4P08A 3AZQA 2WJ4A 1J1IA 2JGFA 3A2LA 2V97A 5ALRA 1XRNA 3G9ZA 2CEKA 2XMCA 1AUOA 1MAAA 2GZRA 1Q83A 3FSGA 3ZLTA 4WDRA 1ORWA 3UMJA 1YAHA 4EY7A 2BKLA 3G9UA 5E4YA 1YA4A 3F67A 5LZ2A 1N1MA 3H0CA 4UFOA 4LYEA 1EH5A 4IHAA 3I2FA 2HA5A 3FVTA 1R88A 1MTZA 2HHAA 2Z3WA 2VJBA 2PX6A 5ALFA 1J07A 4MWTA 4C87A 4PSDA 2Q0XA 3C6BA 4DGQA 4ITVA 1GXSA 2K2QB 4H77A 4U2EA 2YH2A 3UUEA 1GKLA 4XIIA 4ZGBA 2O2HA 3LS2A 4FKBA 3G02A 5ALKA 3E0XA 3ZI7A 2PKYX 4U2GA 1CUYA 4FBLA 4HZGA 5AKIA 3HI4A 3DS8A 2WUFA 2ES4A 2XQIA 4X93A 2HFJA 2ORYA 4HRXA 3I1IA 2AJDA 5EGNA 4KAJA 5A7GA 1AQLA 2PU7A 3DKRA 4BDTA 1F0PA 3FCXA 4TVKA 3MVEA 1XZKA 3NUZA 5K3FA 4J0CA 4MJ3A 1H2XA 1G4HA 1UKAA 4U2BA 1EK2A 3AINA 4F5ZA 1PV1A 2CB9A 1CUUA 2HA2A 4Y2TA 2C0QA 6YASA 3R3ZA 3AIMA 2EDAA 4C4YA 1YA8A 1N5MA 2VEOA 1G42A 4Q82A 4B84A 2HA7A 2XUDA 4DNFA 4Y2JA 1NU8A 4BZWA 2WTNA 2XQGA 1LBTA 4BAGA 3FCYA 5AH0A 2GYWA 5HKBA 1GPLA 1WPXA 3D2CA 3QH4A 1VOTA 2DFPA 3I6ZA 2WKWA 1EB9A 2PUHA 3BE8A 1H2ZA 1UZAA 5AKXA 5ALTA 4MYDA 2J4CA 4OYYA 4B81A 1YB6A 1ISPA 5AKGA 5FPQA 3WL5A 1MU0A 1MAHA 3U1TA 4G9EA 2P8SA 3O9MA 3G7NA 5K3DA 3WL8A 1ORVA 5AKEA 5ALXA 1VA5A 4OD0A 5T4FA 1X2EA 3HEAA 3O95A 2WLSA 4KE7A 5ALUA 3K6KA 2XQKA 5HF9A 4X6XA 4FLMA 2AJLI 3WK9A 3UUFA 4PSCA 3W9UA 3WIOA 1QE3A 2Z3ZA 5ALEA 1MJ5A 5D3ZA 4GWLA 4Y9SA 4AB1A 2JGLA 5JALA 2QUBA 2QR5A 2FJPA 3ZV7A 5JD5A 3BDIA 4DNOA 4E46A 3F9CA 1YCDA 3PUHA 3FLBA 3FOBA 3VVMA 3VJKA 3SC2A 3DOHA 2WIDA 3BJRA 1CUDA 5AI6A 4BVJA 1VXOA 1CUJA 2FX5A 2OQVA 4H7JA 5I7UA 3H04A 3STXA 4OSEA 2H7CA 1TKRA 4AO7A 2WG0A 4HXFB 2XUFA 5ALJA 1RP1A 4F21A 1RWQA 2R11A 4BRZA 4TGLA 1HL7A 1XZCA 1XZDA 5ALMA 4MQMA 2XB6A 1RYYA 4C4XA 3SK0A 5CBKA 4QDTA 1THTA 4GXNA 5DYWA 1ZIXA 3DD5A 4MEBA 4CCYA 2C4HA 5AK4A 1KU6A 3O9VA 4DNQA 2C7BA 3EBLA 4RPCA 3HXKA 2OCLA 5LLSA 3OC0A 5EHZA 5AOAA 5HK8A 1H2WA 2DCMA 5ALPA 1R9MA 1E8DA 5HF8A 3WZMA 1L7AA 3A2MA 2QXTA 1QIHA 4CI9A 3B3QA 3PUIA 5CW2A 4DYHA 3C8DA 4QA9A 3R40A 3D2AA 5KWJA 1N8SA 2WHRA 3U0VA 4EY8A 4IO0A 1ODTC 5AJHA 4X71A 5FKJA 2CBGA 4HXEB 4QE3A 5C81A 4AN1A 1UK9A 2G4LA 1CUIA 4B82A 4EY4A 1ZD4A 4B0PA 3STYA 4FLEA 4UBLA 1C7IA 5DTJA 5JAUA 2JGKA 3WKEA 2WHPA 3QYJA 1YASA 3WL7A 2HL6A 4IQ4A 2BGRA 1CUWA 5JARA 2XUGA 1MNQA 2XUKA 2PSHA 3WJ1A 4GLBA 2Y2UA 3H1AA 1VE6A 3DKKA 3LCRA 4WCVA 1VZ2A 4C89A 4WFKA 1XRMA 5ALLA 3CN9A 3M3DA 5AHXA 5EIHA 3ESAA 1GQSA 4KE9A 3TJMA 4JEIA 2WFLA 3STVA 4ZXFA 3O4GA 5ALIA 2XMRA 4DMKA 2O7VA 3STUA 1QLWA 1L7QA 5JYCA 5LZ8A 1GKKA 3D4LA 5IKXA 4X7BA 4AN0A 4BTLA 1YR2A 1EVQA 2HFKA 1DINA 3IA2A 4KRXA 3H2JA 1JU4A 1GZ7A 3QMMA 2CJPA 2CKMA 1QO7A 1ZJ5A 4W1PA 3V1NA 4EY5A 2PL5A 4Q3OA 4QZVA 1EK1A 1JJBA 4EUSA 4BCCA 1K5PA 4H18A 1QIIA 5A71A 3C5VA 3R0VA 4Y2PA 4J0GA 3IUNA 2OQIA 3V48A 2H9YA 2WTMA 2ZSIA 4U2FA 4LIPD 5C8VA 2Z8ZA 3QPDA 3IBTA 1FFAA 1K6EA 1O6GA 2WU3A 5FDFA 5AK6A 4JYPA 1CV2A 4XWGA 1I6WA 2WQZA 1XZFA 3FYUB 1EINA 2HA0A 4LYDA 5E4JA 3WA7A 4C01A 1T2NA 1MX9A 2J3QA 2XLCA 1UWCA 3KXPA 3QM1A 2RIPA 4U2DA 1TQHA 1GPKA 4HXGA 1VZ3A 2BUBA 4X00A 2BCEA 1DQYA 1SOMA 3C43A 1FSSA 5ALSA 5ESRA 1QTIA 1B6GA 4KE6A 4GEGA 2DQYA 4P9NA 2WILA 2XQJA 1EVEA 4LKOA 3FWHA 1R9NA 4QWMA 4E11A 2QXUA 3BF7A 1EDEA 5AKZA 5ALGA 1F0NA 4L72A 3ZLVA 4BAUA 1UOQA 3OURA 4BYMA 2PUJA 2QOEA 5AM1A 4X6UA 2C5FA 3AFIA 3M83A 2VTVA 4BDSA 1CUVA 1E3QA 1ZICA 3V9AA 3DJYA 2VA9A 5EHNA 5HF5A 5BWBA 1DT5A 3V1LA 1E89A 4CIAA 3EQ9A 3IDAA 1CR6A 2XQFA 4J0IA 4C4ZA 2V96A 4B9AA 2ACKA 2B4KA 5AM3A 5FUMA 1Y7HA 2IITA 3HACA 3IB3A 4PSUA 4ZRDA 4A5SA 5AM5A 1U65A 1XLVA 2WUDA 3E3AA 4G8BA 1Z68A 5BV7A 5E4TA 1YAJA 1ZIYA 5HK9A 4B85A 5LZ4A 4ARBA 2XDWA 4FFVA 3E1GA 4KYVA 2YASA 4Y2SA 4KAFA 2ZJ7A 1YS1X 3SWWA 4PO3X 5H3HA 5CXXA 1IUNA 3I2JA 3QITA 4ZWNA 5AOBA 5FP0A 4F60A 3GELA 4Y2XA 4UHFA 3WKAA 4PQEA 4J7AA 5JAHA 3E4DA 1U2EA 2Y6UA 3GA7A 4K2AA 1XROA 5DJ5A 3FBWA 4HAIA 1XZMA 3RK4A 2C0PA 4ROTA 3ZLUA 3W06A 3JW8A 3I2IA 4QDUA 4OB7A 4FWBA 4GDMA 4WY5A 2ZYSA 4CG1A 4W1RA 2XI4A 2XUPA 2XUOA 4P92A 4XJVA 1QIEA 4FMPA 2I03A 3VISA 2VF2A 3GFFA 2RHWA 2OCKA 1SFRA 5HQ3A 3O4JA 5FLKA 1XLWA 1UXOA 1CQZA 5KBYA 1GT6A 1BEZA 5F4ZA 3FVRA 3S2ZA 2PSJA 1EHYA 5ISMA 2OGSA 3LIPA 3QBJA 1BEEA 2WIGA 3EIOA 3G0IA 5AOCA 5DYYA 4GECA 5ALOA 4HTAA 2HU5A 1UOPA 3R3YA 1K8QA 3T52A 4AO8A 1QGED 1CUAA 3FNBA 5CH8A 3WZLA 3AILA 3OOSA 4KACA 1PFQA 1SC9A 2B20A 3H18A 5K3AA 2XMDA 4BCDA 1ZOIA 3VXKA 2JGJA 2D0DA 1R3DA 2X8BA 3EQ8A 4CG3A 2HADA 4LXIA 4ARAA 2VJCA 2C5GA 4W1QA 3ZWQA 1TCBA 1P0PA 5JAOA 5LKRA 2XMQA 3QPAA 4L9AA 4QEKA 3HJUA 4NZZA 1XZHA 3I2HA 3JYHA 1CUGA 1W4LA 5C8XA 3Q8WA 1DQZA 5I9IA 5JZSA 5CT8A 3D59A 4YX9A 4KEAA 5A2GA 3DEAA 4WFIA 5AKHA 2OGZA 4G4IA 2CMFA 4TPKA 5CH3A 5K5EA 2W6CX 1YSCA 2GYUA 3STWA 5AI5A 4BE9A 3MUOA 4PV7A 5A7FA 5DYTA 2ROQA 1W75A 2XUQA 2EEPA 4Y2QA 3QVMA 4FTWA 4JYMA 2V98A 3WKDA 1HLGA 4J03A 1IVYA 2VQ6A 2Z5GA 1FFBA 3BWXA 4BP9A 3QZUA 5EI5A 1CRLA 5ALYA 5EHQA 2OXEA 4Y2VA 1FFCA 2WJ6A 4UUQA 4Y2RA 4M0EA 3QPCA 2ZYIA 3TRDA 3PF8A 4DMFA 4V2IA 4UHEA 1QTRA 1K4YA 2J3DA 1ETHA 3WMRA 4G5XA 3DOIA 3A2NA 2RI6A 1BROA 1TAHA 4X92A 4BCBA 5FV4A 4UHBA 4LXHA 5LYYA 4IH1A 4LXGA 4OCZA 1HPLA 3AIOA 3WL6A 1L7RA 1UK6A 3ESBA 3R41A 1Q0ZA 3VJMA 4ZREA 4MWSA 3NOXA 3R3VA 1XQYA 5HF6A 3KD2A 1CVLA 1A8QA 1WB4A 4F0JA 5FOQA 2PBLA 3TGLA 1UOOA 4G9GA 5K3BA 4P93A 4IH4A 1GPNA 4C6HA 3VVLA 1JT2A 2WUEA 1XZBA 4UHCA 4DSAA 4XVCA 1DWQA 5IVIA 1SCQA 1EXWA 4G8DA 5JASA 2B61A 1R50A 4DMCA 5JZBA 4BP8A 4X95A 5FXMA 3EQ7A 4N8SA 4ZV7A 3DDUA 3AUKA 3NGMA 3PICA 3B5EA 5JZ9A 2RHTA 3WK7A 1BE0A 4J0KA 1NX9A 4DSZA 3M82A 4AXBA 1JKMA 1ZD5A 3PI6A 2ZSHA 2PVSA 4GW3A 1Q0RA 1E8NA 5JAPA 2R8BA 5IVDA 3WLAA 1C7JA 2VT7A 4EZIA 1EA5A 3W2TA 5CH5A 2V9ZA 4E14A 2NW6A 4W9RA 2HRRA 2J4FA 1DX6A 3H17A 2OG1A 2WM2A 1P0IA 4X6YA 1NU6A 4K6GA 4Y7DA 4UBIA 4G1FA 2I3DA 3GUUA 4X91A 2OPHA 3HC7A 5D7BA 3BXPA 4L3WA 1JMYA 3WK4A 1IUPA 1JJIA 1QO9A 3G0DA 3H2KA 2JIDA 3C87A 3DYVA 3ICWA 3OM8A 4I4CA 4OUKX 1EX9A 5JD4A 4GBGA 4H7IA 4AZ3A 1DU4A 2H7XA 4JH0A 5BWCA 4JNCA 1Q84A 4QWWA 5LZ7A 1LPBB 2OCGA 2WJ3A 1WB6A 4FLFA 3ESDA 3PF9A 2PSDA 1XFDA 2BGNA 4A23A 1CUCA 3LIIA 1WM1A 5AI0A 2I78A 1BN7A 1KEZA 3DYIA 4H7HA 4I3FA 3D7RA 2FUKA 3WYDA 5AM4A 3FLAA 2H7YA 2WG2A 1WPRA 3AIKA 1FFEA 5C7YA 1VA4A 4LHEA 3GZJA 5HCUA 2DSNA 2DHEA 5AKJA 5ALZA 1ODSA 3KOOA 4X97A 1VLQA 2GYVA 1HDEA 2CUTA 2WHQA 3LP5A 5HKAA 1XKLA 3I28A 5AK5A 3ILSA 3P2MA 4GI1A 4N5HX 3STTA 4E15A 2X76A 1XQWA 4DNPA 3AZOA 5CT5A 1VE7A 1AC5A 3C45A 4RE6A 4XX1A 4H7KA 2JBWA 3H19A 3WWCA 4DMHA 2XUHA 4BZZA 5AKYA 2Y6VA 3DNMA 1Y37A 1XRPA 4BTVA 1CIJA 4KJXA 1W1IA 1ZD2P 3I6MA 3AJAA 4DM7A 4Q05A 1LPMA 5HFAA 1DTEA 1QIKA 4FNMA 3WWOA 4UPDA 2XUAA 1BCRA 1D07A 4B0OA 5LZ9A 3JWEA 1OXMA 3RARA 5CTAA 1J2EA 3ANTA 1THGA 2QVBA 1MX1A 3KWFA 1MT3A 1XZJA 1BS9A 1USWA 2JEZA 3PE6A 2C58A 4QDXA 1MO2A 2QS9A 4ZI5A 2AJBA 4EA6A 2QZPA 3BIXA 2ZJ6A 2GBIA 4N8EA 1BCSA 5AIAA 1AURA 5AO9A 3RLIA 1F6WA 4MXDA 4M0MA 5K3FB 3A70A 4OU4A 1JMKC 5T4EA 4BVKA 4KR0A 1OILA 1CPYA 3IUMA 4BC0A 2LIPA 2O2IA 5CT6A 3FAKA 3CN7A 3B12A 4AX4A 1BN6A 4L0CA 2DHCA 5EFZA 1LPPA 1H23A 5BOVA 4EY6A 1XZEA 1EDBA 1UKBA 3KWJA 4OU5A 3BF8A 5FPPA 3N2ZB 4B80A 3TEJA 1CFJA 2AJCA 1AGYA 2G5PA 1QIMA 1C4XA 2HIHA 1F8UA 1QIJA 2X5XA 3KSRA 5ALWA 2JEYA 3W9BA 2HA3A 4WJLA 1QIGA 3IVMA 4KAAA 3CXUA 3G0GA 1A7UA 1XZIA 3HLKA 3MUNA 1GQRA 5LZ5A 3VDXA 3R3WA 3ZPXA 1G5FA 1CEXA 1JU3A 1XRRA 3WWDA 1PJAA 2I3ZA 3G0BA 2GBCA 5DWDA 4UFPA 3WJ2A 1ZJ4A 3R3XA 2BJHA 5K3EA 1SCIA 1X70A 2Z8XA 1P0QA 3PDCA 1UK8A 1XKTA 2G5TA 4FDMA 2RAUA 3G9TA 3IURA 2QT9A 4B9EA 1WHSA 2XUJA 3DL4A 1N5RA 4NMWA 2QMQA 3GROA 2ZYHA 1CUHA 4I19A 4Q3LA 4FNGA 5JIBA 1HKHA 3FYUA 2VJAA 1WB5A 4FOLA 4X85A 2CZQA 4AMZA 3L1HA 2AJ8A 3R3UA 2QM0A 5KWIA 2ECFA 3H2GA 5ALVA 3I2GA 3O4HA 2QRUA 5IVKA 1UKCA 4Q1VA 4DLNA 2VATA 2Y1KA 2RGUA 4QLOA 4RE5A 5CXUA 3WK8A 3WYNA 2G63A 1ZI9A 1BRTA 3HSSA 2YXPX 4J0DA 1QJ4A 3DQZA 5LP1A 3QMWA 4UBMA 4BB0A 3WK6A 4CFSA 1A88A 4CCYB 2VAVA 4EBBA 2D5LA 2OCIA 1QZ3A 2WIJA 1ZD3A 2O7RA 2XMBA 1LGYA 1E5TA 2B9VA 1LZLA 3ESCA 5J3JA 5E2IA 1TCAA 3VJLA 5CT4A 3K2IA 4HVTA 3F98A 1P0MA 3IUQA 2VJDA 2WU4A 3BIWA 3C70A 3RM3A 3YASA 2WSLA 2GZSA 3OPMA 2DR0A 4B83A 5EIAA 5FRDA 5SYMA 3W05A 1O6FA 4OYLA 2OGTA 2HDWA 3LLCA 1LLFA 1CUBA 4AQDA 2OAGA 1QFSA 1WHTA 1HQDA 5DNWA 4Y2YA 1A8UA 3G8YA 1WOMA 4J0JA 3BL8A 3IULA 4BATA 3IUJA 2HRQA 2PU5A 1W76A 2EDCA 2Y2VA 4PNZA 2WHPB 3C6YA 4H7DA 1S8OA 4M0FA 3NWOA 4UBNA 4X94A 2WFZA 2JGMA 3PFCA 4J3JA 4RGYA 1LZKA 5CT9A 2PSFA 1QFMA 1K63A 1YS2X 4UBOA 3WIBA 1E66A 2HA4A 4UBJA 1LPSA 1LPOA 1TCCA 2IIVA 4OB6A 1QOZA 4CIBA 4O08A 4WDQA 3ICVA 5D6OA 1DX4A 1X2BA 4X3CA 1XRLA 2WFMA 1CQWA 5EIEA 1BU8A 5A62A 4K6HA 1VJ5A 2WFLB 3K9BA 3CCBA 3EF3A 4KRYA 1DT3A 2JF0A 5JATA 2QTBA 3ED1A 1OCEA 1LNSA 3HYSA 5CURA 1ZI8A 3D5EA 4HS9A 4QLAA 2PPLA 4N8DA 3L1JA 2ZYRA 4BE4A 2AXEA 4PW0A 4MYSA 2XE4A 4FHZA 1E8MA 1ACJA 1XQXA 3OG9A 5AK3A 4H7EA 2HU8A 1R1DA 3WQHA 1W52X 3H1BA 4DTCA 4ETWA 5AKLA 2BFNA 7YASA 2XUIA 2DHDA 3N0TA 2FJ0A 3IIIA 3SX4A 4K5QA 2ZJFA 1CUXA 4N5IX 5ALHA 3D0KA 5A6VA 1R4ZA 5A7HA 4W63A 2PSEA 3AZPA 2HM7A 3WWEA 4DIUA 4YPVA 5AI8A 5AIBA 2BAGA 1LPNA 3HZOA 3F97A 4Y2UA 2YYSA 3WWPA 1EI9A 5AI4A 1JI3A 2UZ0A 1ZI6A 5CRIA 4B6GA 5ALQA 2VT6A 5DTIA 2ACEA 4INZA 3C5WP 3KDAA 5K3CA 1U4NA 4G4JA 4G4GA 2QUAA 3I1YA 1A8SA 3WKCA 2E3JA 3O0DA 3FYUC 4S0XA 4MEAA 4Q3KA 3O4IA 1XLUA 1GGVA 1ACLA 5C8ZA 1EB8A 2JGIA 3HRHA 5ALDA 1CUZA 4KE8A 1FFDA 5JADA 2GBFA 5AI9A 1CLEA 1SCKA 1G66A 1XZGA 2XMGA 1UT6A 1AZWA 4BC1A 3BDVA 2QKYA 3CCCA 1IMJA 5JD6A 4EB0A 4X90A 5AICA 1MNAA 2OAEA 5I8PA 4UBKA 1MX5A 4U2CA 1CUFA 1LPAB 4PF1A 3V1KA 5DLPA 4J0HA 1AMNA 3FSGD 1Y7IA 2XT0A 3C8HA 3V1MA 4UFNA 5AKKA 1AKNA 5LKAA 1WCYA 2WUGA 3MGAA 3BJMA 3DL7A 4IH9A 5IVHA 2GBGA 1XZAA 2ONCA 2QJRA 4D9JA 3OTQA 3DLTA 4H0CA 5IH7A 3F8SA 3S8YA 1QIDA 3D3NA 3QMVA 1VKHA 5DNUA 4BRSA 5EHXA 5DNVA 5T4HA 1U8EA 3WKBA 3FLEA 3DCNA 5YASA 5AM2A 1IZ8A 1LBSA 4UHDA 1H2YA 1M33A 5ALNA 1TRHA 3FYTA 2WIKA 4A16A 1T4MA 3C6XA 4H35A 5LIPA 1MN6A 1DWPA 1VXRA 4OB8A 1QONA 2XLBA 1UK7A 2BUCA 1IZ7A 3T4UA 1TK3A 2JGEA 5SYNA 3Q0TA 1J06A 1DWOA 3I2KA 2HA6A 1MPXA 3A6ZA 4Q34A 5KREA 3L1IA 1XRQA 1ZGBA 4H7FA 4NVRA 4WY8A 2IX9A 1QIFA 3C6ZA 3H2IA 3WK5A 1FJ2A 3WA6A 3VKFA 5CMLA 2XMZA 2WG1A 3HABA 1CUEA 2HU7A 3PFBA 4B7ZA 4HRYA 4AZ0A 4CCWA 4WFJA 2PM8A 5T4BA 4W1SA 3ANSA 5HQ3B 2VSQA 1JJFA 4AO6A 2W22A 3RKSA 2BUAA 1TIBA 2QJWA 3H2HA 4K6KA 4BAZA 1UFOA 2ZVDA 4UHHA 3M81A 5D3KA 4QDOA 4JUIA 4RNCA 1CUSA 4AMYA 2RONA 2VAXA 1YB7A 4FFWA 1XQVA 3F96A 2WIFA 3D2BA 4FBMA 4OPMA 1KU0A 1B41A 2XMSA 4QNNA 2H1IA 4GHWA 1ZGCA 5HFNA 1AX9A 4ZV9A 4Z49A 3G9XA 3X3HA 5JANA 1ODCA 4YK7A 4BVLA 2O2GA 5HZGA 4G8CA 1XZLA 1H22A
chains in the Genus database with same CATH superfamily
1Q3TA 5KJ6A 1UM9B 4YRAA 2I2WA 2YNMC 4QTYA 2YFYA 2XWBF 1QMPA 1G20E 2VQSA 4DKJA 2FW8A 4MQLA 1X92A 1BXGA 4NS4A 3KQHA 4NOJA 5BSHA 3GBSA 2C1EA 4NBSA 4Z0TA 3ZJ5A 1SG6A 1IYZA 1F17A 4Z7JA 5BNZA 2ZR0A 4MVJH 1N8NA 2C29D 4XA8A 1FP7A 1NVXQ 5EVJA 3UWMA 1NQ5A 4BBZA 2PZAA 4YASA 4DG8A 5AP9A 3L0YA 4FFDA 2J5KA 3I9JA 4C1BA 4BYGA 5AHKA 4N5DA 2X5NA 4R69A 4RTKA 1S02A 1W6UA 2HJ9A 2PTHA 4NXNB 3W5IA 4UU7A 3AVTA 4RK4A 1T9HA 2J0QA 2DUWA 5FA8A 3HJFA 3G6KA 3HN7A 2QU8A 4WEOA 1ZVVA 2UZ1A 1ZH6A 4GH5A 4GPIB 5CCDA 3OPQA 3RRBA 3SDSA 1N9GA 3EJWA 5A04A 3QKSB 3I92A 5MHTA 3SX2A 2G80A 3JXEA 1K9VF 2GZRA 3AH8A 4Z4GA 1EJ0A 3LECA 3JQ7B 4ZGWA 1RZVA 1RI5A 1T1RA 1GQYA 1V6CA 1CWUA 4PFQA 3UAGA 4JQOA 1RAFA 4O8ZA 2QL9A 2ZG6A 3OM0A 3OY2A 4DWOA 2H48A 3FSGA 1K06A 1M0SA 5CB4B 4A82A 5CD9A 4PCVA 4PNHA 1VDMA 1W0KA 2JA2A 1EK6A 1TD1A 1GGHA 4WDRA 5LB2A 2TMYA 1BQ3A 4MVJP 6ABPA 1YAHA 3GFVA 3FROA 4ALKA 5E0OA 1FX1A 1YA4A 2H59A 1Z9BA 3FZEA 2L82A 4C2UA 1T5SA 4B3DA 1LY1A 5LZ2A 4CGYA 3CZQA 4FZ3A 4X66B 1FLVA 2FGJA 1IUKA 2YINC 3D7NA 4RFLA 3RFFA 2CMHA 1K9SA 4KN6A 2L2QA 3AHHA 3BWYA 1UPCA 3GX1A 4IHAA 2YRWA 3C3YA 3JD3A 3CLKA 3LV8A 2PV7A 2PL9A 1R88A 2WMNB 5LXTA 1NOJA 3JD4A 4ZO6A 4LY0A 4Q00A 4DN6A 4OLFA 4R4JA 5FOUA 2X4DA 4RTMA 3A6DA 4YO7A 4TRMA 2QXYA 2NYAA 1DTWA 5T3YA 3V7FA 2V7UA 3BL6A 1X7XB 3QVLA 4C87A 5IDWA 2X14A 1YQTA 2CNLA 3PXGA 1EP3B 1ARZA 1SC6A 3OX3A 3MTBA 4KDRA 4B32A 3DEIA 4ITVA 4ZEXA 3C3XA 2C3UA 4KXMA 1GPUA 2Q5HA 3WGVA 3KSZO 3TM5A 4QDJA 3DD1A 1AA6A 4LHZA 1Z63A 1GKLA 1KK0A 3KQSA 4CI0B 4G97A 2QNRA 4HB4A 1N2CB 4XIIA 2D7CA 1Q12A 5KTRA 2XBMA 2I3BA 5G02A 3EEIA 3HUTA 5DVZA 3R7BA 4EYOA 4RS3A 5ILQA 4RZQA 4I4NA 2H5LA 4FKBA 3C7DB 4FONA 5ALKA 4DSUA 2ASEA 6REQA 3PNLA 4NPCA 1G3QA 2PMEA 3ZXIA 3B9RA 4OQXA 1DO8A 1CRQA 1G8SA 1WXHA 1KHTA 2CLFB 1DQRA 3QYAA 4J75A 1KZHA 5IABA 3DPUA 5AVXA 1L1EA 3F3KA 2ZR7A 4PFKA 1CUYA 4U2GA 2WE7A 4KOEC 1JR6A 3CKYA 5C34B 1T2AA 3HI4A 3BFPA 3DUWA 3HSKA 4PAGA 2IZ5A 1CD5A 2ES4A 4X93A 1UKEA 1NTRA 2ORYA 3ZR4B 4EG0A 4GQAA 2FWNA 3UA3A 3KSAC 1AKUA 4IQFA 4L6IA 2RHHA 5KHOC 3C8UA 2WWYA 2AJDA 2EOAA 4MQEB 4LOHA 5F33A 1ZDMA 2OEPA 1ZN9A 3ZWDA 3QEBZ 1HDIA 1U8XX 2GAFA 4D8VA 3DKRA 2OP0A 1BMDA 1RMQA 1GV1A 3H9CA 2PMFA 2IS4A 4PG7A 2CDRA 5IJXA 1X7ZA 3ILVA 1JJ7A 1RHUA 4J0CA 1MRNA 1U4OA 2H1VA 3O7MA 4JVSB 4WTOA 1T8PA 1ADJA 1G4HA 5EUBA 1ANKA 4XI9A 4U2BA 2DFDA 2XOEA 2IYEA 2JGNA 2R7KA 4NARA 5CVDA 1EK2A 2YVKA 3ADOA 4RU1A 3CX8A 5EMNA 1PV1A 3UHPA 4DL9A 2CB9A 1II8B 1P0CA 4O4IF 4LRSB 2ZAGA 3T0GA 4JXJA 1TOAA 4WXYB 1OYYA 3IUEA 6YASA 5AVWA 2DPYA 3GVCA 1C1YA 1YACA 4YJDA 2XX3A 3DWIA 1T43A 1UPBA 2VNAA 4TN1A 4EI2A 3CLRC 4KB5A 2P35A 2FDXA 3RUIA 4BFWA 4BLPA 4B40A 1N5MA 2IEDA 3K0FB 1EQUA 1G42A 1CY4A 1Y1KE 1Z6AA 2NZVG 1QKKA 5K1ZA 5TEVA 1KE1A 4TXLA 3U4HA 3W2EA 4DF3A 5HBGA 4JB3A 1CC1S 1YVDA 3HFSA 1DUIA 3LY7A 2YFQA 4JZKA 3JQRA 1JFVA 5FUYA 4LJKA 2KHZA 4YV2A 1QRRA 2IS6A 3AV3A 3V33A 4Z9FA 3PSHA 1YTLA 4TWAA 1S3GA 4JWKA 3PVCA 3TTSA 1IN7A 4YMUA 1DX9A 1T5HX 4JBHA 2ZT8A 3CEPB 4JJKA 3RR2A 1ZRMA 1OIVA 3NTUA 1Y9JA 2C1XA 4NDZA 4UVDA 2X6RA 3W5VA 3JPYA 1U0SY 4JXXA 3D2CA 3Q2OA 4GOXA 3SM3A 4JLMA 4DJTA 1U98A 2CNBA 4N6NA 3LA6A 4DXDA 3OEEA 1KSGA 3I6ZA 1KQGA 5E1MA 1H4VB 4CWAA 2WKWA 4KKVA 1JAYA 3VA7A 1YDGA 1GRRA 2PUHA 1H2ZA 2C9MA 3BE8A 1UZAA 2V6FA 5AKXA 2ZIEA 5ALTA 5FI1B 3AB3A 1DRJA 3WYGA 4YRRA 3GGJA 1AGRA 3N53A 3NT4A 5AKGA 3LT4A 3NOVA 4LGCA 3ZE8A 4EK9A 4CLOA 2XH8A 2OXFA 1T9DA 3COPA 1KIAA 2P8SA 1V1MB 1NLUA 2B0CA 3FIUA 2GDZA 3O9MA 4N0QA 3T3GA 5BUCA 1F2UB 4PYKA 1O03A 2L17A 3GLIA 3PDIB 1YJAA 2UUCB 3DEYX 2ZTHA 4NU0A 4RPHA 3VOTA 2O48X 5JCPA 2V65A 3N39C 3LDHA 4OGGA 1ORVA 2GN6A 2NU7B 3BD7A 4QYXA 5AKEA 5T57A 4A6XA 5HUQA 4HMPA 5DM2A 5LMUB 5E6RA 1Z3CA 2HYDA 2YZKA 3RTGA 5B2ZA 1USKA 1M8JA 1VA5A 3OLZA 2AOTA 1NBMD 4Q9KA 5T4FA 2GEKA 3UUGA 4AS2A 4MKRA 4KWEA 2EX4A 3OCYA 1H1TA 3J7AC 2PKEA 1TUEA 4E7OA 2MT9A 2IE0A 3PZBA 2KLBA 3HY3A 4LUCA 3HFJA 4FQ8A 4OH1A 2HMSA 3K6KA 5DLQC 3MMPA 3IVRA 2AJLI 4I1PA 1IQRA 4DMGA 1QZZA 3WK9A 4YUZA 1YRHA 1Z0KA 3L8DA 4UM9D 1EP1B 3MCAA 4G1EB 2HK7A 3OX4A 3TPFA 1QE3A 2X8JA 3FHOA 3SS9X 1CJVC 3UK2A 5AT1A 2RCYA 3NWEA 3ZBPA 3DLAA 4DYVA 2FP4B 2H3HA 3KHKA 1WDTA 3R7LA 5B4UA 4Y9SA 5FF9A 3SOPA 3TWOA 3ON5A 4F72A 3NCTA 3ETGA 4HVLA 4ERXA 3N8HA 1MO5A 3A05A 3KUXA 3GP3A 3ASYA 2ZETA 3BDIA 4IS2A 3Q98A 1CZKA 4KFRA 4DNOA 3F7OA 1T15A 3JARA 1QDEA 4D8WA 2GAJA 1UBSB 5FI3A 5L40A 3LUDA 1ZD1A 2HSGA 3B51X 4Q39A 2WIDA 4GOKA 4U0KA 4OXIA 4D6YA 1L7XA 3M0EA 4XQGA 4DRXB 5LMNB 1A2QA 2FB9A 2WLTA 2PMKA 3ITEA 3DFMA 3K5WA 4TLBA 3KELA 4FK8A 1OLUB 2IH5A 5DCUA 3TOCA 1LQTA 2VNJA 2DR2A 5M7EA 1HSZA 2N0SA 2R7LA 2NYVA 3T1NA 1QVWA 1C1XA 4LHSA 4PTZA 1QHGA 3KVYA 4BL5A 1WP9A 3ZG6A 3ROPA 1VPEA 4OSEA 1C41A 3E82A 4LF4B 1TKRA 3IMKA 1B0AA 2WG0A 4HXFB 4JLUA 4K05A 1LU9A 3HVIA 5DOVA 3COYA 3HB4X 4H3KB 2NQ8A 4MGKR 3MG9A 4RVFA 4YP7A 1OTYA 3K31A 4IDBA 3JAKB 3QEAZ 1MT0A 5DRYA 4F21A 1RWQA 2R11A 3T61A 3HV0A 4U7HA 1M34A 3OZEA 5FFFA 4UTPA 3QTTA 3EE6A 2NPOA 4PX2A 1FDRA 2GEVA 5ALMA 5A1TA 1C9MA 1G7TA 1UBNA 1RQRA 4ENPA 1XN4A 5CDTA 2VTBB 4D0LB 2O0HA 1GYQA 2R2AA 1OH7A 4XKJA 1DCKA 4XVUA 1WQ4A 1MDFA 3SK0A 4DGSA 2JFHA 4F9TA 5THXA 2VC2B 5L6LB 4XLZA 3MJTA 5JS1A 2XXAA 4G4SO 1ZMRA 1TZCA 3RRNA 4C14A 1MOZA 1ULAA 3TZKA 2QQGA 1SCDA 3WMXA 4JENA 1LTKA 1HDZA 4JJ8A 4E4RA 4JLVA 1SOVA 5FQNA 1UP4A 4ND6A 4DDUA 5CGZA 1PUJA 2IH2A 1WCIB 2A9JA 3D6JA 3I1FA 5AK4A 4FYKA 1JLRA 5IU6A 1G5TA 3LXXA 3IUBA 4URWR 4DR5B 4WZBB 2F48A 1J8DA 4TWBA 2WVJA 3FPCA 4OFWA 3WLEA 3MD9A 1CEQA 5KVVA 2NZ2A 1TK9A 3OC0A 3QVKA 5LLSA 1ZNZA 1KARA 1KAOA 5AOAA 1V8FA 3EMVA 4DEXA 4N1AA 5HK8A 4WN9B 3TSAA 4AYWA 3EUFA 3VNBA 3RBAA 1T4BA 4N48A 4Q4HB 3GGOA 2AQ8A 1LFDB 1XTSA 1C5KA 2KBFA 3C1TA 5JMTA 1E6EA 4W8OA 2OFOA 4ARCA 1I36A 3TEFA 2LRHA 3H3JA 5ALPA 3BBLA 4LG1A 2RBEA 1G5HA 1MIOB 1T29A 2V5VA 1FVXA 4Z7NB 4M1MA 3N2GB 5HF8A 5E38A 3WZMA 2ZRJA 3FTCA 3L7DA 4FNAA 3R24A 5A0FA 1VMIA 2E6UX 4RSGA 4FN4A 4Q66C 3G5UA 4NCXA 5IXSA 1F0KA 2FPGA 4DLUA 5DE3A 3S29A 2GCGA 3QMPA 4IDFA 2P6RA 4NDAA 2DQSA 1YVRA 1J5XA 1U9JA 1JEAA 1C81A 4HB3A 3IC5A 3W1WA 1P61B 1YR8A 1I8TA 3WR5A 1FJXA 3IGFA 1BXKA 1FP4B 1NBEA 1NRWA 4RLSA 4EY8A 3BE6A 5M34A 2PMWB 4LVCA 3N2LA 3U7JA 1ZLYA 4RORA 4RJJA 5DULA 3ZOZA 5AJHA 3HP1A 4WNIA 3TMAA 1BCRB 4AECA 4R71A 2ZDHA 3IDSA 4Z6KA 3PQ3A 2I76A 5I7FA 4X71A 4K8OA 1BH2A 3ZDFA 1NURA 4EMTA 3HJTA 2IIPA 5JI3E 4J16A 5FKJA 1ZU5A 1OFIA 3HDYA 4LZOA 2GTPA 3TW6A 2H9IA 3U62A 2AZMA 2ZSKA 2RH4A 1AKVA 1P8AA 4O4HF 1OF1A 2R6GA 1NNLA 2FCRA 1ZCBA 3WLIA 2QK4A 1DJLA 4QJBA 1RBZA 1YGPA 3WJAA 4GXQA 2DBRA 4PYLA 1Z0UA 5E4FA 4EY4A 3I09A 4B0PA 1OFHA 1NPDA 3NEPX 5F78A 4CJXA 1ZGGA 3HP4A 2OBNA 2QRVA 2QSJA 3HPRA 1C30B 2R0QC 1C7IA 1NJ1A 3PPXA 5JAUA 3MRVA 3FRJA 2G09A 1AF7A 5TE9A 3V4ZA 1Y7PA 1YJ5A 4RCYA 1BCSB 3PWZA 1IK6A 4QUIA 4MQUA 2PUDA 3U1VA 1T2DA 5G2OA 1U7UA 3FYDA 5DXJA 4WACA 1A98A 2HL6A 4X63A 4IQ4A 1XZ8A 2DBZA 4NV0A 1Z07A 4HR7A 3USES 4IQ0A 1LSJA 5ED4A 2XGMA 3OO1A 4L4ZA 2O54A 1QH1B 2JAWA 3KJXA 4DT1B 4D3XA 2PLNA 4LSWA 3HK2A 3H84A 1J23A 5BQFA 2XUKA 3LD9A 3FFAA 2A5LA 3WJ1A 5J2TB 1T8WA 2FWPA 1GKIA 3K96A 4PXYA 2C07A 2CLOB 3I73A 3KOWA 4GLBA 5BQOA 5ARBA 3P5BA 1OX4A 1K5DA 1AK2A 3EBPA 1UDRA 3CLUC 3D1VA 4QU8A 4UNQA 5CK5A 5FBLB 3LCRA 4Q4JA 4WCVA 1VZ2A 1AV6A 3LUJA 4WFKA 3SCZA 1REQA 1I4EB 4R7TA 2WYIA 1OFUX 3CN9A 1NX6A 3I5MA 5D3QA 2Q28A 1NBMA 5IDYA 4ZMSA 5FWXB 1CVIA 4MQ5A 2LZ0A 3QHAA 1CJBA 1Z4QA 1E60A 3SVLA 3LNCA 3ZGOA 1I7NA 1RFGE 2SNIE 4KMRA 1J7KA 4FMCF 4O2BA 3DAFA 4WAUA 3M9WA 4JEIA 3RROA 1PIWA 5BORA 5FX2A 3TLXA 4ZOEA 1ODKA 3STVA 2FZCA 4G37A 4WECA 3R5XA 1U7PA 2C4WA 1JVSA 2O1XA 2XMRA 4NSNA 5ALIA 3LVQE 1TAQA 1M1XB 1NW8A 5IJ0A 5IAJA 3WLQA 4CF3A 1TTPB 2YWBA 3O7WA 1T36A 5DNAA 1JG6A 4F3KA 5JYCA 5LQDA 5IT4A 3F90A 4IY1A 3KLBA 4TV9B 1IOZA 3GA5A 1R4AA 5EUCA 4B45A 5LZ8A 4R2JA 1Y4SA 1GKKA 4CIDA 5M04A 4ZO9A 1KAMA 1W4CA 2E2WA 4B1FA 1G2IA 2B83A 2FR0A 5KNLA 1DWUA 2D0PB 3P8ZA 1YR2A 4HGOA 1W96A 2HFKA 5BMVB 4DYDA 4KFCA 3H2JA 5BWMA 1QG6A 4FIZA 4GSLA 3I05A 2W2TA 2CJPA 2QTZA 3GRPA 4LRQA 5DGDA 1QP4A 3NONA 4P86A 3DNPA 3CIOA 3RAJA 4EJSB 5DWQA 3ZDXB 1JZTA 4DQKA 5TT1A 1XMJA 3A3PA 2PL5A 4Q3OA 4W8HA 4CMIA 2BKXA 1J09A 1VJCA 1Q7EA 2LCIA 1DDIA 1K7CA 4QZVA 4PZAA 3GJZA 5I48A 3DFIA 1QO0A 4H18A 4D9HA 3K0AB 1JA0A 1VE1A 3G89A 4BWYA 1DOHA 3K9WA 3MAAC 3TCNA 3KYCA 3ZS8A 1AN0A 1F1BA 1QIIA 3C4JA 3HY6A 3KJEA 4JIMA 3R0VA 4RL4A 2I8CA 2G9RA 4TWRA 3NIGB 3GRFA 1H69A 1BKYA 2OQIA 3IUNA 4TRNA 4ZMRA 5CA1F 1CQXA 2AMLA 1UDBA 3QKRB 5KSOA 2PWZA 1GGJA 2H9YA 1YDFA 5MN6A 3G5AA 3DLBA 4JDUA 4NC9A 4DG9A 4TUYF 4JQYA 2HXSA 3QPDA 4QATA 3CLUD 3DEFA 5IANA 2Q45A 3ABIA 1M2KA 2ZIWB 4PC3A 2BI4A 1ESDA 1K6EA 3HKEB 5EP3A 4EO7A 5JV5A 1O6GA 3I34X 1OJLA 1WHSB 5ITWA 2FW6A 5FDFA 5TDHA 3T3PB 1BFUA 2CMDA 4BNYA 1SQ0A 1YULA 5AXDA 2XW6A 3RVMA 5J2UF 2WQZA 3PNYA 3P27A 3SEFA 2OORC 1YS4A 5THKA 2D3TA 3OZWA 4JJZA 5CVVA 1A7AA 2HA0A 3R5HA 3K8OE 4PAQA 3TIXB 3ZJYA 5GADl 2O8CA 4GEKA 3V4SA 3CZAA 1Q50A 4G84A 5JEDA 4Q6BA 5JZMA 3K30A 3DR3A 2EG9A 4OQDA 2DMRA 1MX9A 1A1VA 1PGNA 1X80A 4BEBA 1JHQA 3PD0A 1UWCA 3HB5X 2CYAA 1EEXB 2GHQA 3TG8A 3QM1A 3CPEA 4F5YA 3FYSA 3SYKA 4U2DA 5AW7A 2PS9A 1QVRA 3GG2A 3AFOA 4IFBA 4B44A 4HXGA 3AR9A 3TINA 4BU1A 3HGMA 1GA6A 2EQBA 2BCEA 3T3HA 2GQ0A 2C77A 4CMAA 2MSDB 3O8BA 1TMOA 3KAQA 2FEAA 4DIFA 1JG4A 1KAQA 1HQYE 2A88A 2ZJ1A 4OM7A 3GPBA 3M6MD 3SSAA 3IAAA 4JYAB 3DULA 5DU2A 4ZOLA 3C7TA 5GQSA 2OB1A 3VR3D 2QDXA 3D1JA 2C4TA 3DE4X 2ZR9A 3OP1A 1QTIA 2RIRA 2QGFA 1B6GA 2GYYA 3MMSA 1NSTA 3FYHA 1VSVA 1LS6A 2DQYA 2B21A 1YB1A 1AE1A 1JU9A 5TVKA 1XJQA 3WB0A 1LK0A 2JLXA 1EEHA 1E2HA 1MVOA 3JASB 1KH2A 3FWHA 1OI3A 2HBRA 3BRSA 4IXWA 4PIMA 5T6MA 2UYQA 1B76A 3JWHA 4QIHA 3TLCA 2A1TS 3KT0A 4JKYA 3HKCA 4WNAA 3L7AA 1GA1A 5JLJA 3FWZA 5LQUA 2RG1A 4QWMA 4E11A 3LC2O 1VIAA 2IEAA 4OHYA 2N42A 1H42A 1YJQA 4FHFA 3Q3VA 1CG6A 1EDEA 3O83A 2A9KA 4BKOA 3LYLA 5KTTA 1U31A 4J91A 4BVAA 1L3IA 2X9QA 1A9SA 1UOQA 2PXHA 2QPLA 1Z45A 4GL4A 4RKRA 1Z5PA 5IJ9B 1FUIA 1Z4KA 3L07A 3PU6A 5AM1A 4X6UA 1Z83A 1SAYA 3GEBA 1V5EA 2FU5C 3AFIA 4OKSA 4V0ME 5DW3A 5LA6A 3O38A 4DR1B 3GC6A 4NU6A 1KDZA 3S2EA 3FDXA 4N6GA 4IMJB 1Z2NX 2BZGA 2QM8A 3F3YA 3LX8A 2JJ2A 2ASVA 3OCVA 1R5OA 1UIRA 3T5BA 3RAEC 3WYBA 2J31A 3SSOA 2JFUA 2QVZX 2VXOA 1TIPA 4HEA1 5CLLA 2IQ5A 4JLDA 1OW3B 4O0MA 2H4YA 3EXG1 2H2IA 1ECBA 4AK9A 5CYGA 3I45A 5BWBA 1TT7A 4ENVA 3RV3A 3RSCA 4IGFA 1EQ2A 4QOEA 1UANA 3U31A 1XVLA 4DHEA 2HQOA 3M2PA 3GCZA 3H8WA 1IXRC 4XARA 4EHHA 3P9KA 4H9GA 4LJLA 4DV0B 3CZPA 3ELWA 3TKLA 3I39X 4C7XA 3O1LA 1CR6A 5J4HA 2VUTA 3FF4A 5KVSA 2DTEA 2J9YB 2XQFA 4QXAA 5GZ6A 2PJUA 1GCIA 1WR8A 4L7QA 2V96A 2ODPA 4DJDC 5H81A 1NMSA 2VRCD 1NMEA 5F1YA 5HOEA 5BNTA 2IC5A 2IITA 3HACA 1J8QA 2H9AA 3SYMA 1DC6A 3MLAA 3UMRA 2JFBA 2W71A 2FJUA 3AHGA 1EFPA 4ZTBA 3VJRA 5LC1A 5HGJA 1J21A 3OHSX 5AM5A 1U65A 1PR2A 1F9AA 1QGDA 4R2LA 4X1KA 5LR6A 3E3AA 2WTUA 2PYDA 1FXSA 3D31A 1Z2EA 1Z68A 3LW8A 1KDRA 5BV7A 4MHOA 3KT3A 2CDBA 5EQTA 4HAXA 3E4CA 3GLVA 1VHLA 1Y63A 4D42A 1M5UA 2YOFA 3L4BA 3CBQA 2CMGA 3TIGA 3ZHCA 1JG1A 5BN4A 4CTJA 2NN3C 3MTGA 4ARBA 4LXYA 1TU0A 1J0EA 2HDHA 1XI2A 4EYSA 4E22A 1P1FA 4R3NA 4Y2SA 2ZJ7A 2WAOA 1UOEA 5CDFA 2JFQA 4B73A 1K6IA 1Q44A 3TIVA 3A1EA 5JU6A 4RZHA 1GPH1 2AK2A 4EO9A 3LPMA 3F4BA 3IQGX 4I6JA 2B30A 3E5MA 4MB6A 3UKJA 1EUYA 1Q0SA 3QXJA 3ZV3A 3WWYA 2AMJA 3DOJA 1BDIA 2ZB4A 2AJTA 1U0NA 4ZCQA 1NRIA 3C6KA 3HL4A 4Y2XA 5HPYB 2PX5A 2I2AA 4UHFA 4EG7A 4PQEA 6ADHA 2HI0A 1M6HA 2BM8A 1Y0BA 2WA1A 1W0JD 4FXPA 4B76A 1HTTA 3U6BA 1BFDA 2EZ8A 3GA7A 1FUKA 2C7QA 2D2FA 3N0VA 4DSTA 1ODJA 1QAMA 3AKCA 5DJ5A 4U8HA 1DRVA 3EUAA 4F45A 4QEZA 5EHIA 1SVOA 3AKEA 4O4JA 3GZ4A 3UOWA 2UYYA 4FIDA 1Z5WA 1KI4A 4HDQB 4Q7MB 1Z4PX 3A4MA 1TM7E 2C3MA 2Q5OA 4F3NA 4FCTA 4ROTA 3H5TA 2IHVA 4GBED 2FFJA 1G21A 3DZ8A 3ZLUA 4BFSA 4IOJA 2BBOA 3IAS1 1KZ9A 3JW8A 5DI3A 4P7KA 3I2IA 4A10A 4YJ2A 1D7AA 1LLCA 3R23A 1V7ZA 4QDUA 1GVNB 4OB7A 3T94A 5I7VA 1EGMB 3O31A 2ZYSA 4URVR 5IDQA 2XI4A 2ZBVA 1DIAA 3OOJA 2Y0EA 1GTJ1 2BTOA 3DL2A 2C0CA 2MHCA 2ODNA 2WABA 4MVJM 4RD4A 4RO0A 3WIVA 4FMPA 1O0CA 3THRA 4BGVA 3EZNA 1GZSA 4OFZA 3VTKA 4DA0A 3C6QA 4GF5A 1WXXA 3J81A 3AU8A 4RA9A 2A0UA 2C95A 1C1HA 3UYLA 5HQ3A 4C3OB 1DC7A 4MR9B 3LX6A 4NYIQ 4L5BA 1UXOA 4YLGA 4PCLA 1O77A 1XEWX 1MVLA 5GPBA 2WTEA 1PV4A 5B37A 1KYWA 3EXG2 3RUHA 2C7VA 1FMLA 4OK5A 4EENA 1Z0AA 3A32A 1OI4A 3D0QA 2Q9AA 4NAUA 1I5RA 5K6RA 2FNAA 5MFZA 1E4EA 4JUAA 1V16A 4QGGA 2A9PA 3BMNA 1NYTA 4EUKA 3LFHA 3QBJA 3GD7A 4CQMB 5CA1A 1URPA 3N86A 2DTDA 2C00A 5KYXB 3AESB 1YGYA 3M5DA 3IPLA 1CU1A 3KHSA 5ALOA 3DOFA 3LNTA 2XITA 4HTAA 3K1ZA 1UOPA 1YZLA 5EGSA 1QGED 1TJ5A 5EJ7A 1CUAA 1SVNA 2Z4SA 3FNBA 1ZJWA 3KQPA 5CH8A 1Q92A 3UT5A 4B8WA 2RJNA 3OIDA 5FWYB 1S2GA 3HCDA 4KACA 4RLHA 1GZ4A 3UBMA 3KZKA 2B20A 4L51A 4LI3X 5K3AA 4BCDA 4GDFA 2O5EA 1ZIOA 4CZ2A 2JJYA 5BQXA 3RTBA 3CF6R 2D0DA 3EOAI 4BVHA 4WH0A 3EQ8A 4F1KA 1NT4A 4RFVA 3UJPA 4F9FA 3L8HA 2PFGA 3N1UA 2IP2A 4LXIA 5I4CA 1E9SA 1FTQA 2JIMA 1H2RS 5JYBA 3ZWQA 2PT7A 1OGJA 1AZTA 1P72A 1TCBA 2A1UA 4K88A 4XZ3A 1SCUB 5U1PA 3VR3A 3GLIB 2RGBA 1P0PA 3EC7A 1ULBA 5JAOA 2VS1A 1AUVA 1JG3A 1UKVY 1CNFA 3GLHA 3VU9B 3UQYS 4TLLB 4W5TA 1J33A 3PXDA 2H06A 3P4YA 3GBVA 1Q21A 3KFVA 5AJUA 1NOKA 3E9RA 4L9AA 2VNKA 4QEKA 2X7JA 4JN6B 3SP1A 2ZRQA 3KQTA 3MT0A 1BDMA 2I9PA 2P2GA 1EWRA 3ANYB 1SXIA 1W4LA 4YRQA 2AUNA 1CDOA 1U99A 1SKQA 4A0GA 1C3OB 3F3SA 2ZQZA 3UAYA 1SURA 2NADA 1Z38A 5JNLA 1LVGA 4REMA 4ZVRA 3E8MA 3W4KA 1Y5NA 1OLSA 3E27A 4Q3DA 3LWZA 1X1DA 4BBPA 3ZJTA 2WJYA 1T9GS 2VP3A 3HZRA 1C29B 2D62A 4G5OA 2ZQ5A 4V24A 1I3MA 3WRWA 1C1DA 2P5YA 3PLNA 2IVZA 1TK2A 5JCXA 5T64A 1OLXA 4PFSA 1QKIA 3PXAA 5HTKA 3I0MA 2IV3A 3TBKA 5DK6A 4EFNA 1U8CB 2CVHA 3FW1A 5K5EA 1WBBA 4C5BA 2A6PA 2W6CX 2GTIA 4F06A 3GY0A 4MULA 4X24A 1CEYA 2OORA 4ZI7F 2J3LA 4QUEA 3V1YA 1ZUIA 1DUSA 3L6RA 4XGQA 5CFRA 5C8DA 3C7AA 3QQPA 3MUOA 4BE9A 1RZRD 1VFPA 3SZLA 3W5DA 2HCTA 5A7FA 2VZ9A 3N59A 2IZ1A 3Q12A 2XVMA 2EHDA 5H82A 3QUBA 1XK6A 5HM8A 1W75A 4X5OA 1V8PA 4D9NA 5C1DA 4L8WB 3C39A 3HWWA 1A7KA 4JYMA 4BFVA 5JCJD 4QLBA 4YUAA 2IHNA 4EYGA 2AYYA 1E79D 1HLGA 5GM2A 5BW5A 2VRCA 1I6KA 1N6IA 4G1MB 4R6XA 1C0PA 1XAHA 3DCJA 5H7XA 4NNPA 1IPEA 3R6WA 1PSZA 3ZD9A 2HAEA 4BP9A 1ZGZA 2GWRA 4CEHA 3AF0A 5ALYA 2C3YA 4ZEOA 4C1NA 3GJ3A 4Y2RA 4M0EA 4YUYA 1TDJA 4U7WA 4ZQIA 2EKLA 1Q16A 3GAMA 1W30A 3G2NA 4JJ6A 4B6JA 3PF8A 2F9FA 3K35A 3ETLA 4L2IA 3QVUA 2EU8A 4V2IA 4D0GA 1K4YA 1LV8A 2J3DA 2HWUA 2H2DA 3KE8A 4S12A 2XTJA 2UYCA 1A9ZA 4ZU3A 1JEYA 1AQIA 2WAYA 3N5CA 4IX1A 4NE2A 4CMHA 4J9VA 1M1UA 1S96A 3MTIA 2CV1A 1EESA 2VPYA 1E98A 4C6TB 4KH1A 4J4BA 4W9MC 1Y3CE 1PJ4A 1R8JA 2MWMA 4LCEA 4NCIA 5TGTA 4GD3Q 1SHKA 2CHQA 5I7WA 2WSMA 3GFBA 4BCBA 4F12A 1IB0A 3B1YA 4MQBA 1YRBA 3THOA 1ETUA 4D6PA 2E37A 1RRGA 3AIOA 2H0RA 3FUCA 4JD5A 1PEDA 3DBOB 1RDFA 2C5HA 3L77A 5DM70 2VNSA 3Q0IA 1XXHA 2P3QA 3GUHA 4Y6LA 2A33A 2Q3JA 3MF4A 5D00A 1PJ3A 2P79A 1KZYC 2G25A 3W5UA 4AUKA 4FINA 4V0NA 1D8TA 2HQSA 3THXB 3VJMA 4N5MA 1D5WA 4GNKA 3Q11A 4DUZB 3DAGA 2BMAA 2QN9A 4MWSA 3W78A 2A5FA 2QY6A 2J0EA 3KD2A 4QRDA 3LPCA 3WLFA 2QX9A 4RY9A 3VO1A 4IV5A 2ZXEA 4P2BA 2FOLA 3HDJA 2CXXA 5E9WA 4B6FA 1ZX1A 2IUTA 4TL7A 4UDOA 3IP6A 5I7OA 4JT4A 4BVFA 1ZIPA 4JP8A 4ARZB 4C04A 5CFZA 1RAEA 2GCIA 2O2EA 2V4ZA 2FRDC 4I8XA 3IVGA 5D1NA 5ESXA 3S2FA 4R0NA 3CVWA 2FN9A 4Z9XA 2Q5CA 4DCMA 2YQ5A 4REQB 4LXUA 4NYJR 4BQEA 3ZC3A 1G7SA 1CQIA 2AXNA 1B0ZA 2Q2OA 4LX8A 1CJSA 1I51A 4MDYA 2CDNA 5JS7A 2WUEA 2A3NA 3AHFA 1XZBA 4TSRA 4LC1A 3RC9A 4HYTA 4A6PA 2IYWA 3RWOA 3PBKA 1DJQA 2E4UA 4ALNA 1A82A 1C14A 2J87A 3W7BA 4EIWA 2G06A 2PS1A 3M4XA 5CVJA 1MA3A 1ZRSA 2LE0A 1MJNA 4TWZA 3LUGA 1ENYA 1Y1PA 4RGVA 1F8FA 5JASA 1LB1B 3W8FA 4XX0B 3WRVA 4BMCA 2EG5A 3AEUB 3CX7A 1HI9A 3DNFA 3FUUA 1M6YA 4O4LB 4H1HA 5JE8A 1NNSA 1H0RA 1RMTA 1Y8RA 3MWYW 4DMCA 2GEJA 3GLFB 5I9TA 2NVOA 4F6RB 4JZYA 1RYBA 4ZOLF 5FXMA 3NRCA 2INGX 2AKYA 3QOFA 1RJGA 1LLUA 4LJSA 5F7JA 5HIIA 3U4DA 1FX0A 1QG0A 2P9GA 3EB9A 3BKWA 3QWFA 5IP5A 1A4IA 4M83A 3TLYA 1GPDG 2BE7A 5EP2A 3PICA 3FI0A 4KO1S 2QJFA 3M4NA 4AN4A 1U81A 1JE1A 3QF4A 2RHTA 4FN5A 4I36A 5JZ9A 4GE3A 2IDKA 5B6JA 3IEMA 1NDHA 1QQTA 4CLRB 1IEWA 4RSMA 1SHLA 1X1TA 4DSZA 2W8BB 4KC0A 2FLVA 3OIFA 3OBIA 2Q0QA 1YCGA 3C0KA 4J7UA 1PKXA 1W8IA 3ZV4A 4KHPB 1ZOSA 3IJEB 1SPXA 1HNWB 1DAPA 1TW3A 4HRAA 2Y1GA 2PVSA 2NU6B 2IZZA 3LA8A 2HMWA 1Q0RA 3ZH9B 1XQ9A 2WP8J 4QNRA 4DXAA 4B7CA 2R8BA 4BRWA 2MMCA 3O2QB 1EA5A 2VL7A 3GZTB 3IP1A 4L5IA 5CH5A 3WLNA 1FTGA 3TFOA 4ZVLA 1WZUA 1YBMA 2BGJA 2BJWA 4AS3A 4MYHA 4B3IA 4BS9A 2C59A 1N7IA 2BZSA 3CWCA 2ESRA 3M3PA 5L45A 1PQ4A 2IZ0A 2OK7A 4BOYA 2QTGA 1W9HA 1DX6A 4GE0A 3AF1A 5KOHB 4MKHA 1GKYA 2HJWA 3ZH2A 3MJDA 1W5SA 1ONOA 3B13B 3E0QA 4RVHA 3P45A 3RQSA 4RLFA 3MRXA 4Q9DA 4MGZR 3V2HA 4EYKA 1NU6A 2IT1A 1YR1A 3I6QA 1JBKA 4UBIA 4GPTA 1RHQA 4G1FA 1MEEA 4F4DA 4ZXPA 2CV2A 3PXBA 1I6LA 2ZKLA 3U7GA 1FTWA 1LW6E 2CLIB 3DE7X 3PPWA 3PPVA 5F4BA 4WESA 1JH9A 3I6BA 3O8OB 3RJ9A 3C6MA 3KYIB 1SUWA 1XDDA 4Z8YA 3EHDA 2Q3EA 3NOQA 3W79A 1HZZC 2FK8A 1G8KA 3NORA 3ZE9A 3TNDA 3PHIA 2JBAB 1JSCA 4JOCA 1H8HD 1QO9A 1M1YB 1BWQA 3H2KA 3TW8B 4FJ0A 3P0HA 2JIDA 2H1WA 2OG2A 3QBVA 3QFTA 4JSYA 4ZQGA 3C87A 5CEJA 3DYVA 3RAFC 4RC9A 3VHQA 4YUWA 1VI5A 2Z2ZA 2JH9A 4WOKA 5THQA 5FAXA 1DKPA 1AO3A 3DMNA 5F1OA 5K8IA 4Y9RA 4DM3A 4Z53A 3IAUA 2R96A 3SSNA 1TVKB 4DR2B 4KQJA 2NNWB 5JW6A 1D9ZA 1WXIA 1X9HA 2GB4A 3ASUA 3ZHBA 2IHZA 5HIJA 4O4HB 5IAEA 4BKPA 3TG2A 1ZRHA 4DCVA 1B15A 4RMJA 5AXAA 3AP3A 4Y1EA 1M83A 1ZH2A 3OECA 4JNCA 3VC2A 3GNQA 3ZIAD 3K0CC 3TLGA 1QYRA 1NQVA 4JB0A 3G7UA 5JCJA 1LK5A 1MOPA 4RJIA 1E79A 1S2MA 4J2TA 1BXGB 1I3CA 1QVVA 2HWWA 3AJ8A 3KEGA 3SEZA 4AZTA 8AT1A 3ES9A 1U1FA 3T35A 3ESDA 3H83A 2F1OA 2PSDA 2HYIC 1GTVA 1PD0A 3GJ0A 5H9WA 2BW0A 3QLJA 1E2MA 2YY5A 2ZYDA 3QKIA 4HG2A 5D86A 5JQGA 4LYYA 1L4MA 2HV9A 3CLVA 1KEKA 4ZO4A 1BN7A 1PX2A 1AK9A 2ZUBA 5TQ2A 3UIEA 2FQQA 1BDHA 5JNRA 3LWDA 2PXAA 2XADA 4RH0A 4FGZA 1WWKA 1VE3A 2P91A 3UK6A 3TQIA 2H1FA 4NATA 3VZDA 2CDCA 2UZ1B 4UXHA 1NC3A 3DVRX 4OHRA 4G6ZA 5IPFA 5JS8A 1JLSA 3HJCA 1N9GB 3D4BA 2O8BA 4EKIA 3GZJA 2R6JA 1NFQA 5EJIA 5NULA 1L7OA 1OYWA 2DSNA 5KSZA 2DHEA 1EAYA 3FRHA 2B7LA 4LDZA 4N0DA 3K5PA 3UJ9A 3BWDD 4L73A 3EZXA 4PFJA 4YMWA 1HDEA 2WHQA 3Q2KA 3LP5A 4GMFA 5HKAA 1IZZA 4TSFD 5EIBD 2OBMA 1J9GA 3U60B 3I28A 1OAKA 2WVHA 2FRXA 3ILSA 4K03A 5AK5A 2M98A 3P2MA 2ZIUB 1NP7A 2EX1A 3STTA 2QAJA 3TD2A 4E5MA 4EEXA 5LLDA 5I5GA 1XQWA 5TMBA 1WSDA 2OV4A 4GX0A 4FMCB 2O0LA 3L1UA 4XDGA 4YCMA 3HCBA 1JIVA 4OFBA 3BUSA 4TM8A 3WVNA 4DCNA 5BR1A 1VLHA 1XCPA 3COZA 2XNSA 3WWCA 1L3CA 4QGBA 1NVEA 4YJ3F 1V3UA 4G86A 3RJZA 4DMHA 2PKWA 3ZHYA 4F8YA 4M0PA 1HNNA 1S8FA 3DOOA 4KR2A 5AQEA 2R1VA 2ZLBA 3RWMB 2C94A 4JIGA 5IBRA 2I62A 1SA0A 4QQNA 5LXTB 5J1SB 1DGQA 1FW8A 2I87A 2Z2XA 4AROA 3SBDA 1TW2A 4WGGA 2BZ0A 1Y37A 1XL1A 1U2GC 1R0RE 1XRPA 1WUKS 2I67A 4X54A 2F3PA 4KJXA 2PEZA 5IBPA 5TPZD 4BTVA 5JHGB 1T91A 2PKQO 4JP5A 1W1IA 4L5YA 1DTWB 1NC1A 3NAZA 4E4TA 4D97A 1RC1A 4Q05A 1LPMA 1P5FA 3QVJA 1DFGA 1NZJA 5KCMA 5D5HA 2J3IA 1QIKA 1G0OA 1QG2A 2XBLA 3K8QA 3QENA 3BBPA 5DV9A 4L8YA 3M34A 2IXBA 1P2BA 3N07A 3SYTA 4FOTA 2BIFA 1S2NA 2YJ3A 2ZBRA 4K9RA 2WD7A 1D07A 4FX2A 5FBKA 3SNKA 3JWEA 4PQYA 1N2HA 1OXKB 1YL6A 4KO4S 3SF0A 1HE2A 4BO2A 1ADGA 3HG7A 1H93A 2I65A 3NALA 1LI5A 2FOIA 2BFWA 3LCVB 1E3WA 1SBIA 1J8FA 3B1ZA 2YN4A 6REQB 3CW2A 1THGA 4JC4A 2I4NA 3GCXA 1MX1A 1ULUA 2FZWA 4NBLA 4R1UA 3R7FA 4BX9A 4I8IA 4NECA 2DH6A 1FNBA 1XZJA 3E7DA 5B2EA 2OUIA 1T4GA 4BGIA 3GK3A 3QXXA 1BS9A 2RH5A 1E1KA 1J99A 1NBWB 5G4KA 1YDEA 5IARA 3SMQA 1CZOA 3FH0A 3FTDA 4TKUA 3TNLA 1GDTA 4F4CA 3MJCA 1FSGA 3EEYA 1TM2A 4QDXA 2QS9A 1MB2A 5HDQA 3LO8A 4K40A 4RUKA 3TTUA 1E7MA 4HDMA 2ZJ6A 2BMJA 2VHZA 5EA2A 9MHTA 5K9ZA 2WKQA 3GXOA 4Z1MA 3ZE6A 3TJZA 3I37X 4AKTA 4EHDA 3DZKA 4IEIA 1TM1E 1G8PA 4OHWA 3SQNA 2HRDA 4XWAA 3WNQA 4RKYA 3IDZA 2RB5A 4M0MA 4N0PA 3Q9LA 5HRUA 3Q8MA 1X7ZB 1DOAA 2R44A 3A70A 3BD8A 4J1SA 4PYMA 1JMKC 4BVKA 1Z12A 1KMMA 1OILA 3AUFA 1JQJC 3MBIA 5EXPA 3U56A 3BILA 3EGOA 4TVOA 5EWJA 2YYAA 3G1WA 3INYA 2PRZA 3GW8A 2FG5A 3R6GA 2RHOA 4ER7A 4ZVQA 2GA8A 1U9YA 2ZITA 1Y9AA 3IFSA 1QUFA 1W59A 2MINA 2EZ4A 2RKWA 4OBWA 4J3NA 1Q15A 3QJ5A 4GPZA 3T5DA 1PT8A 2C2BA 1UFKA 1V96A 2W6OA 3DWFA 2XDYA 3B12A 3FAKA 3L8MA 4QSHA 5PGMA 1U1EA 1Y89A 1NXTA 1BN6A 5FNVA 4II3A 5IAKA 1HSOA 3ZU6A 2EF0A 1KYTA 1Y5IA 2WJPA 1HEYA 5KEIA 4PZLA 5C7OO 3L0DA 5EFZA 3U5TA 3R9XA 3AEKA 3ZTTA 1HRKA 2B69A 1GEEA 1R0KA 1EUDA 2VZ0A 5BUSA 2EBUA 2B8TA 3I6IA 2V0NA 1H23A 3C7CB 3EMBA 3U7IA 4MQFA 3O3OB 4B3BA 1XPOA 3P9XA 4HH1A 4EY6A 1EHCA 2WVAA 1RZ3A 2G88A 3FDFA 4FILA 5ADHA 2ODTX 3VAAA 2Q27A 1ZK3A 4RGQA 4D0RA 2IPLA 1QK3A 3IR7A 4LWPA 3GXBA 3JQ6A 1JUDA 1H8HA 3PUJA 5E3IA 2O3QA 1QGOA 3H2YA 1NSYA 1UBMS 4LMAA 2RGRA 4ERNA 1KZ4A 1QIMA 4E2ZA 5TY0A 5KNCH 1LSUA 3HRIA 4L4SA 4P3OA 2CVFA 2HIHA 1F8UA 1QIJA 1JJVA 3C3KA 1SUBA 1YHZA 2X5XA 3PNMA 5ABPA 3RVJA 3ERCA 4B34A 2QQ5A 4MV1A 3QKUA 4JFRA 1E64A 5H5JA 3TQOA 3DT8A 3RS5A 4AMUA 3H11A 3C48A 4JBLA 1VDZA 2BKAA 2HA3A 5DHUA 4GM4A 1Q7TA 3ROTA 4WJLA 4F97A 2XZLA 3L40A 4AX8A 1O6ZA 2JLZA 2W4MA 2JFXA 2R9VA 2NGRA 3CXUA 1UJ2A 3E03A 3GRAA 4QU0A 3U9LA 3G0GA 1IBCA 1XTRA 1K1EA 3IH5A 4YAUA 3E3NA 1UWKA 1JDBB 2VOEA 5DYIA 1WUIS 3CMMA 1GUYA 2PKCA 2R4TA 4O3FA 1GQRA 3C3AA 4G0VA 4YJFA 4CTNA 1FUEA 2ONZA 5E6RB 1PQYA 5LZ5A 3VDXA 1KYXA 3DMHA 1M2JA 3WAJA 1CEXA 1JU3A 2AOTB 4QXPA 4HT3B 1Z26A 3M89A 1T5OA 2AQIA 2I3ZA 2P90A 3EHEA 2XCRB 2RAPA 2I6SA 4UFPA 3ZU4A 3CEJA 4MLCA 4YPFA 4OX9B 1N0VC 4A3SA 2OC9A 1KO4A 2Q8PA 4MV3A 3W1VA 2ON6A 1D2EA 3LT1A 1JNYA 3PXXA 1X70A 5AJYA 4LZWA 3DM5A 4B71A 2B2NA 3UJCA 2Q8NA 4MVYA 3VU8A 2QX4A 1YUBA 1YOBA 2G5TA 2WMDA 3GVHA 4U7DA 1SEPA 2ID7A 4MRAA 2X8JB 3OQ6A 1O7JA 4UW9A 4B9EA 4GI7A 3AETA 2Z04A 3J7TA 5L9AA 2IOFK 3DLHA 4IJ5A 1H6DA 3E3MA 3GT4A 2ZYHA 4MHSA 3IP5A 1L5ZA 5HW0A 5KYUA 1W34A 4JMPA 3NM5A 4CM1A 5E8RA 4TSFA 4R7GA 1ZVKA 3AR6A 3HDTA 1QSGA 2VJAA 4JX8A 4MUGA 2OOKA 2VHCA 1Q1QA 3JARB 3NZEA 4HSGA 4X85A 2CZQA 4M1WA 5AXCA 2CUZA 2WTXA 2H4WA 1PRYA 1H65A 3LF2A 3ZWOA 7ADHA 2XWPA 2HR1A 1HZZA 1K3UB 3E9YA 1HY3A 2W2PA 3TSYA 3A1NA 2QM0A 1T10A 2P4EA 4R8VA 1JAHA 3A6LA 1NQAO 1R66A 2Y66A 3O4HA 4MOWA 4CKEA 2Q62A 1XDUA 2Y77A 1D4FA 1TYBE 3I12A 3PV0A 4UVHA 2I8AA 3PNOA 4FGKA 2ZYTX 5TGDA 5I9NA 2GCEA 1C1XB 3RBXA 3L84A 1R3UA 3A28A 2YVUA 4HFJA 5I7HA 3NJ8A 2QQ0A 4XB6B 3T38A 4F3RA 3TOXA 1PFGA 4FE7A 2BMDA 4LRUA 5TPZA 2YHBA 3ZE2B 3LUHA 2PS3A 4ZT5A 3QV2A 2PE5A 1X7HA 3FBGA 3PUZA 4DBVO 1EJ2A 4MRSA 3DOCA 1KEWA 5AVYA 3K0CA 3ZNNA 1LI7A 2CT8A 2Q1YA 3KALA 1GSHA 1M34B 4JI5B 4U8GA 3ROFA 1ZI9A 4YUVA 1GSAA 4KLCA 2ATCA 4TZKA 2GPNA 3HSSA 4X3OA 1FQJA 2VDKB 2FPXA 3NBMA 1B1AA 1XNJA 2EVWX 2YXPX 3E9MA 4KQHA 1YZ3A 3QE0A 3U17A 2EKDA 4OHZA 1J6UA 4CMKA 3A1VA 1JX6A 4V0MA 2DYKA 2WMOB 3TFWA 3IPRA 5FOXA 3R7WA 1YZQA 2Z6UA 3F6YA 2XXAB 4H6PA 5JCZA 1P77A 1KVQA 1A95A 1MB4A 3O26A 4DLVA 4B2PA 5CD1A 3CG4A 1VM6A 4WY2A 2E0IA 2GPJA 2PIAA 1UZNA 1PJZA 3KUDA 4LPSA 3KBOA 2D5LA 2OCIA 1JEOA 1QZ3A 1ZKMA 1ZD3A 2PZFA 3MPUA 5I45A 2XMBA 2EERA 3DFZA 1HTBA 4NBNA 2EW1A 1GZ3A 2RHJA 3ORSA 4K0RA 2CNNA 2P6OA 4RDCA 2R6CA 4CF5A 3B9BA 3NBUA 5JISA 4CM7A 3AUTA 3WQRA 1DJMA 4KJZA 2F55A 1D5CA 2BGUA 1Q14A 5CT4A 1FSFA 1FZQA 2GETA 3LYUA 4HVTA 4RLQA 3SYLA 2G6TA 4JT9A 4PSKA 4RNDB 3DDNA 4ZVMA 2LWIA 2IU3A 2X0JA 2P5UA 3JQQA 1P0MA 4C4PA 1ATIA 1C0EA 3ZHXA 2CFIA 4BV8A 2Z5FA 3OF5A 1QTQA 3BIWA 3OJFA 5ELMA 4ASUD 3HLTA 3N58A 1VSBA 2YWJA 4DJEC 1T0HB 1GG9A 3I64A 1ECGA 5F1PA 2WSLA 3HJBA 5LU8A 2FPGB 2G1PA 1TLLA 2HK8A 3HCAA 4KIGA 1QH0A 3TBHA 4YCLA 2EXXA 3WQBA 4Y6RA 5I5EA 3RRFA 2DR0A 2A67A 1KKLA 3QW4B 4HD8A 3JZMA 4US1R 3PTLA 4HC4A 5EIAA 5SYMA 3AM5A 1BU5A 1ZCJA 4MI6A 5SZHB 5BVGA 4DR3B 2E21A 4HAYA 3UGKA 1P1RA 3Q7SA 4A8TA 1E32A 5AD1A 3ZLBA 1LQ2A 3I9FA 2W2VA 1I9GA 1LLFA 1UJBA 2VOJA 4FHCA 1U2GA 3FDZA 3P26A 4LK2A 3ZE7A 1D6NA 4QHYA 1R6VA 2LBPA 3GRVA 1JEDA 1F6BA 3HNRA 5DNWA 1E2UA 3AFNA 2ECQA 1NFRA 2PX2A 4YPOA 1NW9B 4BTEA 4MCHA 4CMGA 4W6QA 4OQYA 2QW1A 4EITA 1WVIA 4LDAA 3DR5A 4AU1A 1WOMA 4RW0A 5J4LA 2I4LA 5FBZA 3OQBA 4J49A 2QRVB 3HJHA 4UU8A 5I9MA 1P1CA 5I9SA 5G1NA 4INJA 4DW8A 3B9QA 1KJWA 1YZTA 4GRIA 3ONNA 4Y0VA 1F06A 2XYRA 4UVEA 2FSPA 2PU5A 4BATA 5JRDS 1W76A 4PZEA 4ZDWA 1C8LA 3V6MA 1XA4A 1ZVJA 1PLLA 3K94A 5DBHX 5GJBA 1PEAA 1RWNA 3KHTA 2CY0A 3L5KA 4Y9UA 1S2LA 3EW9A 2WD8A 1HDRA 1S8OA 2BL4A 3VNRA 2Z6AA 2B1JA 1L9XA 2BR4A 5BSGA 4YAOA 2VAWA 3NAGA 2Z9DA 2G04A 1KL7A 1TM5E 4RGYA 5I7RA 3EPJA 2G1KA 4ZCMA 5TLSA 1H4TA 1LI4A 1Z6QA 1UKYA 5K2MA 3A9WA 4RTNA 2MSNA 4F4IA 5E6SA 2D8MA 4GVPA 3R0IA 3NGLA 2IY8A 5CT9A 2GK6A 2QIPA 4WCFC 4RTQA 2CV0A 3ZLJA 2J0SA 1K63A 1P4JA 4DIOA 4UBOA 3HJAA 1J2JA 1D2GA 2VHVA 1EHIA 1BWSA 5TS3A 1B6RA 3RREA 4C9BA 1MR3F 2B6HA 1ADCA 1THZA 4JVLA 3EVDA 3NS7A 4Q4JB 4TV8A 2HWYA 5SY4A 3CLSD 3VPDA 1LWNA 3M1LA 4NCNA 4WD3A 3RU3A 1P29A 1W7AA 1L6RA 1REQB 5D6OA 1HO3A 3ZKAA 3RRMA 2FDCA 1Y5RA 1XDWA 3KPYA 1TM3E 3MEQA 5KSPA 1I30A 1KMIY 4NBRA 5DLDA 5TMPA 3JTEA 1QE5A 1CQWA 2YXBA 1H66A 4O2BB 2P0AA 2YJZA 5EE5B 1VJ5A 1ZNYA 1WNTA 5IS2A 1RXVA 3I83A 2WI8A 5M2QA 3EF3A 1E7WA 1Z7BA 2PYIA 1ISIA 1KI2A 1KTIA 4UM9B 5IJ0B 2AB0A 4M1TA 3TX6A 4BO9A 2CXHA 1T36B 2QUIA 3GVXA 4EW2A 3NKFA 5CDGA 2QI9C 1NPTO 1W2GA 2NUPA 3ED1A 3HYSA 5GAJA 3VU3A 4ITRC 2WB4A 4LJRA 1O6CA 4KL8S 3G2PA 3EW7A 4YCDA 5DP1A 1J0DA 3T1TA 1UJ6A 5EERA 3SG0A 3PCXA 5LD2C 1QQ7A 5A9SA 1WRBA 3U9SA 3K2BA 3RHFA 1DBVO 1PVDA 3DYBA 3VDQA 5KWEA 4FEEA 2PKQP 4DLKA 3TUIC 4TTVA 2ZE6A 4LGMA 2JH8A 1QHIA 3TEMA 5B4VA 3LKVA 3LUKA 4BO3A 2NTEA 1XD8A 1CW2B 1E8MA 1L1RA 4MB0A 1R8QA 1TPZA 1DAMA 2G72A 3DBVO 3OG9A 2BFBA 2PPVA 1EGAA 3G2JA 3HR4A 3LLSA 5AK3A 4CMIB 2HU8A 2RHRA 3TL2A 5A4JA 4JLBA 3WQHA 1X8XA 2QTRA 4AIIA 1BH6A 2C54A 1E5QA 3B70A 3FJOA 4KI0A 4MV0A 3PRYA 1MQ8B 3PEUA 4Z54A 5EJEA 4GKJB 2WSSD 2CUNA 3KYCB 1TZMA 5EMHA 3WLSA 1GPYA 1P19A 1WA5A 3BFXA 3MINA 1KJQA 1ADFA 3VPSA 1ONSA 1A50B 5IBCA 1CBUA 2VNIA 4S0ZA 2M6KA 2W6JD 3EVGA 3IIIA 1N2GA 1VE5A 5EJMA 1SD2A 4J0FA 3DL0A 2Y05A 4K5QA 4WBSA 4YCSA 1W85A 3RBZA 2RHDA 3MJSA 3RFTA 5B55A 1M2WA 2C9OA 4KVAA 5J23A 3L06A 4QARA 3D0KA 3SJAA 3JVIA 1Y6RA 2CLKB 3HB1A 2XR1A 1DEAA 3F6RA 3ZDDA 2LW7A 4WZBE 4HX2A 1QHXA 2QENA 4RYDA 4P7GA 5A5DA 5IX8A 3WWEA 1Y1SA 1RXWA 3FVQA 1P0FA 1V47A 3HPQA 3RK1A 4YUXA 5IZCC 1G8AA 4FDUA 1FDOA 2BAGA 4EA7A 5AIBA 5HGXA 3K70C 3H3FA 2O8CB 5KMGA 3ZYZA 4Y2UA 4J43A 4CV1A 5CCEA 3BCRA 4JLKA 3L0CA 3BPSA 3H5RA 3U3OA 2E4ZA 4R84A 3AC0A 1VL1A 1IOLA 4Z4HA 1EI9A 4N7RA 4TZTA 1X80B 4Y67A 3ZGLA 5LB4A 1XNQB 3B7GA 4UOEA 4LWOA 3NG1A 3PFHA 3D8TA 1ZI6A 5FBQB 4TXJA 4Z9BA 4LBWA 2V7BA 1US8A 4OGLA 4OO3A 3Q7TA 4OQPA 4QUDA 5ALQA 3D3EA 4B6GA 4TKMA 2RE8A 1DKUA 1SHTX 2XHZA 3GJ6A 4QXQA 3I52A 4CNQA 1FY2A 3FNRA 5E6UA 1MB9A 3R3SA 1NATA 2QW0X 3BWMA 2PR7A 5HDBB 3DMRA 4D44A 2PLWA 2H31A 1ESZA 3RV4A 1A8SA 3G2QA 4ZOLB 4OXQA 3WKCA 4ASUA 2AKEA 2E3JA 5AVRA 1H0KA 2P9YA 3FYUC 2DLDA 4S0XA 2RFLA 5BSFA 1Z7EA 3ZXXA 4Q19A 4Q3KA 1IG3A 5E0KB 1L8XA 4YXFA 3O4IA 4DTIA 1GGVA 3JR3A 5C8ZA 1DQSA 2BBTA 3I01A 3IERA 1EDZA 2VDQB 1VPTA 4PX3A 1FK8A 3ET4A 3QLTA 5JADA 3HKCB 4G0YA 4WNAB 1KVRA 5AI9A 5KDLA 4J1TA 5K0BA 2O0MA 1G0NA 4LOAA 2WU1A 3E9CA 2ZSFA 3RS3A 1TEVA 3VAYA 3SHOA 4OA8A 1G66A 1XZGA 3QU9A 5SY6A 1NXVA 1AZWA 2F3TA 4HQKA 4LBZA 4TQAA 3AUUA 1UMKA 1OXSC 2OHIA 3BDVA 3VH3A 1JLLA 1XDSA 3CCCA 1M0WA 2FLWA 1PQWA 3VTAA 1ZUWA 2WNIA 1SQ6A 4DG5A 4EUFA 1QFJA 1YZNA 5JD6A 1RAAA 1OT5A 3ZWXA 3NDRA 2B8EA 4PG6A 1Q7GA 5LA6B 1Z8DA 4I2NA 3T3MB 4AJLA 1OBCA 2W0MA 3PHCA 5ADUS 5HA5A 3MXOA 3WLHA 1N2IA 2RK6A 2DY1A 1WS6A 1N9KA 3KDSE 1O2DA 4I66A 4BP3A 1XPJA 1JR3E 3G5MA 2IEGA 1YKSA 3MJVA 1Y6JA 2B25A 3HVJA 1AMNA 5F9HA 3NBXX 4KQEA 1Y7IA 3GJYA 5A5VA 5CBPA 2IF2A 2H1HA 2B8JA 3GFGA 4HAZA 4IJVA 2VHTA 1QR2A 4BMDA 4C2AA 2XNKA 2ZJ8A 3A3YA 2O7SA 4UFNA 5AKKA 3V1MA 1KERA 1TQ6A 2YIDA 1WCYA 2CE7A 4UOZA 1T2EA 4Y1GA 2G3YA 2NTVA 3ORYA 1P6UA 3O82A 1TQ8A 3R1IA 3L43A 3MSXA 4F4JA 5HJ7A 1P1HA 5IVHA 1AN9A 4YN3A 1OWLA 2QRLA 3PX2A 2GVDC 2FV8A 1D6MA 3AOEA 3PXEA 3DLTA 4R1NA 1OTHA 5A3VA 4NY1A 1M74A 1I13A 1EFPB 4JC5A 1NSFA 2GR9A 1E9EA 1PU2A 1QIDA 3LXMA 3UB2A 2OWEA 1DJPA 1EFUA 4L75A 5FCDA 4DV7B 3QKWA 3A0RB 4X1KB 2ZBPA 4M87A 4Y98A 4QYIA 5J59A 3UENA 3GRRA 1K8RA 1T3TA 1K8XB 2JFZA 3AERA 5EHXA 1MCZA 1FZTA 1H94A 5BQPA 1U8EA 3QTLA 4IKOA 4LZZA 2DJ5A 3RFCA 1NVMB 3CONA 2JI9A 1G5IA 1BKDR 1KVSA 3DQQA 2X19A 4G81A 1NXQA 1TO1E 3H4MA 1IZ8A 1ULSA 3L8ZA 4HQNA 1M8FA 5BN4B 5DSTA 5K7SA 1NBHA 4GPBA 4NJOA 4BMPB 2ZCUA 3ZY5A 2GFIA 2PZEA 2WIKA 2O52A 4A16A 4C7KA 1NKSA 3LOQA 4D43A 1XU7A 5BW8A 5IAAA 5D84A 1PK9A 1TC2A 2XYVA 5BSVA 2ENUA 1Y82A 4G24A 4GPD1 3ELYA 1AH2A 4MPJA 1KP2A 4KLAA 3UTCA 4EDHA 4TKVA 1E0DA 2LKDA 3BJZA 4MKIA 5BYBA 5EIWA 3TLMA 2H4FA 2XLBA 3LZCA 1FB5A 4C43A 1N25A 4OATA 1WKCA 3CUKA 4OF4A 4MW7A 1Z22A 3AOGA 1E2DA 3LBYA 5EZ5A 3RTEA 4YV7A 1S0UA 4LDQA 1WZIA 2HWXA 3HM2A 5ED0A 5MGBA 2SHKA 3MXTA 3FPKA 3PGLA 3RT9A 1Q0HA 4BNUA 3U5ZB 2WSIA 2VAPA 2IH4A 2FQ1A 3DV9A 3EF1A 3T7CA 1ZM7A 2O2CA 2ZPTX 3EZFA 4Y0AA 5D85A 3I2KA 3SR3A 4Z86A 2WV9A 3UVEA 4O4JB 3CV3A 3GYBA 4PZ9A 3KSBC 4MI1A 3AO0B 4HNQA 4E1VA 3HCNA 1AIPA 1N4AA 4RVUA 3LT0A 3WHPA 1VL5A 1G21B 1YL7A 4WY8A 1L5QA 3LWNA 4Q1FA 2IX9A 5DI3B 4YJ2B 1ODLA 1HEUA 1Q17A 1QIFA 3T6KA 1PJCA 2J8ZA 3PB3A 1W5FA 3H2IA 4RY2A 3UHFA 3DE3X 5C1OA 3NX4A 2DM6A 2WSSA 1VL8A 4YV0A 1S8AA 3WO0A 2I3GA 1APBA 2HT6A 2X5JO 1P7VA 3WJ7A 4PN7A 1JDSA 3VSDA 4A73A 5CHEA 1G8GA 1BJTA 2HU7A 5G0TA 4B7ZA 5KVAA 1FJGB 2VQFB 3P0JA 4BMOB 3NVAA 4GZ6A 4XR4A 3R9WA 1NGSA 1JHZA 4WCFA 1JFSA 4KR3A 1M76A 1LLDA 1R9JA 5IJAA 4AZ0A 2PJRA 1QB8A 4RA9B 5GIOE 1OX6A 1WNFA 4OREX 5HQ3B 4KUHA 3PA6A 2QN2A 3SBXA 1ML4A 3KQYA 4I55F 4JL5A 4XIJA 4L15A 2IZ6A 1F8YA 4NP6A 1PN3A 2Q7OE 2C2KA 4MVJG 1YRLA 2Q5QA 4KLRA 4D9CA 5C35A 2PGDA 3P0IA 2Y93A 4Q3AA 1RLUA 3UKOA 4OMUA 5A06A 5E7JA 3H2HA 4HATA 1E4EB 4LBYA 1FC0A 1V16B 3A1TA 1P44A 2HHCA 2G71A 4UHHA 1JHMA 1XTBA 2OILA 3BMNB 3HGTA 1AXEA 4JUIA 1CUSA 4XUDA 3BAZA 4IOKA 5EOVA 4EJFA 4RMHA 4BO4A 2DLNA 4UCXA 5EINA 3TTTA 1WLYA 2GCOA 1GPMA 2VAXA 1YB7A 1EKXA 3AGPA 2CXQA 3LFUA 4G5RA 4FFWA 2QPAA