3HYSA

Structure of rv0554 from mycobacterium tuberculosis complexed with malonic acid
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
275
structure length
275
Chain Sequence
b'ENLYFQGAMDPEFRVINLAYDDNGTGDPVVFIAGRGGAGRTWHPHQVPAFLAAGYRCITFDNRGIGATENAEGFTTQTMVADTAALIETLDIAPARVVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIKSTPGLRCQLDCAPQTNRLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDAGHLGFFERPEAVNTAMLKFFASVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein Rv0554, putative Bromoperoxidase
molecule tags Hydrolase
source organism Mycobacterium tuberculosis
publication title Structural and functional analysis of Rv0554 from Mycobacterium tuberculosis: testing a putative role in menaquinone biosynthesis.
pubmed doi rcsb
total genus 97
structure length 275
sequence length 275
chains with identical sequence B
ec nomenclature ec 1.11.1.18: Bromide peroxidase.
pdb deposition date 2009-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3hysA00
4Y2QA 2CKMA 3O9VA 1BCRA 4ZV7A 5HKBA 2VJBA 3STWA 2YH2A 3U1TA 4EY8A 2WJ6A 4ZI5A 3ZWQA 3RLIA 2HA2A 4H7JA 2HU5A 5ALGA 5JATA 5ALUA 5I8PA 4QDOA 5EHQA 5LZ9A 3Q0TA 3SWWA 3ZLVA 4CCYA 1DU4A 4OB8A 1YB6A 2AJLI 2WU3A 3GFFA 4ZV9A 1AQLA 3A2NA 4AO6A 2W22A 2DQZA 5ALPA 2I78A 2WTNA 2XT0A 4UBLA 5ALFA 1WB4A 2RONA 4HVTA 4IHAA 4UHHA 1QIGA 4XIIA 1AURA 3DCNA 1X70A 2VA9A 1MU0A 1ZJ5A 4EHBA 4WFJA 1CUZA 2AJ8A 3C5WP 5ALMA 4QDXA 2H7CA 4EY5A 4N8SA 5AK3A 3HACA 1H2WA 3I2JA 1S8OA 1QO7A 4UFPA 3GA7A 2VF2A 2ACEA 4G9GA 4B81A 1K4YA 2GBGA 3G9UA 1GPNA 1BEEA 1CEXA 2BCEA 3FAKA 4UPDA 2QOEA 4HRYA 2XUAA 1FFEA 4LXIA 1VXRA 2DSNA 4PO3X 2NW6A 1YA4A 2B4KA 4BZZA 1D07A 3GBSA 2Z8ZA 4QZVA 5F4ZA 2V97A 2BAGA 4N5IX 4W1SA 3R0VA 5JZSA 1U8EA 4W1PA 3WL6A 3PDCA 4J03A 1W1IA 1MX5A 3STYA 1K6EA 4C4YA 2Z3WA 1FSSA 1O6GA 2G5TA 3C87A 3E0XA 1L7QA 4UHDA 5AKXA 3WYDA 1CUBA 3GROA 1XRNA 1P0PA 5CT9A 4ARBA 5AI4A 4ZREA 2XMQA 4C89A 4C88A 2ZVDA 1DWPA 2O2IA 4FFWA 4GLBA 4KE8A 3FOBA 4LYEA 2I03A 1SCQA 1XZLA 2QKYA 4MYSA 2JIDA 5AI6A 5A7GA 4OU4A 2XMRA 4E15A 3IURA 2JGKA 1A8UA 2AJDA 2QR5A 1EVEA 3WJ2A 1XRQA 2OQVA 3KD2A 2H7XA 5CT5A 2QXUA 3AZQA 3FCXA 3QM1A 4UBKA 3G0CA 4ROTA 5CT6A 2RAUA 3H18A 3ZPXA 1CRLA 1E3QA 4X6XA 5LZ2A 3GZJA 1CUVA 1T4MA 4AN0A 5ALNA 4OCZA 3FSGA 3WJ1A 4KAFA 1BCSA 5JZ9A 2C7BA 3AIKA 4FNGA 1E8MA 2O2HA 2WIKA 4W1RA 1NX9A 5CRIA 2HA3A 1J06A 3C5VA 3IUMA 1XQYA 5ALZA 3EBLA 1Q0ZA 1EA5A 3B12A 4DGQA 5E2IA 1LPAB 4L3WA 3FLAA 5HK8A 4OU5A 3UUEA 1XKTA 1R88A 5KWIA 1FFDA 1XQXA 4MJ3A 3H2KA 3QITA 5LZ7A 4P08A 4YX9A 2BUAA 1DQZA 1P0MA 1GQRA 1WHTA 5IVIA 3WWOA 5LP1A 1JJIA 3WI7A 4BCBA 3FCYA 4B6GA 5CH8A 1XLWA 5IVKA 2XUHA 4U2GA 1BEZA 5FDFA 1X2BA 1VJ5A 3D2BA 1VA4A 1BU8A 3B3QA 3ESBA 4Q05A 1L7RA 5AHXA 1GXSA 2H1IA 4UBNA 3FYTA 4EZIA 4B9AA 5HQ3B 4OYLA 3H19A 4AB1A 1Y37A 4BP8A 5ALSA 3GUUA 3DL7A 5C81A 2HA0A 4BATA 1WOMA 1U4NA 2C0PA 4G8CA 1LPSA 4NS4A 5AI0A 1H23A 3G0BA 4BZWA 5LZ5A 2J3DA 4X95A 1WPXA 3H1BA 1R1DA 3STTA 1UOPA 3VDXA 1YASA 1H22A 4ZWNA 1EK2A 1A7UA 4Y2SA 3F97A 3DL4A 2VAXA 2XB6A 4FWBA 3I2GA 4DNQA 2CJPA 2RHWA 4CI9A 5FPQA 1O6FA 1J07A 5AM1A 3O4GA 3FVTA 1KU0A 4KEAA 4AZ3A 2EDAA 3I6YA 3HI4A 1AX9A 2OAGA 2PSFA 4WCVA 4G8DA 4CIBA 3ZLTA 1FFBA 5LZ8A 3O4IA 4EBBA 4C87A 5SYMA 4M0MA 5LIPA 3E3AA 2C0QA 1UKCA 4X71A 2XUDA 4DIUA 1X2EA 2QT9A 3C6YA 1P0QA 4H35A 5FP0A 2G5PA 4LXHA 3MUNA 3FNBA 1CUXA 4A5SA 1Y7IA 3C45A 2O7VA 5AM5A 2EEPA 2HA6A 5EI5A 1QIFA 3H04A 4M0FA 2JEZA 4B85A 5LKRA 4Q3KA 4U2BA 5CXUA 1HBJA 2Z8XA 2OQIA 1CUUA 5DLPA 4Y2JA 1UK8A 3BIXA 1CUGA 1WB6A 1F8UA 3WWEA 1JI3A 5IH7A 3IUQA 5ALLA 2PX6A 2DFPA 4PW0A 3X3HA 4Y7DA 4ZRDA 4OD0A 4ETWA 4UBJA 1SC9A 3KWJA 5HF6A 3IUJA 5AKLA 1L7AA 5ALYA 1W52X 3D2CA 1ACJA 2XUGA 4D9JA 5KWJA 4PV7A 4KAJA 5AKHA 4E46A 4J0JA 3STVA 3UMJA 1UOQA 3E1GA 1B6GA 5A71A 1XQVA 1HLGA 2WFZA 2DHEA 5DNVA 5ALJA 3ESAA 4GECA 4J0HA 3DJYA 4ZXFA 5HZGA 1MAHA 2WHRA 1QZ3A 2BFNA 3EQ8A 2ZYRA 3L1HA 2XUFA 3HLKA 1AGYA 3FYUB 1UK7A 1EDBA 1ISPA 2CMFA 2QTBA 3R3XA 1LPBB 5A7HA 4JUIA 5I7UA 3C6XA 3PFCA 4J3JA 1TCCA 1DTEA 4QA9A 1XZGA 1XZKA 4JYMA 4FNMA 4Q3LA 2J4FA 1W76A 4YASA 2YASA 2QUBA 1RWQA 4FOLA 5A7FA 2FJPA 3EIOA 3F9CA 3D2AA 2QJWA 4QE3A 3VJLA 1ZOIA 2AJBA 4I19A 4RPCA 5D6OA 5K3AA 3TRDA 2HL6A 4DM7A 1ORWA 2OCLA 2I3ZA 5DNUA 4MEAA 4F60A 3QZUA 4OB6A 1ZGBA 2BGRA 4KRXA 3AUKA 3G0DA 2AJCA 3IB3A 3WWCA 4L9AA 2HHAA 2X8BA 3VVLA 2PM8A 1DX4A 2JGJA 1EB8A 4QLAA 1CUIA 4QNNA 2RHTA 2HFJA 1QTIA 3I1IA 4WY8A 5ALHA 4QDUA 3LP5A 3T4UA 2DR0A 3ANSA 3IVMA 1QIMA 5AKKA 4BDTA 4DNOA 3A2LA 2EDCA 5IKXA 1YSCA 2Y6VA 3YASA 3DKRA 4KYVA 1ZI8A 4KJXA 1WB5A 3FLBA 3HZOA 2DQYA 4X94A 4OYYA 4BB0A 4PF1A 4BVJA 2OPHA 1HKHA 3EF3A 2B9VA 3W9BA 3F8SA 1DWQA 5JALA 1NU6A 3FWHA 1GPKA 2JBWA 2XDWA 4IH4A 1YCDA 2ECFA 5K3EA 4MYDA 4QDTA 5E4TA 4B9EA 4HTAA 4CCYB 4LXGA 2W6CX 5DJ5A 4EA6A 4GBGA 3P2MA 1A88A 4KRYA 5E4JA 4TPKA 5HFAA 5EIHA 3IUNA 2QRUA 3I6ZA 4H7DA 2O7RA 5BWCA 4UHEA 3M3DA 2HDWA 1XQWA 5C8VA 1H2YA 2WIDA 2XE4A 2XUKA 1TRHA 4JEIA 2XMCA 1XKLA 1BROA 3R3UA 3DNMA 3V1KA 1XRRA 5EFZA 3M81A 5K3BA 5AK6A 3QBJA 2BGNA 4G4GA 3H1AA 1C7JA 4KACA 5C8ZA 3IBTA 1GGVA 4RNCA 2WFMA 1TCBA 5JAPA 5AM2A 2B61A 4LKOA 4H7EA 4TGLA 1XZMA 2HRQA 4AMZA 4N8EA 5ALEA 3WK7A 3W05A 5ALIA 3WL8A 5FXMA 2GBIA 4K5QA 3N0TA 1YA8A 4Y2PA 4Y2TA 3TEJA 4WFKA 2DHDA 1CUEA 5A62A 5ALTA 1CUAA 4B80A 1CUHA 4X6UA 3AZPA 4KE6A 1IMJA 1LBSA 1AMNA 4H7HA 5ALRA 1ZD3A 4FLEA 4U2FA 1SCKA 5K3FA 2R11A 4J7AA 3ZLUA 1CUSA 2YXPX 1LZLA 3LS2A 1ODTC 3KOOA 4UBIA 5AKGA 1MTZA 1H2XA 2XLBA 4OB7A 4G9EA 2WJ4A 1XRLA 1J1IA 1N8SA 1UOOA 3A2MA 3RARA 1ZIXA 1EHYA 2WHPA 5AI9A 3O4HA 3HEAA 5CURA 4TVKA 1EDEA 1RP1A 1DWOA 2QJRA 2WUFA 2OAEA 5JAHA 3JW8A 1QTRA 3R3YA 4NMWA 4Y9SA 1DT5A 2ZJ6A 2G63A 1N1MA 3V1MA 1CLEA 4MWSA 1QGED 1GZ7A 3OM8A 4M0EA 3F96A 3HJUA 3WLAA 4I3FA 3DYIA 2WFLB 4Y2RA 2HA4A 1ETHA 1WCYA 2HRRA 4QWWA 1CQZA 3K9BA 1BN6A 3CXUA 4BC0A 2K2QB 2PSHA 4FMPA 3I28A 1P0IA 2HA5A 2HA7A 3WIBA 4C4XA 1G42A 5AKIA 3MGAA 1IZ7A 4INZA 1QIDA 1XROA 4B0PA 4DSZA 1BE0A 2ZJFA 2CEKA 4PSUA 5AJHA 3Q8WA 2Z5GA 1QIEA 4Y2VA 3QPCA 2Z3ZA 2PUHA 3PE6A 2WJ3A 1EX9A 3LIIA 2WG0A 3G9XA 4CG3A 2XQGA 3QMWA 4G5XA 3UUFA 5AOBA 5JD4A 4DYHA 4BC1A 1USWA 4U2EA 2HADA 1PV1A 3G0GA 3BXPA 5CT8A 2WG1A 4X85A 1YS1X 3BF7A 3DS8A 4KAAA 1VXOA 4BAUA 3OG9A 4P92A 5FKJA 1IUOA 3AJAA 4BE4A 3DDUA 1PFQA 3B5EA 1E66A 3I2FA 5HF5A 2WU4A 3IA2A 1ZICA 2PU7A 4XX1A 4QWMA 1QIHA 4X3CA 2BKLA 5T4HA 3PI6A 2OGZA 2Q0XA 3ICWA 4WDRA 5EIEA 4QEKA 5AK4A 2QMQA 1XRMA 4G4JA 4HZGA 2WKWA 4G1FA 1ODSA 3PF9A 1F6WA 5AI8A 5J3JA 2VTVA 2GBFA 3HXKA 1CUWA 2OCGA 4UHCA 4L72A 3O0DA 2E3JA 3ED1A 3KSRA 5AKZA 3PFBA 4GI1A 1MX9A 2GBCA 2JGEA 4H7IA 3RKSA 4H18A 3STXA 4ARAA 4Y2XA 4KE9A 1HPLA 2HFKA 4LHEA 3VJKA 5EHXA 5HFNA 1LZKA 4P9NA 1THTA 2V9ZA 3D3NA 5H3HA 4A23A 3OURA 1EVQA 4GW3A 4BTLA 2WIFA 5AP9A 2CBGA 3BJRA 1FJ2A 3SK0A 1MAAA 3OC0A 3W04A 3C43A 1CUJA 1JU4A 4GEGA 5ALKA 4EY4A 2WUEA 1W75A 3ILSA 2V96A 2OLEA 1BRTA 5AM4A 5JARA 1JT2A 3AIMA 5JASA 5T4FA 3K6KA 3U0VA 4XJVA 5JADA 3PF8A 3AILA 3S2ZA 4Y2YA 1QIJA 1E5TA 5JAUA 2ES4A 2WM2A 3BDVA 5AH0A 3BDIA 3WL5A 4CCWA 5HF9A 2D0DA 4Q82A 3WK4A 3L1JA 3G02A 3G8YA 2WG2A 2XQKA 5AIBA 1QJ4A 3L1IA 2Y2UA 3F67A 3PICA 4GHWA 5AIAA 1F0NA 4PSDA 4E14A 1XZHA 3VISA 3S8YA 2C5GA 1TKRA 3AINA 2XUPA 1CR6A 4HS9A 2XUQA 3NGMA 3RK4A 2WQZA 2QZPA 1BS9A 2J3QA 3FYUC 1XZDA 5DYYA 4EUSA 4HRXA 5IVHA 3H17A 1A8QA 1K5PA 5FRDA 2VQ6A 3VJMA 2X5XA 2QUAA 1LGYA 3MVEA 4CIAA 3WKBA 1QIIA 5LYYA 3C6ZA 3QPAA 3C8HA 5A6VA 4FLFA 3AFIA 1VZ3A 4BRSA 4AZ0A 5FUMA 4A16A 5K3FB 5ALVA 1C4XA 3EQ7A 4B7ZA 2WHQA 1RYYA 5HQ3A 3R41A 1ZJ4A 2HU7A 4PQEA 2IIVA 1XZCA 5DNWA 4MEBA 4YPVA 5CT4A 4F0JA 5LLSA 2WTMA 1YB7A 4BE9A 1R50A 1MT3A 4XWGA 2CZQA 2BJHA 3SC2A 5C7YA 4K6HA 1IUPA 2DCMA 1JMKC 3QPDA 2V98A 5AM3A 3BF8A 4J0CA 2WLSA 1QOZA 1EH5A 5AOCA 3WQHA 3D4LA 1ZD2P 1F0PA 1QE3A 4X92A 2H7YA 4G8BA 3V1NA 5AO9A 4BAZA 5C8XA 2ONCA 1XZIA 4X97A 2GYUA 4E11A 4N5HX 4B82A 1XFDA 1M33A 2C5FA 2OXEA 1GKKA 2JGMA 4C6HA 4JH0A 3PUHA 5AM0A 3WZMA 3QH4A 5HCUA 4BVLA 1TAHA 1QFSA 3JYHA 1GKLA 4X93A 1W4LA 2PBLA 1LPNA 1CV2A 4I4CA 1B41A 2RIPA 2XQIA 3VVMA 3WKAA 3LIPA 3DLTA 3DEAA 4BDSA 2HIHA 5K3CA 1EXWA 1GQSA 3WK8A 4WY5A 1HQDA 1CUYA 3M82A 4U2DA 1VE6A 3WL7A 4QDZA 4UHBA 5FV4A 4QLOA 5D7BA 5K5EA 3ZV7A 4Y2UA 3WYNA 1YAHA 4MQLA 3M83A 4BTVA 1MPXA 4BRZA 2XUOA 1XLUA 5ALWA 2Y2VA 3KWFA 3VXKA 4XVCA 4EY6A 3ICVA 4LIPD 3H0CA 2C4HA 3W06A 3A6ZA 2PUJA 2XQJA 2XUIA 1JU3A 3FSGD 3DYVA 1LLFA 2VJAA 4FFVA 1TK3A 4AX4A 3FBWA 2ROQA 1TQHA 4X6YA 2JF0A 1VOTA 2H9YA 1AC5A 1DT3A 2OCKA 2XI4A 3AIOA 3WWPA 3NOXA 1E8NA 5CTAA 2UZ0A 1UK6A 2VEOA 3I2HA 4DMHA 1ODCA 5ISMA 3WK6A 3OPMA 1Q0RA 3F98A 1ZI6A 1G66A 4J0KA 1R9NA 3D5EA 1XZFA 4UFOA 4DMCA 4N8DA 1LBTA 2PL5A 1G5FA 1DINA 4YK7A 1JFRA 3V9AA 1T2NA 1AUOA 3A70A 4UBOA 1CUDA 1QLWA 2Y6UA 3WKDA 3G0IA 4AN1A 2JEYA 5JD5A 4Z49A 2XUJA 3WIOA 5E4YA 4OPMA 1Z68A 4PSCA 3V48A 4CG2A 3V1LA 1HL7A 3C70A 3D59A 1KU6A 5T4EA 3DD5A 2FUKA 5AKJA 1N5RA 3VKFA 2WFLA 6YASA 1YS2X 1WPRA 5JANA 4B83A 1E89A 3HYSA 2WUDA 1EK1A 2OG1A 5YASA 1KEZA 2XMBA 2O2GA 5DTIA 1U65A 4ZGBA 2PPLA 1IZ8A 3DOHA 3WA6A 3CCCA 3OTQA 2ZSHA 5FOQA 2XMGA 3W9UA 2ZSIA 4S0XA 4FDMA 5LKAA 4B84A 4IH9A 5ALXA 4Q34A 1C7IA 4OUKX 1UXOA 2QM0A 4FKBA 1EINA 2BUCA 5ALQA 1XZBA 4Q3OA 3QYJA 4HXFB 2ZYHA 4FHZA 4WJLA 2CB9A 1VZ2A 2HU8A 5JZBA 1GT6A 1LPPA 2WIJA 2P8SA 1SCIA 2RGUA 3O95A 1CUFA 2VSQA 1VE7A 3DQZA 4X00A 3GELA 3IDAA 3WK5A 4EB0A 1CIJA 1Q83A 3WA7A 1Y7HA 4GDMA 1MNAA 2R8BA 5A2GA 5AI5A 2GYVA 2RI6A 2WILA 3BJMA 2G4LA 2PSJA 2X76A 4EY7A 5HKAA 1OILA 4NZZA 3QMMA 2IITA 4UUQA 2IX9A 4BAGA 1R9MA 4HXEB 5EHZA 1R3DA 3H2GA 5DYWA 2QVBA 2XMZA 2GYWA 4HXGA 2HM7A 4U2CA 1WM1A 4RE5A 4DMFA 1XRPA 4BP9A 5D3ZA 3DKKA 5BWBA 4ITVA 5IVDA 1ZI9A 3LCRA 1EDDA 1SOMA 3EQ9A 3I2KA 1XZEA 5KREA 2ACKA 1VA5A 3KXPA 4JYPA 3NWOA 3ESDA 4AXBA 1W6RA 3K2IA 2VATA 3CN7A 1TIBA 1MX1A 3O9MA 3T52A 3W2TA 1UFOA 1CVLA 1Q84A 1MNQA 3HC7A 4AQDA 4OSEA 4J0GA 4X91A 1JJBA 5FPPA 3BE8A 1N5MA 4H7FA 2ZJ7A 4K2AA 3WKEA 1UT6A 5K3DA 1MN6A 4F5ZA 4FBLA 5BV7A 4AO8A 5CBKA 3D0KA 2LIPA 5BOVA 1H2ZA 1DX6A 4NVRA 2PU5A 2FJ0A 3PUIA 1OXMA 4J0IA 2WSLA 5I9IA 3R3VA 2J4CA 5ALDA 3G9ZA 2ORYA 4UFNA 5CXXA 3JWEA 4BCCA 4B0OA 2OGSA 5AKYA 3TGLA 1UKBA 3N2ZB 2D5LA 2JGIA 4W1QA 5LZ4A 4BVKA 3CCBA 3ANTA 2XLCA 3HABA 3RM3A 1E8DA 3ESCA 4J0DA 4PNZA 1QFMA 3IIIA 4RE6A 2B20A 3MUOA 5SYNA 1CPYA 4G4IA 4UHFA 2BUBA 2PKYX 4HAIA 4GWLA 4UBMA 1THGA 1UZAA 3DOIA 1ORVA 1R4ZA 4C4ZA 2VAVA 4BBZA 3HSSA 3D7RA 3KDAA 1LNSA 4H7KA 3R3WA 1XZJA 5JD6A 2QXTA 3TJMA 5AKEA 5HF8A 4WFIA 4K6GA 2WUGA 1J2EA 1TCAA 4IH1A 5AOAA 5EGNA 3C6BA 4DTCA 1GPLA 1JJFA 4CG1A 4DNFA 4MWTA 1XLVA 1YAJA 4H77A 4P93A 5D3KA 2C58A 1VKHA 4DNPA 1XZAA 4BCDA 4DMKA 3WKCA 3QVMA 4FBMA 1UKAA 3I1YA 4H0CA 5AK5A 2VJCA 3O4JA 3FLEA 1I6WA 4GXNA 3H2IA 5ALOA 5AICA 3HRHA 1JMYA 3SX4A 1K8QA 1UWCA 2OGTA 3IULA 4AMYA 4Q1VA 1HDEA 4DSAA 1ACLA 2PVSA 1OCEA 2FX5A 7YASA 2GZRA 4L0CA 4LYDA 1DQYA 2PSDA 1LPOA 5CH5A 5ESRA 3R3ZA 5JIBA 1IUNA 1AKNA 3WMRA 2JGFA 1QIKA 4KR0A 1ZD5A 1JKMA 1UK9A 4K6KA 1SFRA 1K63A 3C8DA 2JGLA 2XMSA 4O08A 4MXDA 4MQMA 4C01A 1FFCA 5EHNA 4X7BA 3FVRA 5JYCA 5DTJA 4FTWA 4JNCA 1VLQA 3I2IA 4RGYA 2GZSA 2ZYIA 3AZOA 2PSEA 2OCIA 1CUCA 4F21A 2WHPB 3H2HA 3OOSA 5CH3A 5DWDA 5DYTA 4X90A 3BIWA 5HK9A 4BYMA 5CMLA 3H2JA 1ZIYA 5JAOA 1IVYA 2VJDA 4V2IA 1A8SA 5CW2A 2CUTA 1CQWA 4CFSA 3LLCA 3WK9A 1BN7A 2XQFA 2VT7A 3QMVA 1NU8A 3G7NA 1CFJA 1MO2A 4WDQA 4DLNA 5T4BA 1QO9A 1ZGCA 4KE7A 4W9RA 1YR2A 5FLKA 1PJAA 1WHSA 1U2EA 1G4HA 1MJ5A 4W63A 1ZD4A 1AZWA 2QS9A 4IQ4A 2DHCA 3STUA 3FYUA 2VT6A 2ZYSA 1LPMA 3CN9A 2WIGA 3BL8A 3G9TA 3NUZA 2I3DA 2XMDA 3ZI7A 3WWDA 2AXEA 1EI9A 1QONA 2Y1KA 3I6MA 1FFAA 2YYSA 4AO7A 3R40A 3E4DA 5EIAA 3WZLA 3BWXA 4IO0A 5KBYA 1EB9A 4FLMA
chains in the Genus database with same CATH superfamily
4Y2QA 2CKMA 1G6KA 1ARZA 3NVMB 3QI7A 1R5NA 2JLWA 1G5QA 1ZOOA 3R5FA 4QVKA 1AMUA 2GF9A 3AYXB 4DUGD 1VMAA 3P32A 4UJ3A 3GJSA 5EWLB 3IUEA 4NE9A 5I7WA 1BCRA 4LOIA 5HKBA 2P65A 4PY2A 1E9RA 3EZ6A 4G86A 1WDWB 1KBQA 5IASA 4O02B 1MJGM 2VK2A 4TTSA 3O7MA 3EGXB 5CFPA 1PV4A 4BKPA 1N8KA 3IESA 2PIDA 4H7JA 4O2AB 5ALGA 2HCFA 3MUFA 3L8EA 2EVWX 1M1NA 1RQPA 4IL5A 1NX6A 1RYBA 3SDBA 4WTOA 4RFSA 1KMCA 4D45A 3BUSA 1KERA 5CFOA 4IBOA 3WOVA 3HSKA 1O77A 4LHSA 4TKVB 1DU4A 4Q9AA 4CCYA 1JNXX 5F3WB 2BCJQ 2NUTB 1UDWA 1UH5A 1FUUA 2CJFA 1COWA 4NZ9A 4YT4A 1EBFA 2DT8A 4CRWB 3O9ZA 5EZ5A 1NWCA 4ZV9A 5MDHA 3JQBA 4TRMA 4XWKA 1AVTA 1HGXA 3BRQA 4JGBA 4D8WA 1SXJE 3ZDYB 2EFEB 4FNOA 3A2NA 4XD2A 4AO6A 1FA9A 5B58C 2JKVA 4H6WA 5KQLA 1D0VA 2DQZA 4B3BA 3LT0A 3ED5A 3H2ZA 3K9LA 5ALPA 4BMXA 4EUHA 3L0SA 4N0MA 3UHJA 5CB4F 2BFFB 2WTNA 3EXHC 3QY9A 2Q1UA 3U40A 2VEDA 3EPRA 4NBKA 4UBLA 4EMBA 5ALFA 2VNKA 1L7OA 3AL3A 4QSMA 1C9DB 1T1EA 4BOYA 3VQTA 4IHAA 3EZXA 2I7XA 4BFWA 3TM5A 5EPEA 2EHJA 4X9XA 4MGHA 1E4OA 4TTTS 1TFRA 2W37A 4KO2S 3W6NA 2JLRA 3Q1LA 1A9SA 1SHJA 2E21A 4WFJA 3FJ1A 3L93A 5EY5B 1CUZA 4BMVA 4F9TA 2AJ8A 4IIJF 3U1BA 2UUPA 2ZPTX 3C5WP 4R69A 5DHSA 1EX1A 5E8RA 2R6DA 3I61A 1LSUA 3UV7A 4HNTA 5FUQA 1P1KA 4QDXA 3FXAA 2IL1A 1BDJA 2BFWA 3U19A 3PCXA 4FX5A 3ZEIA 1PNTA 2R44A 1DS6A 2YOGA 1N3BA 4KWEA 5B55A 1OU0A 2W4IA 2PR2A 2YIDA 4MKZA 4R8LA 1Z4NA 3A9VA 2M1ZA 4DILA 1RCFA 2B0JA 4BGVA 4KX5A 2ZIZA 4JZYA 3O8QA 4Z3DA 3MERA 1ZCAA 3ITEA 3HN7A 4LNAA 2ACEA 2WF8A 2B98A 3HLTA 1ZXLA 4JVNA 1SJ9A 4NYIR 1DAOA 1OF1A 1K4YA 4OKNA 1J25A 1MHPA 3D3WA 2JFFA 1RLIA 3JWGA 4U2FA 2VP5A 1NF2A 2IXGA 2RHRA 3PTZA 4YP9A 5BQOA 3L1VA 3RAPR 4FONA 1TMYA 1BEEA 1PR6A 3DNPA 3NUGA 4MQ5A 2H07A 3Q9LA 3RHSA 5BYKA 3CUYA 3VAAA 2F8SA 1AK1A 1WVIA 4GX5A 4QOIA 1SBYA 3NHYA 5DGIA 3TLAA 2OBFA 4RDIA 2R8ZA 1XVAA 2EQ5A 4B3TB 2BDEA 4FFPA 2O6HA 5F2OA 2VDRB 1D9ZA 1XPRA 5LBUA 4PO3X 1QR2A 2NW6A 3ISVA 1YA4A 3NYWA 5DN6A 3IX7A 1RYZA 1SKAA 3R8XA 3WBKA 1KJNA 2C99A 3QVUA 4BZZA 5G1OA 1G6HA 3ELUA 4RFSB 4F4JA 4LC9A 3CINA 3U62A 5CCXA 3GBSA 4AZ3B 4CKBA 3I5AA 4QZVA 2HT1A 2WYWA 1EP2B 2Q49A 5IJWA 4LE1A 1A95A 4MUEA 2V97A 1RWNA 1V3UA 2AEEA 4ZQFA 2R1VA 4PQGA 1PGNA 4I6EA 1MJNA 5IMSA 1CHNA 1VCHA 1VFPA 1N7IA 3G49A 3VOAA 3MWKA 2FXVA 1M2VB 2AOUB 1GWNA 3G1UA 1W1IA 1MX5A 1DAHA 1JQEA 4QC2A 2FV8A 5LM3A 3FB1A 4BGIA 1RHMA 2X6QA 3NHZA 4U5QA 2YWFA 1WV0A 1ZUNA 5A05A 2VSOA 2Z3WA 3LBIA 4YRJA 5FAKA 2EGUA 3GZ4A 2FEXA 1VI5A 2OK8A 1FX0A 1O6GA 1G0NA 1P2SA 2BHNA 3P9RA 4LF9B 3CW8X 3UPUA 3C87A 1AKEA 3CEAA 4RMJA 1IFXA 1G8HA 1HQCA 1L7QA 1RXSA 3CH6A 4UHDA 4P6VF 4BWYA 3C7AA 1JH9A 1CUBA 1L2TA 3H2YA 4NBVA 5CVEA 1P0PA 3ND9A 3R6TA 4JP2A 1KNQA 3WNCA 4DJFC 1YR6A 1E59A 1TK2A 2CNNA 2OKGA 3H97A 3JR3A 4Q39A 4BB5A 5BVGB 4F4UA 3QOFA 1HLDA 1SWWA 1XIVA 3OHSX 3V6MA 3FI9A 3N2YA 3UW1A 4MVJA 4Y6PA 4C88A 1YZ3A 2I76A 3LDGA 2O2IA 3N2KA 3R1IA 3H0KA 2HK7A 1XALA 3IOEA 2AOUA 2I03A 3GCWA 1SCQA 4E1VA 1K3FA 3BZUA 4QUHA 1FLAA 2G07A 4LYGA 2JS7A 1WCXA 5AI6A 3ROXA 3A9SA 1P45A 3OKCA 4OU4A 1MB4A 3W1EA 3K0EA 3KSZO 1Z73A 2ZSJA 1Z8DA 2RHBA 3EXEB 821PA 3DT9A 1AMOA 3DXFA 1TVEA 3KXDA 3IQGX 3L8GA 2EKDA 4F85A 4OLBA 3HP7A 3VR4A 3I76A 5JS6A 2QBYA 2OQVA 3ASZA 4KCGA 4ZZ3A 3MT9A 3OA2A 3TZEA 3D8SA 1GU0A 2EF1A 2HB6A 2YOHA 3B3JA 1P6QA 1OGJA 1VBMA 1WF6A 2HQ1A 3AY6A 3AZQA 2XB2A 2YZMA 3LTNC 2OXRA 4MR9B 4UBKA 1ZK2A 3AFMA 2ZULA 3G0CA 5FEUA 4W4TA 1BS1A 3B52X 1IK4A 3KUDA 2DF8A 3H18A 2JAHA 2GVNA 3LYLA 2ZWAA 3VPBA 1CRLA 1SULA 3SJBA 4LSMA 5F7XA 3M6AA 1N9GB 3HHPA 2VQ3A 3GGGA 4YRDA 2ZGVA 1Q7TA 3D3WB 1L5SA 3DBLB 4QRIA 1E98A 1SA0A 3BEDA 4N01A 4OQZA 4AN0A 1F2TB 5ALNA 3TI9A 4WBNA 3K0BA 3LL4A 2FQQA 1YVDA 3EULA 3OZXA 2DYKA 4P3PA 2DETA 2CXUA 3F7TA 4DR4B 4MMYB 4ZYUA 4TV8A 1B0AA 1NRIA 3ZW9A 2REQB 3BJEA 1L3CA 3OJCA 2AZTA 2XQVA 2MCFA 4FT2A 3VGPA 5HTOA 2O2HA 3QKWA 4AQ7A 1EFPA 1L1EA 4G5FA 4KLAA 1P2BA 4M7PA 5EP4A 3V4ZA 2EIXA 1H3EA 3WTCA 2EF0A 4G67A 4CL3A 3EXHA 2VPXA 3FUWA 2RHOA 4C4OA 5C5IA 3OI7A 4FYKA 1P7WA 2G80A 3CGWA 4KXYA 5ALZA 2HT6A 5F3RA 3BOSA 1VYHA 1DFGA 5G0WA 4DGQA 2X8LA 2D2EA 5K45A 1I4OA 1WSBA 2NV6A 4E33A 5KYWB 4MTLA 2X0DA 4L3WA 1JDPA 3FLAA 3EWAA 4UVGA 1NRXA 3HKBA 2YVLA 2HRBA 3ZE0B 4OU5A 1KEVA 4LPKA 4FDAA 3UUEA 2V4MA 3M1LA 3OEHA 3SAJA 1K5GA 1Y8AA 1XCPA 1ZMXA 3V4LA 3U7HB 1SCUB 1FBNA 1FVHA 3H2KA 2BEJA 1MQ9A 3E22B 1TA4A 1G2OA 3PNVA 3WLFA 2GK7A 2DHQA 1R8XA 3E03A 3GRZA 2HTEA 4P08A 5SV2A 1CC1S 2F6RA 4FSXA 1P7YA 1NOJA 1P0MA 1EUYA 3T9AA 2WW8A 2CVFA 1A3CA 1IM8A 1T8RA 3EHDA 3I01M 2Q45A 3OZIA 2A0UA 4J7CA 4LWZA 4ND5A 1KDVA 3VDRA 3ZJ5A 5A4DA 5LP1A 4XGNA 4O59O 1ADJA 1RXWA 1I4WA 3B5IA 2Q0SA 3HNPA 1RHUA 3LCMA 4GH5A 2DU8A 4KVFA 4EL5A 4BFXA 3HADA 1JDZA 5IW8A 3LWDA 3WJ7A 3ZNOA 4JXZA 3IQIX 4YN3A 3USES 2UYHA 5DWVA 5J4HA 3LSYA 6NULA 4IHQA 4XYMA 1COZA 3NEJA 5KYXA 3SBDA 2XX3A 5FDFA 1ZHFA 3LHKA 3PX3A 1BU8A 1RFGE 2OFXA 3B3QA 3QW2A 1NW8A 1OLXB 4LI0A 3TEMA 4FXOA 2AEFA 3UT0A 5K0GA 1V8DA 4P98A 5K6AA 4L8YA 3TOCA 1SQGA 4RL6A 4EZIA 4E6EA 1A5SB 1G8MA 5T8KA 3R3SA 1EG2A 4JQCA 3GHYA 4IXWA 4YB8A 3MHTA 1JMVA 3ENQA 5IJ0B 1Y1LA 3ZU4A 1D6JA 1N7HA 1Y37A 1OFGA 4YPFA 3LC2O 3MA0A 5ALSA 2Q5JA 4XGRA 2F1KA 3NORA 3DL7A 2HDNB 4GZMA 2CSXA 3VH4A 2I4LA 2W2MA 2HA0A 3AR2A 2HSZA 3BMNA 5C81A 4DN6A 2YN2A 4D9IA 1LK7A 3OU7A 5I9LA 5DW0A 2C0PA 3TZHA 1IAVA 2ZRNA 1GN9A 2NXWA 4NNOA 3TSWA 2DFVA 1GLVA 3RGGA 5JISA 4AKHA 1O94D 4ARIA 1J0BA 4RD0A 2CXHA 2AR0A 4H6XA 2WAMA 1P1BA 1UBJS 1WY7A 3EJWA 2H11A 3PQEA 4GUDA 4BZPA 4OA8A 4AKTA 4W9MC 3WDMA 1QCYA 5FYDA 2FZKA 1OB5A 5K05A 2BBTA 2WF7A 2XADA 1OZFA 5MFZA 4ZWNA 1ESCA 2BJVA 2EGHA 4MWBA 3CRMA 3NHUA 3DTYA 4L6IA 2V6GA 1R5BA 1ECPA 4Q4HA 1QKIA 2VHUA 3U7RA 2AZMA 2IDJA 3CKLA 4PRYA 2J6HA 2E2WA 4FR2A 4G25A 2XB6A 3E84A 4M21A 1YKFA 4TV8F 4YLEA 2CMGA 1XTVA 3I2GA 4FWBA 3T3PB 4EH1A 4HS4A 4JYAB 4KLNA 3EEIA 4EPYA 4X1OA 5BSVA 3TAUA 3W2GA 4QTTB 4CI9A 5F23A 1E6WA 1H5UA 2W7TA 5FPQA 1LS1A 3LC0A 3GIDA 3G8DA 1TQDA 1Z26A 3FVTA 1FVFA 1P1IA 3GEHA 4FP9A 4MULA 4P4TA 4KEAA 1ES9A 1NMSA 4LISA 3VZRA 3C16C 1M6HA 2DQ4A 3TBHA 2RGEA 2L2QA 4BQQA 1R2QA 5EJ6A 2PPVA 1KJWA 4G8DA 3TQFA 4CW7A 4CIBA 1KEUA 1YBHA 3D31A 5EHIA 3E82A 1HK7A 4XOIA 1U6JA 4TVBA 4KQCA 3FUVA 4KIWA 1KO1A 4TS9A 4M0MA 2DVMA 2GFHA 5DTRA 3WS7A 1ESZA 2NTEA 3BMQB 1PJBA 4AS1A 1IMOA 1PTJC 4QXQA 3AVVA 4U02A 1WJGA 3QW4B 4WLNA 2W0SA 4R40A 3V2GA 1HR0B 1JZTA 2H06A 2QYHA 4NOKA 3ZV3A 4B1FA 4TLAA 2A8YA 3H65A 3RABA 4F1JA 3BGWA 2V4ZA 4JFAA 4MCIA 1Z82A 3ZNQA 4JI2B 3HU1A 4D9FA 3OKFA 3NC0C 3MUNA 1IY0A 1CUXA 2EP7A 4ZEWA 3ZV4A 4A5SA 1WETA 4N47A 4COOA 3RS7A 1FOEB 1FP6A 5A6SA 3U16A 5ESDA 1RXYA 2IHNA 4G1BA 3NCTA 4G65A 4R6WA 5JOQA 1NXOA 1U3FA 3AW9A 3QY0A 5IAEA 3IVXA 1THMA 3DMYA 5EAIA 1BWRA 3E27A 5DYNA 4U7WA 1XEWX 1JIVA 4KIUA 3QBTA 2BFOA 2HA6A 5FTNA 1B3BA 4CKXA 1B0ZA 1GSHA 2HCTA 2E4XA 1V8FA 3R2JA 4HEHA 4P2GA 3R9XA 4PLWA 5ESXA 2GZMA 1CSEE 4YMWA 1RWPA 4O2BB 4TSFA 4GO1A 4B85A 2PL3A 1FQKA 2HSJA 3R5TA 4JKOA 5IK2A 3R77A 4UE2A 3RODA 1O4VA 4LAFA 1HBJA 1R15A 4HUTA 5JBIA 4DFDA 5DLPA 1FLNA 2PWPA 3R0ZA 1NHGA 3TRJA 1UK8A 2WA2A 1TK9A 5AW3A 2EATA 1CUGA 2E6KA 1WB6A 2Y1DA 3Q98A 5HFJA 4TWAA 3WWEA 2C9BA 4N6GA 5PGMA 3CLTD 1X15A 2ZAIA 4ZA2A 3ZVRA 9GPBA 3AH8A 3BX1A 1NMZA 5IH7A 1G55A 1OPRA 2C77A 2ID4A 2VBIA 3O8OB 1TPZA 2C7GA 2PX6A 3IUQA 4ZQBA 5I8WA 3CEHA 4J0EA 5EJ5A 1BMFD 4Q1AA 2X8JB 2CWDA 4Y7DA 5FTJA 2ID9A 1XEFA 3BAFA 4M6WA 3DVAA 3BXGA 2C0CA 4KMRA 2OTCA 3VR2D 2C7PA 1T8TA 4G0NA 4RHTA 1SC9A 1HURA 2IU3A 4LHXA 3IP8A 5HF6A 2G4VA 4MVCA 5SICE 4FOTA 3ZY6A 3PQ2A 1EVIA 1SXJD 4IDQA 5A6SB 1L7AA 4PBSA 1NWHA 5ALYA 3W79A 5HZMA 4XM1A 1W5AA 4CL2A 1MRZA 2BYTA 1JFFA 4WNIA 4QT4A 3U17A 4C4TA 1DAFA 3N39C 3UK2A 1UODA 2O57A 1SXJB 4HEJA 1ACJA 3HFRA 3F3SA 3N58A 1KQNA 3N2IA 4NEQA 3HSYA 1U8ZA 4H15A 1AS0A 3CFYA 1PTKA 2FR0A 2P11A 1MRSA 3TL6A 3BWVA 5EQFA 2X0RA 3DMHA 4XB2A 4CR6A 5A9TA 1HDIA 1TC1A 4J0JA 4FILA 1R0KA 2JBAA 1QBGA 1UDCA 3L92A 1VRWA 2ZTHA 1ADBA 3ADOA 2PT9A 2E7ZA 4G1UC 1XU9A 3E1GA 2G1PA 2IK8A 1TD9A 1OX4A 3MCWA 2Q3EA 4EHJA 5CG2A 4AD8A 1HLGA 1RWXA 4CQMB 1H4SA 5DHFA 4QU0A 3FTEA 1WCIA 1OWNA 3GUZA 3SFTA 1OOEA 3EZYA 4F8JA 5JBNA 1G2IA 2RGCA 1AZTA 3KQTA 5COBA 3RRMA 4E13A 5BMVF 1QCZA 5HZGA 5IZ4A 1GZUA 1TW3A 3DTTA 2PNFA 1YUBA 4JP5A 4D43A 3MS2A 3DA8A 1W1WA 2IEBA 4ZOLF 3WNBA 3T5PA 1LCIA 1BA3A 3TVTA 1LSJA 4URUR 4GYJA 1ZFNA 3E4CA 4FFSA 3K9CA 4ZDJA 2WV9A 3ZHZA 5K99A 2JVIA 5A04A 1U1CA 3P0HA 1MB2A 3IUYA 3OT1B 2WIBA 3JWJA 3HLKA 5JSHA 1O9HA 3FR7A 4G8JA 4MVJE 2Z2JA 5HS6A 2VUHB 3CX8A 5KOJA 1AGYA 1HFEL 1UK7A 1MGPA 5B1SA 2V8OA 1EDBA 2A1TS 4QDJA 1N2EA 4W7IA 1LPBB 5A7HA 1ILEA 1KJ9A 3ZHOA 2B7LA 3JQGA 4K46A 1J5EB 1OFIA 1EK6A 4MUNA 4J2HA 5J4YA 1KQFA 5JNTA 4CLDA 1PEDA 2EYQA 2A9PA 3HL0A 2NPOA 4KSBA 2VI5A 3GCXA 1TCCA 1ETUA 2BHRA 4PSAA 1RZRA 4CM7A 3BQNB 5C0OE 1FU8A 1XU7A 1CDZA 1Y1PA 3KR0A 4TSFD 1XZGA 4UAJA 4XE5A 1XZKA 5EXTA 3SHWA 4FNMA 3TM4A 3TMKA 5BW8A 4EI9A 1DXYA 2H5JA 3LKZA 4AVYA 1W76A 2Q1WA 4FGUA 3KPWA 1V6AA 3N7TA 2YASA 3PQCA 4KBFA 4QFMA 4YASA 3RTGA 1GGEA 2Q21A 3MTGA 4QU5A 5F2EA 3JD0A 1A0OA 3OE1A 3U7QB 4ZVQA 2H4JA 3D3JA 2GGSA 4ZXPA 2O3JA 2WWFA 2ZFUA 3PFWO 4GMGA 4LY9A 3ZH2A 2QJWA 2B4RO 4JY7A 3BD6A 1MOZA 2BC9A 2AVNA 3D5QA 1ZOIA 3KX2A 1I36A 3P97A 4I5FA 1BMFA 4EECA 3W5BA 3PU6A 3WLLA 2GHTA 4PFJA 1L4LA 2IY9A 3GPIA 3PGXA 4OEHA 4KYUA 1A9YA 3OY2A 4OK6A 1R6UA 3S2YA 1LF0A 2OCLA 2FOLA 1TJ3A 2I3ZA 4F3RA 5KJEA 2LNDA 5FUYA 4EKDA 1ZC3A 1AGXA 1JG7A 1OLUB 2OCPA 3BN3A 4OB6A 5IG2A 3KE8A 4AKGA 1J0AA 1TTTA 4TLLB 4E2XA 1O08A 1SXJA 1L7MA 1AQ6A 2IYLD 3BTUA 3NTUA 3G0DA 7MHTA 2O8EB 3KAJA 1P72A 3IR6A 3IOMA 4F72A 5KVVA 1E6CA 4J0FA 1E7MA 2Z1DA 4RJ2A 2I7DA 5K0LA 2WJGA 3C39A 4DV0B 2CJXA 1MAVA 1EP1B 2HK8A 2PMDA 1EVKA 1JEAA 2AX4A 4L9AA 3QGMA 4QJIA 4YRRA 1NOIA 4P7GA 2LDXA 2GPJA 4CKYA 1DSSG 4L74A 2O48X 2W2OA 3AGPA 4R83A 4LJ7A 2YYZA 1PGPA 1G2PA 1GAWA 1P19A 3G5LA 1PS8A 3ZUPA 4LRTB 2IYUA 1TFUA 2NPIA 1FTSA 3N6RA 1U2QA 1QVAA 2GLXA 2PLNA 4GI7A 4BO1A 2HFJA 2YYYA 4M76B 4RJJA 4X1IA 4XUEA 1T5BA 3LAWA 4P7KA 2FPMA 5ALHA 1VLJA 3SZRA 3UYKA 2PX2A 1Z34A 4FR0A 3PT5A 1SCAA 2GCEA 1IOLA 1QK5A 3MWLA 5FO1A 2R1VB 1NXTA 3F6YA 4YONB 3P9ZA 2DR0A 3VTZA 2G1AA 4JLNA 1UPTA 4HRAA 2I2CA 3GLKA 4IF4A 3B2NA 5DGXA 4REOA 1QFXA 2RSLA 2NO9A 4BDTA 4BU0A 3FSRA 4PYLA 1ULAA 2EFHB 2EDCA 3A2LA 1N2CE 3H5LA 4M83A 5EPUA 3W5HA 4XD7D 3U7FB 1N36B 3EZNA 1SD2A 1NY5A 4DLUA 1DB3A 1QZTA 1RAAA 3E3OA 3JASA 4KQ9A 3U9TA 4JIMA 4CKEB 4Z0HO 2QR3A 1V5IA 3IXQA 1JS1X 5CPBA 2SNIE 5BN5B 2WYOA 2X86A 2IOQA 1WXWA 2QRLA 3FE2A 4OHBA 5JR3A 4M7WA 2B4TO 2XRMA 1PWXA 2FW6A 2HSGA 4MV7A 5C1IA 1UWVA 4KYVA 3AVYA 3L77A 3EXHB 4B87A 4ESOA 1T4CB 4BFCA 1SVSA 3LFTA 4LWPA 3IEMA 1NMEA 1LSSA 2EBUA 5EQDA 4A4DA 1P77A 2XYGA 3FPHA 1XTQA 1L4UA 1ADFA 2C2ZA 4HN4B 1RLOA 2O9JA 2R66A 2ODTX 4WNYA 5GVSA 2V0NA 4WXYB 2NSYA 3O2QB 4BB0A 2ZJ5A 1U0TA 2OPHA 1GZ6A 1YZGA 3L9XA 4BRWA 1DRJA 5LNK6 1C4WA 3WGJA 4IEIA 1HKHA 3Q3IA 3PJRA 4KFSA 4PPGA 1R4NA 4CU5A 5IT5A 1F7UA 1ZQ1A 3QX8A 2OB1A 2V6BA 1CE8B 3UXYA 5I7SA 4G09A 1X7ZB 1FJHA 3II6X 4IDFA 4Z9FA 1T1IA 3RCBA 2NVBA 1XVVA 1IQUA 1SXHA 4J43A 3UXEA 1UMDB 2RGDA 2PMFA 1IBMB 4EGSA 1HC7A 1GL9B 3LUDA 4OFZA 3R74A 1FPQA 2CNKA 1GA6A 2VJMB 3E15A 5EJ7A 1BJTA 3OOEA 2NX2A 3IT1A 3RJZA 3TIVA 1YR8A 3G6WA 4KR9A 2IYFA 4B9EA 4CCYB 4TKVA 1EEXB 1U0JA 1R0ZA 2QBYB 4EA6A 5G2OA 4DJ5X 4DDMA 5KIAA 3PENA 3UQYS 3ZXUB 1KH1A 1A88A 2ZQ5A 4M46A 1PFGA 4G3XA 4OLJA 4X8MA 3CVVA 5HFAA 5LNK1 1FUYB 3IUNA 1M2VA 3QEAZ 2IY7A 1JYSA 2BGKA 1ZAKA 3ZCVA 1Z15A 3MJEA 3QNMA 1O87A 1U9IA 1N2SA 4FMDB 1QYVA 2O7RA 3GJ3A 3PHCA 3KLNA 3VYUB 2JLBA 3R0JA 1MKYA 2WWTA 1EFHA 1J20A 3AB8A 2QUZA 3GBPA 4TL9A 1UZLA 2C57A 2C95A 2V7UA 4ZZ2A 4MP3A 4NHEA 4BFZA 4DR3B 1KSFX 3NDRA 1YUMA 1Z2NX 4NCIA 3S2SA 3QVKA 4GPTA 2X7HA 3M6UA 3AR7A 1MVOA 4D2IA 3UEOA 4RYLA 5FLEX 5J1SB 4BNTA 1M75A 4IDDA 4EHFA 5HR5A 3ZIAD 2WMYA 5AT1A 1KARA 2D7CA 1J0XO 1AXGA 4JEIA 2M6SA 2ZRGA 1T9AA 3EVFA 3HMQA 4AUEA 1A82A 1B0PA 2XMCA 3DV9A 1Z28A 1OI7A 3AHGA 4HWKA 5JYDA 2PZMA 3DNMA 1XRRA 5CR9A 3BCRA 1UPCA 2MWMA 2WSSD 3B85A 2O54A 4BQIA 2JFXA 5KNCD 5EJFA 3PZBA 5K3BA 5E0KB 3N2GB 4G4GA 3ZWKA 4W5NA 4RBNA 1TI7A 4ZCIA 4U9HS 4KWHA 2O0LA 2QX4A 1C80A 3GDHA 3KZNA 4RQAA 4WXPA 4Z4QA 1GGVA 4QGGA 1SD1A 3MTBA 4RNCA 2A67A 5BR8B 5T64A 3EY4A 1FEZA 5LN1A 2R6GA 4M86A 4X1KA 1FYXA 4E2ZA 4JUFA 3T54A 3QEJA 4PN3A 1LRKA 4TGLA 1ICEA 4Q7JB 1M8PA 2QL7A 1V8OA 3CX7A 3FFXA 1LKZA 4LV6A 5BR4A 1XB2A 2VDUE 3EC1A 3SKYA 4MUMA 5J47A 1M2HA 5TV2A 1HDGO 3WL8A 4FEEA 2YZ2A 2C4TA 2PFKA 4P54A 1K7EB 3CGGA 3IEKA 4R2LA 4OLAA 1MJFA 4YRLA 1A2OA 3AWDA 4K5QA 1CS4C 1KVSA 2XZPA 3NVDA 3VO2A 2L19A 4F8EA 4MLCA 1U0OC 3L8ZA 1L5LA 5JG7A 1MR3F 4QLBA 1T0BA 1E9SA 3M6IA 1DRVA 4DXDA 1CUEA 5A62A 3E53A 4WJZA 5KYUA 1O95C 1DMSA 3SLRA 2XF8A 3QKIA 1O96A 4X6UA 4OP2A 5FUXA 2G36A 4NV0A 1LBSA 4RCVA 1A8PA 2ZYTX 1XO1A 3DV0A 1HZZC 1SCKA 3QX7A 4H9GA 3K6JA 4J7AA 3CZ9A 2OB2A 1P74A 3QG5A 3LBFA 4DKXA 4RTPA 3ZLUA 1K66A 2PLRA 1S9HA 1CUSA 3I42A 3CVJA 3KHUA 1AKUA 2C9MA 1UBMS 1IJEA 3BKWA 2H0RA 1E77A 1M2EA 3KOOA 4JLWA 4KTVE 4R5MA 5L3SA 3WGKA 5DI3B 3OQIA 3QUAA 1T4BA 1SKYE 2VXOA 5AKGA 1N2BA 3D8TA 2WV7A 3QIAA 4B6SA 4IVPA 3KVOA 4X20B 3X2FA 4UMEA 3CVXA 3EFBA 3QTTA 4PLPA 1H4VB 4FN4A 5FADA 3KYBA 5CLIA 1UOOA 2HOQA 2PMWB 3A2MA 4TLMB 3NT4A 3RARA 1P39A 2O8EA 1JEDA 4OK5A 4YROA 4HWOA 1L4BA 1Y9AA 3UMBA 3VR6D 1C30B 4QUIA 1ZJZA 4ZO9A 3WWYA 3LY5A 2D1FA 3PG5A 5JW6A 4IDGA 2Q5EA 3C3PA 1PS0A 5CURA 3ESYA 3KYDA 4LI3X 1KFCB 3HZRA 2DPLA 3VDMA 2AZ4A 1Z6TA 4I1PA 1VJDA 1RP1A 2IXTA 5HIMA 1Q17A 3VSCA 4DT1A 3GAFA 2GKGA 1DKOA 4EJ2A 5FV7A 2GILA 1AB5A 4FW8A 2A4MA 3CRVA 3JW8A 1PJ2A 1QTRA 4JJFA 1E5DA 3KAQA 1JG2A 2BKVA 4RAOA 3FCSB 4U7FA 4YLGA 5JDCA 3R3HA 4Z8XA 1L5OA 2WINI 3W0LB 1E4EB 1GRRA 1CLEA 2PFGA 4NJEB 3WSWA 3CLVA 3W6PA 1QGED 4LMBA 2IZ7A 1UC8A 3IKTA 2FFRA 3NTVA 4FE3A 2B1IA 3FAZA 5DMHA 1EUCA 3CT4A 3HJUA 1RBMA 3BIOA 4S24A 4IYRA 1FUIA 2WJJA 4FBGA 2WFLB 4UQPA 3TECE 4C2UA 1XD9A 2HA4A 3D7MA 3QE3A 4L4UA 3IH5A 3LX5A 4Z7QB 1VB3A 4A0GA 4K9MA 3SNHA 2HRRA 1R6AA 4HKTA 4QWWA 5AW1A 1PJLA 1UFKA 1GTMA 3HB5X 4EVQA 3KTOA 3HB9A 2I54A 3WFIA 4I5DA 2EW1A 2G7ZA 2QP3A 3VA7A 1C29B 2K7ZA 3NIWA 3GUHA 5AXCA 2DLCX 2Z9CA 4CKZA 1POWA 2TECE 4D02A 3FWZA 4PZPA 1PT9A 1G42A 1OHHD 2DPHA 4JB8A 5AKIA 2PMEA 3MGAA 4WCFA 2QSJA 3TOZA 2M2IA 1IZ7A 4INZA 4OLHA 3LQKA 3ZTWA 2JEOA 5CX1B 3UGTA 4LSWA 3GJ5A 3O91A 1XXHB 1WZUA 2VQDA 3E5NA 1E64A 3ETEA 3ZJYA 3Q8WA 4EEXA 3SQDA 3T7CA 3HEBA 4NYMR 3B6MA 3BK7A 1M2GA 3GYBA 1N2ZA 3QPCA 4J1SA 2K87A 4Y2VA 4CT0A 4EX7A 1MOQA 5KINB 3ANLA 5FNVB 3A6DA 3PE6A 2DY0A 1JSXA 4OHRA 5EZ6B 2WJ3A 4XOUA 1EX9A 3K09C 3LIIA 1GKYA 3NLLA 2B37A 2WJVA 1QANA 3SXUB 1J49A 2C2BA 4W9NA 5CB6A 1XJ5A 4TWBA 5EE3A 2GJAA 5AOBA 2XA2A 5TQVA 1NTRA 1QHGA 2C2WA 3P0RA 3UJDA 3BWYA 4BC1A 1USWA 1JXAA 1O57A 2ZUBA 5CDYA 2XNKA 3EVAA 2J7PD 4U2EA 5JC8A 1NBME 1L1QA 1PV1A 3G0GA 2H65A 3KYCB 3OJWA 3TTXA 4DMGA 2V0GA 3LCCA 4M53A 2IXFA 3DFUA 1GZDA 4MV9A 3L6OO 4D4JA 5KC9A 3GLIA 3SY8A 1GNSA 4DQLA 2FKNA 3BF7A 3RK0A 3H9UA 1VXOA 4KAAA 5DX1A 1G38A 3AF5A 3OG9A 4CWAA 2XCSB 2GRAA 2XDQA 2R6AA 2ZDHA 2H29A 4DLPA 2JH9A 4BNVA 5JT1A 5E8JA 5FKJA 1QG0A 3HO1A 3A3PA 1XKXA 1EFRA 1MEJA 4L5AA 4BE4A 1Q0TA 2B9EA 3TQRA 3AEQA 3UMYA 2EZ9A 1RHQA 1ZNQO 2HMUA 5CJ2A 3AU8A 3B5EA 3DDNA 3I2FA 1ISGA 1QVRA 2BELA 4M8SA 1PX0A 1PJQA 1TT7A 5FLYA 2JAUA 5EJIA 1DJNA 3ELBA 2DP4E 2ET6A 3OCXA 1R8JA 2FAXA 2FW1A 4QWMA 3WLTA 4UDYX 1SCNE 1H4TA 1OYYA 2LR0A 3LT1A 4X3CA 3BFVA 3M5WA 3PK0A 3LW7A 4JX8A 2PWAA 3NC1C 2XCIA 3HA7A 4UARA 1L4GA 4DLVA 4E5YA 2Q0XA 1X8XA 4HLDA 2YMLA 3ZOZA 4BNFA 4QODA 3EUFA 3QP9A 5DN6D 3UBMA 3HCFA 5AK4A 1P4AA 4WACA 4D3DA 2ZTSA 3GARA 2IYPA 3BSFA 4NONA 2OFPA 4G1FA 3VI3B 1QP0A 1SC1A 4G89A 2AI3A 3ZHCA 3AUXA 3PF9A 1F6WA 4FDVA 3NPMA 2AG5A 3PA8A 5AI8A 1QOQB 4TN5A 3KZVA 4ZOLB 5KAPA 5J3JA 3NW9A 1QX3A 3F6CA 5DHQA 2QGNA 1Z88A 3Q3GE 1K8RA 4JYBA 1CY6A 5K8LA 2G09A 1HMYA 4LRSB 3F47A 1N6HA 2FLVA 3L9WA 4BGUA 4LYAA 2ZIGA 2VK1A 4XH9B 4DV2B 1GPBA 4GFDA 5GINE 2PJRA 4ZI7F 1A1SA 1U7TA 1W1UA 2DFDA 4KH0A 1XRJA 2PGIA 1Y6ZA 5AKZA 5EJGA 2XA1A 4B3MB 2WF5A 2IZ5A 5BWMA 2IE0A 1QLHA 4BNJA 4Q19A 2WB4A 3HKCA 3MB5A 4B6EA 3BT7A 2B2XA 2XRYA 3NETA 2VP6A 4H7IA 1XD8A 4H18A 4ARAA 4GVPA 3KFXA 4Y2XA 1A1VA 2RC6A 3NBMA 1HPLA 4Y7CA 3F5FA 1X9HA 1XELA 3HR8A 4B2PA 1ZM4A 4QTXA 4EFMA 4PQFA 2BRUA 3UAWA 4D9NA 2QJFA 4DANA 1QZXA 4MMXB 3IFSA 2GK6A 5T8KC 4U0KA 4QEZA 2Q3FA 2VF7A 4MYCA 4ZPXA 5DGCA 1U0EA 4V39A 3MRVA 4PG5A 4RETA 5KYKA 2EC5A 1VLZA 2ABWA 2PXHA 2C5EA 3D3NA 4BTLA 3OURA 2F3UA 5T3YA 2WIFA 4UTXA 1ULUA 2W70A 1JEEA 5HKKA 5KQSA 3PXUA 2E5WA 3KKMA 4LOHA 1Z2AA 4PHTA 3TLGB 4RTLA 1K89A 3PC3A 3NXSA 1JDTA 1SU7A 2QX7A 2YJ5A 3ODGA 4JLVA 1PRYA 4JOCA 1RW4A 4EO9A 3QUQA 4GEGA 3L79A 4X66B 1BW9A 1RQGA 4JITA 2ZS8A 1G8KA 1M0WA 1AN0A 2WUEA 3F1KA 5GOTA 4EYKA 3R7FA 4MMZB 5IX8A 2D62A 1WXQA 5EQJB 1Y1SA 2V96A 2OLEA 3GRRA 1E2MA 4IDEA 5AM4A 5K0SA 5CAEA 2IU4A 3DE0X 3HU3A 1ZL2A 4D44A 1T1GA 5JASA 5T4FA 1ZH2A 3L7NA 3K6KA 4DA0A 3ISTA 4XJVA 1XEXB 3PF8A 5DZSA 5M7EA 3S2ZA 2R8XA 1KOGA 2EARA 4XLLA 2EW8A 4LHVA 4I50A 4QHYA 4E07A 4L7VA 1EE2A 3QYFA 1T3TA 3INGA 1YQ9A 2I34A 1QQBA 1FFXB 3BD9A 3E58A 3BDIA 4LZNA 4CCWA 3LMKA 3RVMA 1VSUA 4LQDA 4Q82A 1FQJA 1W6UA 3D8HA 3EYWA 4KC0A 5KOIA 1K2WA 3W3ZB 1TEVA 2FZEA 4O0MA 3E48A 1FC0A 1TVCA 4GE3A 3E3NA 4V0OA 4C07A 3O94A 3SEFA 3LDFA 1HDYA 1QJ4A 4UMDA 3T7IA 3L1IA 4NIMA 2GM5A 1Z83A 4GR4A 4IGFA 3RYFA 3TW8B 2NIPA 3FPSA 2WPNA 3CZCA 2YHIA 2BGIA 2GNAA 1IBRA 1BWQA 2P9CA 4PSDA 1FNBA 1UJCA 2COUA 4O4HA 3O31A 3I32A 4CEJB 1HEYA 1HO3A 3DPUA 4PTYA 2PH5A 3SI7A 1KDOA 5IBRA 2WDZA 1XZHA 5FYQA 3QPVA 5CM8B 2G7MC 2PXAA 1LX7A 3S8YA 3DFMA 1IB6A 3IAM1 3KQSA 4BWVA 3KJHA 2F55A 3L02A 2J9XB 1KC1A 4RTJA 2H1LA 2XUPA 4ZANA 3TUIC 3N2KB 1FSGA 3S0JA 4EZEA 1IDOA 2WWWA 1U90A 3RF6A 3REQB 1W4AA 3AHDA 5AMXA 4CXMA 5DK6A 2QAGA 1C0KA 4CIVA 4X8OA 3QUCA 3MJTA 2QRVB 2QZPA 1VGRA 5CBPA 1A5TA 2ZT7A 2IYWA 1WCWA 2W2XA 4K9RA 4OHWA 5G1NA 1BS9A 2J3QA 3IR5A 1NVDA 1ZH8A 3FRHA 3FYUC 1XZDA 3KB6A 3NM6B 4KN5A 4R98A 3A4LA 2QZZA 2W4MA 3BL5A 3Q7PA 5H82A 2AC7A 4LMRA 1F4PA 3WLEA 4P8RA 5CFLA 4JLOA 1K5PA 4O1MA 3FNHA 1GT91 4TTRA 3V5NA 1Z5WA 3LNTA 1QQ5A 2XKAA 3FGOA 2NG1A 4OMCA 3GVHA 4XSHA 4BJ6A 5GTDA 4GIBA 4GG1A 1N2XA 3KL4A 3RBVA 4RY8A 4MHOA 1GLGA 4O1IA 4D5EA 3MVEA 1Y8ZA 1VE9A 1SH7A 2XVXA 4GLJA 2J0VA 4TMYA 5H70A 3PHGA 4FYIA 5DKFA 2HMSA 1EP9A 3WMXA 3AHCA 3EIHA 5HRAA 1G20B 1I7DA 5KX5A 2QTWB 4ARZB 1OH5A 2FFJA 2E82A 1ZK0A 5FI1B 1XMQB 1WLSA 3QPAA 4PZZA 3KZCA 1CB7A 2X1VA 1HDRA 4FLFA 1IBCA 1VZ3A 5FUMA 4AZ0A 1K7XB 5BRAA 1UJNA 1AHHA 1EXNA 3CR3C 4IVQA 3SIXA 3SZUA 2IEYA 3EF1A 3HGTA 3SC6A 4HYTA 3CEPB 4BKUA 4MPPA 4B7ZA 3HVRA 4N0EA 1M1YE 4UUOA 5BN3A 4EWLA 2A5FA 1GILA 3DZCA 5J4LA 2FOIA 2JJ1A 4FN5A 2ID7A 2WU8A 1GG5A 1LBQA 3NYIA 1A8HA 3CE6A 4M2LA 4N7MA 3SU8A 4LVUA 3VH2A 4EAAA 3A28A 1NR7A 1V4VA 4MSUA 5IAAA 2QNRA 2PD4A 3V1UA 3Q4GA 2BW0A 4E7OA 4F9FA 4HDSA 4DIOA 4UCFA 1XZCA 4FDTA 5DNWA 3UWKA 3BTSA 2FSVA 4GQIA 2IU0A 4O8CA 3BMCA 4YI5A 2JD1A 2XE6A 1N2OA 3VKGA 1D2MA 3MK31 1F5NA 4XX0A 2VS1A 3O8QB 2QD5A 3LBNA 4K9KA 1ULSA 2V7VA 2YICA 5C37A 3GZTB 2FN9A 3MLEA 3PNOA 4G0PA 3KKLA 3U3OA 4I4TF 1T4DA 3L7IA 3OD1A 4E70A 2BF4A 1CEEA 1YR1A 2Y92A 2IUFA 4QARA 3A9UA 3SC2A 4GKBA 3DR3A 1MV8A 1JEQA 2O1XA 2Y1XA 3M9LA 1JMKC 3GGSA 1Z4OA 3AOEC 4Q03A 3VR1A 3ZW7A 2V98A 4E22A 2MT9A 3FHTA 2ZJBA 2WF9A 4TZ6A 4XWTA 4DWWA 4YQFA 5JMTA 1RZRD 2B8NA 3ERCA 1EH5A 2UYGA 2ZRKA 2VYFA 1J6UA 2XVZA 1DOAA 4Q3CA 5DM2A 3EPJA 3L0IB 5BQFA 1BHQ1 3HA5A 3RVBA 3DFZA 4A7PA 3EC2A 1K7CA 3IPYA 2FWBA 2OHXA 3PJGA 1QWOA 4K05A 3VU1A 2Q9UA 4BAZA 1I3MA 3EAGA 4DCMA 1BMTA 1I7PA 2ONCA 3H1TA 1XZIA 2EV9A 3OE4A 3WNDA 1ENOA 5BQXA 5LQCA 3BBLA 1LX6A 5AQEA 4QL3A 4FGWA 2JKYA 2YINC 3PD1A 3NP7A 2XOEA 3OZSA 2CVHA 4JUCA 4KO3S 1PBTA 2AXPA 3RG2A 4DCTA 4E6PA 3SGLA 3DKVA 3FHLA 3ZCPA 3PEYA 4MR8A 4PIVA 2F3RA 3ANNA 5ANRB 5LQDA 1VP9A 4ES6A 2GN8A 4I50B 1ADGA 4CV0A 2PGXA 3EMVA 3GBVA 5FBZA 5JZOA 1XWWA 1CY0A 4EI8A 3KCNA 1NYRA 2ST1A 5JDIA 5JAIA 2GCGA 3RVQA 1WMAA 3B3FA 1ML4A 5IMBA 3GF4A 5AM0A 2C4KA 3NANA 1PW7A 1P73A 1GFSA 1REQA 2BLLA 1MABB 3ASYA 1UJ2A 1E9EA 1W4LA 3GXBA 2VZEA 1RI1A 2PBLA 1Z4LA 1Z07A 2KYRA 3CSDA 1CV2A 1SPBS 3GVCA 3PS9A 2FTKE 1QNFA 1B41A 4M1QA 4X7RA 5D85A 4DB4A 2ZJZA 4DNXA 1YZQA 1YOVB 2FPXA 4LYYA 1AKVA 3BYZA 1GAJA 4M8IA 1LA2A 3DHEA 1GYRA 4B6GA 5GZ6A 2HIHA 5TQ0A 1VL5A 3GD5A 3IO5A 4G0UA 2ZRIA 4OUDA 1I3LA 1Y3AA 1CVRA 3JALB 4IFIA 2Y0PA 2ZZNA 1GQSA 2PKQP 3NO4A 3RVSA 3JSAA 2EXXA 4LF8B 1YONA 3JQ8B 3HEMA 4MUYA 2ZJOA 1HQDA 1CUYA 3GEEA 1Z0IA 4TLBA 3WQBA 4B2YA 3K70C 3ZJTA 3M70A 4R2XA 1YU9A 3LM8A 4PLVA 4JI0B 4Y8VA 3OLYA 4Q47A 3DOEA 4QLOA 5HWSA 4TXMA 4LC0A 4YMSA 2Q9CA 1JHZA 1AN9A 3GP5A 1Z5VA 2GCNA 1J00A 3H1FA 3LDAA 4G1MB 4UD6A 4QGSA 1EAYA 1QTNA 1IN5A 1SU4A 3E81A 1I0LA 4ISCA 4FD3A 3JPWA 3FZGA 2W6ID 4BRZA 1P2DA 3RW9A 2RHDA 2PZAA 3TZCA 2YMQA 1JR6A 1TT5A 3QUSA 1H5QA 3ZD8A 5KTNA 3VR2A 3BSYA 2ZYAA 3I5UA 4X44A 1ZKMA 3TLBA 4TVSA 4RTMA 3TLMA 3W06A 2I3BA 3H1GA 3KT3A 1GEEA 2IHYA 4W7HA 4RANA 4XEHA 3K4PA 4G0ZA 4P4SB 5JCJA 3ANXA 4BBPA 4DPMA 4IJKA 3RD5A 2QY9A 5EXEA 4K81B 3DYVA 1H94A 1JEQB 2B4AA 4MI6A 3SYRA 4OSPA 2BM1A 2WU1A 3ADDA 4TQAA 3AEZA 3H4MA 3FDZA 2PXCA 1CJSA 3N76A 4P38A 4N3GA 3M6XA 2V6IA 2ROQA 3CPSA 3GT3A 1QU2A 1YGYA 1TM2A 3HBAA 3K0CA 3L0BA 1VKOA 4J8PA 4UOZA 3TE7A 1TTHA 2FX2A 1YGPA 4JK3A 4J16A 1B15A 1JA9A 2H9YA 2SKCA 3CZQA 3FMFA 3KOXA 4S1NA 5JO9A 4C03A 4RTNA 1YDGA 2P5YA 3MFYA 4HLUA 1DT3A 3RVKA 3WWPA 3DBRB 2QTNA 1E8NA 2B5VA 4GBMA 5DHPA 3ZBQA 4DLKA 1ZUWA 2CUKA 2H5LA 2AXQA 2J8ZA 3JVUA 3K5HA 4II3A 1SBQA 4RENA 3ROZA 2AT1A 3TIIA 5AVXA 5HIAA 4ID3A 5JD3A 3K4QA 2XTMA 3LSTA 5JLAA 1NKTA 3HL4A 2X7XA 3EY9A 3WMWA 3P9CA 4P3YA 1EWKA 2IBTA 2QYTA 2HQBA 2AYYA 3QE2A 4EZBA 1EFLA 3W6UA 3UUWA 4MA5A 1Q0RA 1CQIB 1ZI6A 2O8VA 4HGZA 4IQGA 1TM4E 1KO8A 1A69A 4EKYA 4JGGA 4LNUB 4O2RA 1R9NA 3D5EA 1XZFA 5LJLA 2H2WA 2C96A 1DVRA 2I2XB 2RB4A 2W2NA 2NVUA 2XAAA 4G37A 1LBTA 16PKA 2I1LA 4L0QA 5DEOA 3V7NA 5LB4A 4D8TA 1UAYA 2HKIA 3VYVA 4EM6A 4WOJA 4ALKA 4AG5A 3H1PA 4ICIA 3M6FA 1YK0A 2PZ8A 1E1RA 1JSCA 2FP4A 3IAFA 1SKUA 5FNVF 1RWBA 3OE7D 1PSWA 5KCMA 2XUJA 2ECOA 3GPCA 3M4JA 1FMLA 1D8TA 1H1TA 1EFVB 2CXPA 3GN2A 3INNA 3MMSA 1HG0A 1E69A 2Q4BA 3P1JA 4Y18A 1W0KD 5A0TA 1W48A 2AHOA 2HUNA 3ADKA 4IOLA 4R1OA 1F8XA 5JXGA 1W59A 2ZT5A 3JQAB 1P7CA 1BWSA 3G79A 4E3WA 5E7JA 4D8UA 3VNRA 4GC9A 1P61B 3GZNB 4LMAA 2BZGA 3VNBA 4RLHA 1WDTA 3D59A 2XWBF 3GLTA 1O5TA 4AAYA 1M8JA 1QVWA 3UK7A 5AXBA 5CK5A 1C8BA 2H8KA 4BIIA 5C4GB 3C7KA 3V2IA 2R2GA 3KJZA 4ND8A 1SMKA 3T5TA 3AVXA 4H1HA 3OJ0A 3CCFA 3F74A 5F4BA 4A0HA 4X45A 3VKFA 4FYXA 1T34A 2ZDQA 2Z09A 2YV2A 1J5XA 1XF1A 3BILA 4URYR 4AKIA 1NE7A 4YGYA 1WPRA 3HQ4O 4A2PA 1KDZA 5JANA 4B5KA 5E9WA 1TJ5A 3CX6A 1CJKC 2R3SA 2TSYB 2HZ7A 4GM1A 5J1TB 4OXQA 3I12A 2A0FA 1KTVA 2VH5R 4EOGA 1EK1A 5DCWA 4HVLA 4Y9DA 5L51A 1VL8A 4WK0B 4CV2A 1L5YA 2OBBA 4S3MA 1S5PA 4TL7A 4HN9A 1KPGA 3FX2A 5A3SA 3TUJC 3X1KA 3Q3JB 4E88A 4ZGBA 2CD9A 3AERB 4DLZA 3UCEA 1H8EA 5JJBA 1IZ8A 2PDAA 3ZCTA 4W7SA 4ZCLA 3RHTA 4L28A 3CCCA 4RFVA 2H2IA 5BQPA 4XWWA 1CF4A 3WWZA 2QX6A 2VO1A 3D8UA 3OTQA 2HXGA 3ZHQA 2ZSHA 4EI2A 2XMGA 1C0PA 4G2TA 2I33A 3ON5A 4PFSA 3EXIA 2OD2A 4QGFA 4BKRA 4BVHA 4NFHA 1NJ1A 1H3FA 4ZHSA 5REQB 2AQ8A 2PWZA 4IWXA 4S0XA 1LQTA 1L5ZA 3L1UA 5LKAA 3M33A 2PKCA 4TKMA 1JTFA 1YVRA 1A5AB 3K1YA 3TSYA 5TXGA 2I2FA 2R62A 1C7IA 3PEUA 1NKVA 4G4SO 1XWIA 4CTOA 1KEEA 2ORIA 2HZBA 2Z98A 4IJWA 2B4YA 1NYLA 2QM0A 2WSBA 3QI2A 4TLCA 1EINA 2X4GA 4MHSA 1XZPA 2XJ4A 3IT2A 2VPWA 1FUKA 1V9LA 2XGGA 3D54D 4CE6A 1M0SA 3ZN2A 1RKVA 1WXIA 1XTKA 1N3LA 4JBXA 3FOAA 2BUCA 2O2ZA 2PKRA 3BORA 3GFOA 4RHXA 2Z5FA 1D0IA 3AHFA 5FO0A 4OJNA 3MLAA 4PG4A 3I04A 1Z35A 4EUNA 4EIWA 1IYZA 5KEIA 4GLLA 1LW7A 4EUFA 3H9BA 3ER6A 4YS6A 2QL6A 4DC0A 4WJLA 2CB9A 1M6EX 2QD1A 2O7QA 4G5OA 5KZMB 2HHCA 2HU8A 4KQ1A 5K2MA 1WULS 3LX6A 5JZBA 2O4CA 3OPNA 3NPAA 1JIUA 2QG6A 1ZA2A 2MSLA 4D56A 3SR0A 2OPBA 4GKJB 3A1WA 3PL5A 4OP3A 2RGUA 2QTZA 3SSOA 1U4OA 2QTMA 2ZWOA 4UKDA 5IJAA 1I9CA 3CEJA 1XC7A 1CE8A 2OECA 5IC5A 4WZBA 4CN9A 3PHBE 4FYPA 4LFAB 4OIMA 1OI2A 3GELA 3U9SA 4DWOA 1JWLA 1G7SA 2FEWB 4UDNA 1MH9A 1SQ0A 1UBOS 1GCGA 4B09A 3TBKA 4D9EA 1WHTB 5EKSA 3OETA 3ZU3A 4AX8A 1TMOA 1LUAA 3ONFA 1KOLA 5BNTA 3QJYA 2JVKA 4I55A 2ZSKA 1CP3A 3GRVA 3NWEA 1J39A 1GPYA 3AVOA 3BREA 1FNMA 2YCBA 2IDZA 3ASVA 3L7DA 3TE6A 2WNSA 4AUMA 5B7GA 2XD4A 5A2GA 2B8TA 3EA4A 2OESA 4F06A 1NI5A 2WILA 1GA1A 1RM5A 1RPTA 1MO3A 2A2ZA 2O23A 2P1RA 2X76A 4IMJB 4OREX 1BA2A 2YMPA 4DWJA 2I71A 3E7DA 4PHFA 4MPRA 1XPUA 2ZATA 2ADOA 3CB4A 1ZITA 3FUCA 1EHIA 4FU0A 3WIEA 2MR5A 4CUZA 1II0A 3AM1A 1BCSB 4BAGA 1CZKA 3THSA 2UYCA 2X8AA 4WXRA 2PNJA 4PYQA 4AROA 5B53A 5JFGA 1R0WA 2XZTA 3WB2A 1I3OA 1JHAA 1SK8A 1UQRA 2J3IA 5DYWA 3HCNA 1CQJB 2FPIA 1M2OB 1PZGA 3BG5A 4HXGA 4ZOCA 1L5QA 5J5AA 4TUYB 4TM8A 2XZLA 2V9PA 2AMLA 2FGKA 2R00A 2D0OB 1WM1A 1TYEB 5JVDB 3TN7A 2F59A 4M1YA 4HFNA 2I65A 4RE5A 4NYJQ 4DMFA 1A9XA 2IEIA 1XRPA 3DKKA 5BWBA 1ZCBA 2C5LA 5KCZA 4JJ4A 3UH1A 3NHMA 2EX4A 4FOOA 2E1RA 4D9KA 1KI7A 5IM5A 4K88A 2JHPA 3RUDA 3O1JC 1Z5PA 1R6XA 1DG1G 1W2HA 3U7GA 1N0WA 1J2UA 1QF7A 2IH4A 2FSHA 3L7MA 1E5VA 2XT9A 1L7BA 2IVFA 4HFJA 3Q9NA 1L8AA 2HJSA 1VPVA 2C03A 3O9MA 2BM0A 4OXXA 3F8TA 5F7ZA 2G06A 1WG8A 4B4DA 2DECA 4XWAA 2CXRA 3QV2A 1X3SA 1U2DA 2B2CA 4OI2A 1L5WA 3M2PA 3KEQA 4DEXA 3DD1A 3AETB 1XUOA 4ZT4A 2I2AA 4BB6A 1JYFA 3TNYA 3CX4A 5F33A 5D7NA 3OU6A 2Q8QA 4WH0A 1JI0A 1NV8A 3SVZA 3RRBA 2R48A 1EX6A 2VRCA 3LY7A 1P2TA 5KSYA 1E1MA 1TIKA 2C8LA 1GNPA 2Q4DA 2ZJ7A 4K2AA 5FTWA 3WKEA 1I4TD 1V8PA 5K3DA 4FYMA 4WA7A 4G9BA 1U11A 1PUIA 3AM3A 3SFZA 5GIPE 5BV7A 2WK1A 5LQSA 3HP4A 4CMCA 2G0AA 4NVRA 1J99A 1NF3A 1ZUHA 2C2OA 2FJ0A 2Q7XA 5TGDA 4L7QA 5EMMA 4V3BA 3OJFA 4CLEA 1U8AA 4CIDA 1HE8B 1NBAA 4GM0A 4L4YA 3LT4A 3M4XA 4D4GA 2HLDD 2B8WA 1PLJA 2ZB3A 4J75A 1EGVB 4KN8A 4M54A 3FKSD 3V8VA 3BMNB 3KYJB 5I5EA 1C8KA 4TT3A 3AT1A 3GVPA 3LRTA 4CL8A 4OA5A 1KYTA 2I4TA 3U9LA 1QDLB 2YC2C 5C5DA 4TL6A 3JWEA 4TZTA 2GAAA 4PYMA 4YDRA 1FTWA 2XIJA 1PL8A 2RK3A 1AM4D 4LZZA 4R0VA 1DAEA 4R1PA 5EWJA 3RRYA 4EJMA 5CB0A 3KP1A 2CXSA 1XTPA 4HBZA 2NPFA 3TGLA 1XLTC 1M7BA 4ND8B 3ZXIA 1ONBA 2Q4TA 3AV3A 1ZK1A 4ZVVA 4BNUA 3PYXA 2JGIA 1TNDA 2D2XA 3PV0A 4W1QA 4AZTA 2KBFA 5LYJB 2QL9A 4I6GA 4P7BA 3QVOA 1LY1A 1V8BA 1B93A 4BVKA 1PVDA 5TVGA 1KA9H 3CCBA 4MJXA 5TPZD 1W47A 1MA3A 2HPAA 3AGQA 3H87A 4OMUA 5FL3A 3ZU5A 4DEVA 5KQPA 2QMOA 4BNIA 4JC0A 5SY4A 3IA7A 1MC1A 1WE2A 4HPWA 1Y89A 3RM3A 1VYTA 5DW3A 3SJ7A 1CZUA 3WGHA 1VSVA 2E87A 2GBLA 2R7LA 5AHOA 2HF7A 3FHOA 1COWD 4J0DA 3VR5A 3OE7A 4ZTZB 1H2EA 3IIIA 4RE6A 5LSAA 5A4KA 5AJZA 3UAVA 4UHFA 4JBWA 4CKCA 1W0KA 2PKYX 4IIVA 4PGHA 3TJZA 1UZAA 3UFBA 1IY9A 5J9FA 3KQNA 4ZCSA 2CLSA 5FWDA 5B4TA 3JATA 5E2BA 5ARBA 4YUYA 1IZZA 2FDXA 4BBZA 4C6RA 2H1WA 2XOKD 5FNVA 4LG1A 3HDVA 3R9IA 4MRRA 4FGLA 3HKEB 4ALLA 5IYZF 3R3WA 5CA1B 1BX3A 1VPDA 2VL7A 3S29A 4Y3UA 4HK4A 4D81A 1N78A 5BW4A 2QXTA 3MJVA 2EJUA 3FBGA 3TJMA 3VH3A 3V4RA 4QOFA 1NP6A 4UEKA 4RTSA 1XEXA 4K6GA 3R4CA 1QX4A 5TGZA 4QYWA 3UW3A 1UPUA 2WUGA 4QUGA 2BVNA 1NBWB 4DCOA 2WTAA 1IJFA 3E9DA 4PGMA 1KY2A 1ZVVA 2NXJA 1XMPA 2WP0A 2WOJA 4E5KA 2QB5A 2AG1A 1NVXQ 3KFVA 3R6DA 1W36C 3NI2A 5K0NA 2EP5A 1W29A 3BB1A 1JJFA 3RVDA 4CUKA 4H77A 3ZS8A 4UNRA 1I7NA 1KO5A 1SKBA 2D59A 1J2TA 2JIZA 4AF7A 4UUPA 4HVCA 1VKHA 1UQTA 3GUCA 1JFVA 4ZU1X 3JQ9C 4D26A 3GT0A 2G6TA 4IXNA 4Y30A 4BCDA 5BUCA 4LHWA 4DDWA 1OLSA 4ND4A 1J21A 1OHHA 5EUCA 4JHXA 2IOHA 3U4QB 1XAIA 3IXMA 5DNDA 3CUKA 3AG5A 4J6FA 2IS2A 3OIVA 4G0QA 4X3OA 3SZOA 5AJXA 3TGWA 2J07A 2BR3A 1I6WA 2V7BA 4FHCA 3D9QX 1RADA 3BICA 5HUJA 1OBFO 5ALOA 1PFVA 2EHDA 1XJ0A 3HA3A 1HFKA 5AICA 2YOFA 3FTQA 3CLUC 3R8CA 3SICE 2NO0A 1UMDA 1KR2A 4J29A 4XQEA 5JSFA 4BMOB 3IULA 3L7CA 3JVVA 1QP8A 1ZEMA 4BLWA 1K6XA 3IP7A 5HBGA 4Q1VA 5IM4A 5EWJB 3ZV5A 4K40A 2PVSA 1M1ZA 1Z4KA 2A3NA 3DQQA 4HDMB 2GTPA 2FX5A 1C30A 1USVA 2F1HA 4K9DA 4U5XA 4ZT3A 4CM4B 2G1KA 5M04A 2ADFA 3MCVA 4QM6A 1Q92A 3IP1A 2F8MA 5LXTF 4GPIB 5FNZA 1YZYA 4N6NA 3TIXB 4F71A 4BLRA 2O4UX 4ENUA 5BVHB 1ZLXA 3L7OA 4JVSB 3UK6A 1ZH4A 5FORA 1IUNA 2R7MA 4ZPJA 3WMRA 1T4CA 1TXGA 4URZR 1DARA 3IYLW 2L42A 5EMLA 4KR0A 5LDHA 4RVUA 1G3RA 4ZEVA 1AHPA 2AN4A 1Q22A 3OM9A 4DUZB 4TQGA 3AJ8A 2R96A 1B2LA 1XXHE 5TSDA 1G4AE 3C8DA 1ZM7A 3WYGA 1T9BA 2JGLA 3BWDD 3QKSB 4TYWA 2A0YA 2BZSA 2Q6VA 4CTJA 2O19A 3AU9A 2C4MA 2E37A 1F3OA 1UQUA 1S89A 1VSQA 2AN1A 1NW9B 4O08A 3FNRA 5I6DA 4XASA 1YFZA 4N76A 3VOBA 4BMNA 3SSAA 3AQ4A 3C14C 5EHNA 2GN6A 5DM60 1KC3A 3FVRA 4MRVA 2Z9BA 1C7EA 2JFBA 3NT5A 4U00A 4WZAA 5EOVA 1VIAA 2VNIA 3CY6A 1TF7A 2FKAA 2H0AA 3GLRA 3UV3A 4N1AA 2WZQA 5JYCA 4GLOA 1YT5A 3U7EB 2W6ZA 4Z4GA 2JVJA 2ZBPA 4JNCA 1K5HA 4IWYA 4JYCA 1T4GA 2O0JA 1A9PA 3MTIA 4CHTA 3Q3VA 4AJ2A 1AUQA 4ZCMA 3TSZA 4YXWA 4HZIA 3P2JA 4B3RB 3CF6R 3LW8A 4W5JA 3DHVA 1IN8A 3QKSA 5DO9A 3SN6A 2QXYA 2YYAA 1N4DA 3G0OA 1RWMA 1RKXA 2GEDA 2VJMA 2ZRJA 3PFNA 4R2WA 5A0FA 4YHHB 5MFPA 3PEWA 1JFTA 4C0JA 1Q21A 3PQ7A 5G4LA 3IDQA 4FFRA 2YBDA 5JBQA 4M6WB 4W5QA 1WQ4A 2BZ1A 1FB5A 5CX1A 3IERA 2PS0A 3A9RA 3PNSA 1M34A 2A1UA 3LVQE 5LP6C 2I6QA 1XD2B 2OZEA 3SEQA 4F5DA 3NHSA 3OLWA 3DL0A 4RD1A 3BZBA 4TS1A 2QF7A 3HKCB 3LQ1A 4DBZA 2HLPA 1YS6A 3A4MA 3KQPA 2JIQA 5EEHA 4DA9A 1DC7A 2EFGA 3BXZA 2NQTA 1IRIA 1QC5A 4QYIB 3AVTA 4C7OB 2CF6A 5CD9A 1Z6ZA 1PZHA 5CB8A 2O2SA 4BO0A 1KQ3A 3KSUA 4M9UA 1E63A 1N0UA 1JILA 5DNCA 3UPTA 1A8SA 2HPZA 5B3LA 5KS2A 2WTBA 3C3KA 5DCUA 2GWHA 1JNYA 1PD1A 2NLOA 1IVNA 4F93B 1GQQA 4W8OA 2PD6A 2YV5A 5A9RA 3LLCA 2HQOA 3V8EA 1LDNA 4Q3DA 3RF7A 2UUOA 3LOPA 2VT7A 5EIFA 4Z0TA 5D86A 3K5IA 5GM2A 4DSUA 5FL7A 1OBCA 2HWWA 4LCJA 1RHJA 4RL4A 2UKDA 5BYAA 3KZKA 4L1KA 1WV1A 1BIFA 4XYBA 1XCOA 5BSGA 5TT1A 1U5AA 3MPOA 1Y9ZA 1M34B 2ATVA 2IQIA 3IDOA 4DLNA 5HIIA 2I6UA 3KKPA 2V7XA 4V03A 1FRZA 5JCPA 1Y6RA 1AQYA 1CEYA 3AEUB 3KB2A 3ONEA 4KE7A 2P4QA 3WHPA 3OO1A 5JNSA 1CCWA 1C8LA 3NOVA 3OU2A 1U2EA 3EQ6A 2PYZA 1C2TA 1OXXK 1NE2A 1UINA 2XRFA 2HLHA 2WBLC 4KGZA 4W63A 2C2MA 3B9RA 5INTA 1A5ZA 3PQDA 3ZVLA 1O7JA 4TQ9A 3IBGA 3ENZA 2HWUA 3IEUA