3HZKB

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLAFIRNKAKGYTTEYSSSVKGRFTISRDNSQSFLYLQMNTLRAEDSATYYCARDINPGSDGYYDALDYWGQGTSVTVSRAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S73-2 Fab (IgG1k) light chain
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
total genus 39
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2009-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkB01
3VFRA 1WCQA 4Y4FA 4Q0XH 4TUJB 5SWSB 4HXBH 1OAUH 1UQSA 1U3YA 4NFBA 4WHCA 2J4WH 3CFEB 2JJWA 3ME0A 5DRXB 2OTWB 5GRJL 4POUB 1PG7X 3ZE1E 4YHPA 3ZYJA 3BFOA 5GGSB 1MQKH 3X17A 2BSSA 2VL5A 3KPPB 3VU2A 4Q0XL 1L7TL 4HXBL 4N0UB 1OAUL 5JXEC 4IRZH 2NY2C 2XQYK 3MOQA 3RY6C 2J4WL 1W72H 3D2UA 4UT9H 5ESAB 4G8EB 5MENB 3NCJH 1FC2D 1HCVA 3DUSB 4ZFZB 2AXGA 1IGTA 1FFNA 2J8UE 1U2CA 3CFBB 3PGCA 1MQKL 4HUXB 1KJ2A 4L3CA 5JIHA 5DLMH 1YEEH 3G9VA 4M4PA 3AREC 2GY7B 2H2PD 3WSQH 4PP1D 4IRZL 3HE6C 3NCBB 5I0DA 1W72L 4UT9L 3TFKC 3KPSD 3LN9A 1FNSH 3ALXA 4TSCH 3U0PB 1CIDA 4OFYD 3HI1B 5E94A 1S9XA 4ZFOA 3HZMA 3M17B 1EHNA 1XGQB 1S9WB 2PW2B 1Q38A 5DLML 1TPXB 1YEEL 4XBGB 1YMMD 1RZ8A 3D0VB 4FRWA 4I18B 4MDIA 2VLKB 3LKPB 5GSVA 3SCMB 3WSQL 3DBXA 43C9B 4LCYB 4RQQB 1S5HA 3T4YB 2NR6D 3PWPE 4L4TD 2X10A 1BMGA 3WFDH 4P9ML 1FNSL 5C71A 5DK2B 1HWGB 4TSCL 3WJJC 3NIGE 5FM4A 4HHAA 2VITB 5D7JB 3HG1D 1G0XA 1F3JB 1OHQA 3FB5A 1OD9A 4FMKA 2C1OB 1NL0H 2W9DH 5ACZB 1B6DA 1MREH 3KJ4C 3T2QA 3HR5A 4N1CA 4XVJH 1P84J 2Z8RA 2PXYD 1I1AB 4NCC1 3LEXB 3WFDL 1H3XA 1L0QA 4EUPA 2EDOA 3T0DA 1DEEB 2B4CL 1J0HA 1CIUA 3WNLA 3ZO0A 5CEXB 1MJJB 3SDXB 5JORB 3VFOA 3BZDA 1OD7A 4PLOB 2IMNA 1NL0L 4GKOA 1A21A 1MREL 3VWKB 3WS3B 1N8ZA 4POZD 4LKXA 4AL8H 1QLRA 4OD3H 2C3GA 1MCWM 3JUYA 5BCAA 3B5HA 1G6VK 2ED7A 4E5XB 5E56A 2DS4A 4IOFD 5J1AB 2YRPA 2FR4B 5E6IA 5C08A 4QHLA 4XNZB 5DYOA 3LS5H 3B9KA 3H42H 1WSST 4Y16D 3SO3B 1ONQB 2FGZA 3TA3A 1MI5E 4XPBL 4NIKB 4AL8L 4OD3L 5BRZD 1WBXB 2KZ1B 4X6EB 2ICEA 4H0GA 3QO0B 3BVNA 3ZMRA 4HKBB 2AABH 4RIRB 5F72S 1X5JA 3LS5L 3H42L 3ARUA 4Y88A 3K1DA 3PWLB 4XNYH 25C8L 4L4JA 3QDJE 3ZZ1A 4IS6A 4QTIH 2HJLA 2X1XR 4ZDHB 1R6VA 3HLAB 4OI8A 2AABL 1T03H 1AC0A 1M6OB 4P48A 4JZJC 3C5ZC 4Y19B 2CLVA 2Q76B 4KFZC 1KIRA 1R3LA 4GKNA 4XNYL 4LLMA 5EOCJ 1KACB 2IANE 5HI3C 2APFA 2Q3ZA 1CT8A 4HX1A 4QTIL 4GS7C 3HA0A 1X5XA 3VRIB 1PG7W 3VXMA 1T03L 5EU3B 3U4BH 1GC1H 1X5GA 1AKJA 5DWUH 5L0QC 1T20A 3DRTA 5DQ9A 5I75C 1N5AA 3E6HB 1GSMA 1EFQA 5IJKC 4O00A 4GAJL 1A6PA 1U93A 2IPUG 4JFDD 5ICXA 1LO3L 2IFFL 3D48R 1XFPA 3FCTA 3WJLA 4KUZH 3SJVA 1MPAH 2EC8A 2PKDA 2CUMA 3NN8B 4CW1A 5J6HA 3U4BL 1Y18A 3FT3A 3LMJH 2Z8VC 3X14A 2DOCA 3LD8C 4M7ZB 5EZOH 5DMGD 3LVEA 3BWAA 1NUGA 5DWUL 1D5XB 1FFRA 1KPRA 3MBEC 2FECI 2YPLB 3DX9A 4QXUL 4OFIA 2DWEA 4XCNB 2DKMA 2P24B 1NGXB 4D94A 4KUZL 1QLFA 4U1JA 2CKNA 1X7QB 2PR4H 1GC1C 3LMJL 3O3DB 3QWRD 2EDQA 1QFPA 4PTUB 3BHBA 2XT1B 1AH1A 1FE8H 3QUZD 2AXHA 1J11A 1HHJB 3MROB 4G6KH 5A2KH 1I3RA 3O2DL 2GJ6D 4U1HB 3L3JB 1MFCH 2YZ8A 1BIIA 2V5MA 3SDAA 3IDXH 4WU5A 5AYQA 4PJCF 1NGZA 5DD6A 1BZQK 4O2EB 4DZ8B 2PR4L 4MJ6A 4P23D 5I6XC 2EYSB 2ESVD 3O9WD 2Z31A 3ARBA 2C1PB 3CXHK 2ZKHH 1I7ZA 4MXQD 4F7PB 5TE7H 1R5IB 1FE8L 3TH3T 2HH0H 5CKGA 4J1UB 2I07A 1YN6A 1JZ2A 2D31A 3VWJC 4U3HA 5EPMA 1A5FH 1MFCL 5DK3A 5CWSB 3IETB 3QFJA 4LNRB 4XP4H 4JR9H 2K9UA 5FA3B 1K9TA 3DRQB 4CN1A 4ZS7H 1BJ1H 1IGCH 3BN3B 4HK0A 1HZHH 3TJHD 3MOAH 2ZKHL 3LKQA 1HXYA 2ARWA 3V7AE 3GSUA 5TE7L 4CDGC 3SQOH 4BQCA 2FHFA 5B38G 4J3OC 1L9NA 4HK3N 1GGBH 1A5FL 3IDMA 3WIIH 4NQVB 5HYFA 4OCLC 3W81A 1HOCA 4XP4L 3NFPB 5F7DB 4JR9L 4ZS7L 4YJZL 1IGCL 1IEAA 5DJ2A 1HZHL 1FGVH 4HJGB 3RWHB 3MOAL 4N90E 5HHMD 4X8XA 3SQOL 5L88H 3MFGB 2BJMH 3TZVA 4NWUH 5IW3A 3P40A 3GSNA 1GGBL 3WIIL 4MJID 1EIBA 4D3CH 3O41B 5EBLB 1LP9A 1F11B 1Q9KB 4WWKA 1RK0A 3MO1A 3NAAH 3VXQB 1FGVL 1MCRA 1TTFA 4IRSD 3MV01 3NPSC 5FA4A 4P2OD 4Z0XB 5FYJU 5LJYH 4G8GD 5KN5A 1EUUA 4Y2DD 2BJML 1Y0LB 4L1HA 4NWUL 1ORQB 4KTDH 3P4NB 1JPGA 1IILE 1ROWA 4RBPK 4PP2B 4XPTH 4C56B 1CXKA 4D3CL 3RGVB 3O6FD 1DZBA 2FWOA 1DLHB 4EJ1C 3O3AB 5HHOA 2JIXD 2Q8AH 1C12A 2RB8A 3U2SA 1I8LA 3FTGB 3UTSD 2LTQC 3FQWA 3X3GH 2V9TA 4KTDL 5JO5A 5JZ7D 1IGIH 3W39A 4XPTL 1D3CA 1T1ZB 1A3LH 3MLSH 3VFNA 3G5VB 4MQSB 3OG6B 3PP3H 3VH8A 2UWEB 3KPLB 2Q8AL 1TDQA 5IT2H 2Q1EA 4YZFE 5KVEH 3X3GL 1JGEA 4NO2B 3VXME 4APQB 4PP1C 1IL1B 1IGIL 4M93C 5FM5M 4NQSA 1A3LL 4NQXB 5LGKA 3MLSL 3MXWL 2V2XB 3V6OC 3REWB 5I8KH 1CN4A 4X5LA 5H35B 3NIFE 3QXDB 3VDBA 3JWOH 2WW8A 5IT2L 1DANU 3RU8H 4FFVD 3GO1H 3MNZA 1QSEB 3U0WH 5KVEL 3HS0A 4PG9A 3TM6A 2AEIT 1KLFA 2NR6C 3R06A 3DXAD 1DBMH 3SJVE 4KDTC 1VGKA 2YPKA 3B6SB 1EX0A 1U58A 2FJFA 5E9DA 1MHHA 5L8KB 3JWOL 4JEGB 3ILQD 5JOPE 5FOJA 4LHUA 2AK4A 3ES6A 2LU4A 3RU8L 3GO1L 3W9EB 1TIUA 4MYWB 3U0WL 5KBNC 5IUSA 4JAMB 5DK0A 4R26H 4Y1AB 2PXYC 4F7CA 1D9KB 5J06A 1DBML 1H3GA 4I2XB 3DURB 4PRPB 4OZIA 4RZCB 3PL6D 4L9DA 4R3SA 32C2A 2IWGA 2V2WA 3MUHL 1TQCC 2NTFA 1A3RH 3HRZA 3UEZA 2OZ4H 4QRRB 1JZ6A 1S9VA 1FC1A 3C60D 3D25A 4R26L 1AGEB 4Y5VC 5EU6E 5ITBH 1Z9LA 5LBSH 5IEKB 1LEIA 4QOKD 1MCSA 4TUOB 1P4LB 5E2JA 5CBAA 3ARTA 3AXLA 2UV3A 3BP6A 4IOFC 5ESQB 4Y5YB 3DJ9A 35C8H 4XXCA 3QUMH 1A3RL 3BGFB 2OZ4L 4KKBC 5DEGB 4KJYA 1E27B 2VR5A 4Y16C 3DIFA 3J7HA 3UTTD 1B88A 4LFHG 1X5FA 5ITBL 1VACA 2DWDA 3QFJE 4L8DB 3NIDE 2IAMD 1K8IA 5H2BA 5JR1H 1FYTD 2R1YB 1K5NB 3KPNA 2FSEA 3RPIB 35C8L 1QO3A 2EKSA 5GZND 1EJ6A 1RQ5A 3SDDB 2DYPA 4DFHA 4J8RB 4V2BA 1KJVA 4OZFB 1UWXH 4OCNC 4GRMA 2F58H 1S7TA 3L3OA 3RWCA 5JHDB 4LVHC 4BQ9A 1B6UA 5CCKH 3N50A 3CX5J 3EDDA 1P7QA 4TNVF 4JFFB 1A2YB 3HZVB 3T2NH 2NMSA 1R3IH 1U8NA 3FQXA 4MAYC 1CXEA 1LD9A 5IROA 2NY1B 1T83C 2DLIA 2YKLH 3E8UH 5EOCH 1JIBA 2F58L 3S6CA 3V0VA 5AWNH 3BW9B 1I8IA 2DJ4A 2D4FA 1LP9E 3ZTJG 1S8DA 1RURH 2BMKA 1R3IL 3PV7A 4DCQB 5FHBH 2AXFB 1B90A 2VOTA 5A40E 3HRPA 5D93B 2FLRT 4ELME 1AGDA 2YKLL 3E8UL 5EOCL 4Q9QL 4U1SA 2IBZX 5AWNL 1FH5H 2ZUUA 1HSAA 2HTKD 4QHMA 1KXTB 1RURL 1J8HD 1EGJA 1S7RA 5FO7B 4ZFFB 5HHOE 1NJ9B 2B39A 2NY0B 2RGSA 4P2RB 3SE9H 2D7MA 5FHBL 2G75B 2BNQD 2EH7H 4GLRI 4J3XA 3S7GA 2XZQH 3VFPA 2GT9B 4LHQB 1HILB 1CXFA 1HI6A 1BVZA 1MLCA 4OZFH 1NC2A 3VFVB 1ZGLB 5DMGC 2Y72A 2ZUQC 1U8KB 2Q7NA 4GT7A 3VXSA 4E41E 2VWEE 1S7SB 2KL6A 3ZHKA 3RWDA 4F9LC 4B7LA 1A7OH 3FN9A 2MWCA 4S2SA 3SE9L 4UTBH 2EH7L 5I76B 2FIRT 5B21A 2XZQL 3OB8A 4PRAB 5GIRA 3EJJX 4IMLB 1R5WA 5DUMH 4F2MA 2J5LC 1T5WA 3C6SB 3OKMB 1UKTA 5DQJB 5HYJB 1MCHA 4XZUA 3QUZC 3QUYB 4FQQB 4LVEA 1A7OL 4UTBL 3FO1B 3WFEH 4PJGF 2R2EB 3F12A 3TV3H 4NN7C 5CEZD 1AJ7H 2I26N 2CDFB 4LP5A 2VN7A 2BHUA 2VXTH 3MRPA 5DUML 3VFSA 3O9WC 3HMXH 3LH2H 5CD3B 4UB0H 4LAQH 4MD0A 4MXQC 1LDPH 1MAJA 5MEPA 4U0RC 3ZDZF 1H5BB 4ZS6D 4EIZC 5E9DE 2QHLA 5IEHA 3MJ9A 2AJXH 2NX5E 4EOWH 4OKVB 3WFEL 2AK4E 4J12A 2X4SB 1K85A 4PJAB 2DF3A 3N1GC 1QQDB 4P9HC 1JRHI 4XC1H 2VXTL 2GJZA 2H9GA 3CIQA 4U6XB 3TJHC 4PGJA 3HMXL 3LH2L 2R15A 4OZIE 4LAQL 1T0NA 1LDPL 4MD5A 2CDEB 2R2HB 4YEFA 5E8NA 2AJXL 1J1OL 4LPXA 4EOWL 2UY7A 1AHWC 3WV0A 1WZMA 5HGAB 1S7XB 4S1QH 2P5ED 2D3VA 2GSIB 4GUPB 2DQCH 3RNQA 1CDHA 4XC1L 4QLRA 2VZOA 1YPZB 1MIEH 5DO2D 4MCZA 5C09D 5ID0A 3QXAA 3I6KA 3EFDL 3TESA 5F6HI 4XCEA 3I50H 3H9HB 1A6ZA 1NSNH 4LL9A 3O8XA 5HVWA 3E3QE 4S1QL 3ARRA 5FUOH 3B2UD 4Y5XA 1N2RB 4G7VH 2DQCL 4NZTH 2DBJA 2Q86A 2ATKA 4PJDE 3TH2T 2O93L 4EI6A 1J0YA 1Y6MR 1MIEL 4IRSC 3OKNB 4P2OC 3CH1A 1T3FA 4Y2DC 3T09A 4MHHI 3ARGD 1JNLH 3I50L 5DMKA 1NSNL 3GBML 2EYRA 4FG6D 4J6RH 3GSXB 5GS1A 3O0RH 2C4FU 4LSTH 1N5YH 1UXSA 1EPFA 5FUOL 3O6FC 4G7VL 4NZTL 4ZOBA 5K9OA 1ZVYA 5DHXB 3K4DA 4P2QD 3LKSB 4WUUD 3U9PL 4KMLB 4OGAC 3KYOA 1U3HD 3AAZA 3JTTB 1BWMA 1JNLL 3DO7A 5IG7B 5JZ7C 3WLBA 3IJSA 4J6RL 1WIPA 3O0RL 1A22B 4LSRH 4JDTL 4LSTL 4OF0A 1N5YL 5F1IB 1G6RH 2X1OA 1SEBA 3STZA 1CFTB 2BP3A 4PRIA 5IVXA 4BKLB 2BOCA 3TVMD 4G8IB 3JV4A 3U79A 5HVFB 1D5MB 1U92B 4NOFA 2Y5TB 3OKEA 3FHAA 3G5ZA 1P53A 1GZPA 2VIRB 1G7PA 1NCUA 2VUYA 2F54A 1RU9H 1G6RL 1NKRA 1NCNA 4K71B 5J6GA 2ARJA 4PJ5A 3RVWD 4X80L 4PD4K 4FFVC 5H8DA 4LQFL 2N56A 2QL1A 2VRAA 4G42A 4JO2L 4V1DB 1B2WH 5HD8D 4JM4L 5EDXA 2F9BT 5B3NA 4RAVB 1RFDH 1RU9L 2ZJSH 4HS6B 4F3FA 4XNQA 4WW2A 1RV6X 1LO2H 3T8XB 4LLDA 3TH4T 4RAUA 1EAJA 4NN5B 3VXSE 2P5WB 2DM2A 5KSUA 1TCMA 3EIFA 2E9BA 4AQOA 4ODWB 1B2WL 4HEME 2BRRH 3B8SA 4JO4L 3ZLQC 5JW5B 3LB6D 1NDGB 1RFDL 3PL6C 2ZJSL 3RPKA 3UJJH 3IJHA 1MH5A 3WN5A 1Q9LB 2BERA 4Q6IA 3HAEG 5TH2A 4ETQB 4K3GA 3LSOA 1OAQH 2AV1A 3S37X 1LO2L 5FGRA 2ZOKB 3QFDA 5F7HA 3FQNB 3PWPD 2R0ZH 3G6JE 4QXGH 2BHYA 2XFXB 2BRRL 2XZCH 4MNHA 5IB5A 1F2QA 3HUJA 4HW6A 1JZ8A 2R2BB 4Y4HA 1CQYA 3BISA 1OAQL 4KTYA 2APBA 3L3DB 1JGVH 2XWJA 4GW4A 3DVIA 3FQTA 2R0ZL 4L3EA 4QXGL 1U3JA 1FVEA 3MGAA 4OUUA 2XZCL 1DE4B 2VSCA 4NQUA 3HZYB 1RUMH 5HJ3A 3DLQR 3BMWA 2BSRB 2PYFA 1G7IA 5GZNC 3IAPA 4MX7B 2W38A 1YUHA 2MMXA 1A0QH 1AI1H 4L8BB 1JGVL 5KS9A 2OBGA 1F8TL 3RL1B 5D7LA 4Z7VB 3K4AA 5I2IB 1NQBA 2VQ1B 2WP3O 4HC1A 5C7XH 3RZCB 1RUML 4NNXA 4OT1H 5E8OA 3MNWA 2YUWA 1GGTA 5I1KH 3DMMA 1C7SA 3KLAA 1AI1L 4TRPH 4NPYB 4H26B 1MI5D 3VI4F 3BPOB 4QYOB 5FDWB 1PG7H 4HUUA 3I75A 2EDNA 5L2KB 5C7XL 2H3NB 4OT1L 4YBLC 4JFPB 5I1KL 3AS1A 5L9DH 1TJGH 4TRPL 1WWAX 3QDJD 2HJFB 1PG7L 5HPOA 2OSLB 4LSQH 5F9WC 4KTEH 4Z7UF 5IVOA 5F93C 1CDYA 4WO4A 3AU1A 1DCLA 4NKIH 3TBTB 4JKKA 3V6FB 3UC0H 5B39G 5B38B 4P49A 3VGHA 4DKEH 4FXGA 1TJGL 4EBQH 5EUOA 1K2DA 2VABB 5DURB 4RGMB 4KWUA 5J56B 1ZTXH 4F7MB 3HPJA 5I8CA 3N0PB 3OB0K 2IAND 2OJZH 4LSQL 5D5MA 1YNTB 1MHPH 4KTEL 2FECL 5TFSH 1KCRH 5GRVL 4NKIL 1JGDA 2CLRB 4H8WC 1BQHG 3ROLA 3VXTB 2XTLA 3UC0L 4PRIE 4DKEL 4Y4FD 5IVXE 4EBQL 1KJ3H 4OQTA 3JV6A 1VHPA 3I9GL 5IHLB 2RBLA 1TNMA 3EYVB 1G7JA 3SE4C 1ZTXL 1FIGH 2NYYC 2G5BB 2DQFB 2C3WA 2OJZL 1SBSH 1MHPL 5TFSL 4LVNC 4DKDC 4FFWD 3PWJA 3THMH 1KCRL 2F54E 1EHLH 4NKDA 3WE6B 1FFPA 5SWZE 1T7XA 4RA0C 1D5BB 2H32H 1KJ3L 3PV6B 4YFEA 4Z18A 4X98B 4QWWD 1FV1A 4PJ5E 1J5OH 4XBEH 1ZVSB 3MUGB 5DJ6B 4R8WH 2E7LC 1JHTB 1Q9OB 1XZ0B 3MLWH 1FIGL 1HWHB 1OLLA 3JTSB 3D2UD 2Z4QB 4F37K 5IB3B 1SBSL 1I7UB 4RAHA 3THML 1A14H 4ZS6C 4GXUM 5LXGH 4XH2A 3T3PE 3KJ4B 4NUJB 4K3JH 3QPXH 5CJOH 1AGBA 3MRIB 2XKNA 2GK0A 1J5OL 4XBEL 4R8WL 2FYYB 4ZOAA 1CDCA 3K46A 4G9DB 2AXJA 3EYOA 5ANMB 1WWWX 3QUXA 2ZZUT 2W9LA 2PTTB 1A14L 1UJ3C 4P4RA 1ZLWK 3IU3B 1TVBA 5LXGL 4XCYA 4D0BA 4WCYH 4HDIA 1CFQA 5SWQB 1AFVH 1PZ5A 1R5VA 1UH3A 3B5TA 4K3JL 3QPXL 1XF5B 5CJOL 3FQUB 4DZBB 5FB8B 4YX2H 4ZO9A 1HDMB 4UT7H 1U91A 3C5JA 3IGAB 1RHFA 4QGTA 3O6LH 1EHAA 2HKFH 5TQ0H 4WEMB 5K9QG 1LO5A 3WO4B 4KROB 3I84A 5DO2C 1BOYA 4HKJA 5FKAB 4Z7WB 1G7MB 1ZLUH 2XXCB 4U1IB 3SY0A 5I1LA 2AS5M 3ETBF 3HUJE 1CBVH 2J12B 4WCYL 5EZIH 1AFVL 2FX9H 1KEGH 3L9RA 2WANA 4YX2L 3BIKB 3GI9H 4BELD 4UT7L 1FZMB 2D7QA 4L3EE 3O6LL 3B2UC 5TQ0L 2BSTA 5I66A 3U6RA 1IM3B 2A2QT 5ESVB 4GW1B 3EZ8A 1A6UL 3UTQB 2AGJH 5HVGB 4HSQA 1JWMB 3MGOB 3MODH 3ZT7A 1DQQB 4JKWA 5EZIL 3ARGC 1IEBB 2FX9L 3GMMA 4KMTH 4JPIA 4UAOB 1KEGL 5FUZH 1KCLA 3GI9L 8FABA 1AXSB 5KS9E 3L3IA 4JFHE 4C59B 2X4RA 2BC4A 2NXYC 5D7LE 5KOMC 2CO7B 4N90D 3U9UB 3K8KA 3MRKB 1F3DJ 4K94C 1DBAH 2AGJL 2C7UA 5E6ID 5C08D 2J88L 3MODL 1KULA 5F21B 5F7KC 5I18L 5CSGA 1U3HC 3B9KD 3BYYA 1CR9H 2VLLB 4KMTL 4OD2A 2Q6WA 3ILPB 4U6YB 5FUZL 3CDGA 1PX4A 5E4EB 2Q7YB 3TA3D 4LLQB 1SMOA 1Z0NA 2UZXB 4HUMB 5T1MB 1KYOJ 3MOBL 1DBAL 1G7LA 1S9YA 3TVMC 1UCTA 2ADIB 2GITB 4PLJD 5I1HL 2D7NA 4LPCA 4M6NL 3QI9A 1CR9L 3SKMB 4YFLI 4OM1H 5L0QB 1RJCA 3SE8H 1KCSH 4OCMC 4X6DF 5BOZG 3W5NA 2AW2A 4PJCB 5I1EL 3BGAA 1A1NA 1S7WB 5CZKA 3KVQA 3I3DA 5HTSA 4QF1A 3DVNB 5IM7A 3TIEA 3CH8A 2X05A 4LF3A 3RVWC 3IF1A 1EXUB 4DAGH 1GHFH 3U30C 5EBWA 1U8OA 5EUOE 4CGTA 2RAMA 5HD8C 4HGMA 4M61B 4OFDA 4OM1L 3GUTB 1GXEA 1G9NC 3SE8L 3I6GA 4Z9KB 1KCSL 3DX8B 3LRSA 5CIPA 5D5ME 3L7EB 5KVDH 5I1JH 1VFBA 3T1FB 3KPMB 3MPCA 3TNNB 3QIUA 5F1SA 1WICA 2EIZB 2NZIA 1RVFH 4HXAH 3VXMD 3ZDYE 4DAGL 1GHFL 5KG9A 2VSDA 2M2DA 2P8PB 3LRHA 3QQ4B 3F7VB 3LQAH 3LB6C 2YA2A 3QULA 1HKLH 1MHEB 1IKNA 1D6EB 2C3VB 4X9GA 1JWUA 3FB8B 3MRLB 5KVDL 1XGUB 2JK5A 5I1JL 2OLDA 3ZE1F 1CE1H 3QH3B 3SQBA 1RVFL 4HXAL 3C87A 1E4XH 1YDPA 2F74A 1JPTH 3SJVD 1BQSA 5IB4B 2PETA 4PRHA 4N9GB 1ZA6A 2OQJB 4OTXH 2ARJQ 3LQAL 4DVBA 3PWNA 3QISA 3MLUH 2A73A 1P9MC 1HKLL 4UQ3A 2DLFH 5JOPD 3KPQA 2ERJB 2AKRB 3LEYH 2LAAA 1CE1L 4RMQA 2J8UF 1E4XL 1MF2H 5F9JA 1PDKA 3ULUE 1JPTL 3WIHA 3AC0A 4PYHA 1KOAA 1UB5B 1VB9A 5ISZB 2V5YA 1RZKC 4PJHA 5C0BB 1QRNB 3GMQB 4OTXL 1I1CA 2JJTC 3MLUL 4CJ0A 3DETD 3ZE2E 5JOEA 3I02B 2DLFL 4HH8A 4CVXA 5I15H 1YEIH 4Z78B 2JJVA 3LEYL 3N1FC 5T1KB 2PYEA 3KAAA 3DX6B 4P5KA 2KZWA 1MF2L 5EU6D 3SDAD 1U8JB 4BZ1H 5EU7E 1BFOB 1SBBA 3L5WA 4JCLA 4BQ6A 1KFAH 3LDBB 2CLZA 3V8CA 2Z31D 4PJ8B 3RX7A 3PNWA 3ZTJH 5I15L 3QIWA 1B0GA 1LWRA 1YEIL 3EO9H 4B5EA 3NIGF 3F7QA 5FYJE 2X5PA 4KXZI 1WBZA 3QFJD 1EMTH 2FATH 1MFEH 4BZ1L 3U83A 1KFAL 3RI5K 1Y6KR 2V5TA 1K8DA 4YO0B 4GLRH 2EDLA 3CU7A 3NCYS 4MB3A 3NZ8B 2Z91A 3VXOB 4OAWB 1D5ZB 3EO9L 3T77A 1Q72H 3QQNA 3KYNB 3G6AA 4YHYC 4OZGB 3OJDB 3GBNH 1T2XA 3NFNA 3GNMH 1EMTL 5IHZB 2FATL 2AJYH 2MTPA 5C0DB 1MFEL 1BD2B 1KTLB 4ZAKC 1ZLVK 1NFIB 4D0CB 1FNFA 2WIIA 3BZ4B 4P5TA 1ZS8A 4BSJA 4L9LB 2LTQB 1KG0B 1VFUA 5BO1H 1Q72L 1S78D 5CHNB 4ZODA 1L6XA 5F6IC 4DN4H 1N4XH 2V5RA 3GBNL 3N1QC 4X5XB 1WK0A 5JOFB 3GNML 4CNIA 4M02A 2AJYL 1RD6A 3WUWG 5E1HB 5KVMC 5H37G 3K74B 4WW1B 4WWKD 3NCCB 3RVUD 4O02H 5IR1B 3MLRH 5JNYA 1C1EH 1ITBB 3MRNA 3IU4H 1P1ZB 5SV4A 2Q20A 4PR5A 2QTEA 2HFGL 4Y4FC 1UVQA 4DN4L 1N4XL 3RY6A 3FO2B 5D7IB 4ZTOL 3KPSB 2LU7A 2P4AB 3LKRB 2GEEA 3ALPA 1PZUB 2L4OA 4FFWC 4PRBB 1OB1B 4O02L 3QQ3A 4KJPD 5HHOD 3FRPG 3WDJA 3IU4L 4H88H 1YMMB 5J7CC 4GRLA 5CZVH 1BQLH 2ILLA 4X83A 1JRHH 1HXMA 2PW1A 4QWWC 1IAIM 4OIBA 2DJUA 4EDWL 1ZT7B 5GXBB 3HC3H 4K23H 3V8OA 1QBAA 5DJYA 3CFKA 6FABH 2YEZA 4LSUH 4E41D 1UH4A 3RWGB 4QHKI 3H8NA 1KTDB 3PXHA 4P4KA 3MV7A 4H88L 3BKMH 5IBUG 5CZVL 1BQLL 2QQLH 1JRHL 2DQIH 5FO9A 4AMKH 3GJEB 4NQDA 3MV11 1LEKA 1PD6A 4LKCB 4ODVH 1VEMA 1W72A 4JANA 3HC3L 4K23L 1MRDH 1TETH 4LSUL 1S7QA 4V2CB 1K4CB 1E28A 1OP5K 1WZ1H 3IVKA 1MVFA 3VFTB 5E8PB 3BKML 2A6IB 4YC2C 3BZFB 3OKLA 2DQIL 4AMKL 4Y5VB 2ADGA 5ELIA 4J3TA 4ODVL 4NHUB 3WHE1 1HHIB 4N0FB 1MRDL 1TETL 4CVZA 5T1DH 2CQVA 3NVQA 2E6PA 4PRHE 5E9DD 1WZ1L 5JMOC 2NX5D 4PGDA 3EFFB 5GS0H 4LHUD 2AK4D 4XP6H 5HHPB 5SWSA 4TUJA 2WK2A 5BRZB 1FYHB 3S3PA 3FO0H 3CFEA 5GGRB 5FOBB 5I71B 2HTLD 5T1DL 2OTWA 4PJHE 1RJYB 3OWEA 3TCLA 4WHYG 4P2YA 1C5DA 4FHBD 1M71B 4FOMA 3MZTA 4DGYH 5GGSA 5GS0L 1BVLA 3S88H 3UMTA 1ZK9A 2HWZH 3KPPA 4JHZA 4XP6L 5EA0L 1MJ8H 5GRYA 2R0LH 4N0UA 2PYEE 3FO0L 1F3DH 3IDJB 3QUKA 5ESAA 1XF4A 2AJVH 3GMNB 1QRKA 3QXUA 3DUSA 4ZSOB 5IIEB 3PDOB 5ABDE 5E6IC 4DGYL 6CGTA 3CFBA 4HUXA 5GS0C 3K0WA 2HWZL 3M45A 1JPST 1YQ2A 2FJGA 3B9KC 4L8SA 4QXTB 2D7TH 2R0LL 4YDJB 4RMUA 1W8OA 4BK4A 3TA3C 1CLZL 2X4PA 3BPNC 5CSZA 4HMCA 2AJVL 2EICA 4KY1H 3PIQA 1LE5B 3HI1A 4KV5E 1XGQA 3V5HB 1LE9B 1S9WA 5CGMA 4R7DB 4JFEA 3WKNA 3MR9B 4A6YH 4JZJA 2DYPD 3D0VA 4I18A 3LKPA 2AJZA 1NEUA 2D7TL 5DHYA 2KQMA 3SCMA 43C9A 4RQQA 4C83A 3Q1SH 2JF1A 3IKCA 4N5ED 2G2RA 3T4YA 4PJGB 1FN4A 2Y5EA 4N8CH 4NWTH 4JN2A 3S4SG 1MNUH 4KY1L 3IXTB 5DK2A 1P7QD 1VFAB 1T5XB 4KGLA 5C0AB 3S36X 1RZJH 4O5LH 3GI8H 4A6YL 2J8OA 5HHNB 1UM4H 5ETUA 3ZKXC 5ACZA 1YEGH 3MYZA 5C0JB 3Q1SL 1UEMA 4DGIH 1LEGA 1FNEB 4N8CL 4WEUD 4NWTL 4PV9B 1WC7A 5D70H 3DHJA 1LGVA 1DANT 1MNUL 5EU4B 4ISVA 4K8RD 2HMID 1TZHB 2XI9A 1RZJL 1I8MB 4O5LL 3GI8L 4DOHB 4L29B 5T5FH 4OV5B 5D71H 1UM4L 3PDGA 4Y8DC 1YEGL 2J5LB 1T6WA 3VWKA 3WS3A 3L5JA 1QR4A 2EKJA 2GUOB 3OZ9H 4DGIL 5KVGH 7CGTA 3NACH 4G80A 1T1XB 1CFNB 5D70L 1MFNA 3HPLB 4XC3H 5EOTB 2GJ6B 1Z9SA 5J1AA 4BFEA 4MAUH 1YEJH 3IFOB 5CFHA 3CLFH 3WJLC 5T5FL 1ZE3C 3D1MC 2HP4A 3LEVL 4P23B 1E4KA 4OFVA 4M00A 1ONQA 1YEHH 1NC2D 5A2FA 4QKXB 4HG4J 5KVGL 2XPGB 1UKQA 3NACL 2AI0H 1WT5A 2X42A 4X6EA 3VXSD 4XC3L 1T21B 1RUAL 4AM0B 5IFHH 4HKBA 4MAUL 4RIRA 3MV7E 4PJ7B 4X7FC 3CLFL 3BD4A 3Q6FB 1ZWIB 1EEUA 5EIIB 2PO6B 1RIUH 1L9MA 4NQDE 1KPUA 4YZFF 2EYTA 1YEHL 1J12A 5BZDB 1IGYB 3EOBB 3PWLA 3MV9A 1EV2E 3WL9A 4HKZB 2AI0L 1WITA 3CSGA 5C0FB 4NHCH 1JV5B 3F7YB 1CGWA 3KDMB 3MX0A 3NIFF 3VWJA 1G7QB 5IFHL 3C5SB 3PWVA 1A7NH 1FBIH 4Q9BA 4CUCA 4PBWD 3BP5B 1M6OA 2E7BA 4JQXA 4JE4B 1RIUL 3H7BB 4Y19A 3BO8B 2Q76A 1TFHA 4R97C 1LMKA 3BJ91 3QA3A 5HHMB 1RIVH 1WF5A 2XA8H 5IBTH 2Z31C 2BNUA 4XX1E 4NHCL 3CFJB 1ZLSH 1WFUA 3VE0B 5BQ7B 2JCCB 3MNVB 1A7NL 2FX8H 1FBIL 1I1FA 5DD0H 5EU3A 2NY6B 4MSWA 3EKCA 5SWSE 4CADB 3GSWA 3MRJA 4IRSB 1RIVL 2XA8L 5IBTL 3V5KB 2XWTB 4PTTA 4I13B 3LN5B 2FDBP 4G8GB 1ZLSL 3IDUA 4OZHA 5HI4C 3E6HA 5JDSB 4D0DB 5AZ2H 3LHPH 1UADC 5A3ID 2LQRA 2FX8L 5DD0L 5JHLH 2HT3C 1XR8A 3O6FB 2PUQT 3NN8A 4L4VA 4N0UE 1UACH 1Z0MA 1A3QA 5LCVH 1UZ8B 1BVKB 1D5XA 5M7QA 4JGUA 1ZHKA 3UTSB 1DLFH 3R0MA 4WY7H 5HY9B 4I48A 4W68A 1S78C 1I3GH 3QNYA 4XCNA 2GCYA 5AZ2L 3D5OF 2P24A 3LHPL 5JW4N 4IM8A 5MEQB 5JHLL 1NGXA 4TNWF 3RWFA 4JQVA 3O8XD 3NPZB 4BH7B 1RULH 1X7QA 5J11B 2IPTH 3GEWB 3O3DA 4WWKC 1UACL 3RVUC 1N64H 1IZKA 5LCVL 1UYWH 1JZ5A 3NIDF 1DLFL 4DUWA 1HHJA 1I3GL 3MROA 4NO3B 3CFDB 4U1HA 4JFEE 1MCQA 3RWEB 2XG5A 2NLJB 4FFZH 4UI2A 5IW6B 4O2EA 4DZ8A 2IPTL 2OYPA 1N64L 1KCUH 1N6UA 4S10A 3FOLB 4KJPC 4F7PA 2QBWA 2CXGA 4F9PA 1I1RA 2YOCA 1R5IA 4JFYB 3MUY1 1BJ8A 4J1UA 2EE9A 3DXAB 5CP7B 2WBJC 3X13A 4HCRH 3QHZH 4LNRA 3MCG1 4OV6F 1IM9A 1IFHH 4RNRB 1MCEA 3V7AG 3DRQA 5I9QC 2VQTA 4EUPG 3AB0C 2VWEC 1KCUL 4PRID 3C8DA 4MA1C 4X99A 2HFFB 3IAGC 1LP9F 1D5IH 4K9EH 4NJAH 3P4OB 1JNHB 3H0TB 5F88B 2YD8A 3WIFB 3BT2H 4KDTA 4HCRL 3OAZH 3QHZL 4NQVA 3MCLL 3NFPA 1IFHL 4ELMF 2F54D 5F7DA 1ZV5A 1BF8A 1FAIH 4HJGA 3RWHA 5SWZD 5JLZA 1FJ1A 1ULVA 2I9TA 3RBGA 4PJ5D 4EN3A 1KBGH 1D5IL 4K9EL 4NJAL 3C60B 3NABH 2HLAB 3BT2L 3GFUA 4NT6B 2LFGA 1F45A 3QDGB 2BOBA 3O41A 5EBLA 2V2TB 2F53B 1F11A 5IMKB 4BSWB 3FB6A 3VXQA 4I9WE 1LO4H 1H3TA 2DB8A 5D2NC 5F96L 3MRRB 5BXFB 4LDLB 3QO1A 3GJFB 5I74B 3UTTB 3NABL 5I19H 3N06B 4UINH 4WHTB 2WAHA 5TPWH 5INDA 2YWYA 2IAMB 1IGFH 1SJVA 4GBXA 4MD4A 1FYTB 4PP2A 3NCMA 1FNHA 3FQRB 4ZFGH 2HTLC 4YIQA 5D6CA 2BVYA 1F4XH 4X7DC 5ENWB 3MV9E 1LO4L 2PCPB 1NCTA 5I73B 1KN2L 5K59E 1SJXA 4PJBA 4UINL 1DSFH 1U95A 5TPWL 5F1NB 1XIWA 1IGFL 2RHEA 1T1ZA 1MVUA 3QEHB 1PY9A 4Y19E 4ZFGL 5JPNA 2QR0B 1VADB 3G5VA 1F4XL 4Y4HD 2WWKT 3KPLA 3VMPA 2OZ4A 1WTLA 3V5DB 3E3QC 5CLWA 2C4FT 1JF1A 4L3ED 1DSFL 4UIKH 4NO2A 4APQA 1IL1A 3REVB 4YK4C 3GMOB 2P45B 3IXAA 3P3YA 4NQXA 2EIBA 3LPGA 3RIAF 2H6PB 5H35A 5DA0B 3BD3A 5D9SB 1XF2A 2XG4A 4MAYA 2FHBA 3QEGH 1PJ9A 4J4PC 4RMSA 4XGZA 4OZIF 4JREB 2PNDA 1OQXA 1T83A 4OZHE 1T1WB 3GJFH 5DJAA 5F9WB 4JFHD 1QSEA 3RY4A 4Z7NE 5F3BA 5D7LD 1XGPA 4UIKL 5EO9B 3U4EA 4N5EC 4HWUA 1PYWB 2A9MH 1A1MB 2HRPH 3MRHB 4PGBB 1JE6A 2NY3C 1J8HB 4L4VE 1HHHB 5GHWH 3BZEB 4PGEB 2JB6A 3VGAC 2CDGA 1RZGB 3V6BR 3U46B 3QEGL 5E5MA 1XH3B 3DMMD 4Z77A 3RVTD 3HNVH 2VYRE 1BIHA 4M9OA 2EC9U 3KWWB 5SX5H 3PP3K 4WTWA 1BAFH 2A9ML 4UDTB 2D4DA 3DURA 4RZCA 3KNBB 5GHWL 4HEPG 4K8RC 4PJDF 3N1PC 5E03A 1Z9MA 1A1OB 4QRRA 5GGVY 5C07A 3HNVL 2W1NA 5DFWH 5KW9H 3RHWK 5CBEA 3OKOA 1BAFL 2BRQA 2EXYD 3FKUS 4P3DB 3PQYA 5IQ9B 2ZPKH 3BH8A 1M7IA 3WUZA 4WO4D 3FB7A 1GYAA 1A9EB 4F9LA 5ESQA 5J4MA 3DPBA 5DJCB 4PRNB 4QRUA 1PFCA 1KELH 4K3DH 4FQXD 1T22B 4FZEH 1K4DB 5DEGA 1DVFB 1E27A 2P1YA 4YFLF 5KW9L 1LK3H 4URTB 4XB8A 4OCYH 2Z9TA 2PN5A 3QRFM 4LASH 1DQJB 4I5BA 4OF3A 2YC1A 4L8DA 2ZPKL 4I0PB 4H5SB 4MZ3A 1MIMH 1P84K 4HWNA 3QUZA 1OT1A 4XB7A 3OXRB 4I1NB 1K5NA 4NZDA 3RPIA 4MXWH 2CUHA 5LGJB 2O61B 1U42A 4K3DL 4NM4H 5DJ8A 4J23A 2P8MA 4FZEL 3SDDA 1F4AA 4OZFA 3DARA 3BEVB 3EDEA 3WLWD 2OL3H 4HJ0D 1DQTA 4OCYL 1UJ3B 4LASL 5JHDA 1QSVA 1WWBX 1S9KC 3PP4H 4KXZH 1HEZB 5DVKA 2XXMB 4WFHE 4MXWL 4GMTH 4KRPD 2DQDH 5J0BA 5A2LH 2WINB 3SE3A 3RIFK 2AJ3A 1Q1JL 4WUKH 3S9DB 1VSCA 3KYMA 1S3KH 3UZVB 2NTSP 5EWIH 4XNXH 1MFDH 1WV7T 2IEPA 4QTHB 2OL3L 5C09B 1GIGH 3BW9A 1YQVH 3PP4L 3V9FA 1N26A 2J6EH 4F8QA 3KPRB 1IGMH 2OK0H 2IG2H 3ULUD 4GMTL 3TN0C 2DQDL 4HIJA 4I8DA 5HVHC 1FVCB 4DCQA 2X9XA 2AXFA 5IMOB 4WUKL 4YGVB 1OPGH 3P77A 1S3KL 5IHUH 2EO9A 1OTSD 5EWIL 4XNXL 1MFDL 2X09A 5C8JB 3P4MB 3KLHD 3D9AH 5LAXB 2V9QA 3UO1H 3QUXD 3HMXA 1GIGL 5DGQA 5J9PB 1H9VA 1YQVL 4RDQF 2X7LB 2J6EL 5IBUB 15C8H 1TZGH 1B4JL 1IGML 3UBXG 2OK0L 2IG2L 4LCWB 1TMCB 4HJJH 1NJ9A 1ED3B 4CMHC 5A3IC 2GY5A 1U8PB 1OPGL 3FN0H 5IHUL 4OLWH 2GT9A 4PJBE 3G6JF 2VC2H 4GRWB 3T0VA 3D9AL 3VFVA 1DDHA 3DGGB 3P9LB 1NANI 3BKCH 3VH8G 1ZGLA 2ORBH 4WUUB 1U8KA 4R0LA 1IARB 2XOTA 15C8L 4ONHA 5FYJD 1TZGL 1IAKA 1U3HB 3O11B 4M1DH 1S7SA 4HJJL 5EUKA 3DNKA 1YY9D 1WCBB 2FJHB 3EYFB 4NO0D 1FFOB 5E4IA 4PRAA 3FN0L 1JL8A 1NEZA 3O8XC 1WLHA 4OLWL 2BK8A 2VC2L 2HFEA 3EO0B 4Y5XC 3GMLB 4ZPVA 3B9DA 3TVMB 3BKCL 1S7VA 3C6SA 3OKMA 1JUFB 2ORBL 5DQJA 4RA3A 4UDUA 5FKPB 1FRGH 4O2FB 4M1DL 4XMLH 1CXLA 1WBYB 4HK3J 1OVZA 4FXKB 1U8LB 4LLUB 2H8PB 5F89B 3O6MH 3TO4C 5E1AB 1QSEE 2RFXA 5TDOB 2CDFA 2D7PA 4ODTH 4GG6B 3OJ2C 5C2BH 4LHUG 1H5BA 3VMNA 4AZ8A 1FRGL 5L6YH 1C16B 4XMLL 5DDHB 4HS8H 2OTUB 3AUVA 3GSQB 2VZ1A 5L2JB 5TE4H 4OKVA 5DZOA 4CVWA 1FL5A 4N8VG 4PJAA 2J8UB 2VDKH 3O6ML 2EXWD 1NBYB 5IMMB 5GGUA 4GRWH 5EO1A 4ODTL 4X7EC 4U6XA 5TDNA 3MRFA 4EEEA 1UA6H 5C2BL 3BP7B 4R7NB 3SDCB 5L6YL 2DLGA 1AGFA 2R2HA 4HS8L 2IF7A 3BGMB 3QI9D 1JI2A 2DJSA 5TE4L 4U1MB 4QRRE 5HGAA 4WEBH 5C07E 2I60H 2VDKL 1CD8A 3CDYA 1G6RA 4YDVB 3P9MB 3OB0H 1QUNA 4M62H 2W65A 3UTZB 1YPZA 3DSNA 4RFEB 2R4RH 1ZANH 2MOVA 4ZD3H 4TPRH 1DL7H 2ZG2A 3OSKA 5DD5H 3UP1A 5IOPA 2QSCH 4NCC2 3ESUF 3AY4A 3D39A 4KRNA 4WEBL 3OKKA 2I60L 4FQCH 3LS4L 3S4SB 5DHVB 1U3ZA 2AV7A 2C4XA 5K9KB 4OF6A 4NBXB 1F6AB 3N9GL 2R4RL 1ZANL 1TVHB 4TPRL 3OKNA 3QIUD 4WV1C 4AK1A 1DL7L 3D85B 1FHGA 5DD5L 4D9RE 2QSCL 5FGCE 2UVFA 5HDOA 5IVXF 1HKFA 1FL6A 5F7LB 5A2IH 3Q2CA 4LU5H 4FQCL 4MJ5B 1V3KA 4YDLB 3AFLA 5EN2A 5JHDE 5GGTH 3WN5C 4ZQKB 2ZCLH 4F33A 4Q6IC 1WQVT 4JFXA 1FNAA 1UB6B 3OJVC 2NW2A 4GXVH 1RZ7L 1X3DA 2VH5H 3OBAA 1W0WB 3P2TA 3QIBB 1EA9C 4QY8A 1C8PA 1QBBA 4PRHD 3T0XA 2ENSA 5F1IA 1YMHB 4MWFB 1NCBH 1CFTA 4OLVH 4Y4HC 5GGTL 3VXRA 4YHZH 2ZCLL 3NGBC 5T5NG 3MGTB 5LQBH 2VL4A 1MI5B 2X4UB 5A2JH 3EDKA 1ZLWH 4X5WB 2CIIB 1ZAGA 1D5MA 3BIBX 1MJ7L 4GXVL 4S1DD 1HE7A 2Y5TA 2VH5L 2VIRA 4WI9A 1BOGA 4ORGB 3BE1H 4H0HB 2VUOA 3OL2A 4HQQH 3LV3B 1U8QB 4X0KB 1NCBL 3G6DH 4OLVL 1MCDA 4YHZL 3UTOA 5LQBL 5D2LB 2QSQA 5EC2A 2ICCA 3QDJB 2PYED 5E00B 4BJLA 5C86A 3AM8A 4C57C 4V1DA 4Z5RB 2HYMA 5BZWB 4YWGH 3O6KH 1NAMB 4EIGB 3LIZH 4HQQL 4B7IA 4HULB 4HS6A 3G6DL 3M8OH 4G9FA 3QIWD 5DEFA 5E99H 3DMMC 1R0AH 3T8XA 5ALBH 3RVTC 4I0KA 5A16B 1GZQB 3F6IA 3HUJF 2X9WA 3BESR 4RDQG 1FL3B 1KTKE 1JVKA 1IZJA 5FCSH 4HBQA 3SN6N 3O3UN 2D0HA 2MQ3A 5EZJB 1R3KA 4AIOA 4YWGL 3O6KL 2QJDA 2DI8A 1NDGA 4IIQB 3LIZL 4X7CC 3OHXA 4Y4FB 1Q9LA 4ETQA 1QZ1A 1R0AL 2ZOKA 3MA7B 5ALBL 3NMEA 1CDBA 1H15A 5FYKH 1RIHH 3H9ZA 4F37F 4AT6A 1KB5H 2W0FA 5KAQG 3CVHH 2EXYC 4YHPB 5D8JH 1S7UA 1OAXH 4XCCH 5KS9F 1FG2A 4P5TD 4WO4C 1BECA 2BSSB 2LU3A 3BPLC 3E2HC 2CIKA 1BP3B 2EDKA 3BDBA 4G7YH 4K7PY 3OGCA 2L0DA 4U1NB 1O5DT 1KT2B 4FQXC 3D2UB 5FYKL 1RIHL 2A6KA 5GRZA 4LSPH 4XP1H 1KB5L 4U7SA 5FGSA 3CVHL 2IBBA 4LOUD 4GAGH 3RZWA 5HYQA 4PJAE 5D8JL 1FFNB 1OAXL 4M1CC 3PGCB 1LDSA 5DSCA 4DKFH 1KJ2B 3QEUA 4HIXH 1CGUA 1CL7I 4G7YL 1PQZB 3D87B 3O4LA 1CLYH 3CC5A 2E7LA 4B50A 2NY2D 5IB2B 4ONFH 2JE8A 1JN6B 4LSPL 1ZEAH 3X3FH 4XP1L 2F15A 4U1GB 4Z7VA 1S9XB 3HZMB 2VQ1A 2ZUWA 3O2WH 4PJFA 1SMAA 4DKFL 3GKWH 1E4JA 2X1QA 4HIXL 3HN3A 5J12C 1RZ8B 4GRLD 5GSVB 1Q0YH 1YPZE 4TVPH 1QSFB 3DBXB 1LVEA 4KRPC 1CLYL 2Z0BA 3IRZA 3VXUB 4H26A 3KYKL 4ONFL 3GK8H 3X3FL 1ZEAL 2W91A 1WISA 1RK1A 2XV6B 3H3KA 3D39E 4HHAB 5EUOF 3O2WL 2E8YA 1J0ZA 1X5IA 4OZ4A 4RCAA 3FB5B 3GKWL 4P4KD 3MV7D 4XWGL 4YDIH 5D5MF 3C8HA 1Q0YL 4TVPL 3ULUC 2X41A 3HR5B 4NQDD 1I1YA 4PFEA 1IAOB 2IQAB 2P5EA 3QYCA 3GK8L 3ZDYF 1OTSC 2E5EA 3LN4A 4WWID 5KSAB 4OCXH 4EUPB 2OSLA 2DN7A 1MAKA 1UXWA 3QUXC 4P46B 4OSUH 1CCZA 3VI4E 3BPCB 4YDIL 4O9HH 3V2AR 3TYFA 5I16A 1QVOB 4OLXH 1N8ZB 3CX5K 4LKXB 2VABA 5EU7C 3TO2B 1QLRB 5JPMA 5MEOA 3U7YH 4CJ1A 3E6FA 4OCXL 4P5MB 1DQMH 4WI5A 1YNTA 4G43A 3RNKB 3V4PH 4YBQD 5F8RC 5C08B 2VZUA 4U6HB 4OSUL 4U6VH 4QHLB 3MA9H 5DYOB 2CLRA 4YLQT 4JFZH 3VXTA 5J8OA 4O9HL 3F7RA 1DP0A 3VXRE 2VE6A 4OLXL 5SWSD 1YY9C 2COQA 3KLDA 4M7JL 2YWZA 3ULUF 3S36H 2AAVA 2RQ8A 2IPUK 2XNAB 1DQML 4UMGA 3V4PL 5EG6C 2NY4D 3SGDI 4CN4A 3FZUD 4U6VL 3MA9L 1PAMA 1XGRA 2P43B 4FFYH 3U82B 3WE6A 3ZE2F 4JFZL 1X5ZA 4QEGA 1TXKA 2I9LA 1FPTL 2DLTA 1ZVSA 5DJ6A 1Q9OA 1OSPH 1DQDL 4LBEB 4IS6B 4LCCC 3S36L 5HDBE 2Z4QA 4V1DE 1VGEH 5IB3A 2X6MA 2HJLB 5DVLA 2FIKB 4MB5A 4EXKA 5ICZB 1TTUA 4FFYL 3LPFA 3G5XB 3RWIA 4G9FE 1AP2A 2CLVB 4NUJA 3M1BA 2GFBA 1KIRB 1R3LB 4G3YL 3L3KB 4WJ5A 3MRCB 1X5KA 1OSPL 1OF2B 4WI7A 4JY6A 5ANMA 1VGEL 3OAUH 2L7UA 2XKUA 2D9CA 1ZLVH 2ZCKH 4HIEA 4JKPH 5BVJA 4XNMA 4JFED 5LG1A 3DVGB 4L3AA 1T4KB 4X6CB 4OLZH 1ZXQA 5SWQA 3SCMD 3WXVH 4XI5D 1AKJB 5FB8A 2FH6A 4LGPB 5BV7H 1ACZA 1HDMA 2Y07H 1T20B 3R0NA 1N5AB 4TYUA 3MZGB 2OX5A 5ICXB 5B8CC 3QXVA 5FKAA 4P3WA 1T04B 4Z7WA 4ESKA 4JKPL 3TJEH 4U1IA 1XEDA 3GGWA 1SYSB 2XZAH 4GJTB 4CW1B 3LKOA 4UNVA 4G5ZH 4OLZL 3STBA 3WXVL 3BWAB 5BV7L 2Y07L 1KPRB 1NC4A 1H0DA 3OXSA 2DWEB 4GW1A 3WMSA 1JWMA 2ZG3A 3TJEL 3QIUC 3MGOA 3C6LA 4WU7B 1C5CH 4HLZH 2XZAL 4H1LH 4M6OH 5I1DB 4RGNC 4G5ZL 3CAFA 1IEBA 4LRNH 5HSFA 3O4LE 3BUYB 3DI2B 3MCKA 1QNZL 3VWKD 1AXSA 2R0WH 5BV7C 1P9MA 2UYLB 3BHBB 4AH2B 1IKNC 2CGRH 4Z7VE 1J05B 3U9UA 4MXVE 4QRTB 4PJFE 1HNGA 4LQ1A 2ZOLB 5GS3A 1BIIB 1C5CL 3SDAB 4M6OL 1YJDH 4WU5B 4M4RA 1NGZB 4R97B 4LRNL 2VLLA 1URLA 1I9JH 3ILPA 1F90H 1PY4A 3Q3GA 4ORZC 2B0SH 2Q7YA 3ARBB 1ZLUK 4BM7A 2R0WL 5IKCB 1CICB 1I7ZB 1P69B 2ZUXA 4I9WD 3ZKND 2CGRL 5T1MA 2EE3A 2D31B 5JQ6H 1DBKH 1LO0H 5EPMB 2R8SH 1F4WH 4HFUL 3QFJB 4S1DC 1YJDL 1II4E 3LRGA 1ERNA 1I9JL 5FM5O 3SKMA 1F90L 4HK0B 2B0SL 4F8TA 1ZKAA 4KH2A 3LKQB 3MV9D 2N7AA 1AQKH 3GSUB 3VMOA 1S7WA 1DBKL 3VWJD 2R8SL 4XBPB 1F4WL 4YEEA 3IDMB 4R90H 4MNQB 1HOCB 1EXUA 2BVOA 2YXFA 4Y19D 4HUWB 5DJ2B 3FOMB 5EO0A 3GUTA 4U0QB 1AQKL 4LDEB 5EB9A 4JFQB 4F7TA 4AIZA 1Q8MA 1E0OB 3TZVB 1K3ZA 1UGNA 3QIWC 1ZHLB 4YQXH 2AJSH 3KPMA 3T1FA 4EKXA 4R90L 1GGUA 3VRLE 3VFUA 3S35H 5E5RB 1LP9B 3ARDA 2P8PA 4ZAKA 1RK0B 3MO1B 4M03A 3EJZD 2CO6B 4LLYB 5FA4B 1MHEA 2C3VA 2VDQH 5KN5B 2IH1B 1HCFX 2KBGA 5FO8A 1KIUA 3FB8A 4PJHF 2YRLA 3EYQD 1Q9WA 2AJSL 4YQXL 3ZKMD 1ACYL 1JPGB 4DWHA 3E1F1 4NFDA 3S35L 3S3JA 3UDWA 3DTXA 1PLGH 2FWOB 4L4VD 3SKOB 2XY2A 4JVWA 4OCWH 5IB4A 4N9GA 43CAB 3OX8B 1C12B 1DQLH 4KJWD 2X4TB 3U2SB 4LPWA 4NO5B 2VDQL 3UBXB 3FQWB 1DUYB 1L7TH 2AKRA 5C0RH 5TE6H 2FZ3B 2BNRB 3LQZB 2AVGA 5ISZA 2NCMA 2FEEL 4PJ9B 3RA7H 1PLGL 3VH8B 4LOUC 4OCWL 3MYJA 5C0BA 3ULVH 4ODXB 3GMQA 1DQLL 4TUKH 5GGRY 3I02A 5ANME 4Z78A 2Y06H 1WJ3A 3EDFA 4KV5F 4HLJA 5C0RL 2BY1A 5TE6L 1PSKH 3PWUB 5HGHA 5HGGS 4NBYB 1U8JA 5AUMB 4JO3H 3RA7L 1BFOA 5CAYB 3ULVL 3T1WA 5IBLD 4Y4KC 3T08A 4TUKL 4XHQA 3MNZB 2Z93A 4GRLC 3K81A 1MHCA 4FXLA 2Y06L 3VRJA 4Z7WE 4JVPA 1PSKL 2A1WH 1VGKB 3CLEL 1EEZA 5C9KA 2Q8BH 3DI3B 1QHOA 4P9MH 3ALWA 1OOAA 1IM9D 1WFOA 1KGCE 4JO3L 3CZFB 1MHHB 1K6QH 4GKSB 1U36A 2FO4B 2AK4B 3PGDB 3ES6B 3NZ8A 3RAJH 4P4KC 1GOFA 4P0DA 2EO1A 5DK0B 2LABA 3OJDA 4OZGA 1NANH 4F7CB 4N8VB 2A1WL 5IJVA 2YD3A 4R3SB 2Q8BL 32C2B 3ZHDA 4H0IA 3W2DH 3TBWA 2ZUYA 3ELAT 1BD2A 2UZIH 2VNCA 3F5WB 3D69B 1FG9C 1NFIA 2B4CH 1K6QL 3QZWB 1V3MA 2UUDK 4WFHD 2NTFB 5F70A 1TJIH 3MRGA 3RAJL 4Q9RH 4L9LA 5DMIH 1KG0A 1JHKH 4EN3D 1S9VB 1FLRH 3D25B 5TGBB 1INQA 1BEYL 5JOFA 3W2DL 3AXLB 4R4BB 1NGYA 2UZIL 3SPVB 4YBQC 2WWMD 3HZKA 5D96B 1UZ6E 1FVDB 1TJIL 4Q9RL 4KJYB 5DMIL 3GSOA 3DV6A 1JHKL 3PJSA 4OD1H 3DIFB 1FLRL 4G6MH 4XPBH 3FO2A 5D7IA 2KQNA 1K8IB 5H2BB 4GBXD 4HWEH 3KPNB 2FSEB 4AYFA 1NLDH 1SY6L 3C9NA 1QO3B 1ZOXA 3QP3A 2B4CC 2NY4C 1OB1A 1ODAA 3FZUC 3UPRA 4M5ZH 4KKBD 5AEAA 4AENA 2C9AA 4OD1L 4OKDA 5DC9B 5IFJB 4QRPB 4GRMB 4G6ML 3L3OB 3RWCB 25C8H 5AYUH 1ZT7A 1XIWD 4X4XA 2W59A 4HWEL 1TCRB 1INEH 1FZKB 3VGAB 1NLDL 3HCVB 1EVUA 2BHZA 2V7NB 1KTDA 4M5ZL 1M7DB 1ND0A 4X9FA 1SYVA 1P2CA 4L8SC 3H9SB 4JRYB 1WIUA 1YEFH 1I8IB 4LKCA 5AYUL 4APQD 4YXHH 4WENB 3NTCH 1INEL 5FK9A 2BMKB 1H8SA 1JF5A 3QJFA 3CX2A 1K4CA 2CSPA 4MAYD 1FAKT 1Q94A 4HMDA 3DVFA 3VFTA 1KEMH 1AGDB 3BZFA 5JIPA 1SM3L 1DUZA 3RQ3A 1OTTC 4I18C 2D2OA 1AIFA 1QSED 3SCMC 4MGXA 5KSBA 3QNXA 4XI5C 1YEFL 2G60H 3GMPA 2GTZB 4YXHL 1HSAB 4FABH 4QHMB 1JYWA 4K3EH 1H3PH 3NTCL 4N0FA 1NBVL 4NSKB 1S7RB 5MP6H 3RX5A 4GAJH 1LO3H 2IFFH 2IBGA 2VXSH 2BSED 4A6YA 2DQUH 2K3TA 3EFFA 1KEML 5MERA 4S11A 1MLCB 4RRPA 1NC2B 4OUOA 5F7MC 2G60L 2YMXH 4K2UH 1IAMA 1MEXH 4FABL 4QT5A 4K3EL 1H3PL 1J9CT 3T04D 5ISZE 5FOBA 2NY7H 1X4ZA 3VXSB 3AMLA 5MP6L 1P5VA 2VQUA 5C0BE 3RWDB 4QXUH 5IQ7H 2OI9B 4S2SB 2VXSL 4BQBA 4ACPA 2DQUL 5GPRA 2Y7QB 4QRRD 3MACL 5C07D 2YS4A 3O3BB 1R5WB 3DGCR 3V7MA 3BIAX 1T5WB 3VWKC 1MUJA 2YMXL 4K2UL 2A83A 1MEXL 4ONOA 3IDJA 3PQYD 3IJYB 4XZUB 2NY7L 2J3SA 1C5BH 2J2ZA 3WHE0 4ZSOA 4GKZB 2FRGP 3KPTA 5IQ7L 3PDOA 3O2DH 2VLJA 5CGYD 3F12B 2EH8H 1FSKB 1V05A 3C8KA 1DEDA 1BJMA 1KLUA 3VGBA 2JLLA 3VFSB 1E4KC 2Z8WC 4HZLA 5EFIB 4MD0B 5BJTA 4BZ2H 4HIIB 3EZJB 3ZKNC 1AR1D 1C5BL 2X4QB 1WT5C 1P6FA 2DLHA 5IEHB 2YK1H 4D9RD 5KSVA 3WO3B 1QBLH 1CXHA 2EH8L 5EU6A 4QHUB 2P47B 2EDFA 3SDDD 3QXTA 3CK0H 2GJZB 2H9GB 2NNAB 4OZGE 4UU9A 1VEOA 1ORSB 5JHDD 4BZ2L 4MD5B 2O5YH 1BD2E 4NNYA 3HFMH 5E8NB 2W60B 2GK2A 3IXTA 2YK1L 1VFAA 1T5XA 5C0AA 2HG5B 4CMHB 2H2SD 4LK4A 1QBLL 1IQDA 4ERSH 4JQXC 3CK0L 3ULSA 1A4KB 4CKVX 4MCZB 5ID0B 3QXAB 4NQEA 2O5YL 2DAVA 4PV9A 3HFML 5EU4A 5IGXH 4XVSH 2XTJE 1A6ZB 5J13B 1I8MA 1T80A 1KYOK 3VW3H 1T89C 3O8XB 2MKWA 3OR6B 5I1IL 4ERSL 1ZHBB 4GXUN 5JUEL 3AROA 3EJZC 4EI6B 5D7IE 5GSRA 1I4FB 3WKMH 2VJXA 4P99A 2P7TB 3QJHB 1CFNA 3L5XH 3LPWA 1T3FB 3HPLA 4N1EA 3EYQC 5IGXL 4XVSL 3ZKMC 5DMKB 2NY5H 1KF9B 4ZPTB 2EC9T 3W9DA 3VW3L 5GS1B 2VXVH 5E2UH 3S34H 3TYGH 1UXSB 5DJ0B 5K59F 1CQKA 4MQ7A 3T2PA 1CL7H 5K9OB 4WNQA 3WKML 5C1MB 2DIAA 4MS8C 2XPGA 4KJWC 1HIMH 3L5XL 1QFOA 2FL5B 3KYOB 4ELMA 3V95A 2N4IA 4AM0A 2NY5L 2BX5A 3WLBB 4L1DA 3IJSB 4PJ7A 2VXVL 5E2UL 3S34L 3TYGL 4Q97A 3U36A 2R1WA 3Q6FA 1ZWIA 4JQVC 1SEBB 5EIIA 2PO6A 3STZB 4LPYA 3VD4A 1CL7L 4PRIB 5BZDA 3EOBA 5ERWA 2BOCB 4JLRB 3TGXA 1QFWI 3JV4B 4FZ8H 4ELKA 2Y1VA 5C0CA 3BKJH 3RWJA 1HIML 5C0FA 4Q2ZB 5JMRA 3KDMA 4OGAD 1GH7A 1B0RB 3OKEB 2DD8H 2F19H 3G5ZB 2WBJA 1GZPB 4MCYA 3C5SA 3AS0A 4MA8H 1HSBA 3KJ6H 5D1XA 2F54B 1R3JA 4OZHF 5D1ZA 3MXWH 4XX1G 4OIIH 4Z7NF 2OCFD 4E41A 5KSBE 2WM0A 3QG6A 4F58H 3MJ7B 3VGDA 1N3NA 5IBLC 1I7TA 4FZ8L 4PJ5B 3BKJL 3CFJA 4F9PC 4UQ2A 4C4KT 4XVTH 4IDLA 2DD8L 5EC1A 4X8JA 2F19L 4FQ2H 2JCCA 3MNVA 4MA8L 2JKXA 3KJ6L 1AE6H 4F3FB 4XNQB 4OIIL 4WW2B 2AJUH 4CADA 4JFOB 4F58L 2HT4D 5CEYB 2XWTA 4LLDB 4ZUWB 4RSVA 4C4KO 4BSVA 4CN6A 1HQ4B 5KSUB 4N0RA 3FRUB 4XVTL 1MRCH 4D0DA 3IRPX 1JWSA 4FQ2L 3WFHA 4X9HA 2VDMH 4HCRA 4UV7H 3GSRB 3TT1H 1AE6L 1TITA 3IJHB 2AJUL 4PRDA 1MH5B 4KKNA 4Q6IB 3QCVH 5TH2B 4B53A 3JSSA 3LSOB 2AV1B 5D2NA 4OBSA 3DYOA 4BH8A 2NX5A 3Q5OA 5I17A 2APWA 3QFDB 1BVKA 4NZRH 2CK2A 4UOW0 1NFDA 4ZUSA 2FNBA 4ZSOE 4EN3C 1MRCL 2VLJE 1GRWA 4NM8L 4ODUB 2VDML 3SGDH 3D39D 4UV7L 5MEQA 3MBXL 3TT1L 5FCUH 2VISB 3HUJB 4Y4HB 1RAMA 1LNUA 2V7HB 3QCVL 4Q7DA 2WWMC 2HJKB 3JWOC 4KKAD 2DQHH 4NZRL 4GW4B 4HPOH 4YXLH 2F5BH 3FQTB 2ICWJ 4MVBD 3VXNB 3VD5A 4IMKA 4EZMA 4FNLH 3VCLA 5C9JA 5CINH 5FCUL 3T0AA 2NLJA 4GBXC 4JM2B 3RGVC 1JYNA 3CVIH 2PYFB 1G7IB 3WHXA 3MLTB 1YUHB 3FOLA 5IVNA 2DQHL 5E7BA 4KKLD 5KS9B 1DFBH 4HPOL 4YXLL 2F5BL 4JFYA 5D7LB 5C0AE 3RUGA 3CPLB 4PJDA 1IEHA 1E4XI 4FNLL 5CINL 1XIWC 1NBQA 4NNXB 3EOYG 1J8KA 5E8OB 1QR1B 3MNWB 3L6FA 4NC2B 3CVIL 4PBVC 2WSKA 4J4PA 3DMMB 3ZYZA 3VXRD 1ZSDB 2XKSA 4NQEE 2EDWA 1DFBL 3UZEA 3RGHA 4C54A 4K3HA 4HWZB 3P4OA 3RHWF 5ADOH 4KI1A 5DUPH 4APQC 3LOWA 1ZT1B 3BRGC 2ATPA 1GVIA 4X6FB 5I1GH 4YNYA 5DFVD 4XPFH 3MJ6A 3F7PC 4TSBH 2OXGA 1HQRA 4J3UA 3C09B 4NNPH 5CP3H 2HLAA 4CVUA 4Q9QH 3EO1B 4V1DD 5ADOL 5DUPL 1BLNA 2R69H 3AU1B 3OKDB 4JDVB 3ZSTA 2ZSWA 1G9MH 4PJBF 5I1GL 2V2TA 2BVPA 4XPFL 2F53A 5IMKA 3EGSB 4FXGB 4BSWA 3QNZB 4G9FD 5EUOB 1K2DB 3X11A 4TSBL 1TQBC 3GJFA 4NNPL 5I8CB 3V6ZA 4XPAH 1OGAA 3OR7B 4LLVA 4PJ7E 2CKBB 2P44B 5EZLB 2R69L 1QSZA 3K3QA 2E7MA 3BAEH 1G9ML 3ROLB 1R3HB 5GJTH 1QKZH 3JV6B 3RIFF 3OAZK 5C0CE 2P48B 4LCUA 4U3XA 1G7JB 2AK1H 5A43C 3IDYB 3C2AH 4XPAL 1EEYB 3QHFH 4HS3B 3PWJB 4KJQD 1RZFH 5F1NA 4NKDB 2YD7A 3HTLX 3QEHA 3AVEA 3BAEL 4PV8B 1VADA 5FV1L 1QKZL 3EDJA 3F62A 4KRPB 4YPGA 5GJTL 4EVNA 4JZOA 1FV1B 1JBJA 5CGYC 4N0CD 2AK1L 2NYYD 3BGFC 3C2AL 3FL7A 5IFAH 2JCCE 2XIDA 3QHFL 4UILL 4LAJH 1RZFL 1T0MA 3REVA 4QCIB 4CMMA 4PGZA 1AR1C 4XH2B 4X4YA 2VXQH 1A7RH 2H6PA 1RUPH 1NBZB 3G6JA 1A7BA 1AGBB 5ID1B 3SKNA 3O4LD 4G8GE 4QRQB 1H3WM 1T1WA 4KK8D 4OF7A 4LIQL 5E8EB 4I77H 3EYOB 3SDDC 5CD5D 3O2VH 5IFAL 5FGBC 1TVDA 4TOYH 5ACLA 1PYWA 4LRIA 4XT1C 5B22A 1A1MA 1E6OL 2KPNA 1X6NA 4D0BB 2VXQL 1A7RL 5C3LD 1RUPL 3TN0A 3P9WB 5D2NE 1OSZB 1R5VB 1J1OH 1PZ5B 1RZGA 2YPVL 2A77H 2H2SC 1XH3A 5DRWB 3S3SA 1NFDE 3SE3C 3C5JB 5FXCH 3VFGH 4I77L 3O2VL 4E42B 2OL3A 3KWWA 1GGIH 2A74A 4NRXB 3SBWA 4TOYL 1AD0A 3PXJA 1MFAH 1Z9OA 2CKBL 3X12A 5HGBA 3OG4B 4TTGA 4UTAH 3UYPA 1IJ9A 3EFDH 3FHQA 4PJIB 3L9RB 4NQCA 2A77L 3FFCA 3RL2B 1KXQE 2W92A 3T0WA 4JN1H 3U7AA 1JPFA 5D93C 3VFGL 4PJEB 5IVZB 1A4JA 4YGAB 2FD6H 5I66B 1GGIL 3W82A 2GI7A 1MFAL 3EOTH 4QHNA 2J6EA 3GJFK 1F6LL 4AEHH 4UTAL 3D0LA 2FB4H 1BWWA 3GMMB 4JPIB 1XCTA 1N59A 3GBMH 1EFXB 5F1OB 1J0IA 4JN1L 5KANI 4MA3B 1K4DA 2FD6L 1ZGLP 1DVFA 4PUBH 3RUGE 3QAZB 2V17H 4FQIH 1BZ7A 4LVOB 3EOTL 1DN0A 3TBVB 4I4WA 4I0PA 2SEBB 3U9PH 2Y36H 4R0LC 4AEHL 5SX5K 2FB4L 2VDRH 4OD2B 4U1LB 4WFFE 5LGJA 4O2CA 3T0EA 3TO4A 4JDTH 4KVNH 4YHIB 2NXYD 3VGGA 4PUBL 3VXPB 4LEXH 1WTGT 2V17L 3PHQA 4FQIL 3N85H 2X70B 2F8OA 5AZEH 3TWCH 2Y36L 3DYPA 3P11H 5GGVH 3QI9B 4ODBD 4TN9A 3S96B 2VDRL 3RDTB 1CU4L 4R96B 1JPSH 5BS0A 1P4IH 2D03H 2ZSVB 3KHOA 4KVNL 1FCCA 4U7MA 4QTHA 3RJQB 1A1NB 4JO1H 4LEXL 4YR6A 1NMCC 4QF1B 3N85L 2ICWB 3HC4H 3QDGE 3TIEB 4LF3B 5GS2D 5AZEL 3IF1B 3TWCL 4X80H 1L6ZA 5HDQH 3P11L 4LQFH 1H5BC 2F53E 5GGVL 4HG4K 3KPRA 1U8OB 3IS1X 4JO2H 4UOJA 4JM4H 1CD0A 1JPSL 1P4IL 2D03L 3BEWA 4G6FD 4YGVA 4TVSa 3LRSB 5CIPB 2P46B 1NPUA 1OGAE 3ZT5A 1PKQB 4JO1L 1VFBB 5SWZA 2HT4C 4JKLA 2FLBT 2O5XH 2RIKA 1A9BB 3HC4L 4CRPA 2VAJA 5DVMA 5HYIA 5HDQL 2VLRB 5KG9B 2Y25A 3SGKC 4LCWA 1AR2A 1FDLH 3TCXA 5DJZB 3LKNB 3OF6A 1V3JA 4JO4H 4NJ9H 5F9AC 2JJSC 1KLGB 4UBDD 3IDGA 3QULB 3UROR 4UV4H 5I8EB 2VERN 2JK5B 2KKQA 2AQ3A 3ISWA 3DGGA 3P9LA 4KROD 2O5XL 3MRQB 4WV1A 5DMYA 1YDPB 5EBMA 1RUKH 2QEJA 3HMWH 4Y8AA 1FDLL 4WDIA 3S8WA 1WCBA 1KGCD 4NJ9L 4U7KA 4XHJC 1SVCP 1MCBA 1FFOA 3AY4C 4DEPB 3PWNB 4OM0L 2A73B 3W0WB 3IYLW 1MCWW 1O7VA 2R29H 1HHGB 4UV4L 1NC4D 2YBRB 1TNNA 4P3CH 2I25N 1B9ZA 8CGTA 4KKAC 1JUFA 4PJAF 1I7RA 2ZCHH 3NZHH 4WI4A 3EW3B 1RUKL 1NMBH 3C6LD 4O2FA 2ZUSA 5DFTA 3HMWL 2ZG1A 1LK2B 4MVBC 5I0ZA 1T1YA 4NYLA 2H8PA 5F89A 4WI6A 5E1AA 2R29L 4AEFA 3T4AB 5TDOA 4CVXB 4RGOH 5J1TC 4P3CL 2K7QA 3UJIH 4KQ4L 4GG6A 4P5KB 4KKLC 1W0VB 2ZCHL 5F7EH 3NZHL 1F8TH 1NMBL 1MQ8A 1YPZF 3L5WB 4D8PA 5T3XH 4IEFB 4ZXBB 4WIQA 1EH9A 2CLZB 4GFTB 2IJ0C 1BGXH 5J3HD 4JPVH 5INCA 1T6VN 2WNGA 3PNWB 4WHDA 4RWYH 4RGOL 2K7PA 5GGTA 1MSPA 1O0VA 4IRJA 3UJIL 4ZG1A 3GBLA 4LHJB 4Q6YA 5GRXG 3I3BA 4QGYA 3QEQA 3BP7A 3BH9A 4Y7MA 5D1QB 5F7EL 5EH1A 5E95B 1XR9B 1WBZB 3TLRA 3SDCA 1M05B 2A6DA 5BW7C 4NQCE 3FFCE 3BGMA 5T3XL 1BGXL 1FZOA 4JPVL 4JG1H 3TEUA 4YDVA 2Z91B 2DBLH 4RWYL 3MMEA 5DFVC 1YEDB 3T77B 2R9HD 1P7KB 3KS0J 2MFNA 4YFDB 4RFNB 2PTVA 4MMZC 2O5ZH 2DLEA 3NFNB 1PX3A 3WS6C 4OCSH 4OLYH 4HIHB 3AM8C 4AIXA 4DVRH 2ADJA 2WIIB 4P5TB 1ZS8B 3RX8A 4JG1L 2DBLL 1ZA3A 1FO0B 5LGHH 4MNGA 1TVHA 4DUXA 2O5ZL 2NZ9D 4OCSL 3D85A 4NN5C 4N1HB 4DW2H 1VA9A 4OZFG 2UVEA 4OLYL 4J3SA 3WYRA 3ARDD 4ZAKD 2OJEA 5T1LA 4DVRL 1VENA 3T0EE 3MRNB 4L8CA 4MJ5A 1IC4H 5GISH 3R8BB 4PR5B 5I8OH 2BXZA 3MRDA 4WTXA 2NY2B 5LGHL 3I9GH 4FQXA 1MRFH 4UIMA 4XCFH 4DW2L 4OBRA 2IALA 2Z92B 1REIA 3DV4B 3QIBA 4KJQC 5DD3H 5BS0E 4NKOA 3QQ3B 2YD2A 4HT1H 1OP9A 2VKXA 1U8MA 1IC4L 3AREB 5GISL 5FUCE 5HDBF 4MWFA 5I8OL 4NKMB 1HXMB 4PLKC 2PW1B 3HE6B 4R4FH 1T2JA 1JTPA 1MRFL 4N0CC 3JWDH 4UT6H 2CIIA 3KPRE 4XCFL 5DJYB 1KB5A 2B1AH 1F58H 3D18A 5FECB 3D3VB 5ISZD 2VAAB 2YEZB 3CVHA 2YHGA 3HE7A 5DD3L 5C0BD 2HVJB 4HT1L 4M7LH 4P4KB 2EE6A 2R2CA 4ORGA 4ALAH 4JCMA 5IF0A 3PABA 4BFGA 1FGNH 4X0KA 4JGMA 1JZ3A 5FYLH 1FO0H 3VFWB 4QO1A 5D2LA 4R4FL 3DYMA 4ZO6A 3JWDL 4UT6L 4KK8C 4JANB 1JI1A 4QNPE 2B1AL 5CD5C 4LCWE 1F58L 3MLZH 3W5MA 1S7QB 2R4SH 4EDXB 5BZWA 1S5IH 2CRIA 4M7LL 3IVKB 1HH9B 5AG8A 4ALAL 4JRXA 4GRWE 4LGSB 1FGNL 5FYLL 1FO0L 1CG9A 4HZAA 5C3TA 1GZQA 5IK3B 1NEZG 1B3JA 4MQXD 1MOEA 3MLZL 4CVZB 2H45A 4JY4A 1XCQB 2R4SL 5CMAB 5DJDB 1S5IL 3GIVA 3BQUA 1UWGH 4IIQA 4W6WB 4ZUUA 2NW3A 4LSDA 2QHRH 3MA7A 1PW3A 3UPAA 3A6OA 5JTWA 4BQ8A 1RJZB 5AG9A 1MCKA 4PREB 3OGOE 3TCLB 1BD2D 2NY4B 4P57A 2EDYA 1C5DB 1BBJA 1A6UH 1MLBA 4JB9H 1UWGL 3H2WA 1BVLB 2ITDB 3SGEI 4PIRF 3UCRA 2DQGH 5K9QI 4Z7VF 5ECJE 5I1AA 4MXVF 4GG6E 1R24B 4PJFF 4NO0A 2QHRL 4U1NA 4FTVB 1CLOH 1GGCH 1QFWH 3DWTA 3INUH 4RGMC 1KT2A 3QUKB 3BX7C 1XF4B 1V5JA 4GAYB 5F7UA 3MV8B 1XGYH 1HHKB 5DI8B 2BVTA 4JB9L 2J88H 5GS2H 2XTJD 2DQGL 5I18H 5ITFA 2FJGB 3KG5A 4L8SB 1PQZA 5JA9A 3QEQE 1CLOL 2GIYA 2X4PB 5IB2A 1GGCL 1QFWL 3INUL 2G9HB 4LCCA 2WUCH 5CSZB 4XAWH 1JN6A 3NCJL 3VGEA 3PIQB 1A64A 2NQCA 3MOBH 1XGYL 5SX4I 3GDBA 4JFEB 1AD9B 5GS0D 5I1HH 4JZJB 3C5ZB 4M6NH 3QDMA 2CR3A 2AJZB 5DHYB 4C83B 1QSFA 1ZHNB 3IKCB 2G2RB 3QCUH 2A38A 3MRMA 1FN4B 4RMRA 3VXUA 2WUCL 1Z5LB 3D6GA 4XAWL 3TBYA 4JN2B 4GS7B 5I1EH 3G9AB 1NDMB 3I3EA 4K7PH 1U8IB 1UEYA 3EOAA 3O45A 5IB1A 2YD9A 5CS7A 3ORJA 5ETUB 5DTFA 1I9EA 1NGWA 3FONB 4JRWA 4RISH 3ZYIA 4MNGE 1CI5A 3QCUL 3KXFB 4NOBA 1AO7B 1SEQH 5I75B 1LEGB 3VRLF 1IAOA 2IQAA 5EU5A 3BD5A 3NCEB 1WC7B 4EI5A 1E6JH 1KJMA 5KSAA 4ISVB 5B8CA 4K7PL 5E2TH 5E2WH 2C3XA 3IFPA 4P46A 1KNOA 3ABZA 4BA8A 1G1CA 3MRBB 3BPCA 3F58H 2W9DL 1QVOA 3R1GH 3LD8B 4RISL 1BFVH 1RZIA 4XVJL 2BVQA 2Z35A 3TO2A 3FT4B 4X4ZA 3GSVB 1SEQL 4GOSA 3VD9A 4UBDC 1NCAH 4G80B 4Z95H 1ZMYA 1NFKA 2IADA 1ES0B 3MBEB 1W8NA 1E6JL 3L3GA 4P5MA 5I1CH 3WO4C 2OMNA 5E2TL 3RNKA 5E2WL 4KROC 2ITCA 1U9KA 5HGDA 4U6HA 2EIEA 3ARXA 4QRSA 3OAYK 4X7TA 3CJJA 1B4RA 1MAMH 3KR3H 1U6AH 3F58L 4YUEH 3R1GL 2ZUVA 1BFVL 1NUDA 4HAGA 4E9LA 2XN9B 5FYKE 3ZE0E 1NCAL 4Z95L 1N6VA 2XNAA 2XACC 5HHXH 5I1CL 3VJ6B 5HYSG 3CCHA 3H9YA 1UJTA 1QFUH 1MAML 3KR3L 3C6LC 1U6AL 1QA9A 4XRCB 1UT9A 4YUEL 5I6XB 1KPUB 2HAZA 2EYTB 2GQHA 5D2LE 4M8QA 2IGFH 3MV9B 4UAOC 5C0ND 4KUCD 3WL9B 4JHBA 5C0EA 7FABH 2B2XH 4LBEA 5HHXL 3VWJB 2WQ8A 4KI5E 1JGUH 3PWVB 2FIKA 5DJXA 4DQOH 5ICZA 2VLJD 1QFUL 4F7EB 4JRXE 2R1XA 3ROOB 4H1LA 3G5XA 1VDGA 2X44D 4NZJA 3ZT6A 4NBZB 2X4NA 2VKWA 3QA3B 2IGFL 4Z7WF 3L3KA 3MRCA 4JHWH 4YAQA 4Y2OA 5E4EC 7FABL 2BNUB 3LQAC 5J3HC 5IV2B 2B2XL 1FZJB 1OF2A 3R8QA 4BYHA 4JZNB 4LARH 1JGUL 1KB9J 4DQOL 2UUDH 4XWOD 4POYA 4LMQI 1I1FB 1U2HA 3K8MA 3DVGA 4MSWB 1T4KA 4TVPE 4X6CA 3GSWB 1HH6B 2VZTA 2YA0A 3CUPB 3MJ8A 3G5YB 5TDPB 3MRJB 4AY0A 1RJLA 1QEWA 1A6AA 4JHWL 4PTTB 3QWQB 3KS0H 1H8OA 4OZHB 1QP1A 3HI6H 5TF1H 1YC7A 2R9HC 4LARL 3RRQA 3SKJH 4IHOA 1BFTA 3H7LA 2BXYA 4H25A 5C0AD 1T04A 1J87A 1XR8B 1SYSA 4L4VB 5E6YA 1F02I 4F15C 4YHNA 1GC1L 5GRUH 3NPSB 4NP4H 3QXWA 1ZHKB 4OQ1A 4RFOH 5HI4D 3HI6L 4NQED 1G1YA 5TF1L 3WXWH 5C70A 4HAFA 1KIQA 4I48B 2APVA 3QNYB 3SKJL 2GCYB 4OIAA 3FAXA 4D2NA 3DROA 5IW1A 2NZ9C 1UZ6F 4WU7A 3RWFB 1MPAL 2HT3D 5BMFH 2DTMH 5I1DA 5B4MD 4NC1E 3G08A 2EZ0C 3ARDC 3BUYA 3BXNA 5EZOL 3FT2A 5GRUL 3T0BA 4NP4L 1CVRA 1BX2B 4RFOL 5KTEH 4K7FA 2UYLA 4PJXA 3RTQA 1C08B 4OF8A 4KMQA 4AH2A 3WXWL 1QFHA 1XF1A 1J05A 4QRTA 2HFGH 2ZOLA 3ARFA 3BDXA 4ZTOH 5BMFL 2DTML 3QDME 2EEDA 1QSFE 3UDWC 5CJ5A 1IGJB 5C2UB 3WFZA 3TPUA 3VXUE 1CICA 5IKCA 4KDVA 5KTEL 1XF3A 2YSSA 3FO9B 1OWRM 4G6KL 5T3ZH 1JTTA 2ERJC 4JJ5A 4M93B 4IOIB 4EDWH 3X13B 3RY5A 2P42B 1IM9B 3IDXL 1VESA 1JNJA 5JW4R 4YE4H 2PO6D 1FNGA 2MKLC 3RVVC 4Y4KA 1CFBA 4LPUA 4X99B 1A7PH 4X9IA 5C0CD 2ID5A 2HH0L 1I9RH 2WUBH 3TBSB 5T3ZL 4L4TB 1KPVB 3WFBH 4XBPA 1CFSB 2WBJD 3S5LA 4MNQA 1WZLA 3BSZH 4IJ3C 1AXIB 5D1XD 5D1ZD 4ZYKB 1H8NA 4YE4L 3PUCA 4HUWA 3HG1B 3FOMA 2E7HA 4JDZA 5JLZB 1FJ1B 3LDBC 2I9TB 4JFQA 1A7PL 4O51B 4EN3B 4PJ8C 4HMEA 1I9RL 2WUBL 5C08E 1ZHLA 2PXYB 3K1KC 1WIOA 3WFBL 1A6TA 1WEJH 4XP5H 2HN7A 3BSZL 2BOBB 4RGNE 4DKAA 2FEDC 4MQXC 4FP8H 5H94B 5B3JE 4ODSH 4R2GD 2NY6D 3FB6B 1TQCB 5D6DC 4LLYA 4GH7B 1DN2A 5LKNA 3QO1B 4HKXA 3TIDB 4G6AD 2IH1A 5L88L 2MPAH 4FQHA 4Z76A 4HGWA 1SJHB 5C6TH 5HHVH 5INDB 2WBWB 3UTPE 1WEJL 4XP5L 4GBXB 4MD4B 1AQDB 4LLWA 4FP8L 4YIQB 4ODSL 4NRYA 5D6CB 4WTZA 3NAAL 3SKOA 3JVGC 2QKIA 1U8HB 1CGYA 43CAA 3OX8A 1EO7A 2X4TA 4NO5A 1M7XA 4Y16B 3UBXA 4L9LC 4PJBB 2MPAL 5EA0H 1H3VA 1DUYA 5C6TL 3L5HA 3B8YA 1U95B 5HHVL 5DS8B 1XIWB 2W0KA 1MVUB 2BNRA 2FZ3A 2QADD 3LQZA 2IPKB 5JPNB 5DRXA 2VN4A 4PJ9A 4HUKB 4ODXA 2XTJC 2AP2A 1T2QH 1DJSA 3QG7H 2H2PC 4M43H 4RWHA 1JF1B 3VI3E 4LVHB 1X6LA 1CLZH 3PWUA 3IXAB 4X6CE 4TNWK 4G8EA 5MENA 1SY6A 5AUMA 3HAEB 4HFWB 3QUMB 3WNNA 4ZFZA 5C92A 1XF2B 4DTGH 4OZGF 4MAYB 3K8LA 4XGZB 4UZGA 2YUVA 2H26B 1T2QL 3QG7L 1IC5H 2AEWA 5DJAB 2MHAB 4M43L 5F3BB 5ILTH 1XGPB 1AGCB 3U4EB 4XMPH 4ZO7A 2GTWB 5I8KL 2JB6B 2YN3A 4J3VA 3U0PA 2CDGB 3TT3H 3CZFA 4DTGL 3M17A 3O81A 4GKSA 5E5MB 4DK3A 4J4PD