3HZKB

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLAFIRNKAKGYTTEYSSSVKGRFTISRDNSQSFLYLQMNTLRAEDSATYYCARDINPGSDGYYDALDYWGQGTSVTVSRAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S73-2 Fab (IgG1k) light chain
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2009-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkB01
4XVJH 2OS7A 3BKYH 5JW4R 1DQDL 1TZHB 1NGYB 1EEYB 4AEIL 3GHEL 3HE6A 3K46A 1H3XA 1IGFH 3P73B 4NM4H 2V2TB 1A6AB 4OUUA 1TQCC 4U0QB 2Q8AH 2HLFD 4E5XB 3MLYL 3MO1B 1KIPB 5FDWB 4BH7B 1KN2H 1U92A 5TE6H 4JO4L 1F42A 4EOWL 3D69B 5C07B 5FYLE 1IGTB 5L9DL 4Q7DA 1IC4H 2NCMA 2HVJB 3Q6FA 1HH6B 3ARGA 4EIGB 4QRRB 3MUJA 4GT7A 4K7FA 4ZXBC 4NQEB 4LCUA 1MHEA 1BFVH 1PLGH 2ITCA 3EUUA 4I3SL 4AEHL 3JTTB 5DHYA 1BF8A 2IBZY 2QKIB 3FZUD 5FF6B 1JUFA 4KRPC 3TT3H 3FO1B 4HPOH 5HVWA 1EK3A 3QG7L 5KW9L 2X89D 4P4KA 2A74B 1TJGH 5GGVH 3T65B 1NAML 1IT9H 5TE7L 2CD0A 2CK2A 3MRLB 3W39A 5IM7B 2F53B 3J8F7 3GSQB 1PG7X 1MEXH 5KSAA 5JZ7C 1T83C 4PLJD 1GIGH 4XVTL 3B9AA 1S5IH 1JHLL 4J2XA 3MRQB 2FBJH 1A6VH 2R0WL 1G0YR 1FP5A 2VLJA 4CMHB 3B9EA 5DD6B 5CGTA 5GGSY 4ELMF 1JI1A 5IK3B 5EU4A 4PJ7F 1IQDB 4LBEA 2EXYC 2MHAB 4RDQF 4WNQA 4PGEA 1NFIB 1B4RA 1F6LL 1I7RB 3VFVB 2O26U 4P9HL 4LFHD 4YDIL 2DM7A 3UTTD 1NLDH 2QJDA 4JJ5B 4M1DH 1VACA 3GDBA 1IGCH 2FH6A 3C87A 1DBJH 3P9LA 3EFDH 1IM3A 4FQHB 4JKPL 12E8L 1Z5LB 4YK4C 4YX2L 3UYRH 3NH7L 2ZUTA 2ZSWA 3H3PH 2HFEA 4OLUH 1N3NA 3U79A 3DROA 3JWOC 1X5GA 1JPTH 4JKWA 3QJHA 5KSUA 2IQAA 2BXZA 1XF2A 2V7HA 1INEL 3B9KA 3L3KA 1T3FB 3M45A 3OJVC 1FSKB 4FFYL 2R69H 1S3KL 3C5ZC 3AU1B 3QQ9D 2W65A 3CZJA 4PJDB 4HPYL 3KXFB 2BSSA 5KS9B 4LLYA 3NGBB 4PJ8D 3TFKC 5HYSG 1NEZB 4J8RA 1MAJA 4ODSL 3SO3B 4YPGB 4MMXC 5INCB 4NQCD 5DQ9A 3PF2A 3U30C 3R06A 3RTQA 2YZ8A 3BJ91 1BD2A 4M62H 2KZ1B 5E8PB 1QSED 2IANB 1OT2A 1TETH 2WBKA 3SKNB 1U8KB 2XYCA 5EU3B 1VFMA 5C8JB 1I1RA 3EJYD 3MOAL 2M2DA 5F70A 1PQZA 4NN5B 5IJKC 1ZGLA 2PNDA 4LSSH 2YD4A 3GMQA 5CMAB 5DJ8A 4FFVD 3ZKQD 4F80A 1JNNH 4B5EA 5C0CB 1NBYB 3WIIL 4PJ9A 2A73A 4U1JB 3MV8B 3KPSE 2YA2A 4RBPK 4TUKL 2NY0C 4FFZH 5DUPL 5ESQB 4CJ0A 5C0ND 4NQSB 1F90H 5EU7C 1WEJH 3GSWA 4HMCA 2UUDH 2FWOA 1BPVA 5E2JA 2FX7H 4UTAH 4TULH 5EUKA 2R1WB 3HG1A 4NO0D 4MD4B 3EYFB 1HOCB 1CGWA 3RAJH 3RHWK 1E28B 1XIWC 3Q3GA 1R0AH 4PJGA 1S9YA 3EGSA 4OCRH 3H42L 5DMGD 3S35X 3KPMB 5E2VH 4P9ML 3KJ4B 4YDJA 3WLWC 3CK0L 2XFXB 4FZEL 3V2AR 2PYEB 5K93A 1DUZA 1XGUA 2DLTA 1I1AB 5DQJB 3PQYE 4F7TA 1JZ2A 2DM4A 2Y36L 5CD5D 3GGWA 1UB6A 2IADB 3TV3L 3DJ9A 3MGTB 1XZ0A 3CLEH 5SWZB 1D3CA 1IAKB 3FO2A 5K59E 4JEGB 2ARJQ 4J4PD 1RZFL 1HKFA 1IGMH 4PRAB 3EYVA 1FL6B 2XV6B 3WNLA 5CLWA 1VKXB 3BGMB 1ZTXH 3MLWL 4PYGA 5INDA 1SVCP 1FC1A 5KBNC 2VLRA 4M7LH 4JPWL 5EORL 1HHHB 5D1QB 3C5JA 2DYPD 3OKYA 3ZTNH 5F7UA 1CF8H 5F9JA 4WWID 1XCTA 1CICA 4KK8C 4LF3A 5IVXE 2DI8A 4KZEH 4HIEB 4ZUVA 3ZSSA 1PX3A 4UIMB 2ZJSL 3H9SD 4XNUH 4H8WL 3PABA 4FQQB 2F58H 4KMTL 2AEPH 1G9MH 4GJTB 4YO0B 1T7XA 4BFBD 4G8GD 5DT1L 4K7PY 2QHRL 5E5UB 3L3DA 1QUNA 1EO8H 1CYGA 3GO1L 3QDMD 5FHBH 2C5DC 5DJ0A 4G80A 3RKDC 3L3JB 3VXRB 5C08B 2XWBB 3IXTA 1LEIA 1OP5H 4XP9H 1JPFA 1F02I 2AS5M 1OWRM 1J12A 4CN6A 4KAQH 1WFUA 3QWQB 3NOIA 1UWXK 4MA3B 3QRGH 1QSFB 4OGYH 4YXLH 3U7YL 1OAXH 3FN3A 3PWUA 2FD6L 4GG8A 1D6EA 3MFFA 4XP1L 1JZ8A 1T04B 5D8JH 2IH1B 4X99B 3CMOH 1UKSA 1E27B 5DRXA 2NY4B 4HWZB 1ZT4A 3LD8C 3O45B 3S35H 4LHQB 5FGBA 3TN0B 2JCCF 3DSFL 3O4LD 3QEUA 3F12B 2I24N 1ZHNB 2VZOA 4JG0H 1N0XH 1E6JH 3DVNB 3BW9B 3O6LL 2H8PA 1OQXA 2BMKB 2EH7H 1YC8A 1R3LB 1YEGL 1RZ7L 2BX5A 4YGAB 5K9OA 4OV6F 2VAJA 1D5IL 4WW2B 3VGAC 5I1DA 3O3DB 3MRGA 5I18H 1BAFL 5HPMA 4U1MB 5GRVL 4MQSB 4QTHA 5I73C 4JFFA 4ELMA 3MCKB 1YYMH 2WBWB 4NZRL 3WHE1 2VNCA 5C6WH 4PJ7A 4YE4L 4OZHE 4PJXF 5K9JL 2F54A 4LHUD 5F7EL 4Z0XA 4X5WB 3F6IA 3WXVL 1VPOL 4IS6B 3U2SB 3VFTB 4XBEH 2IPTL 5IB3A 3VGHA 3LQMA 4FXKA 1Q1JL 5FKAA 4RAUA 4YHPA 2KL6A 4JRXB 3QIUB 2ID5A 2XZZA 5ACZB 3SE8L 1CLYH 4TPRH 1MWAA 4LVOC 3V4VL 4LVEA 3QYCA 35C8L 1R3IL 2EEBA 1OW0A 4YQXH 2HKHL 2BVPA 5TDPA 4QO1A 3TH2T 4MLSA 4WUUD 5F7DB 5ADPL 2DQHH 5IKCA 1QBBA 1WVZA 4I18C 2OZ4A 4L8DB 3QDGA 3VFGL 1Y6KR 1JMXA 4ALAH 1G6RH 3ZKMC 1FQ9C 5D7SH 3CXHJ 4XI5D 2VAAB 3HMXA 4AT6A 1JPGA 1I8KA 2AK1H 4XNXH 3LMJH 5BMFL 3HI6H 3CVHL 2LFGA 1LE5A 4GRWE 2FJFB 5A43C 1MLBB 1ODAA 5GIRB 4R26H 3BP5A 5EOQL 1EBPA 3GIVB 4MX7B 5DZOA 2A0LC 1DZBA 4WHTA 1A6UH 4M61A 1FN4B 3RVUC 3N9GL 5E99H 1RHHB 1LEKB 4NBZB 4Z78B 1HKLL 5D96C 4OCYL 1IFHL 1J0JA 1MCKA 1D6VH 5FYJD 2A9ML 4JN2A 1FZOB 4DZBB 2X1OA 1KCKA 3ARTA 3EO1B 2G75A 1YEKH 3KPTA 4BSJA 5GS0L 1UB5A 4S2SB 1FL5A 3QQNA 1W0VA 4NQCE 3R8QA 1NSNH 1RIHH 1H5BA 5I1IL 1QSEE 2EZ0C 3OJDA 1S9VA 1DN0B 1MOEA 2NY2C 4Z5RB 4P2YA 2AKRB 2W0KA 3RY6A 2HWZH 2FHCA 3D48R 4Y4HA 1XF4A 4YHYB 1UG9A 3M17B 3BX7C 4PLKD 2VDKH 4NUGH 3VWJC 1FORH 1IBGH 4HS8L 5MEPB 3QXDA 1L6XA 2EO9A 5EZIL 3GFUA 3GRWA 2B1AL 3MJ7A 2ADFH 1LP9B 3O6FC 4QT5B 1B9ZA 3NA4A 5I1AA 4P5TB 4Z7OF 2VLKB 3TBTA 1W0WA 4V2BA 3MRJA 4JGUA 1KELL 1EAJA 2CUMA 3EJZC 5IGXL 3NACH 1FL3A 3T09A 2NY1B 5B22A 4RNRA 4IDJL 4LQ1A 3PG2A 2A1WH 2OLDA 1S78C 3MLRH 2VE6B 3ULVC 4R2GB 3TO4D 1GGBH 3NZ8B 3HPJA 3HE6B 3QO0A 5CZVL 2APXA 3P0VL 4Z9KB 1P7HL 4OUUB 3DTXB 1WSST 1A1NA 1JP5A 3BZDA 4K94C 4MQTB 2LTQC 3TGXA 4N0FA 4M4PA 2WUBH 4M9PA 2R2HA 3BVNB 3NFSL 5C0DA 3FONB 3EYQC 1ADQH 5CP3A 2J8UF 2C7UA 3ARGB 2D31A 4JFPA 2ERJB 3FT4A 4K7FB 4LCUB 2ITCB 2F9BT 4MXWH 1G6RA 5DHYB 3A6BL 4U3CA 1ZVSA 1JUFB 2HP4A 5FFLA 5T1DH 3BI9X 4OZFG 1P5UA 2G2RB 5CIPA 1MREL 4P4KB 1AR1D 4FQXD 5D7LD 2P1YA 3PDOB 4XMKL 4JFYA 1NBZA 1KB5H 5GRYA 2WBJB 5DRZA 1ZLVH 1B6DA 5KSAB 3P11H 5L6YL 4Q9BA 3H9SE 3BT2H 2V5MA 4U6VL 1DVFD 3D3VD 3VFPA 1JGDA 2WSKA 4DEPC 1WCQA 3ARWA 3RPIA 4BQ6A 1CL7H 2GQHA 2XQBH 2K1MA 4OTXL 4O5LH 1CD9B 4G8GE 2VLJB 4M8QA 4Y1AD 2Q3ZA 2Y72A 1M4KA 3LPFA 5EU4B 1LO2L 2LVCA 2B1HH 3QDME 2H6PA 1S7TA 4PGEB 4NYLA 2VDPH 3ABZA 1AI1L 1FO0B 1U3ZA 2NY7H 3QFJA 2HRLA 2BOCA 3P4OA 5GISH 4EN3C 2JCCA 2J5LB 3P9LB 5L8LB 1HHIA 3EYSL 1IM3B 4KRLB 3ZLQC 2FEEL 2ZSWB 2HFEB 1N3NB 3DROB 3KPQA 1UZ8A 4RGND 4IOFC 3KPLA 4IMLA 3VGFA 2NYYD 4LSVL 3WFHA 1TJIL 1KCVH 3TJEL 3QJHB 2Q7YA 4BQCA 2IQAB 5I0ZA 2BY0A 2EDWA 1XF2B 1M7XA 2CUIA 2V7HB 4PJXA 5DURB 3B9KB 2E6JA 3L3KB 4F7MA 3O4LE 1ORSA 2YRZA 1I3RA 1AH1A 1ITBB 4MNGE 4APQD 2W65B 4QOKD 3EIFA 4QYOA 3MR9A 2WW8A 4FS0A 2BSSB 4LLYB 3RWGA 4EKXA 1LILA 2J4WL 1V3JA 4J8RB 4Z7WE 4NKIH 1B0WA 2BCKA 3CIQA 3D39D 4LDEB 2DQEL 3G08A 5DQ9B 5IJKA 3RTQB 4EUPB 2QADD 1BD2B 4Y5XC 3BO8A 1IM9D 1RUKL 2UY7A 1MAKA 2BJMH 1F8TH 1D9KD 3OSKA 1UM4L 5IQ7L 1RU9H 1RMFH 4LSQH 1PQZB 4N9OB 4ZOAA 1ZGLB 5IFJA 5I19L 5GS3A 4GKSA 5DJ8B 4NKMA 4E41A 4NNYA 4OBSA 2Y07H 3ARFA 2A73B 4PJ9B 3DMMD 4QTIL 4R90H 1UWXH 4Y4KA 4GAYA 1AY1H 4PJAF 4FFWD 4WUUE 4M5ZL 2GKIA 3NCCB 3MXVH 5ESAB 4Q58C 1XIWA 4KXZI 3DVIA 2YMXL 3GSWB 3WFEH 3VU2A 3TZVA 2HKFL 3CX5K 5C0GA 3G6JE 3B3IA 4KUCD 5EUKB 3HG1B 4XCFH 4R7NA 4M02A 5E2TH 5C86A 3BISA 4HIXL 5L2KA 2PXYA 1OM3H 1U3HA 3Q3GB 3PWPD 4FQ2H 2F8OA 2CMRL 1S9YB 3STLB 1KB5A 3EGSB 1KN4L 4YDLB 2CXGA 4ZYKA 4YDJB 2EDYA 1UEYA 1YYLH 4BK5A 3AS2A 4WFGD 1GAFH 1XGUB 1QBLL 1F3JA 3FQXA 3R4DA 4XVJL 1RZKH 1N7MH 3BKYL 4F7TB 5FYJE 1UB6B 2EDHA 3RJQB 2DQTH 1M7IB 5E8DH 3MLSH 4HH9B 1XZ0B 5CJBA 1IGFL 4U6HA 1GGCH 3TIDA 1T7ZA 1MFCH 2VXTH 2JTDA 3EYVB 1N6QH 1KN2L 1NFKA 5INDB 5AYUH 5E6YA 1IZKA 3UDWC 3VXUA 1HWGB 2VLRB 1IC4L 1CIDA 4Y2DC 3CD4A 3B5HA 3C5JB 1F4AA 5DVOA 3SDDA 5F9JB 2R0KH 1BFVL 1PLGL 1XCTB 1N5AA 4LF3B 5FM5O 4PY7B 4DN4H 4HKJA 5IFHH 4HFWA 2JB6A 4ZUVB 3TT3L 4J6RH 2OJEA 3PABB 1EEUA 1TJGL 5GGVL 5AD0A 1IT9L 1EGJA 2NXYD 4F9LA 5IR1A 4HGKC 4LDLB 3L5IA 1WFTA 2IAMC 3GB7A 5HI4C 4KU1A 2MCPH 3C60A 3L3DB 2GTZA 2C1PA 1S5IL 3FFDA 3K74B 3SGDH 1I1FA 3PGFL 2Z8SA 3QHZL 5EBLB 5DJ0B 5TFSH 5E2UH 2R8SH 3CVIH 4G80B 5CAYB 4GSDH 3IF1A 3IXTB 5MEQA 5HHPA 3WO4C 2J8UA 5DR5H 1JPFB 3HAEG 3WFCH 3SHSA 1S8DA 4YC2B 4ODHH 3SKMA 1BIIB 1UXSB 4NC2B 5JO5A 4KK5C 1NLDL 5LXGH 1YZZA 4M1DL 1ERNA 1TVHA 4P23C 2H32H 1QTYT 1DBJL 3PWUB 3DSNA 4GG8B 4NZTH 4ERSL 3MFFB 2VQ1A 3EFDL 1P5VA 4OM0H 5TDOA 5DRXB 1WFOA 3H3PL 4OLUL 1WBXA 3WYRA 1ZT4B 3LEYH 1G0XA 2XQYG 4AJ0A 1E4KC 3MUHL 2XZCH 4U3XA 1B3JA 1JPTL 4W4NA 2H8PB 4WI2A 4JRYA 3QUZA 3JSSA 1ONQA 4PPTA 5K9OB 2R9HC 4P5MA 5I1DB 1OTSD 2R69L 3BEWA 3MRGB 2AABH 5C2UB 4X6CF 4Y0GA 4P4RA 5F7KC 3U48A 2XN9D 4OI8A 4QTHB 4JFFB 4ELMB 2WLYA 1LNUA 4YGVA 4PJ7B 5D7JC 5F44A 5DJCA 2F54B 2MWCA 4Z0XB 3RWDA 2BHUA 5D70H 4QRUA 4KRMB 3D3VE 4U3HA 5IB3B 4U49A 1KT2A 3D87B 4FXKB 3GMPA 1AP2A 4I18A 5FKAB 4RAUB 4M62L 1WF5A 4YHPB 1UACL 2FLRT 2EDFA 1TETL 1MWAB 4MZ3A 4U7MA 1CDGA 2NPLX 1KYOJ 3QUYC 4Y1AE 4NSKA 3LS5H 4HV8B 3S9DB 5FOBB 2BVPB 5TDPB 3QDAA 3KLHC 3V0VB 1W72H 2GJJA 1F3RB 3QDGB 2VDRH 3UYPA 3I50H 1S7XA 3NCJH 5D2LE 2EE6A 3VG9C 1R6VA 5D2NA 4GRLA 1KUMA 5J6HA 1QFUH 3GSXB 4AT6B 3ELAT 3S3SA 1KIRA 2LV4A 4FFZL 4FN0A 4PJFE 1LE5B 4LKCA 3IDNA 3MACH 4DGYH 1CTOA 1F90L 3BP5B 1WEJL 1JZ3A 1K4CA 2FX7L 4RGNE 1A9EA 4UTAL 2FIRT 4UQ3A 1X5JA 4CU8A 4TULL 4LEXH 3OKDA 4WHTB 3B9DA 1K6QH 1UM6H 4M61B 3X3GH 3QEQD 5BVPH 3KPRA 3RAJL 1UENA 3LKOA 4PLNC 4UT9H 4G6FB 4PP1D 5D6CA 5EOTA 1R0AL 3HZMB 4LP4A 2N56A 4OCRL 4QOKE 3BQUA 5E2VL 4I3GA 5B3JE 4JN2B 4PGBA 4KDWA 1OGAD 3BDXA 4G7YH 2G75B 3RX8A 4GQPH 4G9FD 4G6AD 1BOGA 1UB5B 1MWAL 2GUOA 2AXFA 5E70A 1FL5B 3D39E 4NC1C 2BY1A 1W0VB 5FUZH 5TPWH 1I1YA 4XNYH 5IW1A 3FQNA 3HZYA 4KUZH 1H5BB 4PJAA 5JTWA 1QLEH 4YBHA 3E2HC 1MNUH 3MV01 3OJDB 4A6YA 1S9VB 3VWJA 4OJFH 3OR7A 4P2RE 1PJ9A 2FO4A 3KWWA 5HHVH 1ZTXL 3OAUH 5HHME 5IMMA 2J8HA 4Y4HB 1XF4B 4M7LL 5CHNA 2EE3A 2YD9A 5DEZA 2OL3B 3ZTNL 4Z76A 1CF8L 4NT6A 2D4DA 1XEDA 4YDKH 1KJ2B 3QXDB 5E94A 5FM4A 3O4OB 4EI6A 4JFEA 3WJJC 4YXKL 4PRPA 4ZO9A 4PP2A 4XNUL 3MJ7B 1SY6H 2F58L 2W0FA 5I1AB 2AEPL 1G9ML 3TBTB 3QRFM 3VH8A 3SCMD 1W0WB 3MRJB 5H94A 3OX8B 3I2CH 1D7FA 4NKQB 1FL3B 4D0DA 4RNRB 2B5IC 5FHBL 2JJSC 4KTDL 1NGZA 1MCFA 1QBMH 3DUSB 4I0PA 3HPJB 4WFGE 3T0ED 1L7TH 4MAUH 1MVUA 4QHUA 4I3RH 2XXCB 1A1NB 5AG8A 4OZIE 4KAQL 3VE0A 4JO1H 3NPSC 4JZJA 3VFOA 1X5FA 3UROR 4PGCB 4FNLH 2R2HB 1YJDH 5IBLC 4J23A 3OMZA 3QRGL 1I8LA 4JPIA 4YXLL 1OAXL 3IJSB 1JF5A 5C0RL 4YHIA 4XXCC 2C7UB 2D31B 4JFPB 3FT4B 4ZMAT 3A6OA 4AL8H 4ZUSA 1QRND 5D8JL 2UWEE 4N5ED 4DFHA 4JGMA 4XPHL 3S35L 2XACC 5HHXL 4U1NA 4PB0L 1ZVSB 4I77H 3GRWL 5CIPB 3G5YB 4JG0L 2XZAH 1N0XL 2ESVA 4QF1A 2HRPH 2EH7L 1EERB 1RUMH 2IEPA 4XVUD 4ENED 3HC3H 4JFYB 3RWFA 1NBZB 2XOTA 2R1YA 5DRZB 4JG1H 3OKMA 3SPVA 5L8KB 5I18L 2DBLH 1NC2A 1TENA 1P9MC 3L3GA 4D2NA 1YYML 1JGDB 2NR6D 4WV1A 5I1GL 2AQ1A 5FECB 3RPIB 4JR9H 1GJIA 3GMOB 5CBAA 1HHGA 2P7TA 3OJMB 5ALBL 1KCLA 1NEZG 1WC7B 2H6PB 4N68A 4PG2C 1S7TB 4N1CA 4NGHH 1CLYL 3KJ6H 4TPRL 5IROA 1EDQA 4FQ1H 3UZVB 3ULUH 2GJ6A 5I1EH 4XB7A 3QFJB 4EI5C 2BOCB 4YQXL 3P4OB 3VFRA 2DTMH 4CJ1A 4XT1C 5GGTA 2JCCB 4TRPL 2DQHL 2V6HA 2ZG2A 2B0SH 1HHIB 2Z31A 5ABDE 3K81A 4P48A 3RUGE 4PJ5A 1KTDA 1G6RL 2V9RA 2VITA 3GSOA 5D7SL 1Q38A 3KPQB 1UZ8B 2APVA 2P49B 1Z9OA 4X6CA 3ZE0F 1OTTC 3KPLB 2AK1L 4IMLB 3DO3A 3LMJL 4XNXL 3HI6L 1YEFH 3AXLA 4D0CA 2YUWA 2KPNA 4KROD 5H37H 2Q7YB 1YMMA 5KAQG 1YN7A 4R26L 3ZHLA 1Z2KA 5A2IH 1Z0NA 4PJXB 3NAAH 3QG6A 1RHFA 4F7MB 3N1GC 1TZIA 1ORSB 1T6VN 5SWSA 1NH6A 1I3RB 5K9KA 2FGWL 3RX5A 1RK0A 2B2XH 4Y5XA 3MR9B 5HVGB 1WTGT 3SGJA 4NJAH 3RWGB 3ARUA 3PXHA 3REVA 4NQDD 5E99L 4WWKC 3SDCA 2BCKB 4MVBD 2XN9E 1AQKH 3TA3A 4OM1H 4OV5A 3G08B 1D6VL 1KXTB 1QZ1A 1SJEA 1YEKL 4M1CD 3TH3T 3BO8B 5T3XH 1P2CA 3KYKH 5T5NF 3QIBA 1NSNL 2GIYA 3RL1A 5AZ2H 2GJZA 2GHWB 5IFJB 4GKSB 3H9ZA 3F7RA 3DHMA 4NNYB 1DN2A 5FUCC 2R1XA 2RFXB 3ARFB 1R3HA 4Y4KB 3HNSH 1YDPB 4GAYB 5LWYH 4UNUA 2HWZL 4M7KH 3MZTA 1JPSH 1AQDB 3EHBC 3T4AA 2AJUH 5HJ3A 1XIWB 4XWOC 3TVMA 2VDKL 3GSNH 4NUGL 1FORL 1IBGL 4XAWH 3BFOA 5C0GB 1QPXA 3B3IB 2WANA 5LGKA 4V2CB 3OKOA 1BZ9B 1RUQL 5F9OH 4R7NB 1SYVB 2ADFL 2GT9A 5L2KB 2PXYB 2ARJA 4KQ3H 4LIQH 1U3HB 1N64H 5DS8A 1X6LA 4G8EA 1GOGA 2ICWA 3NACL 3QEQE 4ZYKB 2VC2H 4U1SA 2ZZUT 3AY4C 3MODH 2A1WL 4XXDA 4BFEA 4LEOA 5HDLA 1F3JB 3FQXB 3MLRL 1EBAA 3H0TA 3HC4L 4ZUWA 3MUY1 1GGBL 1OGAE 1R5IA 5F7MC 4G9FE 5CJOH 2BSTA 1J8HD 1QLFA 1PYWA 3TIDB 3C09C 3I6KB 2CRIA 4L3ED 2WUBL 2FLBT 3LN5A 5JIIA 1UCBL 3KLAA 1HHKA 1IAIH 3VXUB 1KCRH 1B0RA 4XGZA 2IAMA 2MMXA 2VWEC 4JFOB 3SDAA 3IXAA 4MXWL 1N5AB 4P46A 2NZIA 4KKNA 1IZJA 3B6SB 2ORBH 4HFWB 4P0DA 3WN5A 4RX4A 2OJEB 3L5XH 5AD0B 4LP5A 4HIHA 2VSCA 4P57A 5IR1B 4P2OC 1KB5L 5FCSH 5HHOD 3F5WA 3P11L 1KB9J 5KSBF 1MFDH 3C60B 3BT2L 3JV5A 4OZGF 2GTZB 2C1PB 4MGXA 3ARBC 1ZLSH 5CFHA 3FFDB 1CL7L 2RCSH 3ES6A 2XQBL 2MPAH 1XMWA 3VXSD 4P23A 2F8VA 3ARDD 3MNZA 4X9BA 3HE7D 3IF1B 2B1HL 3IDYC 5MEQB 3SN6N 1GC1H 2R23A 5HHPB 1CL7I 2J8UB 3VDBA 4X6DF 1I1CA 3SKMB 2C9AA 5JO5B 2NY7L 2EC8A 3HI1A 1U6AH 1TVHB 4K3HA 5D1ZC 3QWOA 3T0EE 2Q7NA 3T3MF 3DX9B 3WJLC 4Q9QH 3CFDA 2KQMA 3MUGA 2EKJA 2VQ1B 3SGEI 4PUBH 1WAAF 4R4NC 3VGAB 1FBIH 2CDFB 4NIKB 5TDOB 2AVGA 4K23H 1WBXB 4ZUTA 2E5EA 2AJYH 1CK0L 5I71B 1CXIA 5DO2D 1CI5A 4XPAH 1IRAY 1KCVL 1QRNE 4BK4A 4CGTA 1P53A 2YWZA 1TITA 4YPJA 4JRYB 3QUZB 3RVVD 4XNMA 1ONQB 4DWHA 2EIZA 4P5MB 4HJJH 3UEZA 1KLGB 1ZT1A 4FP8L 4P4RB 3K7UA 4DK3A 1LNUB 5E1HB 2HN7A 2F19L 3NIFE 3RWDB 2ZUSA 3A6CH 4NKIL 4EDWH 4QRUB 3ZDYE 1YPZF 4M5YH 1KT2B 4G42A 5BVJA 3GMPB 1AP2B 4I18B 2A9NH 4Y19D 3N50A 2BJML 1F8TL 2JJUA 1L0XA 2CQVA 2MTPA 2FO1A 4HWNA 4NSKB 2H41A 1J0IA 2NXZD 1J0HA 1RU9L 1RMFL 4LSQL 1C5CH 3VRIA 1HXMA 3FHAA 1EH9A 1B0GA 4XCCH 5KVDH 2CLVA 2OR7A 5L7XH 1S7XB 2D2OA 2Y07L 1M1SA 5EIQA 2Z4QA 2XRAL 4K8RH 4R90L 5D2NB 4GRLB 3V95A 5J6HB 5IVNA 4NQXA 2QQNH 1KIRB 3MXVL 3PL6D 4LKCB 1EA9C 5J89A 1FNHA 1T2XA 4P5KA 3WFEL 5DTFA 1K4CB 2E7BA 3MROB 3RDTD 4UQ3B 5C3TA 1N26A 2D9CA 3OKDB 3MV7A 4XCFL 1IJ9A 1BFOB 4YBLB 3AREC 3MBEA 5E2TL 4PRBA 4LCWA 3LKOB 3MLXH 1OM3L 5D6CB 3PIQA 5TQ0H 5EOTB 4FQ2L 2LAGB 2ZOKB 3BQUB 5EU6D 1N6VA 4ZFZA 2JKXA 4WHCA 1DANU 2UYLA 4PGBB 3C2AH 3B4NA 2EDEA 5FM5M 2PTTA 1YYLL 3SE9H 4NJ9H 3FAXA 3IKCA 3HLAA 4NQDE 4RRPA 3I9GH 5SWZD 2GUOB 2AXFB 4LCYA 1RZKL 1JIBA 5GQBA 1I1YB 1I3UA 2HFGH 1WZ1H 3ZT6A 5HI5D 5B8CC 5IW1B 1JWUB 4NO3A 4O2FA 4PJAB 2DQTL 2AERT 5E8DL 3EOTH 4HEME 3MLSL 4L1HA 5KVEH 1NLBH 4A6YB 1GGCL 3VWJB 4G6JH 3OR7B 3BGFB 1N6QL 2EIEA 4XPBH 3K4AA 3KWWB 2VB5A 3BH9A 4JAMA 2ED8A 4LRIA 5AYUL 1KJMA 1KPVA 4PLOB 3MA9H 2Q8BH 4NNPH 3X14A 2MFNA 5J13C 5IVOA 3DRTA 4Z76B 1BWMA 2R0KL 4NT6B 3FN0H 2JK5A 3AAZA 4ZFGL 1NC4A 4XPFH 2J88L 2CH8A 4EI6B 4JFEB 4J6RL 4RMRA 4PRPB 2NX5B 1MJUH 1NGXA 2ICES 3BUYA 2W0FB 2O5ZH 3RZCA 3IFNH 1ZMYA 4UT6H 5BS0A 4NUJA 5H94B 1AGFA 5T1LD 2MCPL 4D0DB 1PY4A 5HYEA 4HWBA 1OGTA 1INQA 1KFAH 2LTQB 3KYNA 5DHVA 5JXAH 4CAGA 5TFSL 4HUUB 5E2UL 3CVIL 3V8OA 5AZEH 3NTCH 4I0PB 1MFAH 1FC2D 1MPAH 2ZUWA 4GSDL 2VXQL 5ACMA 1QFWM 5DR5L 1MVUB 4QHUB 3SGDI 2MJWA 2AEQH 1SBBA 3WFCL 1OLZA 3P2TA 5IMOA 5J0BA 4ODHL 3LS4H 5FGSA 3VE0B 4JZJB 3VFOB 1M05A 1MCLA 1VFAA 3JWOH 1Y18B 5L2JA 3ZDXF 1A0QH 4PRID 5LXGL 1G9NH 5HGGS 3EZ8A 1QFWI 1J8HE 2GFBA 3BYYA 3U1SL 4JPIB 1PZ5A 3RKPA 4YHIB 1NMAH 5GRUH 4NZTL 2YA1A 3OKKA 5IB5A 4L3EE 3OXSA 1ROWA 4ZUSB 3RIFK 1MQKL 2QSQA 1D5BA 2ZG3A 5E8NA 4OM0L 1DQMH 2J7LA 2CR3A 3TCLA 1MLCA 2XZCL 1B2WH 1CDYA 1FLRH 1MVFA 5KSBA 2ESVB 4QF1B 2K7QA 4OZGA 5ETUA 4GKNA 5J1SC 3RWFB 3ZYZA 3C6LA 2R1YB 2LABA 3SPVB 3OKMB 2AABL 5IB4A 1NC2B 3JWDC 3LAFA 5DJ6A 3L3GB 1KENH 4JREB 1P1ZA 4QKXB 2JF1A 4RFNC 3EDKA 4CW1A 4Y5YC 1JF1A 1FFQA 1GGYA 4GMSH 5HHOE 3E0GA 1HNGA 4X6DA 5D70L 5B3NA 4JKKA 2P7TB 4EN3B 5CBAB 3MNVB 4X9GA 1S9WB 3C8DA 2E7MA 5JW4M 3NCFB 1GPOH 3MREA 1J87A 3E6HA 3V5DA 4JFXA 3VXSE 1MRFH 1WAAA 3G9AB 4R97C 4G9DA 2GJ6B 6FABH 4H1LH 4EUPG 2ZKHH 3LS5L 1Z9MA 1T89C 4RA0C 3SOBL 3VFRB 2F5BH 4LLAA 1MCIA 1W72L 1JL8A 2Z31B 5DUBA 2VDRL 4PJ5B 3DHJA 3I50L 3NCJL 3T0AA 4XCEA 2VITB 3GSOB 3UTOA 3FFCA 5KVGH 1QFUL 3Q1SL 4R7DA 1CN4A 2FRGP 2H2PD 2VDOH 4X6CB 1H3GA 4G8FA 3REWA 3AXLB 4K2UH 1YMMB 3KGRA 1YN7B 4DGYL 4PY8J 4GQ9H 3QG6B 1R5VA 4F58H 3S88H 1TZIB 5ISZA 5SWSB 4C54A 4YFEA 1YPZA 1K6QL 1IC1A 1UM6L 1RK0B 1N2RA 2VXVH 4WENB 3X3GL 4Y5XB 4TVPH 3QIWD 1T7YA 3DYMA 4UT9L 3REVB 2FECL 4JQXA 1F3DJ 4LLMA 1AKJD 4GKOA 4BSVA 4PJCE 4EDXA 3TA3B 4EQ3A 2QSTA 3F7VA 4RWYH 4OV5B 1O7SA 3VXPA 4NZUH 1RZJC 1SJEB 2IJ0C 4JFDA 3RGHA 2BHZA 5L0QC 4G7YL 2IPKA 4JN1H 1P2CB 3G6AA 3SQOH 4MA1C 1J0YA 5FUZL 1NBVH 1AC6A 5TPWL 4F7CA 3ROLA 4PIRF 4WEBH 4XNYL 3RL1B 1C16B 4KUZL 4PRHA 4XNZC 1QLEL 2GJZB 1MNUL 4Y19E 3ZE2E 2V9QA 5E8EA 3ARQA 1Q8MA 4OJFL 5E6IA 3QT2A 2R1XB 1I3GH 3WIFA 4B7LA 5HHVL 1R3HB 4YWGH 3BESR 2AEWA 1YY8A 1EFQA 3T4AB 4Y4FA 5HJ3B 4L3CA 3QI9C 3P3YA 4LVNC 2FR4A 3HZVA 1TCMA 2ADIA 4ZUUA 2NZ9D 1MRCH 4YDKL 2OBGA 4Z7VE 1A5FH 3OKOB 5JA8B 2GEEA 2B4CC 5HD8D 1SY6L 5DFVD 5T1MA 1I85A 1QFOA 1U93A 5GRXG 4CDHA 5BO1H 3QUMA 5E4EC 1MFEL 3LPGA 4TTGA 1LE9A 4MJ6A 4G8EB 5HI3D 1ED3A 2GITB 3G5ZB 2LQRA 3GBMH 4YFDB 2ICWB 3MBXH 2V2XB 3BUTA 5IJVA 3L95A 4M4RA 3ZKND 4XXDB 5DQDL 2X4SA 4HJ0D 4R3SB 5FYLH 5EU6E 1J1OL 4L4TA 5JQHC 1QBML 4Y16D 3H0TB 1YEIH 4ZUWB 1R5IB 4LHJB 4L4VA 5DFTA 2WWKT 5M7QA 5SWZE 2HT4C 2BSTB 1L7TL 3B2UD 4MAUL 5IV2B 1PYWB 2WM0A 4RCAA 4I3RL 1RULL 4RZCA 2UZIH 4F57H 1EHXA 4JO1L 4QRQB 1RURH 2V2WA 4M6OH 3LN5B 5KVMC 1HHKB 5BXFA 4UILH 2D3VA 4NN7B 4OF6A 3UAJC 1B0RB 4XGZB 4UBDD 4AL8L 3DX8A 2PW2A 5C9JA 2IAMB 2OCFD 5JORA 1I9RH 1T66C 2C4FU 2PCPA 1W8NA 3IXAB 3SDAB 4P46B 5BZDA 4Z8FH 1EHLH 2FX8H 1BGXH 4UV7H 2WBJD 4I77L 3ZO0A 2XZAL 1EEZA 3WN5B 4L29A 5HYJD 2HRPL 2L0DA 1RUML 4HWUA 4IRSD 3VXNA 4D94A 4HIHB 4P57B 4O02L 2JJTC 4JHBA 3PGCB 3V0WH 4Q6YA 4JG1L 3WNMA 3F5WB 4QXUH 2DBLL 1NEUA 2K7PA 3QUKA 4JY5H 2DWDA 5I74B 4M48H 4FQCH 5D4QA 3QH3A 1HINH 4JR9L 4PJHE 1MCPH 2BNQA 3ES6B 1T1WA 5F7FA 3RGVD 4P23B 3Q6GH 3MNZB 3IDUA 4FRWA 1BVKA 4RDQG 3QDJD 4GAFB 2R23B 4LL9A 4H0GA 4ETYA 4NGHL 2WP3O 3KJ6L 4RGOH 5F7HA 2UV3A 4ODUA 3ULUL 1JI2A 4KHXH 5I1EL 5K59F 3HI1B 4KDTA 5DI8B 4OLVH 4X7EC 1ORQA 3QWOB 5JA9A 3ISWA 5DD5H 4M93B 2BRQA 3CFDB 1LQSR 3MUGB 2B0SL 2W92A 2OK0H 4AQ1B 1ZGLM 4G43A 5F93C 1KPUA 4OD2A 5FIEA 4PD4J 4N8VA 4PRIE 4CU7A 4ZUTB 3CFKA 3HRPA 4RA3A 2JELL 2PN5A 2RJMA 2WQ8A 3FOLA 1YEFL 1MCWW 2VZVA 3QUXA 5IVXF 4NM8H 5DRWA 3QISA 4XNMB 4BQ8A 3T0DA 3NAAL 2EIZB 2COQA 3FKUS 5EB9A 5EO9A 1A64A 2V9TA 1IC5L 1ZT1B 1H3VA 4LPTA 1TTGA 4OF5A 5F1IA 2WV3A 1JRHI 3OWEA 4KI5C 5DSCB 2B2XL 4FQJH 2HN7B 3RTQD 3CFEA 4LPXA 1BD2D 3MNWA 1VDGA 5KVFL 1HIMH 4CMHC 3ESUF 5FYJU 1BBJB 4R8WH 4GLRI 3ULUD 1AQKL 1FYTB 4OM1L 3BDBA 1PGRB 4HLZH 4G42B 5BVJB 5ADOH 3WE6B 5T3XL 1CFSB 3KYKL 4RFEB 3QP3A 2EYRA 5EFIB 3LQZB 1AJ7H 1V3KA 2W91A 4OLYH 5F6HI 2DQDL 5T1KA 3KNBA 2DIBA 1NFDF 2LAAA 2Q1EA 3SJVD 5AZ2L 3VRIB 3HNVH 3WIHH 1R3JA 1HXMB 2X4UB 5IT2L 1B0GB 5HYFA 1MHCA 1FV1B 2ITDA 4MXQC 2CLVB 3BPLC 2EDKA 1OCWH 2ATPB 2Z4QB 4MZ2A 3HNSL 2EE9A 2L7UA 3DX6A 5LWYL 3ZKXB 4KKAC 3E6FA 5E5MA 4NQXB 4M7KL 3VMNA 5JW3H 1UGNA 1JPSL 1YEEH 1NAKL 2Z8VC 3ARSA 5C0AD 3C2SA 3GSNL 3RWJA 2ZCHH 5DTFB 4DKAA 4XAWL 1MIMH 3RNQA 5IQ9A 4Y5VA 3MV7B 3NGBC 5F9OL 5CP7A 3K0WA 4LVHB 2EICA 3MBEB 2RQ8A 3EDFA 4LCWB 4PRBB 4MNQD 4KQ3L 4LIQL 3PIQB 3SO3C 1N64L 1PKOA 1Q9KA 5B8CA 3N1FC 1RUAH 3ULVH 1XH3A 4ZFZB 4HMDA 2UYLB 2VC2L 2XA3A 4EQ2A 4QXTA 4ZAKC 3MODL 1QBAA 3IKCB 3HLAB 5DZLA 5IIEA 4K94H 3DYPA 3ARRA 3G9VA 1T03L 2PF6A 2VH5H 4NO3B 4O2FB 2E27H 3AGVA 5BW7C 1KEGH 3RPKA 2Z92B 3V8CA 1OOAA 3OKLA 1IC7H 1MCEA 5HXMA 4JAMB 3BH9B 3MRNA 3F62A 1KJMB 2XI9A 1U2CA 4HLJA 1KCRL 3X14B 1MJ8H 3JZ7A 2SEBA 3AVEA 2W1NA 2ENSA 3DRTB 2BOBA 4MS8D 4RGMC 1ZHBB 5KG9A 2JK5B 3AAZB 4HKBB 1WBZA 3BP4B 5GZOC 4IOSD 2BXYA 4GRWF 1IAII 2ORBL 4H8WC 1RZIA 1T4KA 4OFPA 3L5XL 1NGXB 3BUYB 4R4BA 3RZCB 2VZTA 3O9WC 1X7QA 4KTEH 3AMLA 5BS0B 1AGFB 3KJ4C 3WSQH 1FRGH 3JTSB 3ILQD 5FYKU 1H8SA 5CINH 4L4JA 1K8DA 1OGTB 4E42B 3MLTB 1I1AC 1ZLSL 1INQB 3L3HA 3QEHA 4HXBH 5JHLH 5TDNA 3KYNB 5DHVB 2MPAL 1GHFH 5F96H 4Y2OA 5MI0B 4NCC1 1MFBL 1JGVH 1CXEA 1CBVH 1YA5A 1GC1L 3MJ9A 1PW3A 3F6LA 3KPSA 4HG4J 2GSIB 1M05B 1VFAB 5L2JB 5I0DA 1U6AL 3JXAA 5HDBE 2HJFB 5D1QC 2GFBB 2Y5TA 4Z7NE 5C09D 1PZ5B 3GJEA 4N0UA 4Q9QL 2CPCA 3OKKB 4U33A 3OXSB 5F1SA 1ZSDA 5DEGB 4PUBL 4J3XA 1D5BB 2OSLA 1C08B 4K23L 4MAYD 3TCLB 1MLCB 3RIAK 1TFHA 1R3KA 4XPAL 5KSBB 4DCQA 3PWNA 2QTEA 4OZ4B 4OZGB 5ETUB 5JHDD 4GKNB 4QRPE 4UDTA 4C57C 5D1XC 4OKVA 1FCGA 3C6LB 4HJJL 4KI5F 2DOCA 4WHYH 5IB4B 3BAEH 5KTEH 5DJ6B 5HYJE 1P1ZB 5ERWA 4FQLH 4CW1B 4U1HA 1UWGH 4BJLA 3PQYA 1T5WA 4WO4D 4ZOEA 1CDJA 3A6CL 4X6DB 4EDWL 2DAVA 4LU5H 4MA7H 4JKMA 1FGNH 3K1DA 4M5YL 5GPRA 4U1LA 2X5PA 3R0NA 2C3GA 2A6KA 5TE4H 2A9NL 2DQUH 4G5ZH 4YJZL 3MREB 3E6HB 3V5DB 4JFXB 4JE4B 3BEVA 1KLUA 4G9DB 4XC3H 4DFIA 3ALXA 3MPCA 5EN2A 3C6SA 3QDJE 1C5CL 4XCCL 2VXUH 3ZTJH 4H1LG 5KVDL 1YY9C 2NY4C 5DUBB 5IVXA 3R1GL 1YEDA 3FB6A 4HAGA 5L7XL 5ALCH 3TN0C 4XCEB 4JDZA 2P8MA 1AO7E 4R7DB 2KDGA 4OIAA 3LEVH 4G8FB 3REWB 3PDGA 5CGMA 2HT2C 4XMLH 3MYZA 1QR4A 3IJHA 3V7AG 4C83A 4DKDC 3TBSA 1R5VB 1RJZA 1MJJA 1AGBA 4NFDA 1U8IA 3QPXH 1R24A 3O8XA 4OF3A 1HHJA 5AEAA 4H0HB 1YPZB 1N2RB 2X7LA 3MRFA 5I15H 4MJ2A 4P3CH 5TQ0L 4YZFE 5JIHA 3GJFA 4LLMB 5AUMA 3WEXA 4BSVB 4EDXB 1E4XI 3F7VB 1AGCA 3VXPB 4KJPD 4Q74A 2CR6A 1NFDA 1P69B 4ZOCA 3QIUC 4JFDB 5GS0C 3B2VH 2IQ9H 3SE9L 1H3WM 2IPKB 5BCAA 4JHWH 3I9GL 3G6AB 4CN1A 4I48A 1BOYA 2HJKA 4MCZA 3ULUE 1KJ3H 4POZD 4F7CB 3ROLB 4GBXD 4N0CC 1ZK9A 2YHGA 4K8RD 1NDGA 1JVKA 2IBGA 4PRHB 3ALWA 5KVEL 1NLBL 5T33L 3QI9A 4FQPA 5E8EB 3WO3B 2AW2A 4G6JL 5E6IB 1DBMH 1CLZH 4XPBL 3BHBA 3WIFB 4HDIA 3SJVE 2PO6C 3QXVA 1V7NL 1YY8B 3MA9L 1VSCA 3S5LA 2Q8BL 2XY2A 4PGZA 4UDUA 4YNYA 4Y4FB 1KPRA 4L3CB 3U0PA 2FR4B 3HZVB 3FN0L 3KHQA 4YHMH 2ADIB 3F65A 4ZUUB 5A3IC 2E8YA 4MQ7A 5EBWB 4XPFL 2XIDA 4L8CA 5C0AE 2EDOA 1MJUL 5IF0A 5T1MB 2O5ZL 1U93B 4FQIH 1NMBH 3IFNL 4UT6L 3UPRA 3QUMB 4LPWA 1LE9B 1ED3B 4OQTH 4CVXA 3LB6C 5IEHB 4MNQE 4Z7WF 4HIIA 3L95B 3D2UD 4ZXBD 2X4SB 2VN4A 4Z77A 5C0JA 5JXAL 4TNVK 4L4TB 3CFJA 4PRDA 3GKZA 1XF1A 3NTCL 5MHSD 1MFAL 4KRPD 2O5XL 4L4VB 1MPAL 4KTYA 1CFQA 5L8JB 1JZ6A 5GJSH 4OFKA 4QXGH 1LO5B 2IALA 2W07A 2AEQL 3DECA 3O11A 3LS4L 2BNRD 2V2WB 3JWOL 3EAKA 1A0QL 4H88H 1G9NL 4HUWA 3EDJA 4YHYC 1NAMA 4YFLF 4C58B 5JZ7D 3P9WB 5GRUL 1NMAL 2W60A 4KKCC 3VD7A 2ATKB 3DX8B 5C9JB 5JORB 1DQML 1RUPH 5BZDB 5I8OH 5JPMA 1B2WL 1FLRL 3NABH 3LQAH 4L29B 4P5TC 2IPUK 3G6JF 2EXYD 3U7WL 3VXNB 2RGSA 1Z3GH 2NY1C 4PJ8A 1KOAA 3LDBC 3QUKB 2IMMA 1KENL 2M26A 2DQGH 2DWDB 3BMWA 5C92A 4W6XB 2B20A 4OLXH 3QH3B 2HAZA 1U91A 2BNQB 4GW1B 4R2GC 5EH1A 3HE6C 1QSEA 4GAGL 3S4SA 4MDJA 2QL1A 5I75B 1GPOL 1MRFL 1F6AA 3T77A 1ND0A 4ODUB 5CILH 6FABL 3RVXC 2PR4H 3C5ZD 1IMHC 1ORQB 2CRYA 3ARGC 2ERJC 4LLVA 5FA3A 2O93L 4NCDA 2F5BL 2NY5C 2HFTA 4G43B 3ZT5A 1KPUB 3TFKD 4OD2B 2EDJA 2ZUQC 4N8VB 1BX2B 3CFKB 5KVGL 4XZUA 4P4KC 5C09E 5F9AC 2VDOL 1OWWA 3FOLB 5E0QA 2EDRA 3UXFA 1URLA 4K2UL 3QUXB 4G8IA 2Z0BA 2BY2A 2ZOLA 3QBTB 4NO0A 4U6XA 5DRWB 4GQ9L 5KSAC 1TZGH 1F11A 4F58L 1NDMB 1KEMH 4XCNA 2V5RA 1A6WH 4ONFH 4MJ4A 1LDSA 5F1IB 2VXVL 4HZLA 1JK8A 5JHDE 3A0OA 4TVPL 3ARPA 3K3QA 4ZO8A 2VQUA 5EZLB 1T1XA 2IF7A 3MFGB 4ZNEE 4RWYL 1RK1A 3JV0A 4NZUL 1AD9A 5EUOF 5ITFA 2NY0D 2E6PA 2Z8WC 4JN1L 3SQOL 4HLZG 2EYRB 1NBVL 3INUH 4HJGA 4J4PA 4WEBL 5DHXB 5T1KB 3KNBB 1R3JB 1IKNA 5GJTH 3PP3K 1MHCB 2AEIT 2ITDB 4LOUC 5E00A 1O5DT 1NCUA 5ICZA 1XIWD 1I3GL 3JV6A 5ELIA 4X8JA 2DYPA 1I4FB 4YWGL 3DX6B 4YHLH 1YEHH 3E6FB 5E5MB 5CKAA 3WLWD 3U4AA 3B9KC 4TVPD 3RWJB 1K9TA 1A9BA 3H9SA 1MRCL 3RNQB 4ZD3H 5E95B 5IQ9B 1A5FL 3HB3C 1G7QA 4CADA 2YPLD 1GZQB 4KHTH 5CP7B 5E9DB 4QCIA 4G8GA 2BHYA 3RI5K 5BO1L 1Q9KB 5B8CB 3QZWA 1EO5A 2IH3A 4BSWB 5BW7A 3GBML 4D0BA 43CAA 3QDMA 3U4EA 2EC9T 1S7UA 4FXLA 1F97A 3WDHA 4N0YL 2DDQH 3FO0L 5IIEB 1JHKH 5FYLL 4DQOH 2CKNA 3L7FA 4KK8D 4M03A 5DJAA 3V4PH 4AMKH 2FZ3A 5FA4B 5GSRB 3LOWA 4PJ9C 2UZIL 4F57L 3OKLB 4M6OL 3FOMA 3MRNB 4C4KO 4ELKB 1U8QA 5J11B 4UILL 3T2QA 5EZJA 5DVKA 5D2LF 4I1NB 3NA9H 3O9WA 2SEBB 3O4LA 2BOBB 5A2KH 1I9RL 5KG9B 4MNGA 1WBZB 4YHZH 4PJFF 4QRTA 4WUKH 2CKBA 2ZPKL 3RKDD 4Z7UE 4Z8FL 2FX8L 1EHLL 1BGXL 4UV7L 3R0MA 5IHLB 5F1OB 5F88A 1T4KB 5BV7H 4NZDA 4H0IA 1E4JA 2VZUA 4Z7WA 3UO1H 4R4BB 4P2QD 3CJJA 5A2JH 5DWUH 3MTRA 3EOBA 1X7QB 3V0WL 4YDLC 3IFPA 1SVZA 4QXUL 1I9EA 3S37X 4LHUA 4JY5L 3W11C 4FQCL 1K8DB 5HY9A 4IHOA 4ZTOL 3HZKA 5J06A 2C4FT 4LAJH 1HINL 1RAMA 3L3HB 3QEHB 1CXLA 2EIDA 3QPQC 5TDNB 4Q97A 3QXAA 3FRUA 1HXYA 4XP6L 3UJJH 3Q6GL 1BQHB 5HHQA 1LVEA 2YWYA 1DSFH 2J1KA 4NWUH 3OHXB 2EYTA 2WIIA 1JNLH 2CK0H 4RGOL 4WUUA 3KPSB 5MHSE 2LU4A 4TSCH 2Y5TB 5DD5L 3GJEB 4N0UB 1F4HA 2JIXA 5JW4N 2OK0L 1ZSDB 1CICC 2Z91A 5D1XA 4F8TA 1QACA 2BNRE 3FRPG 3G6JA 2CO6B 2OSLB 5HYSA 4K3EH 4ZODA 1K8IA 1R3KB 4O4YH 1NBQA 3QDHA 2QLVB 3Q2CA 4DCQB 3PWNB 1AXTL 5MEND 4NM8L 1WICA 2LE9A 4OBRA 4UDTB 3HKFA 1TTUA 4X4ME 5FYKH 1CFNA 5E7BA 5B38A 2O5YL 5ERWB 5BRZD 4CVZB 4KUCF 1TNNA 2CLRA 3PQYB 1T5WB 5JQ6H 1A14H 2V5TA 4TNWF 1EZVY 2E7CA 3KPNA 3VG0H 1LEGB 4R8WL 3ZKMD 4WEMB 4YDVA 1DLHA 3AS1A 4U1LB 2G60H 3LZFH 2H9GA 5ADOL 4BZYA 1A4KA 1WK0A 4MMZC 1B4JH 1HQRA 2FIKA 2FYYA 1GZPA 4X4XA 4FTVE 3CSPA 1T1YA 3BEVB 5F7YC 1AJ7L 1KLUB 5BQ7A 1CZ8H 4OLYL 1RIUH 3CVHA 3C6SB 3N1MC 3WIHL 2A0LD 3HNVL 3GI9H 3EFFA 4OZIF 3RVUD 4C4KT 4TSBH 1A02N 5IVXB 4CVUA 1UZ6E 1YEDB 1KIQA 3FB6B 2QQLH 3IYLW 5FGBC 1OCWL 4JDZB 3S37H 3NFNA 4ZQKA 4ZO7A 3S98A 3OTTA 3W9EA 1RD6A 1ULVA 2UWEF 5JW3L 5IW3A 1YEEL 3VWKC 2BP3A 3NFPA 3QNZA 4D9QD 2ZCHL 3IJHB 4MJIB 1BZQK 1SYSB 4C83B 3TBSB 1RJZB 5SX5H 1MJJB 1AGBB 5AWNH 1MIML 1U8IB 3LRHA 3A67L 1HHJB 4LARH 5L0QB 1N0LA 3RBSA 1L9MA 2X7LB 3MRFB 4JANA 2EZ0D 5HGDA 3TT1H 3OAYK 4AENA 3GJFB 5AUMB 4ZS7H 1A7PH 4XNQA 1AGEA 2NY2D 1FFOA 1RUAL 3RP1A 1AGCB 3DVFA 4ODTH 4H5SA 1PVHA 1NFDB 3VRJA 5IMLA 5DA4A 5TQ2H 1UJ3A 1UVQA 2VR9A 4HSQA 3TO4A 4K94L 4UAOC 1DFBH 5IBTL 4MCZB 4ZFFB 2HJKB 5I30L 1OW0C 3VWJD 4JRWA 2VH5L 3BPNB 1NDGB 2E27L 4WI6A 1KEGL 1KYOK 3QI9B 4AH2A 5EU7E 1FNEA 4LVNB 3O6FD 1IC7L 3BHBB 3DOSA 4ZFOB 3R8BB 3AS0A 4HDIB 4AIOA 3EJZD 3BZ4A 4XB8A 5GGUA 3RUGF 3S5LB 5I1HH 2DQFA 3GHBH 5I1JH 1T22A 1XCQA 4UDUB 2ZUXA 1AXSB 4YNYB 4JFED 1MJ8L 2NX5D 1KPRB 3U0PB 3QR2A 4FQXA 2DI9A 1S78D 3S96A 1SM3H 4MQ7B 2P43B 3ULVD 2X4QA 3CDGA 4L8CB 4TVPE 2BVOA 2A2QT 4U2ZA 2AQ3A 1DVFA 4KTEL 3D3VA 1RI8A 1SEBA 4MJ5A 4RAHA 4URTB 4U1KA 3WSQL 2YPLE 1FRGL 3OKEA 5CINL 4CVXB 5D71H 3EYQD 3TH4T 4HIIB 4UB0H 2KZWA 1CWVA 3HRZA 2IBBA 4Y1AA 4CVWA 2YA0A 3VFUA 4Z77B 5C0JB 1GHFL 5F96L 1H5BC 5GGQH 4PRDB 2FATH 1JGVL 4X0KA 5IHZA 5D9SA 5J9PA 3CC5A 1CFQB 1U42A 1CBVL 4LSRH 2VLMD 4U7SA 2HVKA 1LGVA 5D2LA 5LKNA 1J0KA 3O11B 1K4DA 3VFMA 3RY6C 4QRSA 2VLLA 4Y4HC 4HUWB 3KDMA 1GOHA 4PJFA 1J0ZA 1EVTC 4GRWB 1NAMB 2WUCH 3CX5J 3PP3H 2ICWJ 2QBWA 2W60B 1JCKA 1PBYA 4XX1G 4WU7B 5IG7A 1HYSC 3OL2A 1WISA 3O4OC 3TYGH 4D9RD 1BEYL 5I17B 5JPMB 3OKNA 5KJRH 3IDJA 4JM4H 4PJBE 2YRLA 1FLTX 1ZV5A 4APQA 4JCMA 4PJIE 4QOKA 5KTEL 3BAEL 3S3PA 4EN3D 5C0IA 4C56D 4P2QE 1N59A 4HKZA 2I60L 3D39A 1UWGL 2JE8A 3ARXA 4HHAA 1U91B 1TCRA 8FABA 1MH5A 1WCBA 1QHPA 1CVRA 4LU5L 4MA7L 1FGNL 1IM9A 1QSEB 3S4SB 4OZFH 4IOFD 4MDJB 4JFHD 5TE4L 4G5ZL 1D9KA 2DQUL 4P2RA 4NNXA 1WWAX 2J8UE 4AY0A 1X4YA 4LSDA 2XZQH 1CIUA 1F6AB 1HCVA 3LSOA 1ND0B 3HCVA 1FVCA 3JUYA 4XC3L 4KJYA 1Y0LA 3MV9D 5F1KC 5FA3B 4LLVB 4FZ8H 1DR9A 1DQLH 4AG4H 3DI3B 1S7WA 5ALCL 4DGVH 4XZUB 1OP3K 1ZANL 3UPCA 1NUDA 3LEVL 3HUJE 4GXVH 3O0RH 4IMKA 4X98A 3UTQB 4G8IB 4XMLL 2ZOLB 4NO0B 4U6XB 1DE4A 1MCJA 3IDIA 1F11B 4AQOA 2J3SA 4TQEH 4XCNB 3QPXL 4N90D 1DEEB 4KKLC 1N4XL 5MENE 3ZYIA 4HZLB 1JK8B 4RIRA 5TF1H 5I15L 1MCDA 4HFUH 4P3CL 2IBZX 3VXQA 1G1YA 3DX7A 1T1XB 3X12A 5BRZE 1PDKA 4GAJH 1RK1B 4K3GA 3WUWA 4OLWH 3FCTA 1AD9B 5ITFB 3B2VL 5T5NG 2APTA 3BPLB 3UP1A 4JHWL 4OZIA 4M3KB 4IOIA 1KJ3L 4HJGB 2BFVL 3BPCA 4P49A 3O2WH 4NHUB 3AROA 2UWEA 3IRPX 4WDIA 2DKUA 3CSBA 2JB5H 2PKDA 3IVKA 4DVRL 1NCAH 4OCWH 1DBML 2BRRL 1CLZL 5E00B 3VI3E 1BFTA 5ICZB 4LSTH 3ZSTA 3JV6B 4KJWC 4X8JB 2DYPB 4GW5A 4NCC2 2AJ3A 1X5XA 2K3TA 2X1WL 1XGRA 5JLZA 1T2QH 5JOFA 1S7VB 4LCIH 1UFUA 1A9BB 1CFTA 4NKOA 3H9SB 4YHML 1N6UA 5CJ5A 2X4NB 4V1DB 5D7KD 5I16A 1G7QB 2FCBA 4ZAKB 4CADB 3GUTA 3AMKA 4D9QE 1CGUA 3QAZC 4FQIL 4QCIB 4G8GB 1NMBL 2VERN 1D5ZA 3QZWB 3K4DA 5EC1A 1BIHA 1ZEAL 1ZS8A 2IH3B 4OQTL 2CDEA 4D0BB 43CAB 3QDMB 3VFNA 3NIFF 3ROOA 4GG6E 1PG7H 3U4EB 1S7SA 4U0RC 4Y2DD 1S7UB 2X9XA 4QHLA 3ZDYF 1DQQB 2A6JB 3P0YH 3WNOA 3WCYA 5DJAB 5I76A 2FZ3B 5EA0H 4WGVB 5ID0B 4WRLA 3RUGA 2EXWC 5GJSL 2VYRE 4PGDA 1J05A 4QXGL 4RGMB 3E1F1 4X8XA 4I5BA 3ARFC 4IRJC 1YQVH 4Y4KC 1REIA 3T8XB 2AK4D 3ARDC 1YNTA 3FOMB 3X13A 4H88L 5HI4D 2YC1A 3IAQA 5E8OA 1U8QB 1VB9A 5EZJB 1MCRA 1X5YA 3QWRD 2DLGA 3O9WB 3TZVC 3O4LB 3MQIA 5F1NA 2FL5A 1RUPL 1DLFH 2A38A 4QRTB 2CKBB 1U3YA 5I8OL 3NIGE 1MRDL 4PJEE 5F88B 2HFFB 1DBAH 2PXYC 3NABL 3UTZA 3LQAL 2NX5E 1U3HC 1IEBA 2OX5A 4Z7WB 2DJSA 5DK0A 1Z3GL 3MC0A 2XN9A 3T2NH 1ES0A 2C1OA 3EOBB 2Q6WA 4G6MH 3ULVE 1IVLA 1ZGLP 1JYWA 4I4WB 4KK5D 1KG0A 4P23D 4LHUB 2NMSA 2UZYB 2DQGL 4NN6B 4BUHA 4MWFA 3T0XA 3X3FH 4IHOB 5HY9B 3W9DA 3EYUH 3HZKB 5I66A 3ZHKA 3ULSA 3OAYH 4K55A 3QXAB 4D3CH 1BLNA 3OG4B 2H45A 4GUPA 2E9IA 3HS0A 5HHQB 1NGPH 5CZXC 5J3HC 1EUUA 4KGLA 4Y88A 2EYTB 2WIIB 5FO7A 3S97C 2R9HD 4WUUB 5CILL 2APFA 2PR4L 3UTSE 3O3BA 2X4RB 3VFSA 4NOBA 2VLME 3ZL4L 2JIXB 3VGGA 4CN4A 1Q9LB 5DYOA 3SDDC 1WT5A 5DJ2A 1KNOA 2Z91B 5D1XB 3RVWC 5A1AA 3WFBL 5D7JD 3G6JB 5MEOA 1EFXB 5HYSB 2CKBL 1QD0A 1K8IB 1L4IA 2P5WD 2YPVH 2YD7A 1JTOA 5ANME 43C9A 4F9LC 2W9LA 3EDEA 3HAEH 4D9RE 3GM0A 1Q9OB 3T2PA 1TZGL 5J6GA 1CFNB 1KEML 3QEQA 3C60C 1P4IH 3QUYD 4MCYA 5B38B 1A6WL 4ONFL 3SKOA 1FYTD 2X2YA 3HHRB 1VFOA 3MCG1 3OG6B 3QB7C 2CLRB 4WCYL 3KLHD 1KB9K 5B39A 2H2SC 2IFGA 1KTRL 3KPNB 1G84A 1OGAA 1XF5A 4G9FA 4YDVB 1DLHB 2D7NA 4C56E 4D8PA 2H9GB 2X1QA 4NP4H 1HQRB 3QO1A 3ETBF 2FYYB 4X4XB 1T1YB 4S0TD 4K7PX 3INUL 5HGAA 5BQ7B 3Q5TA 1HQ4A 3D25A 4JDTH 3CVHB 4JFHE 1EIBA 3VWKA 3EFFB 5GJTL 2VR4A 1KIQB 4XHQA 2EEAA 2V7NA 3MV9E 5I71C 3NFNB 2RBLA 1W8OA 5IHUH 4YHLL 1YEHL 3V9FA 5F7LB 4ONGH 2B4CH 3QUZC 1G7MB 3ARZA 3O6KH 2HYMA 3NFPB 2ADGA 5D72L 2ICEA 2NTSP 2NY6C 3CFIC 4ZD3L 1PG7W 4U4BA 1BP3B 3HI5H 4KHTL 3SCMA 4L8SA 1IAOB 2IFFH 4JANB 5EUOB 5HGDB 5FYJL 4AENB 2BVUA 4XNQB 2GSGA 1AGEB 5JR1H 3GHEH 3KPPA 2IPUG 3JVGA 5JDSB 3UTTE 3VRJB 5IMLB 3UJIH 4J3SA 3LN4A 4A2LA 1I7UA 1UJ3B 1UVQB 2DDQL 1RZKC 3TO4B 1JHKL 1I9IH 4OT1H 4DQOL 2PO6B 4EOWH 4HAFA 3T0EA 4RMUA 3MYJA 3V4PL 1BHGA 4J3VA 4RISH 4AMKL 4NC0B 3MRKA 3NBNA 1CGXA 1GH7A 3M07A 3CFCL 3ZMRA 3DV6A 3P4NA 4YHKH 1FNEB 3H8NA 4Z0BH 1F5WA 4OF7A 5D2NC 4GRLC 1OAUH 1U58A 1J18A 4ORGA 1CCZA 1QRNA 1LK2A 2VXSH 3BZ4B 3TNMA 5GGUB 1J10A 2DQFB 1T22B 2WQRA 3NA9L 4LLDA 3VD5A 1P7QA 4YHZL 4FQXB 4WUKL 3QQ4A 4YBLC 3S96B 3TYFB 1OP3H 1YMHA 2X4QB 4GOSA 3CDGB 4JY4A 5BV7L 2BVOB 2F74A 2R0WH 4K7PH 5DWUL 4YEEA 5D7KE 5A2LH 3BQUC 3CH1A 1DVFB 4X4YA 3D3VB 1SEBB 4JY6A 1WIPA 3RHWF 3OKEB 1C7SA 5IBLD 1FNLA 3QQ3A 4MNHA 1DBKH 4W81A 4UZGA 4PJCF 1I8MA 4PBXA 3HRZB 2JJWA 2DICA 4Y1AB 3S6CA 3RY5A 3VFUB 2MKLC 5SX4I 4OGXH 4GRMA 1X5ZA 4P99A 1QA9A 3UJJL 3W81A 3FQTA 4X0KB 3O2DH 5IHZB 5D9SB 5HPOA 1TMCB 1DSFL 3CC5B 5J9PB 1T7VA 1MHPL 1XGTB 2P8LA 4XVSH 3BGFC 2HVKB 2EDQA 4O9HH 5D2LB 5IBUG 1JNLL 2CK0L 1WZMA 3VFMB 4QRSB 4ONHA 2VLLB 4HUXA 3KDMB 4TSCL 2R39A 1J7VR 1DUYA 4PJFB 3SEPA 5I1LA 4NHCH 5KAQF 2AK4E 5IG7B 3N0PB 4IEFB 4RGNB 4FFYH 3RFZC 1ZXQA 3BRGC 3KYAA 3LKSA 3LDBB 2HTLC 3HR6A 4O4YL 3OKNB 1WUNT 3IDJB 3MRDA 4YHOL 4O2EA 2Y6SC 4N8VG 4Q0XL 3QHFH 4Z7VF 2HG5A 3HC0A 4QOKB 5F3HA 5FYKL 2WMPA 1FHGA 3PUCA 4EI5D 2WWMC 2AXGA 5IWLA 4YAQA 4NQDA 5C0IB 1N59B 1MF2H 4PBVC 1U92B 2YUXA 1A14L 4HHAB 4HUKB 5FOJA 1BM3H 1TCRB 8FABB 1MH5B 3VG0L 2QADB 1WCBB 4I0PC 2D0GA 3Q6FB 2YEZA 1MFNA 1IM9B 1T2JA 3LKRA 3LZFL 3X11A 4Q6IC 1MHEB 1JBJA 1OTTD 1RFDH 4B41A 4P2RB 1D9KB 3AM8A 1B4JL 4FXGA 2ZUQB 4JZJC 4TOYH 2N7BA 3AB0B 4RBPH 5BOZG 5F8RC 2VOTA 5HHMB 1CZ8L 3HCVB 1FVCB 1RIUL 1I8LC 4KJYB 1Y0LB 2Q20A 3HFMH 1FAKT 2AJVL 4GFTB 5DUPH 3SDXF 3GI9L 4Q9CA 3N85H 3W39B 1HSAA 2E7LA 3E3QC 2ENYA 4TSBL 2QR0A 2BERA 4K3JH 3BXNA 1S7WB 4KFZC 3S37L 4WWKD 5FYKD 3NCMA 4OCNC 4NZJA 5FGCE 4PGJA 1O0VA 1NJ9A 2D7QA 4JKLA 1NCBH 4R9HA 1FZMA 1PD6A 4HS6A 1DE4B 1NQBA 3CDFA 4FHBD 3IDIB 2P5WE 1V05A 4GMTH 4W6YB 4JREC 4LBEB 3VRLE 1X3DA 3CK0H 2VZ1A 4WNQB 4WV1C 4LARL 3SGEH 5CWSA 1UM5H 4RIRB 5CUSH 4JFDD 2Y36H 1TZHA 1VACB 3TT1L 2XTJC 5EPMA 4QHKJ 2CXKA 2I9TA 3X12B 1FYTE 5EWIH 4ODTL 2VDLH 4PJHF 3IAGC 1CDBA 3WUWB 3FCTB 3FQUA 3O3AA 5IROC 5KZCB 5FDWA 5TQ2L 4OZIB 4J3OC 4BH7A 4IOIB 2H3NA 4P3DA 4XWOD 2IGFH 1JGUH 3CH8A 3MRMA 1J8HA 4WIQA 3BPCB 2VIRA 5KSUB 2IMNA 1MELA 4L3EA 3NCYS 3O2DA 4S1SH 2Z31C 2DMKA 1OP9A 2GTWA 2UWEB 4JO3L 4WDIB 3ZE0E 4LRNH 4G6KH 4M7JH 3IVKB 4Y16C 3SKJH 2NY3D 4R0LA 1JTPA 3FO1A 3BPOB 3EDDA 3RBGA 3UBXG 2GI7A 1UKQA 1X5LA 2P46B 4GW5B 2AJ3B 3C9NA 5I1HL 5I1JL 5TGBA 5JLZB 2X4PA 5JOFB 3DYOA 4YBQC 4WFED 3R06B 3MRBA 4HH8A 1CFTB 4NKOB 1OB1A 1SM3L 3WNPA 3SGJC 3GUTB 5CKGA 5JDJA 4XC1L 5HHOA 5KN5A 3SDCC 1UCTA 2OXGA 3TA3C 1D5ZB 5DD6A 4OFYA 2AJSL 5EC1B 1WWCA 4QGYA 3GMQB 2CDEB 1A3RH 4XTRC 5D7IE 4L4TD 1IQDA 3ROOB 5D71L 4F9PA 3VXSA 1KBGH 1S7SB 2W9DH 4LNVA 4UB0L 4IRJA 1V8HA 2EDBA 4QHLB 3ARDA 3QIBC 2OQJA 4DUVA 5DC4B 3HE7A 5EO0A 1EHAA 2YXFA 4JLRA 1LWRA 2ED7A 1ADQA 5GGQL 3U7YH 2CJUH 4DJMA 2FATL 4RSVA 5I76B 4JPKH 1VFBA 1EO7A 1HWHB 4LSRL 3P77A 2FWOB 3RUGB 1VERA 4PTUA 4PGDB 1J05B 2P4AB 3S7GA 1FFNA 4I5BB 1BQHG 1M7DA 2ZUVA 1XGYH 1YNTB 3OXRA 4P2OD 5AYQA 5HVFB 3X13B 5HYQA 2YC1B 5E8OB 1MY5A 3P4MA 1BQUA 1BREA 2WUCL 3TVMC 4F33A 4PJGB 4G7VH 4ZPVA 1T3FA 3ARBD 3HR5A 5E1AA 4DKFH 5F1NB 2FL5B 3FQWA 3TYGL 1JZ5A 2FJHA 4S1QL 4KVNH 5D6DC 1DUZB 3BZFA 5KJRL 3BDYL 4UINH 4JM4L 3IETA 3UTZB 1PSKH 4U31A 1IEBB 1NEZA 3GGWB 4PJCA 3ZE1E 5DK0B 4YPGA 2XN9B 1ES0B 2Q6WB 3FO2B 4NM4L 2HMIC 5AG9A 2Q8AL 1KG0B 5D1ZD 3RU8H 5EG6C 4MWFB 2VDMH 3DRQA 3W9DB 5TE6L 3V4VH 2P8PA 2RR3A 4R4ND 1BLNB 4KKBC 4GUPB 1EJ6A 1MAMH 4HD9A 4Y19A 3HS0B 2CDGA 3MLZH 7CGTA 4HF5H 2UZXB 1CICB 3FT2A 5A40E 3FO9A 4HPOL 4X9FA 5FO7B 3WHE0 3O3BB 3VMOA 3VFSB 5J1AA 4NN7C 4ISVA 2DMBA 3D6GA 4FZ8L 2MCG1 5DYOB 4B50A 4X7TA 1DQLL 3SDAC 5DJ2B 1MEXL 4P46C 4Z7VA 5MEOB 3N06B 1GIGL 3PL6A 1ZLWK 3WN5C 2FBJL 1A6VL 1XGQA 5KSBE 4GXVL 3O0RL 43C9B 3D18A 3RDTA 4P59H 4OZGE 3ECBA 4M9OA 4OD3H 3MJGX 2JLLA 5J6GB 1QFWH 1IFHH 1LEIB 1LK3H 4TQEL 3QEQB 5I74C 5C2BH 4MCYB 3WS6A 4AEFA 3IS1X 3SKOB 5GS0H 2Y7QA 5TF1L 2DTSA 4HFUL 1U8MA 3I85A 5EU6A 5IEKA 5B39B 2R15A 2YSSA 3IDGA 1IGCL 5F7WC 1OGAB 1XF5B 4PFEA 1D6EB 4G9FB 3MGTA 2VL5A 4D8PB 3UYRL 4GAJL 2HTKC 4OLWL 1CG9A 3SDXA 5T1KD 2I07A 3TPUA 3T3ME 3QO1B 3UYOD 5FUOH 2HT3C 4MQXC 3QEUB 1CLCA 1DCLA 1EAPA 5HGAB 4F37K 1HQ4B 3D25B 3O2WL 4O00A 2X4OA 4M93C 1HHHA 3VWKB 3U4BH 3DLQR 3O41A 3ARED 3NN8A 5HPMB 1NCAL 4OCWL 5HDBF 2ZUUA 5D7LE 4Z7NF 2V7NB 4LSTL 5GS1A 4UIMA 4DOHB 2PYFA 4XBPA 2FJGA 3UBXI 1T2QL 2Z93A 2FBOJ 3TC9A 3S8WA 2ADGB 3B5GA 4EXKA 4LCIL 5E9DD 2ICEB 5FYKE 3LV3A 3RJDA 3S5LG 1NMCB 1H3UA 4DVBA 4PJHA 3Q48A 4L8SB 1A3LH 5T1LA 1QG3A 4UAOB 3K1KC 1SJHA 3L3JA 4LSSL 5IKCB 3KPPB 5IFAH 3P0VH 5DA0B 1JNNL 3EZJB 5EULV 1PG7L 5DGQA 4OSUH 1MSPA 4ODVH 4I2XE 3LN4B 1I7UB 5FUCE 4MA3A 1JPGB 3GI8H 3P0YL 1I8KB 3U36A 1G7LA 2DMCA 3AFLA 3MYJB 1VFUA 3MRKB 1RVFH 1JZ4A 2ILLA 5DDHA 2IH1A 3DV6B 1A6PA 4PRIA 4FMFA 3O45A 1YQVL 2VUYA 3ZKXC 3V4UH 4H20H 5HYIA 1U58B 1MREH 1ZHNA 4ORGB 1QRNB 1LK2B 1MCBA 1U2HA 3TNMB 3IDXH 2DQJH 1YNLH 5FGRA 2X09A 3BP6A 3O3DA 4HCRH 1JWSA 4LLDB 1P7QB 1IGYA 1DLFL 4W4OA 3QQ4B 4LVHC 5TH2A 1YMHB 1WBYA 4UU9A 1NUGA 3MBEC 5CJ8A 4JY4B 4WHDA 5DMJB 2F74B 4X5WA 5EOCH 4WFEE 1KXQE 2OYPA 2OTUA 4K3DH 3T2NL 3VW3H 1WLHA 2XPGA 3CH1B 4X4YB 4G6ML 3CLEL 4JY6B 2APBA 3W2DH 5C3LD 3ET9F 1LO2H 1IQWH 3QQ3B 4MNHB 1JFQH 1IGML 4YZFF 4F3FA 3X3FL 4ZSOA 1I8MB 2BNUA 3EYUL 1C5BH 2DD8H 4D3CL 4GRMB 1II4E 2H32A 3FQTB 2XG4A 3OQ3B 2GK0A 3LN9A 3EYSH 4XPTH 1NGPL 3ULUF 2P8LB 3MLVH 3LHPH 1NKOA 2NY5H 4KZEL 2VWEE 5GGVY 3M8OH 4TN9A 1CLOH 4LRIC 3S4SG 4ONHB 4HUXB 5E7FA 5I1LB 3FTGA 2FJFA 2F5AH 2I25N 5GIRA 3U9UA 4O2CA 3T4YA 4I9WD 4RMVA 4KROB 3LKSB 1EO8L 1LHZA 1P84K 1VESA 2YPVL 3PWPE 5FO9A 4DN3H 3MRDB 3RZCC 4O2EB 2Y5EA 4X6EA 2DBJA 3T3PE 4Z78A 1T20A 4PB9H 1X5IA 3QO0B 3QIWA 5E08H 4DZBA 1P4IL 3PE9A 4Q6IA 4XP9L 1L6ZA 5ICYA 3SGKA 4YAQB 2V5YA 1IILE 2H1PH 2QSCH 4NQDB 1AKJA 5EDXA 4E0RA 4N0FB 1FO0H 3MCLH 5C0DB 5MI0C 2ZCKH 4OGYL 4NPYA 4X9IA 4TTDC 4IM8A 2YEZB 1W72A 1F3DH 4FA8A 2C3WA 3X11B 2A6DA 3CMOL 5A16A 4NP4L 1G6RB 5GHWH 4FXGB 3B8SA 1CGTA 1FE8H 1F4YH 3ZHDA 1E6JL 1H9VA 4OGAC 3MX0A 3U0WH 1P7KA 4HG4K 1P6FA 7FABH 2KBGA 5HDQH 2QR0B 4BYHA 4LASH 5MEPA 4R6UA 3BN9C 3VFPB 4MJID 5IHUL 3JWNC 4AM0A 1NJ9B 4NO2A 4ONGL 2B4CL 5F8QC 3O6KL 4XBEL 5LCVH 4M8QB 3C6LC 4HS6B 3DBXA 1BJ1J 4OD1H 4EUPH 1WWBX 5L88H 3M1BA 3HI5L 4NYLB 3K2UH 3MRIA 2D7PA 5CWSB 3VXMD 5E2WH 2PETA 4PBWD 1Z9SA 4Y89A 5EPMB 2VE6A 3TJHC 1P6AB 1KULA 2Y23A 5JR1L 3NZ8A 3BMVA 2I9TB 1KSRA 5CEZD 4JVWA 3TIEA 1UA6H 5FO8A 3DTXA 3FQUB 4ALAL 3O3AB 3UJIL 4Y16A 3SE4C 2EH8H 3QZWG 4ZDHA 3DXAD 4S1DC 1JNHA 2H3NB 1I9IL 4P3DB 3QI9D 4OT1L 3BVNA 3MRMB 3WFHB 1J8HB 1JRHH 3FONA 2VIRB 1PKQE 4RISL 3VJ6A 4L3EB 1OAZH 1S5HA 1SJVA 2GTWB 2FSEA 4YHKL 4Z0BL 4GLRH 3OGOE 4JM2C 1A6UL 2WZPD 3DGGA 4R0LB 4UQ2A 1OAUL 4QYOB 2G2RA 4LPYA 4KK6C 1FNAA 1SY6A 2VXSL 3C9NB 4M43H 3QAZB 5DD1H 4QRPA 3PDOA 5TGBB 2X4PB 1ZVHA 1BVLA 2WBJA 5C0BD 4WEUD 1WWWX 4X6BA 4MLIA 3MMEA 3MRBB 1OB1B 5HYJA 1OL0A 1J88A 1ZLWH 5T3ZH 3VXTA 4IRSA 4U0RB 3FN9A 4JQXC 1CGYA 2HT4D 3PGFH 1FZJA 3QHZH 5E9DE 5HHOB 5HVHC 5KN5B 1ETZA 4K7PL 3NVQA 1H3TA 1W0YT 4LPUA 1RIHL 1H0DA 4QNPE 3L9RA 3AC0A 2CO7B 4NKMB 4E41B 4N1HB 3RGVA 5DEFA 1DBKL 2OI9C 3VXSB 4MB3A 4EJ1C 4IRJB 1MI5D 3UAJD 3MRPA 3ARDB 1FO0A 2OQJB 1FPTH 3HE7B 5EO0B 1TXKA 4AIZA 4OGXL 3VDAA 1T66D 4JLRB 4LHUG 3BH8A 3OF6D 3RWHA 3QDJA 4JPVH 2YPKA 3G04A 3O2DL 1VFBB 4ERSH 5GSVA 5C6PB 3UZEA 2XWJA 3RNKA 3TZVB 3P77B 4XVSL 5E6IC 4QXWA 1AE6H 4PTUB 3W0WD 4O9HL 1FFNB 1RIVH 2I9LA 4H26A 1AO7A 2YZ1A 3MRRA 1M7DB 2MOVA 4UOJA 3OXRB 1G9NC 1WIUA 5IESH 5D6DA 5HYQB 3JV4A 4PG9A 1KCSH 3DETC 3P4MB 1IEAA 4Y4FC 4F33B 4NHCL 1KB5B 3MUZ1 4ZPVB 5JIPA 3IS0X 3HR5B 5E1AB 1U8HA 3FQWB 1ZVYA 2FJHB 4X5XA 1CE1H 5GZNC 3BZFB 1I85C 3IETB 2N4IA 3QHFL 1CQYA 5FDYA 3PV7A 4PJCB 3QNXA 5FK9A 3WD5H 4OCSH 4NRZA 5I1CH 5C07D 3V6OE 4U6HB 3DPBA 4EUPA 4H25A 1BF2A 1UACH 4IJ3B 4QRRD 4XP5H 1NGQH 3SE3C 4NQED 5ILTH 3DRQB 1MF2L 5FAAA 5GS2D 3W82A 1J1PH 2P8PB 1BM3L 5B38G 5CS7A 1ADQL 4Y19B 4MD5A 5DJYA 1BFSA 2CDGB 4QWWC 3SDDB 4E9LA 1RFDL 2R2EA 2Z9TA 2P5EA 1F6FB 3FT2B 5HSFA 4PRNA 2NXZB 1CU4H 4HKJB 2F53D 4TOYL 3SJVA 5T1DL 2JB6B 3FO9B 5JMRA 3U0TA 4HGMA 3HFML 4KK9C 5J1AB 3BKMH 5F9DC 5ESAA 3N85L 4ISVB 4KI5D 4N0UE 4OLZH 3TPKA 4X7TB 3GB7B 1FH5H 3IB4A 1ZLVK 4K3JL 4Z7VB 3AUVA 1B6UA 1C1EH 3PL6B 4NBYB 5C0AA 1NCBL 1XGQB 1I1FB 4TSAH 5I1KH 4I9WE 4O5LL 3IFLH 3D18B 3RDTB 3ECBB 4Z7UF 3STLA 4GKZA 4GMTL 2NQCA 2X9WA 4X7SH 4Z7QE 5KSVA 1ZT7A 4MNQA 5EU5A 2VDPL 1S8DB 2Y7QB 1UM5L 5C0FA 3IFOA 1MWAH 5CUSL 2CIKA 5KANG 4JGJA 1U8MB 2ZNWA 5IP4A 5EU6B 1D5MA 2OMNA 5IEKB 2YSSB 4MXQD 5GISL 3IDGB 1A7BA 4LCCA 3CPLA 4ODXA 1M7IA 5D5ME 4HH9A 4NFCA 2VL5B 1GVIA 2YN3A 2DIJA 5EWIL 3V6FA 2VDLL 1ZKAA 5CJQH 2OZ4H 3RWCA 4KKAD 5I75C 1CG9B 1G0DA 3SDXB 2I07B 1SQ2N 3TPUB 5F6IC 1TQBB 2IGFL 1JGUL 4KDTC 1EAPB 3HMXH 4BH8A 2K9UA 2X4OB 2VKWA 1Q0YH 1UYWH 5CGYC 1QEWA 4MSWA 3KXFD 4S1SL 2IC2A 3GSNA 1FVEA 4JM2F 4LRNL 4G6KL 2Q86A 3O41B 4M7JL 3BEWB 3NN8B 4PY7A 3SKJL 2NY6B 3H7BA 2W0PA 1NUFA 5GS1B 5DMYA 5B4MC 4YXKH 1GGTA 4YGVB 3QUXC 2PYFB 4V1DD 5DJCB 5FV1L 1FGVH 4XBPB 1PEWA 1A7OH 1AFVH 2FJGB 3QCTH 5E6ZA 2IAND 4ZAKD 2Z93B 3L3OA 3KS0J 4OF8A 4MJIE 3ARVA 2OMBA 3LV3B 4NRXA 3LIZH 3OZ9H 1CDHA 2EE2A 1QBLH 4KV5F 4DVBB 4PJHB 3ALPA 4RQQA 4UTBH 2YUZA 5T1LB 5EBLA 4KTDH 3BD4A 5C0CD 1SJHB 4WVRA 3MOBH 5ENWA 3EKCA 3MV8D 4G3YH 1A3RL 1BQLH 3VXME 3QXTA 1JNJA 1NFDE 4Z18A 1KBGL 2W9DL 2G5RA 5LAXA 4WFHD 1AY1L 1EJOH 1BIIA 1UXSA 2R0LH 4WFFD 5CEZE 3GMMA 4HS3A 3U36B 1G7LB 4KPHH 1RJYA 5GZOD 2CJUL 3IDNB 5C0RH 4JPKL 2OL3H 4M00A 2F8XC 3DXAE 1I3VA 5DDHB 2KUTA 2MSPA 1A9EB 4PRIB 5DK2A 1KJ2H 1MCNA 4XPHH 5HHXH 3O9WD 1E4XH 1XGYL 4PB0H 5C09A 2EDDA 3GRWH 1U8LA 3KPRB 4XBGA 3TBVA 4M3JA 1UZ6F 2PYED 1UH2A 4J1UA 4XHJC 2YN5A 4YFLI 1ZE3C 3TEUA 1S9XA 4MAYA 4G7VL 4KVCH 1I1AD 5D93C 3BP6B 4BUGA 1KF9B 1QSVA 5GXBB 1JWSB 4DKFL 1P4BH 3S34H 1IGYB 4Y5VC 3V6ZA 4MD0A 2Q87A 3K80A 5JHDA 4KVNL 5TH2B 1WBYB 1BOGB 1GAFL 2OP4H 4UU9B 4ORZC 5I1GH 4UINL 4JFQA 3OV6A 5JMOC 1U8NA 1XF3A 1PSKL 1N7ML 5C0BE 1INDH 3GMNA 2OTUB 3FQNB 3HZYB 1SMAA 4ZNEA 2XPGB 3VI4F 4LNRA 3DARA 5ALBH 4WO4A 2NTFA 1MFCL 2VXTL 5D1QD 3RU8L 1AHWC 2FO4B 5IB1A 4F3FB 2ICCA 2VDML 4ZSOB 2BNUB 4JQIH 1FCCA 1G7PA 4HV8A 5IMMB 5FOBA 1X44A 5I8EA 5CHNB 2H32B 2GCYA 5CP3H 1MAML 4TRPH 2G9HA 3V0VA 1H8OA 3MLZL 2GK0B 3PWJA 4HF5L 1MI5E 4DN4L 4MXVE 5E94B 2JIXD 3VGEA 5IFHL 1HCFX 5D1XD 4TUJA 5DGRA 5CIPH 3MLUH 4PP2B 5J11C 3GSXA 1EFXD 3GIZH 3FTGB 4KJQC 2BVQA 3TF7C 15C8H 3W0WE 3U9UB 4O2CB 3VH8B 1QFPA 3T4YB 5EZOH 1X5HA 5FB8A 4HC1H 2FGWH 3VXRD 3I3EA 4XPGH 5C08D 4ZOBA 5FO9B 1JYNA 3BSZH 2DL2A 1NGZB 2R8SL 1NCWH 4LLUA 4P59L 3HZMA 4X6EB 3SBWA 1T20B 4WTZA 2XWTA 4OD3L 2FEDD 1QFWL 3RVTC 1LK3L 4NQVA 3QIWB 1QSFD 5C2BL 4OF0A 4Q6IB 3FMGH 5ICYB 4M7LT 2DQIH 1AKJB 4E0RB 4DKEH 2X6MA 1YY9D 2NY4D 2D7TH 2QSVA 5C07E 5KANI 4NPYB 3TN0D 5E24E 5JXEC 1W72B 4QRRE 4NQEE 4GS7B