3HZKB

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLAFIRNKAKGYTTEYSSSVKGRFTISRDNSQSFLYLQMNTLRAEDSATYYCARDINPGSDGYYDALDYWGQGTSVTVSRAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S73-2 Fab (IgG1k) light chain
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
molecule tags Immune system
total genus 39
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2009-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkB01
4E42A 4ELKB 4MNGE 3HMWH 2ICWA 2BRRL 1MIML 4RGND 5I1CH 2W65A 3GJEA 3LQAC 1MFBH 5HDQH 5ECJE 5I30L 3ORJA 3P9WB 1HHKB 2C26A 4CKVX 1OSPH 3HFML 5GRJH 3UXFA 3NIGF 3AS0A 4HLZG 5FYKE 1ES0B 3WUWA 3NZ8A 4EUPB 4BJLA 2ADFL 1YMMB 2GYSA 5C0AE 4PV8A 3PNWB 2FYYA 4M8QA 3K8LA 3HPJB 2J6EH 1HQRB 2HYMA 3HC4L 3WIIH 1QSFA 1RJZA 4LCWD 4UIMB 3B2VH 4RA3A 4XPGH 4MXWL 1VFBB 1V7NH 1MCKA 3T1FA 1UM4L 4M62L 4O51B 4O02L 3FRPA 3CSYA 4JRXD 4PD4J 4LCIH 3FOMB 5MP6L 4MDIB 3H3PL 3MJ8B 1YYLH 4CVXB 2GHWB 3VWKA 1YY9D 3HR5B 4MAUL 4RMTA 5IB5B 2HWZH 3S34H 1JZ6A 4ZS7L 2P5EB 1D5IL 3T4AB 3GSUA 3KPPA 1MWAH 3QUZB 1JRHL 1TPXB 1I8LA 2VXSH 4ERSH 2R4SH 3D69B 1CICC 2PYEE 3EOBB 1S7WA 4MA1B 1QFOA 3TN0D 2YPKB 2DYPD 3ULUL 4F15B 4YPGB 1KJ2H 2L4OA 1JGDA 4F57L 3L5JA 3CFCH 2KPNA 3IU4L 3QNZA 2DLHA 3CZJA 1KTDB 2NW3A 5T3ZE 1F3RB 1OB1A 4X6FA 3HC3L 5EZOL 1R5WA 2PCPA 3WN5C 3ZE1F 1UXSB 3QWRA 2W91A 4UT6H 1MCQA 3RDTA 1R0AH 4PJEB 1EZVY 1RZ8A 1T04A 3ARXA 2NY5C 1U8LA 5AZ2L 2WINA 5HGHA 5DXWA 3CK0L 5LVEA 1XF4B 4HF5H 3FB5A 4XVSL 1MVFA 4J6RL 1YN6A 1U92B 1MCWM 5ITBH 5FB8B 4GW5A 5CHNA 1XFPA 4NOFA 1A7QH 1JIBA 4OSUL 4S1RH 4JJ5B 5D7KE 4HIXH 3LD8B 1A6ZB 5GZOC 3SGEH 3UTSD 3BH8B 3IF1B 2PTTB 4Y5VB 15C8H 1IAII 1QBAA 3KXFB 4U3XA 4CU6A 3T0EB 2XQBL 1FLRL 5D6DC 1GCFA 3RNKA 5JW4N 3X13B 3AGVA 3KYOA 1YNLL 3Q5TA 2IALB 5C0BD 1SQ2N 4DAGH 1LILA 5KOMC 1REIA 3TZVC 2P47B 5CLTA 1HKLH 1KIQB 3F65A 4N0UE 2ADIB 2PYFA 1MJ8H 1RZIB 5IV2A 4F7EA 3RIFF 1MFEH 4CN1A 5E8EA 1EBPA 4Y89A 4X6CE 4KJPD 1IGIL 4I9WE 5T5NG 4YHLL 2BC4A 4GW4B 3NACH 5FKPB 4QY8B 4P5TD 2O61B 4OLYL 3RGVC 5DC0A 5ITFB 5BQ7B 3VGAB 4MJ5B 3VE0B 4PS4H 5JLZA 3O2WH 3LN9A 4QWWC 2BOCB 4M8VA 3VWJA 2V2WB 4R0LC 1MCBA 4KH2A 3I9GH 4Z7UB 4CRPA 1RIUH 3A6BL 3PHOB 3TO4A 4WTXA 1KJVB 3QUML 1FC1A 4GKSB 2GKIA 4FTVE 5IKCA 2X9XA 3CFDB 2FX8H 3C08H 4S2SB 1H3GA 1T7WA 5L7XH 1DE4A 1NEZG 2BSRB 2BVQA 2D03H 3KPRD 1HSBA 3S5LG 2FIRT 4NHUA 3SO3B 3QZWA 4OFYA 3U4AA 3TH4T 1AKJA 4P9HL 1E4WL 1CXEA 3QDJD 2JLLA 4XMKH 3TFKC 3UEZA 1DQML 2WZPD 3L6FA 1BFVH 5HD8C 3LN5B 4HKJA 5C08A 3W81A 1BD2D 3RWGB 4ZFGH 1CQYA 3RL2A 1IC5H 2Z35B 1FYTA 1N3NA 4RWYH 2N7BA 2DM4A 2QJDA 1IGCH 4MGXA 5EIIB 2HTLD 1BP3B 5F70A 5KVMC 5TF1H 1C08A 5F44A 3U36B 1A7PH 1I8MA 2JIXD 4PRID 4JCMA 3G9VA 4M02A 2DQJL 1LK3L 2KZ1B 3QZWG 5IEHB 2HKFL 2G2RB 3W11D 3L5IA 1EMTH 3KG5A 3WJLC 3AM8A 3QIWD 2DB8A 4U1KA 2Z8RA 4X6BA 4KY1H 4S0SD 3E2HB 1MRDL 2HT2C 4QGTA 2XXCB 2VR4A 1SBSL 3CFJB 4HLZH 4LKXA 3GSXA 4OZIB 1WBXB 4HUXA 5FYJE 1GJIA 4Z0BL 2ED8A 5D7LE 3ARBA 1F3JB 4P48A 5I2IA 3IB4A 1AIFB 1YJDL 1HWHB 4L3CB 1U95A 4KRMB 4RAUB 2F5AL 1CD8A 4WO4A 3UDWA 3SE3A 5K9OB 1AC6A 1CDUA 3EZJB 1QNZH 1N8ZB 3EGSB 4WI5A 1WJ3A 4HIJA 1D3CA 1B4JL 5JIKA 4I3SL 4P57B 4IS6A 3NAAH 3V79C 1ORQB 1Z9MA 4MNHB 4PR5A 2I07A 2H26B 5EG6C 1JE6A 3WFCL 3KLAB 3QEGH 2VSCA 4MJIE 5I1EL 4NO0D 5EIQA 2HVJA 5K59E 1G7QA 1HXYA 3IXAA 4P3CH 5I1JL 1IRAY 4PJGA 4JFXB 3LKSB 5IESH 1T21A 1H5BC 3ARRA 3TH2T 2XTLA 3HE7D 3CVHL 1S7XB 2A77L 3JV5A 5C6WH 3V5HA 3J8F7 1CR9L 4GFTB 3DHMA 1H8NA 5M7QA 1YNTB 1G0DA 4HWUA 4RIRA 3ET9F 1J7VR 4PJ9A 4PB9H 3NZHH 4JY4A 2ZSVA 5BRZA 5BMFH 5JOPD 1HCFX 2XZQL 3PABB 5KAQF 4DJMA 2P8MA 2XICA 3NA4A 4WI9A 4OBRA 3EO0B 3R1GH 5DMGD 3VGEA 2CRYA 4N0YL 5CP3A 1WC7B 3PXHA 5FCUL 3SDXE 1FVDB 4BSWB 4I77L 4HX1A 4N1CA 5T1LD 1JI1A 3HUJE 4ODTH 4ZODA 5ERWB 3ZKSD 1OT1A 2AKRA 1S9YA 1C5CH 5EUKB 1G7IB 5MEOB 1UADC 4TNVF 4JG1H 4JFED 5C9JB 5BO1L 3KPQB 4DEPC 2VQUA 3WMSA 1ZOXA 5FV2A 3SCMD 3BN9C 4R4NC 2BVOA 3PWUB 1XIWB 1XGUB 4WGWB 1CTOA 1TJHH 1H3XA 1V3MA 4MD0A 4JREB 3V2AR 3RIFK 3BUYB 2EZ0D 5F3HA 1J86A 1YEGL 4HGMA 2OP4H 4YE4L 2IWGA 5FOBB 3MRGB 3BPOC 1WEJL 4FQJH 1N5AA 3ZSTA 5TFSH 1IJ9A 3QQNA 2DTSA 1EX0A 1FL6B 2VMFA 1HDMA 5EC2A 3MRRB 1SJEB 1OQXA 4QYOB 2R69L 3GKWL 2OXGA 5DLMH 2AAVA 5IBLC 2HJLB 5ALBL 1E0OB 2I26N 3DX6A 5HGGS 3RKDD 3CFBA 4H25A 1PG7L 3BRGC 1KTRL 1FNEB 1UZ8A 4GBXA 1M71B 1I1YB 2DLEA 1UWEH 2VN7A 3RVUC 4CVZA 4MMZC 4GG6F 1CDGA 4WWKB 5F9AC 1RUAL 2BZDA 4QTHA 4PJBB 2OR9L 3T2NH 1WSST 1UZ6F 1AGFB 3BH9A 4IJ3B 1MRFL 4L8DA 5EBGA 4ZO6A 4HK0A 5C0ND 1XF5B 5FGRA 1EBAA 2C3HA 4ZTOL 3MRMB 5ESVA 1XF3B 3LEVL 3T65B 1MCFA 1GGCL 3L5WA 2WBWB 1BOYA 2ZUTA 1IC7L 4JAMA 1MAML 2A9ML 5C2BL 1CLYL 5HYJD 4K7PL 5IHBA 2YD9A 2AJ3B 3D5OF 5EFIB 3GMQA 1QFWH 2I60L 3ARTA 2UYLA 3OKLB 1D5XB 5C09E 1DQDH 4UV7L 4Q97A 1CLOH 2IQ9H 5DD3L 4C54A 1AC0A 4NKIH 5JOFA 4PY7A 2YUXA 5F7HA 2X4OB 4LF3A 1NGXA 4I48B 1J1XL 2R0ZH 3OKKB 1LEGA 2NY6D 1ZANL 3QO0B 1IGTB 4OFIA 5JQ6H 3GMMA 1L9NA 2GI7A 5EOCL 4JHWH 4WTZG 2AGJH 3EJYC 4DGVH 1NDMB 4E41A 5F6IB 1ZA6A 3DWTA 5DVOA 4CUCA 2B0SH 1MQKL 2RJMA 3MLRH 2P5WE 1RULH 2IH1A 3RKPA 1CFNB 4LSSH 4NGHL 5EU6D 4WUUD 3MLXL 4DGIH 4YBHA 2CLRB 2CLZB 4LQ1A 4NJAL 4YIQA 1YPZA 2F74A 2DLFH 3SDAA 3C5SB 4BQCA 1OTTD 4KAQL 1TZGH 3RU8L 4DZ8A 4MA8H 2GTWA 5T3XH 4WFFD 5HHMB 3BD5A 1QEWA 5FYLL 4N5UA 2NXYC 4PJXF 1IKNA 4MLSA 4UIKH 4X9FA 1H3PH 5GRZA 5AWNH 4M4PA 1CFSA 4A2MA 1I1CA 1DQQA 3FCTB 3FMGL 3F5WB 1AGCA 4LCCA 1ZGLA 3CIQA 3VXMD 3QRFM 3E6HB 2WAHA 3RWDA 4G9FD 3K46A 3UPRB 5F1NA 4PPTA 5GZND 1MSPA 4FZ8H 4P4KB 4YHMH 4ALAH 1EGJH 3AVEA 5JO5B 4EN3A 2IFGA 2YR3A 5EC1B 3RUGB 5I74C 4EI5D 3RVXD 4TSCL 2H9GB 4J3SA 1F45A 4N0FA 2EECA 4PTUA 3QH3A 4O2EB 4GRLA 2EDTA 1AQDB 3V7AG 4X5XB 5DRNA 3O2DH 1QSZA 3FOLB 1I7UA 3HPLA 3CMOL 4NZRH 5A2IH 3S5LB 1HQ4B 2EDFA 1ZHNB 4OM1H 4W6WB 3FQTA 3E1F1 2R4RL 4X6DB 3I75B 5M95B 3D1MC 2LU3A 3MJGX 5GS1B 5IW1A 3O2VL 1T5WA 4M03A 1TETH 3F12A 2Z92A 2Y25A 3GM8A 4I0PC 5J56B 2DI7A 3MMEB 4PJIE 1QLRB 4W4NA 5C0GA 2AXGA 5EU7E 2Q6WB 3PWLA 4P59L 4LHUD 3ARWA 5JUEH 4FG6D 5M94B 2DKMA 4FQCH 4R4FH 3U30C 5MENE 2ZNWA 3BEVA 4FXLA 5J9PB 1PX4A 1EH9A 2Q3AA 2WBJB 1F3DH 5B39A 4JO4H 3VU2A 4TNVK 4M00A 4EOWH 3DVNB 2R0KH 2ICWJ 4YDVA 5KN5B 5T1DL 3U7WL 4P2OA 2AABH 4EXPX 3SQOL 3RX8A 1MLBB 3OF6A 1AGDA 5LCVL 3GO1L 3MBEA 3BISA 1ETZA 3MCLL 4XPHH 4OGZA 5FGCE 2FX9H 3SDYL 4JFQA 3QB7C 4KKCC 3FFCD 5EO0B 1NMBH 4G42B 4KK6D 3PJSA 4WFHE 3ZO0A 4PJCB 2W60A 4O2FA 1BVKB 4HS8L 5LWYH 2VAAB 2Z91B 3TPKA 4ELKA 1MCSA 2JF1A 3C09C 2ZG2A 1CU4H 3ILQD 3IU3B 4R6UA 4PG2A 1MJUH 3EJZD 4XC1L 4G43A 1KCSL 4X7FC 5JHDB 4Z8FL 4ZQKB 5JOEA 2YA1A 4OZGA 4N8CH 2MCPH 4U0QB 3G6JE 1HYSC 3TVMB 2V17L 2FR4B 2AJYH 2KZWA 3HAEG 1YMMA 4XI5C 4XT1C 3PNWA 3NH7L 5DUPH 1P4BH 1F02I 3VXPA 5DHXB 5D7JD 4YQXH 3QDAA 1QSFD 3QFDB 3CCHB 3RBGA 5E9DB 1VFBA 4BK4A 1KPUB 2CMRL 3MXVH 1BBJB 4N8VG 5KVEH 4HJJL 4KI5E 5HHNB 4LIQE 3W9DB 3FOMA 4HWBA 1QG3A 4MDIA 2W9EH 1P9MC 3A0OA 3UJIL 1FFPA 3HR5A 1CK0L 1JPSL 3F58H 1QFUH 4Y4FC 4ZFZA 2CPCA 4BZ1L 1YQVH 2OMBA 5L9DH 1QP1A 2P5EA 3T4AA 4O4YL 5GJSH 4BZYA 3QUZA 1Y18B 5IROA 3S3PA 2Y6SC 1UWGL 4IRJB 4JY5H 1HHHA 3EOBA 1QKZL 4LCYA 1MREL 4EIZC 4DKEH 3BJ91 3MLVL 3TIEA 2ZG3A 4YPGA 3FL7A 4MD4B 3PWVB 3TNMA 2I5YH 1QFHA 1KTDA 3QA3A 3EYSL 1CGXA 4R7NA 1CXLA 1C12A 1KFAH 1H8OA 3QUYB 3TIDA 3WS3A 3JV0A 4I2XB 3KS0J 4Q0XH 2W9DL 4UB0L 1CS6A 4JGUA 3LS4H 5JXED 1FPTH 2AVGA 4LLVB 3WLBB 1U92A 1VGEH 1VACB 4LQFH 3N1PC 1A6VL 3H9SB 4PB0H 1GGIH 5HBBA 3ABZA 1ZS8B 5FB8A 1TQBC 1BBDL 2BMKB 1ZLUH 1A6WL 4YEFA 1A4JB 3RPIB 5DMJB 4JJ5A 4P4RA 5D2LA 5E7BA 1FGNH 3IF1A 2PTTA 1T83C 2B1AL 3VGHA 4RQQB 3KXFA 4IIQB 3T0EA 5KVGL 1CGSH 4J1UB 4OF6A 2X89D 4QHUB 3ZDXF 3LSOB 3TT3H 4NHCL 4PJ8D 1DZBA 1E4XL 5DMKA 3WIFA 4XNQB 3CU7A 3X13A 2IALA 3NA9L 1OGTB 4PJDE 1DEEA 5CBAA 4YPJA 4WW2F 35C8H 3WL9A 1KIQA 2IC2A 1RZ7L 3OAZH 1OCWL 1QBLL 3H7BB 5D70L 5F8QC 1YEHL 4GW4A 3RTQB 1QBMH 4QY8A 2O61A 3BZ4A 5BQ7A 1IGJA 2LVEA 3UYOD 1P1ZB 2D7QA 4OIIL 4MJ5A 5GS0H 5KSVA 1XH3B 4MB5A 4OLXH 4P5MB 4XPAH 2BOCA 3QPXH 5DSCB 4FQXD 3S37H 3VW3L 4XVUD 3U4BH 3ULVE 3MYZA 2VZUA 4OB5H 2VKXA 3PHOA 5EBLB 1JF1B 1RJLA 5EN2B 3TO4D 1OM3L 5C0EB 1WF5A 4GKSA 1JK8A 1F2QA 5ETUB 3ROLB 3DETC 3BP4A 2PW1A 3TYGL 4FQIH 4YHZH 1CGWA 2Z31C 4XP1H 3F6IA 4LRNH 4GUPB 4Y19B 4TSBH 2EDQA 1KELL 1DN2A 4NN6B 4RBPK 5F7DA 4L29B 4ZPTB 4J4PA 4ELMA 4OCSL 5A16A 1FNFA 2VL5A 1ZLVH 4KFZC 2H45A 3TBWB 2BNRB 2V5SA 3KYMB 1VPOL 5AZEL 5IHZB 5MERB 1JN6A 3FB8A 1KIRA 5B38G 1DDHB 2XWJA 4PD4K 5CZVL 4FMKA 1S7SA 1XGQB 1A2YA 2VZSA 1T7VA 3MV8B 5IIEB 1T7YA 1T03L 2RB8A 2DLTA 1FLTX 4KI5C 1FYTD 3GRWA 2YOCA 5E6IC 1KJMA 4TPRH 2IMNA 1I85A 3G5XA 5HGDB 5EIIA 2IPUG 4KK8D 5JHDD 1MCOH 3DI3B 5I16B 5D7IB 5DT1H 5TE4H 4FQ2L 3UZQA 3BZEA 5EU5B 4JDTH 2O5XH 4KQ3H 5HHPB 1P4LB 5F88B 3TVMD 4Z95L 5IEHA 2GUOA 1AR1D 2J8UF 1TITA 5E94B 1FBIL 4G6ML 2A1WH 1MH5B 5ESQA 5J1TC 4NCDA 3OPZL 3KLHD 2OJZH 2VC2L 5HI5D 3CFJA 1JZ3A 4XBEL 4X9IA 1ACZA 1KCUL 2XKSA 1GGTA 2GJJA 3HAEH 2UY6A 3STZB 4OZIA 1RZKL 2J5LC 3NIGE 1CYGA 4NRYB 3MOAL 3E8UH 4ORGB 5CP7B 5JMOC 1AIFA 4L3CA 5IVXF 4FP8L 1NBZB 1NBYB 1MCRA 3NOIA 4OUOA 3IJHB 43CAB 5I8OL 2ZNXA 2YC1A 2AQ1A 1YEEH 3PE9A 4G8IA 4LP5A 2PUQT 4P57A 4K94L 1LO0L 3D3VD 2CXKA 1HK6A 4WGVB 3VG9C 3QJHB 2HFGL 4C4KT 1H8SA 1ORQA 2AEQH 4U1NA 1JVKA 1OLLA 4IRSC 3U0PB 4Z7OF 4U31A 4WU7B 2CR6A 4LLQA 2AW2A 3KLAA 5GGRB 5J4MA 1JZ5A 5DJ6B 1X5YA 3HE6D 4KK5D 3T3PF 3FO0L 1LK2A 2VLLB 3T2QA 3LKSA 1BQLL 4RMQA 1F58L 5DQ9B 2C5DC 4TSAL 1S7XA 3MLWL 5F7MC 5F96H 2KH2B 1EO7A 2EXWC 2ADGB 4NWTL 5F9OH 2A6JA 4DFIA 5GGVL 2R23B 1YNTA 3UCRA 2ICES 4HW6A 1FORH 1C5BL 1B0GA 5FOJA 5BVPH 1KLUB 4R0LB 4YBLB 3D2UB 1GC1H 4C55A 1U58A 2BVPB 4O00A 4RFNC 4C58B 1H3VA 3PABA 1PKQE 4MNGB 2KL6A 2WLZA 3ZE1E 2FEDD 2HTKC 5ISZE 1I9IH 1G1CA 4GXUM 3B9KD 2P49B 4PP2A 4P46D 3JWDH 5C71A 4DZBA 5DQDH 4YHIA 5D7SL 2E6QA 3JWOH 2ZUQC 1WZ1H 3ZL4H 2D0HA 4OLWH 4S10A 1UKTA 2WQRA 5EOTA 2EYTA 5ERWA 3PP3K 4NFBA 5I1LB 4OTXL 5ALCH 1X7QB 4U6HA 4X99B 5C0AB 1UA6L 5MEOA 3RA7L 4F33A 1WFOA 5C9JA 3ARZA 1IGMH 1S7RB 3KPQA 3EW3B 2JB6B 1BJ1H 3SGJA 1IBGH 5D1ZB 3QI9B 3SE9H 4ZD3H 5EBMB 4O58H 3HAEB 2VDNL 1XIWA 3FZUC 2HMID 2E6PA 3O6FB 1KC5H 1ITCA 1BX2B 3DOSA 3OB0K 4LLUB 1RVFH 1Z9SA 3V4VL 3IXTA 3BW9B 3MRGA 1N5YH 4N8VB 1DBML 2JJUA 1FL6A 2MQ3A 4HXBH 4HJ0D 5I8CA 1X6NA 3DROB 4Q9RL 2PYEB 4BSVA 4D9QE 1ADQH 2HJLA 1DQTA 4WV1A 4UI2A 2AJZA 5CIPH 4Q9QL 4HUMB 1JGLH 3GSWB 2B2XH 4X7SH 3JTSB 3MOBL 1IC4H 3I3DA 2W0FB 3G5YA 1U6AH 3C6SA 4HH9A 4NC1C 5FM4A 2VSDA 4JPKL 2AK1H 1PLGL 4QF1A 2Q7YA 4Y5YA 4FFVC 4CJ1A 1M71A 4PLNC 1SBBA 1I1YA 2BJML 4G7VH 3U1SL 4WWKA 5DI8A 1EHNA 3HG1A 3CPLA 4LSUH 5DS8B 2YA0A 4HSQA 4QXTA 4HUWB 3THML 3RVVC 1AGFA 4IDLA 3VRLF 3HZVB 4YHYB 4K8RH 5E0QA 2WW8A 3QXUA 3LKNB 4NUGH 1W0YT 5BXFB 4NBYB 3FO9B 5HYSB 3BDYH 1XF3A 5C0DB 3T65A 1BPVA 1J8HE 1MCCA 2VLKD 3BZDA 2PN5A 1UYWL 1D9KA 3WFBL 1I9RL 3ES6B 3MRHB 2AJ3A 4I0CC 4RAVB 4OM0L 3CX2A 5C0FA 4MMXC 1D5XA 4YDJB 5GIRB 4X80L 4Q6IB 4UTAH 1P6FA 4FRWA 2DOCA 3HC0B 2X4OA 1SEQL 5DO2C 3OKKA 1G6RA 3CUPB 1JWUA 3QO0A 1BEYH 2NY1B 4MCZB 5TQ2L 5FM5O 1IGTA 1EJOH 4RFOH 4PG9B 3K8KA 5E2WL 2FBJH 3HI5L 1OLZA 3V6OA 3TA3D 2VZVA 4K3JH 5E5RB 4YDKL 3TBTB 3M1BA 4U7KA 4KPHH 3VFVB 2VLMD 2DS4A 3IKKA 5BS0D 5I1IH 4NRZB 2B4CC 1NBQA 5FUOH 2D7MA 1U3ZA 4CW1A 1CDJA 4N0UB 2CLRA 1T1WA 2AP2A 5IMMA 1EK3A 1F8TL 2NYYD 1U8MA 2AJVH 1DFBL 4X6CB 3C5SA 5AYUH 5ESAB 4U2ZA 5HDLA 4JG0L 4TUKL 4UT9H 2J1KA 3H9HB 4DKFL 1T66D 3QJFB 1TNNA 4V1DA 1X5KA 4K7PY 3BKML 5GS0D 3HI1A 1NGYB 4I18C 2N4IA 1KPRB 1QPPA 2IFFH 3FCTA 4EEEA 3F5WA 5CAYB 1ZK9A 3MJ9H 2A6KB 5EU4B 5CIPB 2CDGB 4MQXC 5IB1B 3DRTB 1X4YA 3W2DL 3E6HA 2XA8H 3U79A 5HVHB 4FTVB 3GSVA 3UTZB 4YXHL 1MHPH 1IAKA 4P2QE 3WJJC 4JFDE 3BOVA 4P4KA 1CF8H 1DBAH 2EH8L 2Q7NA 5JXAH 5I6XC 1ZTXL 5EC1A 3RUGA 4IM8A 3O8XB 2NY4B 1YEJH 2H9GA 3BPOB 1YUHB 5ILTH 4EDWL 1NLBL 5DTFB 3QIBA 5TDOA 1RUPH 3BQUB 4YNYB 1UM5L 4O2EA 1V3JA 1X9QA 1AQDA 2DQEL 3V4UH 4X5XA 2FD6L 4QOKA 1U3YA 4P0DA 4MAYD 5T1MB 4R26L 4B7LA 5F71A 1HQ4A 1DN0A 1TJIL 4JZNB 3GSQB 1IMHC 1QQDA 3I75A 1PSKH 2N7AA 1QUNA 5GS1A 2IBZX 3CH1B 5FGBA 2CGRL 3ARDA 2OBGA 3HLAB 1M05A 3QEQE 5DHVH 3DXAD 2VRAA 2Y06L 4MXQC 3IJYB 1MFAH 3UJJH 5HHOE 3VFNB 1DANU 5J9PA 2PXYA 4W6YB 1JMZA 4XAWL 2WBJA 1B88A 3HB3C 4C4KO 1QHOA 5C0AD 4F7TB 1OP3H 1V7MH 5I17B 4XH2B 3DVNA 5KN5A 2H3NB 4Y2DA 1T1YB 1B4RA 2PKDA 4I5BB 5HI4C 5E08L 2VABB 3MFFB 3QG6B 3QIUC 1JFQL 3GK8H 4FFZH 2JB5L 3I2CH 3R8QA 4HULB 3O3UN 4OQTH 3EOAB 3HRZB 3GMLB 3I3EA 5D7LB 1VFAB 3VXTB 3O6FD 3MRDA 1U8IB 3SN6N 5SWSA 5GSRB 1FE8L 3OKOA 4PRHE 3AB0B 5EO0A 5BZWA 5B3JF 1SM3L 5I73C 4KK9D 3DIFB 3LRHA 1BVKA 3ARSA 4PREB 2DQFB 2IAMD 2VAAA 3O45B 3QPQD 5E1AB 2AV1B 1QRNA 3GIVA 3BT2H 3ARGD 1U93B 3VWKC 4DN4H 2P8PB 2PYED 1ZHLA 1KCVH 3IU3A 1DLFH 1JNHA 1II4E 4JHBA 1NLDH 4MJIB 1JYNA 4XP4L 4KVNL 4XNZC 4HWBL 1S9VB 1IEAA 4ZQKA 3MV9E 2VXTH 4YHOH 4Y4HC 5DMIL 5KJRH 4U1GC 4KROD 5HGBA 1VKXB 3BPLB 4NUJB 4NKMB 3GI9L 4FQLL 4YGVA 2FJGB 5FEBA 2AQ2A 2EEDA 2NXYB 3BVNA 3VFRA 1OGAA 4XAKD 5IWLC 2YEZB 2VQ1B 3CCHA 5E9DA 1TVBA 1KPUA 2ERJC 2DQIH 4PRPE 3F7YB 2M26A 5T1KD 1JGVL 3KYAA 4NBXB 3OR7B 2AEWA 5F1IB 4OLEA 4PGCA 3W9DA 4JQIL 5E2TH 5F7EH 3EHBC 2EDLA 3O41A 2CSPA 4IHOB 4M6OL 4G6FD 4ZAKB 4GG6E 2X4TB 1ZA3B 4OCLC 3C60A 1P2CA 3D0VB 3K1DA 6FABL 1QTYT 1UZ6E 4AENB 5A2FA 3ETBF 3G08B 5I74B 2NXZC 4DKDC 2IJ0C 1VCAA 3BXNA 4KDTC 5D7KD 1A47A 3SDXB 1YEDB 1AJ7L 4JR9L 3HUJB 2K9UA 1VEOA 3NCEB 2NY1D 1O0VA 2ZUUA 3AMKA 2X10A 1D6VH 3C6LB 1OSZB 3QO1B 1BFTA 5IFAL 2H2SC 4HMEA 1A4KB 2F54E 2GW5A 2ZOKB 3O3EB 4Z9KB 3S4SA 3C5ZC 5EIVA 5IHLB 4YC2C 3QUYA 4I0PB 4YX2L 4JQVA 1S3KH 1F4XL 3U9UB 3WNMA 1RURH 1T0NB 1FL5B 1I8KB 4QRUB 3M8OH 4I9WD 3R0MA 1MFNA 2R56H 4ODHH 2D0FA 3X3FL 2XT1B 3S35L 2J6EL 2AJSL 3WLBA 5IW6B 3UROR 1VACA 3B2VL 3NCJH 2XRAH 4XPGL 1QSEA 5CGTA 3QRGL 1VA9A 4QO1A 3VFMB 5B8CC 5F7LB 2BMKA 1PD6A 2HT4C 1OWRM 4QHKI 4XVTH 5CBEB 1NUNB 2NNAB 2Z4QB 1YYLL 3MV7E 4FTVD 1UT9A 1A3RL 5I1KH 4FQHB 2EICA 3IFLL 1N6VA 2QR0A 4PJXE 4J1UA 4U6TA 2ZUVA 4POZC 4XP9L 3RHWK 4HAFA 3S4SG 1IQDB 2NY4D 5EULV 5DEZA 2VXSL 3BQUD 5K9KA 3U0WL 1GZPB 2OL3B 4XNQA 5CJ8A 4K8RD 1TENA 4RMWA 4R2GD 3KPSB 4ODSH 1YEIH 3C09B 2ZZUT 2R1XB 5F7FA 4W70A 3X11B 1I1FA 1U91B 3O9WB 5IMKB 3I3BA 1LE9B 3G6AB 1IM9B 1NBVH 2OI9B 1ZVSB 3V0WH 3WO3B 3VXUE 3N9GL 5C09B 1NGPH 5GRVL 5DC9B 3KPLA 1XH3A 4NQXA 2Q8BH 1R0AL 1OWWA 2SEBB 4HKBB 3VRJA 1V3KA 5CJBA 3MLPA 5C6TH 2CRIA 5CINH 1RHFA 4HF5L 1RIVL 2P42B 5KTEH 1ZKAA 1K8IB 4M7KH 2FLBT 5ETUA 4X0KB 3ROLA 1RY7B 3B2UC 4NNPH 5CJXC 5ITBL 2P5WB 4LCWE 5LGHH 3LKPB 3BRFA 2CDEA 1MAJA 2Q20A 2X09A 4AM0A 2XZAL 5JZ7D 4GUPA 3GRWL 5DRZA 3C2AH 1WIUA 2YBRA 2QQKH 1MI5D 3OL2A 2AS5M 1I1AC 3FN0H 2C1OB 4JRXE 2GITB 3IDNA 1EUTA 4J4PD 2LE9A 2BNRA 1Q9WB 4LNRA 1MHCB 5GRUH 3I6KB 1YEKH 4KHTH 4BSJA 1Q8MA 5IHZA 1CICA 5ACLA 1DDHA 2V2TA 1KN2H 4XPBH 1G9MC 4XP6H 1TMCB 1WQVT 3DVGA 4OCYH 5IIEA 5HHQB 1KGCD 5JW3H 4G5ZH 4URTB 4DAGL 4K71B 5DR5H 3S36H 2CKBA 1PEWA 4NN5C 3RX7A 4U1HB 4WVRA 3CMGA 4PBWD 1U41A 4F7PB 5HGDA 1LO2L 3WN5A 1OW0C 4DW2H 2BVTA 5D7IA 3V4PH 3NACL 2Z93B 1B90A 4M7LL 1WCQA 2UVEA 1P4LA 4R7DA 4X4XB 1EEUA 2VUOA 5SX5K 3K4AA 3A6CL 4PS4L 5I19H 1OF2A 4B0MM 4PRNA 5A2JH 4XCYA 3I9GL 1RIUL 5EOQL 3T3MF 1KIUA 5K9JH 1KNOB 4KTYA 1CXKA 3PL6B 3T0BA 5JDSB 4QTIH 1TQBB 4TVPL 1RZFL 4G8GA 3H6JA 1HSAB 5FIEA 5IMLA 4UNUA 3DRQB 4DQOL 3P4OB 4NRYA 1ITBB 2DQHL 3C08L 3JV6B 4ORGA 5L7XL 4WFGD 1MFDH 4YO0B 4ZAKD 5SWZA 1QSVA 4KV5F 1NBYA 1NBZA 1F4WL 1NSNH 2C1PA 5C07E 3IJHA 5DVLA 5DEFB 4UU9B 1ND0A 3O4LE 4P9MH 3QXAB 2PW2A 4S11A 1PY4A 1KLFA 4PJIB 4XPTH 2C7UB 4FN0A 4O5LL 3RZCC 1QHPA 1NCAH 5MENB 5IOPB 3U0PA 2R2BB 5D9SB 1BFVL 4XB7A 3TZVA 5D1QC 5DJ6A 3AREB 5CZXC 3C6LD 4IOIA 1JZ8A 4RISH 2QV2A 4ZFGL 1GOGA 2VLLA 3Q5YA 3QAZB 5DHYB 3OJMB 1CLZH 1Q9OB 5DQ9A 5INCB 1OY3B 3T0XA 4MJ4A 3RGVA 3STLA 4AK1A 1IM3B 2ADGA 3LY6A 1NGWB 5L0QC 2PO6D 3DV4B 2ESVA 5IW3A 5A3ID 1NCTA 1IFHH 1UG9A 3L3OB 4JKPL 3C87A 3JTTB 5FGCB 5KVDL 5TF1L 3AS3A 3U9PL 4G8FB 3V0VB 4D0BB 1A7PL 1T5XB 4XZUB 3P30H 2XTJC 3MGTA 4LDEB 3MCG1 5C0RL 1KLUA 3MACH 2O5YH 4R0LA 1HHJA 3D2UA 4QEGA 1GHFH 3FQWB 1EMTL 5F3BB 2HH0H 4KY1L 1UFUA 3GHBH 5C86A 1A7RH 1PYWA 2X4SB 1N59B 3FQNB 2HFEB 5DJXB 3HCVB 4XCCL 4Z7WA 1HILB 1I3GL 2Z31B 3ILPA 3X3GH 1TCMA 2YN5A 1A1OB 3TBYB 5FHAL 2RCSH 3MZTA 4HC1A 4JFYA 3G6JB 4H26B 4RGNC 1A6UH 1B9ZA 3UTQA 4AH2B 1X7QA 3KPRE 1U3HD 1NJ9A 4S1DD 3TYFB 1QNZL 3B9DA 2A73B 4FFWD 2X40A 1S7RA 2IEPA 5GGUB 4NO2B 4HBQA 2WUCH 2JB6A 4OI9A 3BKCH 3PV6B 1UJ3C 3QDJE 1FVCA 1R3KB 4G7YH 4LDLB 3KPSD 5EO9A 4CGTA 1JNJA 1OL0A 1GGUA 3CVIL 2VDOH 4B50A 1CL7L 4P3CL 5E6IB 5F9JB 4QRPE 4XTRD 4LLUA 12E8L 3ZDXE 1ZV5A 3BW9A 5E2UH 1GPOH 3DHJA 4GOSA 2O93L 1LO4L 2ITCA 3P77B 1F2XK 1T1XB 2DRUA 3H42H 1QO3A 3ARQA 3B9VA 4X98B 4LAJH 4HWEL 2FJFB 3C5JA 3WJLA 1YY9C 3DROA 5ICZB 3ULVH 3NZHL 4XMPH 3O6KH 3DVIA 3PGFL 3GSWA 1AHWC 1YPZF 4PRIE 1HE7A 3JTSA 1RJYB 3MUHL 2NY0D 1T7ZA 2ITDB 2J5LB 1HXMA 1IGYA 4NQVA 4CAGA 2WV3A 4QRSB 4AEEA 2NX5D 4HFWB 1LD9B 5BJTB 2IPKA 1VFMA 4WTWA 5FO9B 4HIHB 1WITA 3TN0C 3HG1D 2OSLB 4ZUUA 5IR1A 1M7DB 5DJYB 4Z18A 3LEXB 5I75B 4ODTL 3LKNA 4UDTB 1DQJB 1NC4B 3K4DA 3QCVH 2EDRA 3MNWB 3FO9A 3H3BC 5HYSA 2Q86A 3QDGA 5C0DA 4JG1L 2BSTB 3DBXB 1NMAH 4U1MA 4NNYA 5E2VH 4M3JA 4U6YB 5DD6B 4Q2ZB 3VXNB 1H5BA 4C56D 4ZFFB 5F6HI 4HPOH 1CN4A 4LRIC 3VDBA 4AT6A 1JPGB 1PZ5A 2GSIA 4JPIB 3VFPB 4MCZA 1S7UA 5DJ8B 3GIZH 5TFSL 4UINL 3D9AH 4L5FH 3GHEH 4XCNB 4NN7C 2DQCH 3K0WA 4ODVH 4LEXH 3DMMB 4RFNB 2LVCA 2IG2L 3P73A 5DLML 3PHQB 5E00B 1OAXL 4PJDB 1F11A 4NQCA 4AEIL 3PL6D 1EXUB 4N0UA 3F7PC 5I18H 2WWMD 4GXVH 5E70A 1K4CB 5JOPE 1NCDL 2WSKA 5D1XC 4GRLC 4QRQA 4ODXA 2R1WA 1FIGL 1MCJA 3D39D 3QNYB 2EDDA 2J8UE 3NCYP 3MBXH 5I15H 3QJFA 1ULVA 3QHZH 5FAAA 4V1DD 1NGYA 1C5DB 1Z5LA 1JJUA 3RGHA 4EIGB 4KJPC 2X7LB 4UDUB 4NT6B 4PRBA 1XT5A 4XPFH 5JIHA 2CDGA 3SKJH 5H94A 3DRTA 1G9NH 3PUCA 2APWA 3UTZA 5IVXE 4WEUD 4JFEE 4OAWA 4P5KB 5I76A 3QDHA 1QFWL 1A21A 4X9BA 1BZ9A 3KAAA 1SJVA 1ZWIB 5DJZA 1XEDA 1UCTA 1YUHA 2IQ9L 5DD5H 4BZ2L 4L4VD 5DTFA 3I02A 2XWTB 1WFUA 3QIBD 4YNYA 1KTLB 3BDBA 2R0ZL 3SDCD 2HLFD 2C3XA 2J4WL 1F4YH 4Z7OE 3EFDH 4QOKD 1WZMA 1OAKH 2NPLX 3QHFH 4Y8DC 3S36X 3T3PE 4JHWL 1RZJH 4BQBA 4OZGF 2I25N 3GSQA 1EHLL 3FQRB 4NPYB 8FABB 1YEFL 4G8EA 2FH6A 3CH1A 3MLTB 3V52H 1DQLL 1UCBH 3D85D 1J05A 4RGOH 3ARDD 4DGIL 1JL8A 3BPNC 3D25B 5CILH 4J3XA 4M7LT 1A64A 5GISL 1W72H 1TZGL 4G9DA 4G6AD 3VFNA 5EH1A 5T3XL 5TPWH 3TWCH 3ZHDA 2EE6A 1R6VA 2PXYD 3QISA 3D87B 2EXYC 4UIKL 2WMPA 3CLEH 5I17A 4OLVH 4XH2A 5AWNL 2GT9B 4QXUH 4ZXBD 5TH2B 2OJEB 1KB5A 4K23H 5IHUH 4AJ0A 4XNMB 1HH6A 3MFGB 2G75B 3MFFA 2Z0BA 3QG6A 2VDPH 3OAYK 5AD0A 1DL7L 1VERA 5IGXH 2QTEA 3H0TB 3W11C 3R06A 1EAPB 3EOAA 5D7LA 1T20B 4ORZC 1RHHB 3VXTA 5JW5A 4YXKH 2B1HH 2P43B 1EGJL 1U8IA 5HYJE 3SPVB 2AK4E 5GSRA 1OD7A 2M2DA 2KBGA 5SWSD 1E27B 3PQYD 4RX4D 5JNYB 2A74B 5TF0A 2OXHA 5DQJA 4CN6A 4XNXH 3OGOE 5HY9B 3O2DL 3Q3GA 4WHTB 3VFWA 5E1AA 4XBPA 2AV1A 5F9WB 2FBOJ 1QRND 5DEGB 4NZRL 1U93A 4M7JH 1UH3A 2CIKB 2FATH 1KPVA 4NQUA 4OM1L 1WAAF 5F7UA 4TRPH 4MJIA 3GSOB 3G04B 1U8JB 1S9VA 3OKMB 4QRRA 2ZKHH 3OGCB 5A2KH 1N2RB 4OKVB 1TPXC 2XZZA 3SY0B 3QEHB 5D96B 3ZKMD 1GL4B 2J88L 3EO1B 4OGYH 3OHXA 1PQZB 4JO3L 4NUJA 4NKMA 4MQ7A 5EU6E 1B6UA 4WUUE 1I3RB 3O3BA 2VDRL 4G3YH 4F15C 4I18B 5JUEL 4JLRB 3QXDB 1OGAD 2YEZA 2VQ1A 4FQCL 3EYQD 4L3EA 3HE7C 1FCCA 1NC4D 2GJZA 5D2LF 1FZOB 1XZ0A 4WFFE 4Z78B 4H1LB 1CXFA 3BPCB 1BOGB 1F13A 5TQ0L 3AXLA 2Z8SA 2AABL 1J1OH 4OD1H 1ZA3A 1PKQB 5TE6H 4KDVA 3D0VA 5DYOB 3C60D 3IJSB 1AD0B 1GIGL 3QR2A 3EYOA 3LKQA 4J3UA 4AENA 5ISZB 1PG7W 3VRLE 3G08A 4HWNA 4XPHL 3UTPD 1W72B 3CX5J 3VXME 4LPWA 5DZNA 2FX9L 4G9FE 4KTDH 4RGMB 2D7TL 3Q6FB 3U7YH 4TUJB 5EORL 1SY6A 5HHXH 4CU8A 1JGUH 5LBSL 4JN1H 3UYRL 5GS3A 1OSZA 3QO1A 1OHQA 1RIHH 1LVEA 3KPOA 4XB8A 1UXWA 1A4KA 3QFJA 3MZGB 2ZOKA 1UACL 3BMWA 4Y5VC 1ZT1B 3O3EA 1L6ZA 3L3DB 5CSZA 1YNKH 1SJHB 5ID0A 4ODWB 4ETYA 3EO9H 4OQTA 4QHNA 4I0PA 4GMTH 1TCRB 4OZFA 1MOEA 1CXHA 3MR9A 3LRGA 4N8CL 1RV6X 1K5NB 3FB7B 5JPMA 2C3GA 5JTWA 4LSVL 1P4BL 5E8NB 3UPCA 5DVMA 4WHYG 2VISA 5HDOA 5IW6A 2FX7H 1R3HB 4Q9BA 3NPSB 3OAUL 4LP4A 4GAFB 3KJ6L 4YXLL 2EZ0C 4LSRH 4FABH 5IFJB 4YHNA 3MXVL 1QSED 3VFMA 4G6JH 5KVEL 2APTA 4O9HL 5CBEA 4PLKC 3QIUB 4ELMF 2EH7L 3REWB 3VGAC 4A6YH 4ONGH 1I9JL 2NNAA 2H32H 2UWEA 1S78D 4L9LC 2OLDA 1PGRB 5C0JB 4FQHA 4NRXB 3ZT7A 2AI0H 3A6OA 3KR3H 5I66A 2RBLA 4E0RB 4MZ3A 3RKDC 5FKAB 5GJSL 3WXWH 3VI4F 4UQ2B 3W0WD 2NW2A 3OKDB 4X4YB 1NANI 1AXTL 2OL3A 5KW9L 2E8ZA 2BY0A 2A9NH 1T1ZA 2HVKB 1N26A 3FFCE 5I8EB 1J8HB 1NCNA 4CMMB 4NQSB 3SO3C 4PJHF 3VXOB 1LE9A 1PY9A 1YECH 2I5YL 4XNZB 1IM9A 1INEL 4JO1H 4NQED 3P4NB 1EZVX 3BGAA 5C0NC 4Y4HB 3SOBH 3HI6L 5C09A 1U8NB 4AIZA 1KFAL 4APQB 1LHZA 3U2SB 4LLMA 1I1RA 2BFVL 5FF6B 2VLJA 1NC2A 3RWIB 4KZDH 3NFPA 2SEBA 4HKBA 2MHAB 2A38A 1VADB 2KQMA 4NO3A 4Q0XL 1ZEAH 3ARYA 3LPFA 3GUTB 2BY3A 3IT8D 4PP1D 1BLNB 4FMFA 1EERB 5CUSL 4PB0L 1W8NA 1AFVH 3FT2B 4BFIB 1FAIH 1P9MA 4M9OA 2X1PA 1QSFE 3LKPA 2VITA 4Y4FA 2Y5TA 4BYHA 1KBGH 2MOVA 2IADA 4F58H 1FGNL 2C1OA 2DQDH 4LLDA 4M1GH 1Y0LA 5EA0H 1GGBH 1Q9WA 5TJWK 1CGSL 3E2HC 4D0DA 2XZCH 2NY5L 1L7TL 1CICD 3TT3L 3Q1SH 3MV11 5LAXA 2NLJB 3MNZA 1FO0H 3LV3B 5D4QA 5C0IA 2OQJB 5GGSA 2ZOLB 1OTTC 1KIPA 2LABA 3DSFH 1AGBB 1ZVYA 35C8L 2HJKB 3ARVA 3MA7A 4U1HA 5I1DB 1AY1L 1MQ8A 3SJVD 4A6YB 4F7PA 3K2UH 2H32B 3MODL 5FM5M 4UUJB 2R29L 4YC2B 4P2QB 2ARJB 1U8QB 4H20L 4JFDB 5B3JE 3O3AB 4MA3A 4X4XA 3PWJB 4U1SA 5LGJA 5L88L 4L1HA 3UC0H 3MRBB 4XPAL 1FFRA 3OZ9H 3S37L 3UO1L 5GZNC 4OB5L 4L4TA 1KNOA 5LQBH 3I50L 4CMHC 4GKNA 3MV01 5JDSA 4EI5C 1G7LB 1WWAX 3F7VB 5B8CB 1Z0NA 5E8OA 4G8GD 3P4OA 4A2LA 2BVEA 5C8JA 5IP4A 4GKZB 4FQIL 3IRPX 3IKCB 4YO0A 5HYEA 2MFNA 1RFDL 1T83A 2A0LC 4LBEA 5SWZD 3SE8L 4XWOC 2X1OA 4UT7H 5DEFA 4UU9A 3QXAA 1J0JA 5IB3A 4NC2B 2E6JA 3QEQB 4HV8B 3REVB 2FSEB 3EJJX 3PGCA 2C7UA 1RUKH 2NTFB 5IK3B 5DK0B 2R8SH 1UB5A 2H1PH 5HHOB 1RUQH 2R2BA 5D9SA 1E6JL 5C0CD 1CFVH 2HFFA 2XV6B 5KSAD 2C4FT 4O2CB 2VUYA 4KVCH 1DLHB 4FG6C 3P3YA 1Q9OA 1AXIB 4OCXL 4HD9A 4GG8A 2DI9A 1S7QA 5KSUB 4XXDB 1L7IH 2XPGA 1AI1H 1IM3A 4XWGH 4LGRB 3DV4A 5FO7B 3QUMA 2VR5A 5KS9F 4DWHA 1HHIB 2ESVD 3L3OA 3LHPH 3NBNA 3V0VA 1DUYB 4JDTL 4HC1L 5FYKL 4PRHB 3Q6GL 3FTGB 3FQWA 4FOMA 2ZSWB 1INDH 2OJZL 1OARH 3DVFA 2XNAA 4WU5A 5H37G 2HFEA 1P6AB 5DJXA 5J11B 3HCVA 4KK6C 2Z31A 3FQXB 1X5AA 1BQHA 3JUYA 4ODUB 1F4HA 5F97E 2D7OA 3L7EB 3MV9B 3PP4H 1I1AB 1JRHI 3CFEA 5ENWB 4JM4L 5D71H 3G6JA 4H26A 3UAJD 4DN3L 1C16B 4AH2A 25C8H 1T22B 4DUWA 1KN4H 1GOFA 3GDBA 2P24B 4P2RD 4XRCA 4FZEH 3FQUB 4LAQL 2CK0H 3IDIA 2Q87A 5FECA 4JY6B 4HK3J 2EKSA 3BX7C 1X5GA 1C1EH 2OTWB 2NTSP 2ZWLT 5HD8D 3ARPA 5DJCB 5DJ2B 4U7SA 2AEQL 3MREB 3MRCB 2KKQA 4PRPB 1JF6A 2X70A 1TXKA 3WXVH 3BIKB 1YY8B 4NN5B 1NFDA 3BGFB 1G7MA 1A1NB 5E6IA 3IGAB 4MCYB 2APXA 1P84J 1RUMH 2VXUL 5D7JC 4GG6B 3FN3A 4CNIB 4Y4KB 3DI2B 4HT1L 4Y1AD 5C08E 5T3ZL 2BNUA 3HNTH 4LK4A 3RNQA 1WT5C 3ZTJG 3FT4B 4K55A 3P77A 1F90H 3L3JA 5F9OL 1FYTE 3MYJA 5GGTH 1LP9A 5LG1A 3VI3F 1MHHB 4U6XB 2D31B 3IDMB 4ISVB 4Y16D 2HT3D 2FJFA 3VFGL 1FORL 5JHDE 4ONHB 1E4KC 3AMLA 4LVOB 2DQGH 5J0BA 4HCRH 3VDAA 2OK0H 3U0TB 3UBXA 1MF2L 2ITDA 1TVHA 5CEZD 5IFHH 2A83B 2F54B 2ICEB 2DMKA 4QRSA 1MHEB 2Z8WC 4HFWA 1LD9A 5BJTA 4H5SB 5FO9A 1I9IL 3WHXB 4HIHA 3SGKC 4FNLH 5AUMA 4BH8A 2BRRH 1MIMH 1VEPA 1JPFA 4AIXA 3LEXA 1E28B 5E5UB 1WZ1L 1Q38A 3ZL4L 2QADD 4OLWL 1RAMA 5F6IC 1JI2A 2XN9D 1DQJA 3VH8G 2BCKB 1EFXB 3WHE0 1D5MB 3IAGC 4IRSA 1Y6MR 1IGML 3GFUA 3ZYIA 4HKZB 1XF1A 1U3JA 1DVFB 3ARFB 2ADFH 3LKOA 4U6YA 3SHSA 3S9DB 1IQWL 3O6ML 2H8PB 3D3VE 4ZD3L 3HC4H 2Q76B 4ZFFA 3IS0X 2R0LL 4YFLI 1KJ3L 4KJWD 4MXWH 5JXEC 4H8WH 3UBXG 2F53A 3QDMA 1UM4H 3MV7B 3ZYJA 3L5XH 2OZ4A 4JPIA 4O02H 4K3HA 3EYVB 2CUMA 3QHTC 4M5YL 5DJ8A 4Z0XA 5MP6H 3LPGA 1N5YL 4KMQA 4PJXB 1ORSA 2GJ6D 4XCNA 5E99H 4P23D 5GGQH 3OQ3B 4BFEA 3W39B 1IKFL 4RSVA 4FQ1L 1AQKL 1MJ7L 4NZDA 4ZS7H 3PHQA 1ADQL 1D5IH 2BNQD 1KCLA 2J12B 2DD8L 1N0LA 4PGZA 4X7SL 4JRWA 3RFZC 4MQSB 3RY5A 4NQCD 5EU3B 4IDJH 4LVHC 1K4CA 4JDVB 4PJ8C 2AK1L 3ULUH 1OPGL 4JFPB 1S5HB 1F42A 1UVQB 4HWZB 3VXUB 4F57H 3IU4H 3TO2A 3BAEL 4QT5A 1C5DA 1GXEA 3T3ME 2X1QA 1PKOA 4K8RL 4QGYA 3K4ZA 3HC3H 1FG2B 4UDUA 1H9VA 5EZOH 3SKMB 1FZMB 4NT6A 2W9LA 5GS1C 3BGMA 2CRMA 3BDYL 2C4FU 4NDMB 1UJ3B 3MLZL 3BN9D 2ADJA 4KV5E 3P4LA 4P5KA 1NAKH 4FQXC 1Q1JH 4J6RH 4LCWB 4XVUC 1FQ9C 1RQ5A 2X4NA 5DC4B 1ZWIA 3DURA 3I6GB 1QLFB 4JKLA 5DMYA 3BP7B 2F19H 3O6LL 4K3DL 5AAWA 4JRXB 2V5TA 4OSUH 1BEYL 3GGWB 4KMTL 3LB6D 2RHEA 4RFOL 2XKUA 4JPWL 1GSMA 4Z76B 2BERA 3ZKND 1A6TB 2OR8A 3FQRA 2EDJA 2XQBH 8FABA 4KPHL 1TTGA 4NKDB 1R24B 1TDQA 1R5VB 2IQAB 3KPNB 3DLQR 1JV5A 3UBXI 3D25A 1YNLH 3OSKA 5J89A 5FYJL 3TN0B 2VDKL 1M7IB 4H88H 2DYPB 3EOTL 3VFSB 1T0PB 5AYUL 4Z7VF 4UT9L 5H37H 4HZAA 3NABL 3L7FB 4YHLH 1P7QA 3P0GB 1G7PB 1KLGA 2UZIH 3CXDH 5TH2A 2E9JA 2OJEA 5IF0B 2C3WA 2R9HC 3CZFA 3GJFA 2FIKB 4ACPA 3TVMC 1URLA 2DBLL 3H0TA 1AR1C 3AUVA 1MEXH 1EAPA 2D7NA 2DIJA 3A6BH 3TBVA 3DYPA 1UC6A 2VLKE 3PP3H 5TGBA 5JXAL 1DBAL 3T77B 1S5IL 2DKSA 4HS6B 4UQ3B 3RJQB 3KLHC 1BFSA 4TULH 4KKBC 5HI5C 3UMTA 4U3CA 1CZ8L 1YEJL 4Y4KD 5C07B 3MO1B 4JFOB 5K33A 2QBWA 3O4LB 3ZKQD 1RUPL 4NSKB 5SWQA 2D2OA 2CLVB 5B3NA 2D9QB 4KMLB 3S8WA 5DEGA 2GK0B 3T0DA 4Z6AT 5KG9B 3GKZA 4P9HH 1E4WH 1AE6H 4WEMB 3MRFB 5I0DA 1U8JA 3OB0H 1DQMH 4C59B 5BZDA 1OAQH 3OGCA 2ZUXA 1N2RA 4OKVA 1NUDA 3BE1H 5E8PB 3QUXB 2VLME 1NMCB 3EO1A 3OKEA 4IRJC 4U6VL 3C9NA 5BS0E 1PQZA 2VLRD 4GAGL 4RRPG 1NL0L 4KUZL 5H8DA 3HE6C 3RWFB 4I18A 4JLRA 1FG9C 2ILLA 1YDPA 3QXDA 4MJ6A 1DBBL 3CFKA 1YPZE 1SY6L 2BHZA 4MDJA 4P5TB 1EFXD 2HFTA 4NQDA 1G7JB 1V7ML 3B4NA 5KANI 1IGFL 4H1LA 1X44A 2DQJH 1LK3H 2AJUH 1DVFD 1HIMH 2G60H 4U05A 1PKQA 2HKFH 1U8PA 5DYOA 3BHBB 1ONQA 3IJSA 3GMRB 1AD0A 3WJJA 4GLRH 2NZIA 5ISZA 1MELA 1MRDH 4OQTL 3RIAF 2DICA 1SBSH 2GCYB 1W72A 3ZYOA 1P4IH 3MRIB 3CSBA 5GQBA 3Q6FA 4U1JB 2Y5EA 4Z0BH 5DRWA 2NCMA 3P11L 3KPRB 3X12B 1F5WA 1KSRA 1YJDH 4U4BA 1EEQA 3B9KC 3WFHA 3IFNL 4P46C 3NTCH 1HKFA 2F5AH 3BP5B 5KSBA 3BT2L 5SV4A 3BWAA 3VCLB 2VR9A 3QFJD 1BAFH 4DN4L 1ZT1A 1DLFL 3QDJB 1OT2A 1SJHA 4IIQC 4ODWA 1HI6A 3BPNB 5A43C 1FN4B 5C7XH 1J1PH 1LE5A 4QRPB 3WFCH 1ZLWK 5I1EH 1K5NA 1A6PA 4F2MB 5GS2H 2K3TA 5I1JH 2DM2A 3VXUD 2DLGA 5E8NA 3FFDB 3VD3A 2HMIC 3H9YA 3CVHH 3OTTA 1JWMB 2A77H 1QLEH 2AXHA 3DXAE 1NDGB 2OL3L 4WW2B 5EWIL 4J8RA 1CR9H 2DQIL 2EYRA 3RTQC 3MOQA 4LPYA 2JIXB 3UP1A 4PRIB 3QIUA 5E2TL 4KKAC 4JDZA 3REWA 1WBYB 4Y0GA 4XXCC 4HJ0C 3E6FA 3LCYA 3QIWB 1TLKA 2XZQH 4NRXA 4UOW0 1NAMA 4M1DH 1WWBX 1NGQL 1EIBA 2CIIA 1CT8B 4EDXB 4KRNA 3RWCA 4UQ2A 4LMQI 1E4JA 3OKDA 1VENA 4X4YA 1IEHA 4N0YH 2RR3A 5ANMA 5FCUH 4I77H 2HVKA 1LMKA 3ZMRA 4MNQD 1F00I 4PJFA 4NQSA 3L3GA 3OG4B 1G1YA 4NNXA 3T8XB 4NN6C 1EAJA 1U8HA 3ECBB 2YD8A 3LKRB 4I4WB 4AYFA 4Y4HA 2B39A 4NJ9L 5DRXA 4IEFB 4JVPA 3WUWG 3U2SA 5FDWB 1S3KL 2VNCA 4XI5D 2VLJD 1NC2D 4PJ5A 1RURL 4NO0B 3ZTNL 4M93C 3RVTD 4D9LL 1VEMA 3P9MB 1VADA 2HG5A 3BP6B 5IWLA 4OZGE 3GSNB 2LU7A 5E6ZA 5EZLB 3EYUH 5TE7H 3ZDZF 3HE7B 1YEGH 1NKRA 1JUFA 3MRPA 4YE4H 3BWUC 1BLNA 2XKNB 3NCJL 2XRAL 4HMDA 3FRPG 2EEAA 3FT2A 4BFIA 1F6AA 1KT2B 2F8XC 4N9GA 4XAKE 2APVA 3IDJA 4OGAC 1JPTL 1P7KB 5FUCC 1I7TB 4XVTL 4PRAB 1EHXA 5MEPB 2R69H 1F6FB 3B8SA 3WE6A 5ALBH 3TA3C 2ZJSL 3D0LB 3K8MA 3D48R 4WWID 5I1KL 4KDTA 3V5DB 3TPUA 1PG7H 3ULUD 2J8UB 2Y6SD 4HKXB 4NKOB 3S88L 1N4XL 5C07D 1A9BB 1CE6A 3O4LD 2NYYC 4PJAA 3LV3A 1DUZB 4UMGA 2OR9H 2ZOLA 4U1IB 1AGBA 5T1LB 3IAPA 5C92A 2HJKA 1T66C 1YC8A 5I1DA 2FGZA 2DWEA 3QQ3A 1PZUB 5GS0C 3CX5K 4UUJA 3C5ZA 5ADPH 5IVXB 4P2QA 4JFEB 4R96A 2ARJA 3QG7H 3LEVH 1GGCH 4JFDA 4YHKH 3V0WL 3GMNB 1U8KA 1XGRB 4PY8J 1MCLA 1CFQA 1NGPL 1MAMH 4IMLB 3PWJA 5CLWA 1N6QH 2A9MH 5C2BH 1CLYH 4K7PH 3QUXD 3B3IB 2YXFA 3GMPA 5FYKU 1T2JA 1BJ8A 3IFPB 4PTTB 5D6CA 3SCMB 1J0ZA 5I1HL 3JV4B 3OJVC 1ZGLM 3R4DA 1A9EB 1MRCH 5C6TL 4Z7WF 1WAAE 3B6SB 4C57C 2ICWI 5CINL 1EV2E 4ZUTA 4L4TD 5KTEL 5B8CA 2O5ZL 2VN4A 4JO2H 1ZANH 2MCG1 3B9EA 1YN7B 4KKLD 7CGTA 3RQ3A 4Y5XC 3O4OC 3IKCA 1MWAB 4L9LB 3DO3A 3DX7A 3C2AL 3OJDB 1MQKH 3SKNA 4YBLC 2LTQC 3MJ6A 3FN0L 1H15A 2FSEA 3ALWA 3RIAK 4NGHH 3V6ZB 3VXRA 3WIHA 4X7EC 4XBGA 2NTFA 1G7HA 1OAUL 1OAYH 5FGSA 5D2LE 1KJ2B 4HIEB 5HHOA 3G6DL 2XFXB 3OXRB 1HHGB 2GAZB 2FHFA 4XPBL 5F89B 1SMAA 5HVWA 4KAQH 4YZFF 4N1EA 4R3SB 5IBUG 3H3KA 4O2CA 4WI8A 4YBQD 5DF0A 1WBZB 1DLHA 4OV5A 4UTBH 4G5ZL 4YK4B 5JW3L 3GBML 1FFQA 3S36L 2RFXB 4X5WB 4KGLA 5KSUA 4IRZL 4HUUA 3CH8A 4XNUH 5IB4B 1X4XA 4CN4A 2LFGA 5FM8A 5FO7A 4DW2L 4X83A 5HSFA 2DWDB 2JCCA 2CK2A 3FAXA 3SQBA 4YAQB 5I0ZA 1QFPA 4QRPD 2EO9A 5HYJB 2AK4B 4HQQL 3L3IB 4Z5RA 1ZXQA 4ZUWB 5D1ZC 5I19L 3DUHA 3QI9C 3K7UA 2CO7B 4POUB 1CGTA 3GB7B 5F7NC 5LJYH 1T4KA 4X8JB 3O6FC 5K9JL 3GZKA 5CJXA 3UTOA 4GAJL 3ZHLA 5ICYB 4QTIL 2NY6B 1MIEH 4F7CB 4LKCB 1EVUA 3FQXA 5DD0L 4KK9C 4LIQL 5L2KA 2AEIT 3CMOH 3MNVB 2IAMC 4ODUA 2C4XA 3QPQC 3MV9A 4OZHA 1MFDL 1I1AA 1RSFA 4J3WA 5BVJB 1K4DB 3ARGC 2DMBA 2R4RH 3QEUA 2CDFB 4PV9B 4QCIA 2EO1A 3KYNB 4MSWB 2P8LB 5DK2B 4TOYH 5EU6B 4XPTL 3VXQB 4WUUB 3FQUA 1JGEB 1IAIH 4JY6A 5LGKA 1MI5E 1RD6A 5DJ2A 1NCAL 1B0RA 4PRPA 4ELME 5CCKL 4KROC 4OF7A 1XGTB 2DAVA 3DYMA 4PGDB 2DJ4A 2OR7A 5KZCD 5L2JB 4RISL 4S1SH 1A1NA 4MCYA 1D6EB 1OW0A 1CLZL 4R4BA 4CNIA 4NP4L 4PYHA 3WHE1 4XCEA 2YUZA 3STBA 3U46B 3RP1A 3Q48A 4YHYC 1AO7D 1SJXA 3VI4E 1KGCE 2BHYA 2HKHL 5T1DH 4OJFH 4TQEH 1GC1C 3SE4C 1MHHA 3VXMB 4U6XA 2D31A 3IDMA 4ISVA 4G9FB 5LCVH 3VXSB 3GO1H 3P30L 4M43H 3HMXA 1L0QA 3BKJH 3MACL 2O5YL 5TDNB 3PWPA 4PJHE 4E9LA 3SDYH 1GHFL 2YRLA 4CMHB 4NCC1 4EI5B 4ZUVA 3JWDC 5K9QG 4Q6IC 2FZ3A 1S7VA 4MQTB 1A7RL 1WCBB 4PBVC 2F54A 3JWOC 4HS8H 4H5SA 5C2UB 3WHXA 2NY1C 1Q9KA 4ZO8A 2RCSL 1MJJB 2OZ4L 4PUBH 4GAYB 4XC1H 1N7MH 1E4XI 2X4RB 2WWKO 3TLRA 3DX8B 1KCSH 1TTUA 4Z8FH 2BCKA 4WFGE 1Z3GL 4EI6B 3RZCA 1EPFA 4MWFA 1D5MA 2JK5B 2YPLA 3CDGA 5GS2D 4OUUB 5MEQB 3U82B 1A6AA 2DKUA 3SGDI 2V17H 3NFNB 5JW4R 3ARFA 5D1QA 4LEOB 3NH7H 5CEXB 4PFEA 1UQSB 2H8PA 2BX5A 3BKCL 1ACYL 4LHUB 2Q76A 4IMKC 3T0VA 4AEHL 4E5XB 1FZJB 4DVBB 3LN4B 2WQ8A 1CG9B 2VDOL 2E27L 4FXGA 3FHQA 4BQ9A 3MV7A 2F53D 4JM2D 1RZGB 4WEBH 2VOTA 5SX4I 4RMSA 1GPOL 1QA9B 4KXZI 3DTXB 2V5MA 3CD4A 4LLWB 1VFOA 1JPSH 2MQ0A 1EVTC 3PWNB 1Z9OA 3CSGA 5HVHC 3ULVL 4XMPL 3O6KL 4JVWA 4O4YH 2MTPA 3AY4C 4PGEB 3HZYB 1XR9A 3FFCB 2HA1A 2D9CA 5EU3A 3O8XC 1KB9J 2NY4C 3OB8A 4NZUH 2HTKD 1A0QH 1MREH 1LQSR 4JDVA 1R3JA 3BQUC 5FYJU 5DZLA 5E56A 5SX5H 4K8RC 4LGSB 1S5HA 1UVQA 4R2GC 4E42B 3VMPA 4WIQA 4K3EL 1TVDA 3EYSH 3OV6A 2W65B 2ZCKH 3CC5B 5EBWB 3SKMA 3QCVL 1FZMA 4ZS6C 3MRQB 4YFEA 1BGXL 1NCCL 1UJ3A 2MKWA 1NMAL 3WUWB 3TBSA 3NZ8B 4HZLA 5K9QI 3KS0H 5E2VL 2X4PA 2E5EA 2W9DH 4PV8B 4UB0H 2FYYB 2ATKA 2DM3A 5D7JB 4ZUSB 1QSFB 2BVUA 1PG7X 5ELIA 3QCTL 1A6VH 3I6GA 1QLFA 4HPOL 1ZT7A 2JTDA 3BP7A 3FKUS 3T1FB 4K7FA 1BBDH 4KRPB 1CIUA 3KPSE 2PR4H 2ZCLL 3CSYB 3UTTD 5CD3A 4JFZL 2ED9A 3D9AL 2FL5A 2AK4D 5JZ7C 1OOAA 2B1AH 4Z76A 4LEXL 4KGJA 1AHWA 2NQCA 1H3WM 1P84K 5C3TA 4NKDA 1R24A 3O81A 5IM7A 1HZHL 2IQAA 3QUKB 1X3DA 1E4XH 3DGCR 5KS9E 2D4DA 5J57B 1LEIB 3AB0C 3MCKB 4HUVB 5I18L 4K7PX 3NA9H 2ZG1A 4YWGL 3TN0A 5EZJB 2DYPA 3VFSA 5EOCJ 3D18A 2DMCA 4GW1B 3LS5H 3VMOA 4JFFD 2CH8A 3WV0A 3MBXL 1QBLH 3QNZB 2NX5E 3QHZL 5D70H 1YEHH 3L7FA 3OX8A 2Y72A 4H0HB 3QULA 1P7QD 1JYWA 2HLAA 3HG1E 4X6FB 3HKFA 3IAQA 1T89C 2PCPB 2O26U 2N1KA 1BF8A 1SYSA 1CDIA 2DBJA 3CLFH 3DYOA 1RZ8B 5SX4H 3SKJL 1LO5A 4H0IA 1A1MB 2B4CL 3VW3H 1U8LB 5HGHB 2WINB 2QHRH 4JRYA 3BPLC 5ICXB 4M6AA 1S7TB 4LRIA 1A14L 1YN6B 4U2YA 5DO2D 3MLSH 3TYGH 4J23A 4GW5B 5IVOA 4C56E 5CHNB 2IAND 1F4YL 1H0DA 3SDDD 3EFDL 3UTSA 1KELH 1OAKL 1IL1B 4ZAKC 2GK0A 3VXSD 4OCSH 2IBGA 2DQTL 3MRFA 5H2BB 2IMMA 5JDJA 1VPOH 3L3HA 4HDIB 1OQOA 1LNUA 4KJYB 4LVHB 4PJ8B 1J12A 5E8PA 4HHAA 4GMSH 5D1XA 4RGOL 5FYLD 3WDJA 3VI3E 4L1DA 3RNKB 3KYOB 3CGTA 5C0BA 1LWRA 1NEZB 1SYVA 1T03H 1W72L 3C6LC 1QR1A 3A67L 1RK0B 5IV2B 1MNUH 3DGGA 5E8EB 3MGAA 3D39E 4P5TA 5HJ3B 2UWEF 2QSCH 3CLEL 4NQDD 4MQXD 2E7HA 2PO6C 2BP3A 4V1DE 5A3IC 4Z95H 4K07A 4K23L 3VRIA 5JLZB 1FBIH 4FQXB 3VGDA 3OPZH 3VWJB 5DDHB 5D8JL 3TF7C 4QHMB 5DURD 3TO4B 2GCYA 4XBEH 4JB9H 1KCUH 3MRIA 1A7BA 3BIAX 2F15A 4U1JA 1RZKH 1JHTA 2YKLL 3MOAH 1K6QH 4HLJA 4ENEC 1I7RB 3S6CA 3KPRA 1DE4B 2WUBL 4Y88A 4XNXL 1TQCC 2BVQB 3JWNC 5E4IA 4X6EA 3WFDH 1GGYA 4KC3B 4L4VE 1EHAA 4HPYH 5I8OH 4NHUB 5CD5D 2FDBP 3QZWB 3BO8A 3VCLA 2F5BH 4M7JL 3CDYA 1LDPL 3QDJA 4OLZL 4QOKE 4C83A 4K94H 2OTUB 1U3HC 4TRPL 2IGFH 4S1DC 3WEXA 4L8CA 3L6FB 4FFWC 1UM6L 1NKOA 1FYHB 2R1YA 4HKJB 1BD2A 2AQ3A 5C08B 2H41A 3MJ7A 4OGYL 1AR2A 1NAML 2VDQH 3RL2B 1BQLH 2V5RA 1F58H 1KV3A 3FFDA 1FYTB 1N3NB 5EUOF 4QNPF 4L8SC 5GRYA 3MLWH 1LGVA 2OM5A 4WY7L 3O9WC 5B39G 4XTRC 1KG0B 4DOHE 4NWTH 5CP3H 1WVZA 4JKMA 4MVBC 4W68A 1HHKA 2QLVB 3P0YL 2OI9C 3LPWA 5L8KB 4AZ8A 2JIXA 1I8MB 1ES0A 1C5BH 2CUHA 4EUPA 3ULUF 4OD1L 1J1OL 2JJTC 2VO5A 3HPJA 5GHWH 3QIWA 1HQRA 4AG4H 3DPBA 2IBBA 4UIMA 3TP4A 3QXVA 1B0WA 2V7NB 4LKXB 5CJQH 2NY0C 4KRPD 1J18A 4O51A 2QKIB 1OAZL 1L0XA 4HUXB 3U7YL 3LDBC 5JR1L 3MJ8A 4CVXA 4JN1L 1U95B 5SWSE 3ZE2F 3VWKD 3PQYE 1A5FH 4WO4B 5IB5A 5JIPA 1J5OL 2PETA 1UA6H 3ECBA 4HEPG 3LKRA 2L7JA 3D3VB 4NZTH 1QRNE 2DIBA 1ZE3C 3D69A 5FDWA 4PR5B 2I07B 5E2JA 3F62A 4NO0A 2VDNH 2YPKA 3HE6B 4PJ5D 1IZJA 3P9MA 2IPTL 1HXYB 2JJVA 2QL1A 1G0YR 3IXAB 3BP6A 5DJAB 3GSNA 5EZLA 4MA7L 3VG0L 3HE7A 5BCAA 1T21B 4K71C 5IT2H 3V4VH 2FX7L 3PGDB 3LQMA 2GY7B 3V5HB 4LSRL 1DBMH 3NCCB 3EHBD 1UXSA 4G6JL 1KT2A 2DJUA 4OZ4B 3QWRD 4I13B 1OGAE 4PJEA 1NUGA 4OF3A 3RDTD 1I7TA 3MQIA 4RIRB 1P53A 4Q9RH 4A6YL 4PJ9B 5JA9A 4ONGL 4Z7VE 4JY4B 5BRZB 1VFUA 1XF4A 3F7RA 4Q9QH 1CDYA 3MOBH 3V5DA 3CJJA 3KR3L 2J8UA 4HKXA 2K7PA 1LDSA 4YFLF 1PLGH 3PL6C 2Q3ZA 3WXWL 3U1SH 3B9KB 4P46B 1T80A 3UTPE 3EKCA 3RBSA 3OAYH 1BWWA 4U1IA 1A6ZA 3THMH 5T1LA 3BH8A 2EC9T 4HX1B 4Y5VA 2BDNL 2ENYA 1OTSD 3P0VH 2ORBH 3BKYL 1T6VN 2AKRB 1S9YB 3UZEA 4HS3B 5IVXA 1WFTA 1OP9A 4HMCA 3LH2L 4HAGA 2J6EA 4I3GA 5EU7C 2ZUYA 3RZWA 3TEUA 1N64H 1BF2A 4M61B 1I9RH 3FAWA 5AEAA 5GGSY 4OM0H 4PTTA 4M1CD 3WIHL 4NBZB 3ROOB 4N90D 3AREC 3JV4A 2ADIA 1RZIA 3QAZC 3IDYC 4KJQD 4AL8H 1SEQH 4DGYH 4XGZB 5CJ5A 5FKPA 3AAZB 1NCWH 5TQ2H 4XHJD 1ZHBB 5FO8B 5ITFA 1N5AB 1YN7A 1AFVL 3SDCC 5D5MF 5E2WH 3VE0A 3IFOB 2CJUL 1MWAA 4L9LA 1HDMB 3BI9X 1QSEE 1FSKC 2V2WA 3VWJD 4Z7UA 4KDWA 4POZD 3DX6B 1KJVA 5FV1L 4JGMA 1WTGT 3HTLX 5IJVB 2V9TA 4D2NA 3CFBB 5BV7H 3VFTB 1KJ2A 1HCVA 1F8TH 2XZCL 1IE5A 3CFDA 1KEGL 2JKXA 1NFDF 2Y07H 4S2SA 4JKWA 1DFBH 1HHGA 3Q1SL 3BD3A 4WENB 5F89A 2BSRA 5J6GB 4CVZB 4TUKH 4DKFH 1DR9A 2K1MA 4QTHB 2X9YA 3W0WE 1KYOJ 1UEYA 1O7SA 3BKMH 3DSFL 4OFYD 4G6AC 2RFXA 4X5WA 2EKJA 2DIAA 1LP9F 1S9XB 4HK0B 1KXTB 1AKJD 3K2UL 1BVLB 5ESVB 1QYGL 2VLKB 1UWXK 3L5WB 5E4EB 4ZXBC 3W2DH 3LN5A 4XVJH 4M93B 5HYJA 4JAMB 4NQEE 4ZTPL 5C08D 3RWGA 1BMGA 3P9LB 1S9WB 5HYIA 4J3OC 3GMQB 2EH8H 2YMXL 1EJ6A 2Z35A 4K2UL 3OZ9L 1G9ML 2VH5L 3BYYA 4FQPA 4BK5A 4NFCA 1WTLA 3RI5F 5JOFB 3ZT5A 5LQBL 1RK1B 1UM5H 2JELL 1NGXB 1LEGB 3LMJL 1FIEA 2FD6H 4F7CA 1F4AA 4KU1A 3U36A 4LKCA 5EPMB 4R26H 5I8KL 3MNVA 4GQ9L 5L2KD 3GMMB 5IG7B 2CKNA 2G2RA 3TA3B 3DX9B 1JF5A 2VIRB 2E7LC 2CDFA 1ZA6B 4PV9A 4MSWA 2P8LA 5BS0B 2IH1B 5EU6A 2HRLA 3DNKA 5K93A 4BELD 4LSPL 4Z77B 4F80A 3INUH 1RUKL 4ZOAA 3TV3H 5HPOA 1WBXA 1I9EA 1RUQL 3HMXL 1YPZB 1OVZA 2ZP0T 2F74B 1F3JA 3ZKMC 1Q72H 3IYLW 3KNBB 2ZPKH 3ARBD 4LOUC 1UGNA 4JM2F 1XGTA 4DZ8B 1RU9L 2GTWB 4RAUA 1U2CA 3ZYZA 5EDXA 1FV1B 2V9QA 3WFZA 5HVFB 1D6EA 4WO4D 4XAWH 5K9OA 1N8ZA 3EGSA 1HINL 4XCFH 4RCAA 3U46A 3EYQC 5I75C 2OYPA 1L7IL 1CFSB 1NCBL 3Q5OA 1AI1L 4XWGL 3SKOB 2V6HA 1AGCB 4MNHA 1WICA 2H26A 3SJVE 3LHPL 2WIIB 4G9FA 5BV7B 3VMNA 3RWDB 1L9MA 5F1NB 2XXMB 1VB9A 4JFXA 3WFEL 1JZ7A 5GXBB 4EI5A 1INDL 1TZIB 5B4MD 4ZG1A 2DDQL 1SM3H 1WCBA 3EDKA 4PJ7F 4Y5XB 3O4OB 4B5EA 4OCRL 4MAYB 5DRNB 4LVNC 4QXGL 2EE3A 3J7HA 5T33H 3TC9A 2FECL 1I7UB 32C2B 2R2HB 2VTFA 4PJ9D 4G8GE 1MJJA 2LTQB 3DMMC 3PP4L 4U0RB 5B21A 4GAYA 5BRZD 3ZDZE 5D71L 2BXZA 2X4RA 3DX8A 4KVNH 4HWBH 1MCPL 25C8L 5IW1B 1KN4L 1FNLA 5MEQA 1UH2A 2YPLD 1T2QL 1T5WB 4FZEL 5DMIH 5SWZE 2CK0L 2V9RA 3F12B 4NIKB 2Z92B 3WO4C 1C1EL 4KHXL 3OWEA 3EO0A 5D1QD 2EC9U 3DXAB 5CEXA 4FQLH 3QWOB 2AXGB 1WC7A 4LHUA 1FVDA 4BSWA 2GFBB 2NY2B 3T4YB 4E5XA 1FZJA 4DVBA 1CG9A 4R8WH 1U8OB 1VGKB 5C0CE 2RAMA 5EUKA 1G7IA 2YD7A 1JGVH 1RZGA 4WFEE 4GRWF 1DANT 5B39B 1A7NL 4ESKA 3HNTL 1CVRA 4S0TD 4NYLB 3F8UB 2QQLH 3ULVC 1QA9A 3DTXA 2XTJD 4LLWA 6FABH 2KQNA 3PWNA 2A6DB 1XGPB 3PWUA 1XGUA 3MBEB 5I9QC 2ESVE 1ETZB 4LDOB 1EO5A 1JPST 3WD5L 4PGEA 4R9HA 1AJ7H 3AU1B 3BUYA 3HZYA 3FFCA 4JFQB 5FOBA 4JR9H 2OK0L 4TUOB 4M6MH 4NM8L 1L6XA 3N85L 4RMUA 1FP5A 3BIBX 1QRKA 5IFHL 3PJSB 2IAMB 2W60B 1AGEB 2D0GA 5IFAH 1CBVL 3MRRA 1SJEA 3ARGB 4QYOA 4FNLL 3LEYH 3PHSA 1RMFL 5JW4M 4Z7WE 1I3VA 4G43B 2N56A 3CC5A 5EBWA 4YX2H 3MRQA 2VJXA 1F4XH 1FNEA 4OZGB 2APBA 3GSRB 4EQ2A 1JHLL 2X2YA 1JNNL 4GBXD 4KROB 1DBJL 4P2RE 1ZSDB 1DSFH 4PJBA 3X3FH 3S35H 3K2MC 5D7JA 3VXPB 2AJSH 4ZUSA 4ZOBA 4PLJD 1XF5A 1WT5A 4H8WL 3QRGH 2R2CA 3UZVB 5T1KB 4PP1C 3L5XL 3MRMA 1LEKB 2UUDK 5D93C 4W4OC 4G6FB 4P99A 4YZFE 1E4KA 1FFPB 4Y1AE 1A3RH 5E99L 4D3CL 5GGQL 5EFIA 1L0YA 4OFVA 4TNWK 4XNYL 5ID1B 3OKLA 4ZFZB 3V8CA 3IFLH 3MC0A 4XP9H 2DQUL 2AJXL 3RI5K 5C6PB 2XWBB 1CE1L 2B8OT 3QUKA 2EDWA 4I48A 5F21B 1K2DB 2WP3O 4Z7QF 4TVSa 3GBLA 4IDJL 3U0WH 1LEIA 3MCKA 4HUVA 1FNSL 1HHHB 3SGKA 4LCYB 4L3AA 4MLIA 5CKAA 5EZJA 5DJ0B 1T0MB 3TIEB 4GW1A 2FJHB 3T2PA 4LL9A 4CJ0A 5CEZE 5F9WC 1NDMA 3TNMB 4E41D 2VE6B 4JPVL 5E7FA 3QA3B 4GXUN 4OKDA 4ZO7A 1CFNA 1R3IL 4R7NB 5HVGB 2YRZA 1G9NC 3N9GH 1C12B 4WHDA 4M6NL 2CLZA 3BFOA 5L6YL 3TIDB 3WS3B 3U6RB 2XN9E 5D96C 1A1MA 4G80B 3SDAD 4DK6A 5I1GH 5ICXA 3B5HA 3QDGE 4U3HA 3FHAA 4JRYD 1S7TA 1RIVH 5JXEA 1NAKL 5IB2B 1Q1JL 1DEDA 3HNVL 4AQOA 4TTDD 2F19L 3IDUA 5KSBF 1RZJC 1BWMA 2XZAH 3GRWH 2YZ1A 4P4RB 5D2LB 1IL1A 1QD0A 3UPRA 5DUMH 1XAUA 1J0KA 1X5XA 2WIMA 5H2BA 2A6IB 2X89A 1BM3L 3RHWF 5JO5A 2GJ6E 4HDIA 4EN3D 5FUZL 3B43A 3IDXH 4KJYA 4S1QH 5DUBB 4PJ8A 4LARH 5BOPA 3CXHJ 5DMKB 4RGMC 2EDHA 5D1XD 3WIFB 4GRLD 3OMZA 1Q9LB 2BNQE 4R2GB 1FH5H 3FOLA 3QYCA 1NEZA 1DEEB 5CBAB 5KSAC 4H88L 4NQCE 3S5LA 4QRTB 3WL9B 1ZHNA 1RK0A 4PGBB 1B2WL 4N8PA 1LO2H 4RWHA 4X6DA 2HRPL 2V5YA 5HJ3A 4M7LH 1J0IA 1KB9K 3BZ4B 4AIOA 2UZIL 1IGJB 3CXDL 1CL7I 1FFNB 5B38B 5KSVB 3MMEA 1CIDA 3A6CH 43C9B 5E8DH 1QLRA 4WI2A 4FQXA 1EEYB 4JFHD 2Q6WA 2FB4H 5DDHA 1OP5K 1M1SA 2NY2D 1MEXL 4NWUL 4QHMA 5EOQH 1Q0XL 1RJLB 4U1LB 4P3DB 4TVPH 1RZFH 4IOFD 2NY3D 4YDIH 1JK8B 4TULL 3NPSC 4DQOH 1TJGH 3BP4B 3H8NA 5CS7A 2DQHH 2PW1B 1JBJA 4PJFF 3QQ9D 2EDEA 1I7RA 4P2OD 4N0CD 1EEZB 1F4WH 1MLBA 1ZLSL 3OF6D 3VFOB 1MI5B 5F7DB 4K9EH 3MBED 4CDGC 4ELMB 3UAJC 5A16B 2VL5B 1AE6L 2OTUA 4O5LH 3TJEH 1FHGA 4OGXH 3LIZH 2RGSA 1JN6B 3FB8B 1KIRB 4G42A 1OAQL 2XWJB 4QLRA 3BE1L 4PJCA 1S7SB 4N5ED 1A2YB 2H2PD 2Z91A 5CWSB 5E6YA 1M4KA 3HN3A 1FDLH 3IS1X 2E8YA 4W6XB 3MLUL 1B3JA 4HFUH 5D72L 4YDLB 1GAFL 2EXYD 1KJMB 3GJFK 3G5XB 1KG0A 5JHDA 2VDML 4XP5L 2RQ8A 4JKPH 3R8BB 5HHVH 3BZEB 4PJHB 5KVDH 3U9PH 4GSDL 1EGJA 3TVMA 2FR4A 4APQC 5ADOL 2AJUL 5C0RH 2G60L 1HIML 4Y16C 3L1OL 2GUOB 2HT3C 3RRQA 1YMMD 2F58L 1DBKH 3I6LD 5LKNA 5ESQB 3T09A 3O2DA 4CBPA 4PJAF 3QFDA 2V7NA 1BBJA 4FXKB 2CD0A 2YD6A 4XCCH 1P4IL 2QKIA 4RNRB 3IVKB 1I3GH 5HHNA 2YUWA 3GSNL 5DGQA 5FHAH 2GK2A 2WK2A 2J8OA 1GOHA 1YYML 4WCYL 3ELAT 3NTCL 1S8DB 2ID5A 3EFFB 1Z6JT 2FEEL 2YC1B 5IQ7L 3CSPA 2QADC 1BAFL 4G8IB 5DHVB 1JZ2A 1KEML 3D3VA 2P5ED 1Y18A 2R0WH 5EZIL 2W1NA 3QUZD 5C9KA 4IRJA 4U1NB 3MUGB 5C7XL 1J1PL 1WGOA 5DK3A 5BW7C 4J7RA 4ODBD 5T5FH 4LLQB 3IETB 3HE6A 3CVIH 1CL7H 4MD4A 1LK2B 4QRRE 3PWVA 5FFLA 5DJAA 3HMWL 1I3UA 4JQXC 12E8H 3WKMH 3AC0A 4CADB 4KJWC 5I1CL 2VLRE 3PGDA 1MFBL 5HDQL 1QLEL 1LO4H 2PO6B 2YK1H 2A6JB 1QFWI 4OZ4A 1OSPL 1FJ1B 5GRJL 4HWEH 4I2XA 3OXSB 4L3EE 1B0GB 4P23C 3TJHD 3RAJH 1MCIA 3PGFH 1U58B 4LLVA 1P69B 3WIIL 5J13C 4M1DL 3H9SA 1MPAH 1V7NL 1ZS8A 3LZFH 4ZPVB 1WFNA 1TQCB 3B9KA 4P46A 1A4JA 4PP2B 4X7TB 4LCIL 3RPIA 4DZBB 3HR6A 4OD3H 4YHIB 1HOCB 3S35X 2P4AB 1WISA 4OCMC 4RQQA 1G6RH 5EOTB 2JCCF 2EYTB 3KXFD 1U3HB 4IIQA 4U6HB 2HWZL 4HS3A 3S34L 4QHUA 3T0ED 4F33B 3LSOA 5GSVB 1E6OH 1MWAL 4M61A 4ERSL 2R4SL 3E0GA 3QFJE 1OGTA 2DTMH 3ROOA 2YXMA 1HN1A 4L8SB 3ZT6A 1KJ2L 4BH7B 4DVRH 3N1GC 3EYUL 3H7BA 5TE7L 3CFCL 4XGZA 5HI3D 3RTQA 4X4ME 3IXTB 4MD5B 3AAZA 1ZT4B 4OZHF 5FO8A 1ZHBA 2E9IA 4UINH 1P1ZA 4PLKD 4OIAA 3IFOA 5C70A 1CCZA 4R90H 4UT6L 4XXCA 4ZMAT 4HK3N 4P5MA 3LB6C 5I8CB 2IG2H 2P1YA 5DSCA 4DUXA 5KS9B 4BSVB 3QSKB 3ZKNC 4WV1B 1OAXH 2AJZB 5EBLA 1JF1A 4J12A 5EN2A 1CDHA 5IJVA 5C0EA 4ZFOB 4AEIH 2NY0B 4LPXA 3G5YB 2A2QT 3VFTA 4F9LC 3C6SB 4HH9B 2UWEE 3LDBB 1NCDH 4MB3A 4QF1B 2NX5B 4Y5YB 2Q7YB 1FIGH 5J11C 5J6GA 1IILE 1YMHB 5EO1B 1A7QL 1NEUA 4WW1B 3LAFA 3HG1B 1DCLA 1R3LB 3CPLB 4Y19A 5DI8B 4S1RL 4KUCD 4QXTB 4HIXL 8CGTA 4JJHA 5HGAB 4WTZA 15C8L 4L29A 4ZPTA 1S9XA 1KOAA 3TBWA 2UV3A 3KYMA 1BVLA 5ADPL 5MERA 3QG7L 4MNQE 2VLKA 4EBQH 2VXVH 4YHKL 4JZJC 4AMKH 4PJGF 1XGQA 1D9KB 1N6QL 2V2XB 3MV8A 3PG2A 3P9LA 1S9WA 1U2HA 5C0FB 1J8KA 4C56B 5HDBF 3U4EB 1WWWX 4ZSOE 4NKQB 1PBYA 2VB5A 1HKLL 3GBNH 3BGFC 1MRCL 1MJ8L 4DFHA 4BZ2H 2VLJE 1MFEL 1RK1A 3N0PB 2P48B 4JO2L 4Y4KC 5I16A 3KYKH 1EFQA 1G6RB 3I84A