3HZKB

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
222
Chain Sequence
EVKLVESGGGLVQSGGSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLAFIRNKAKGYTTEYSSSVKGRFTISRDNSQSFLYLQMNTLRAEDSATYYCARDINPGSDGYYDALDYWGQGTSVTVSRAKTTPPSVYPLAPGSNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
molecule tags Immune system
molecule keywords S73-2 Fab (IgG1k) light chain
total genus 39
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2009-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzkB01
4NDMB 1IC5L 1R24B 3IXTA 1UH4A 5EUKA 1DFBL 2NY3B 3MLUL 2NNAB 1UM6L 4U2YA 3TBYA 5I8CB 3TBVB 1SYVA 4N9OB 4O02L 4OCMC 4PYHA 2CDEB 2V6HA 1JHLL 2XY1A 5JPNA 4Y5YC 5INDA 1KEMH 1C7SA 3FO9B 1OWRM 3DSFL 3L6FA 1SM3H 4ORZC 2VN7A 4L29B 3HE6C 4KTYA 4PREB 3QQ4A 3T1WA 1I7RB 5KS9A 5DWUL 5EU4A 2NY2C 1AGFB 3T65A 3KPSD 3RJQB 1P7HL 3DYOA 1T2XA 2Z8VC 4JG0H 5GJSL 5HHVH 2WUCH 1I3GL 5T1KB 3RWIA 4C54A 4NOBA 1U95A 4OCLC 5AZEH 4YGVB 2CKBH 3EJZD 3VWJB 4IIQC 5DUMH 4DW2L 3WFBH 4G7VH 1J87A 1NL0H 2V7HA 2VR9A 4UT7H 1WVZA 1MFBL 4LDOB 3HZVB 3OGOE 1R3LA 3V4VH 1M7XA 3O3DB 4ELKB 1CGYA 5A2KH 3KAAA 3JWOC 4O2EA 3UJTL 3U2SB 2AXGA 3DRTB 4TPRH 3AU1A 3GZKA 3NCMA 2OCFD 2ESVA 1QLRA 5CBAB 1I75A 1T2QH 5JW4M 4LCCB 1GYAA 3SKNB 2CRZA 2XKNB 3VI3E 4WDIA 3RPIA 2MCPH 2ZPKL 3N1GC 4I3RH 5DJ2B 4NQXA 4C57C 2F8VA 1EZVY 4FFVC 1K85A 3RQ3A 2YD2A 5KVGH 4PRHB 3O9WD 2R0KL 3ZYZA 4NWTL 3SE3A 3SBWC 1BVKB 2Y5TB 3WYRA 1QYGL 2FX7H 4CN1A 5TDPA 4L4TA 1XF2B 2CD0A 4BQ8A 4WO4A 4M8QA 3P4NA 4GW1B 4DAGH 1RULH 5FO7B 5DD6B 1J05B 1HHHA 3F7VA 5B4MC 3MUGA 5CSZB 2XRAL 1DZBA 1KB9J 4IJ3C 3FB6B 1T22A 4LARH 1WZKA 4JQXA 3LN4B 4N5UA 5JW5B 1B90A 3HZVA 5AUMA 2H32B 2XZQL 1FRGL 1CFTA 5ACZA 2FB4H 3S35X 5HYEA 4M5ZL 2YRPA 2ZUQB 4MD4A 4NFCA 3I6GB 1PGRB 4DEPB 3UPRB 5T33H 2QEJA 5IHUH 1G0YR 4XP5H 4J3TA 3UBXI 2D7QA 2H1PH 4LHUB 2Q20A 2R15A 1W72B 1AQDB 4RMSA 5CUSL 5CEZE 4Y5XC 4Z7QE 4H5SA 3DX6B 1U9KA 1CGVA 5DSCA 3L7EA 2R9HC 2OR8A 5E94A 1MCWM 1D5MA 3QXDB 2NXYC 2ICEB 1Q9KB 4JFEB 3FQWA 3BUYA 5DJCA 1ZLSH 3RUGB 4LHUG 5GJTL 2NY1B 1NSNL 2X44D 2NY1C 4LP5A 3VRLF 1R5IB 1VADB 2BDNH 5A1AA 2J8UF 3L7FA 4KQ3H 4UOW1 3B9KB 4JREC 3S36H 3NZHL 5I1IL 3NPZB 5DI8A 1OP3H 1PLGL 2YR3A 3RL1A 4N0UE 1P69B 1CS6A 2FCBA 5F72S 2A6DA 4QRUB 2NY5H 2XQBL 3UZQA 1L6ZA 4NQEB 4HWBA 3S8WA 1MNUH 4FFWD 1WEJH 3F7QA 3AREC 5CP3H 3EIFA 2WW8A 2X4RA 4L9LC 4UDUB 2YWZA 4WI5A 2DBLH 2H8PB 3SJVE 3QFJB 1SY6L 3GDBA 3WIIL 4WW1B 4R4FH 4S1QH 1U8QA 1D5MB 1VA9A 2AW2A 3IDGB 1QSED 1QSFD 1IAKB 2FIRT 3E6HB 4QRSB 4DGVH 2I25N 4U6XB 3CFIC 2AKRB 5MEQA 3BAEH 3PHOA 4N8VG 2AEPL 4Z7UE 1U3YA 3UJIL 1Z2KA 3BQUB 4WW2A 3EZJB 5TPWL 2BZDA 4XNYL 3HC3H 1JWMA 4KJYB 1BWMA 4Z7NF 2FZ3B 1M6OB 1CQYA 2AEQL 3QDMB 2FJHB 4LSVH 4CDGC 3LKSB 4E5XA 2NY6B 1K8DB 4U0RC 4U7MA 1GGTA 2R4SH 1HINL 1JI2A 1IAOB 2QJDA 4P5KA 2BRRL 5J8OA 1XR9B 1MRFL 1UWXK 4MJ4A 2A1WH 2BRQA 32C2A 2MOVA 3A6BH 4OGZA 2DQHL 3D85D 2XZAL 5FYLD 4I3SL 4M93C 4PJXA 1U8PA 2PW1A 1U58A 3DBXB 4G8IA 4P5TC 3NACH 1DDHA 1IEAA 3UTTA 3N9GL 4BSWB 4Z7NE 3TP4A 3V7AG 2ZG2A 2Z4QB 3UAJC 5D93C 4Z7UF 5JLZB 1L7TL 5DJXB 4NNPH 1M6OA 2FIKA 3U30C 1YQVH 3WFDH 3WNOA 1Q1JH 5BV7C 1RMFL 5I74C 3LKSA 4Y4KD 5EZOH 1R3HA 4Z76B 1CDGA 3VXRB 5FXCH 1MY7A 3BH8B 3OKKB 4JO4L 4XCFH 1MVUB 3TCLA 43CAB 5D1XD 4KVCL 2DKSA 2E7LA 3QQ3A 4M1CC 3RBGA 4EI5D 3UEZA 1RUMH 2OS7A 4XTRD 1YECL 1J8KA 2CRYA 2EZ0D 5C0AD 2VQ1A 2FJHA 1IEBA 4HKBB 4I4WB 4JM2B 4P4KC 4YDVB 5E00B 3ZKXB 1HXMB 3A6CL 4HZLA 3RPIB 12E8H 1MIEL 1QFWM 2AJUH 3WDJA 5LCVL 3JBG7 3F7YB 2HRPH 4OSUH 2SEBB 3QUXC 4OV6F 4UQ3A 5IHLB 3QEQA 3QHFH 4NSKB 1WBXA 2MFNA 1HDMB 4JKLA 3D69A 3FAWA 4L3EE 3VFNB 1F4WH 3KPSB 3OKYA 1AR1C 5C0IB 4WNQA 5HGDB 4HUNB 1XF3A 2X10A 3H7LA 4DOHE 1VGKA 3TJHD 1FFPB 3HA0A 4ZDHB 3W9DA 1AO7E 3FOMB 4PBVC 2Y07H 4MDIA 1TMCB 2DICA 1CDBA 3G9AB 4GAFB 4URTB 3GNML 4MJ6A 4MMXC 3TVMB 4EQ3A 4WFEE 3VGHA 3PGDB 1MLCA 2B20A 4LLDA 3RNQA 3TO4A 2BJMH 4NT6A 2GY7B 4HZLB 3EZ8A 4JRXE 1ZS8B 3Q0HA 5LG1A 4JLRB 2W9DL 4K7PX 4LLYB 2AJZB 2MMXA 2FDBP 4OTXL 3VFVB 5F6IB 1AQDA 2ZCLL 5IROA 1I8LC 2ED7A 2QSQA 1N26A 3CNKA 3PWPE 1OWWA 5GSVA 3TVMC 5F7UA 3QQ3B 5K9JH 3H42H 1KGCD 3GBMH 3KHQA 3DURA 2X4QB 3HFML 2H26A 4TUJA 5E4EB 1LEKB 4LIQE 3AAZB 4PYGA 5E08L 3MRPB 2L4OA 1BZ9A 5FGBC 3ILQC 1ZTXH 3MJ9H 4X4ZA 1KJVB 4PJXF 3IFPA 3C60A 3RWHA 1NCBH 3NIDE 5HVGB 4P2YA 5F7WC 5J3HD 3VXUD 4MSWA 2WBJD 3MRMA 5J6GA 4E41B 4PLKC 5F88A 1TZIB 1MCBA 3OKEA 5BS0A 1OT1A 1GHFH 5C0BE 2B5IC 4DGYL 1AJ7H 3HZYA 2XRAH 4N9GB 3G08B 3PJSA 2NY7L 3HZMB 1UVQB 3HPLB 3MLWH 4LIQH 5ITBH 3PGFH 1DP0A 4ERSH 1JL8A 2ERJC 3HI1B 2QKIB 3MV7E 3NH7H 4QHMB 5DHVA 1X9QA 4XPGL 3ZDYE 2Q7YA 1IAKA 5F3BA 4RGNE 5D7IF 2CPCA 1I7RA 3QDGE 3C5ZC 4NQDB 1UCBL 3LKNA 3TIDB 3X13A 3C8HA 4HGWB 4DZBA 3D39E 3G5YA 2DRUA 2VDNL 1AKJD 2ICCA 4OFDA 4YPGA 1FN4A 2XFXA 3FN0H 3MLSL 1WWCA 1ZSDA 2GCYB 3OKMB 2P5EA 4B0MM 1T1WB 1YN6B 4ZAKD 2W65B 5H35A 3FT3A 3G5ZA 2W9EH 3CH1A 4FFZH 3BE1L 4N5ED 4Y1AA 5AWNH 3S4SB 1Q8MA 3K1KC 5C0CA 2YEZB 5IQ9A 3TEUA 1A02N 1Y0LA 4PV8B 4M6OH 3WO4C 5HHNA 5FHBH 1RUPH 2EIDA 3KJ6L 3TA3C 5CINL 3I02B 3RAJH 4PGJA 5GGTL 4CVWA 1D6EB 3S96A 1OSPH 4X98A 3W2DH 3QXVA 2HRPL 4OSUL 4JFHE 2ARJQ 3WLWD 4TVPD 4XPAL 2YKLL 1MI5A 4F37F 5IB2B 4OGXH 2JJSA 4ONFL 3RWGA 4YHYC 1Q0XH 1A7NL 4NYLB 2GY5A 5CCKL 5IHBA 3AVEA 3OKMA 1OP3K 3TA3B 2A74B 1DE4A 1S5HA 1FORL 1FP5A 2C3HA 1S7SB 2W07A 1JGVL 2PYEB 2VYRE 5HGHA 1S9VA 3GRWA 5HHMB 5JIIA 3C8DA 2NX5E 2EYTB 4YO0B 5E5MB 1CVRA 5EBWA 4NN7B 4MXQC 5DK0B 3ZSTA 2W0KA 3M8OL 2O61A 1YEFH 3FB5A 4M61B 1J88A 3O0RH 1F58H 5DJCB 1MREH 3BZDA 6CGTA 2APXA 2K3TA 3O3AB 3UZVB 4K7PH 1IBGL 4PJAF 1QLEL 3VWKB 1ZSDB 4UINL 3NZ8A 5CGTA 5LCVH 3U0PA 4OKVA 4PJDB 3ZYJA 4N90E 1DEEB 5I73C 5KBNC 2WLYA 2HJKA 4PBWD 3MBEC 3EYUL 5T1LB 3T0AA 4L4VB 3U4BL 5EORH 2DM7A 4TOYH 1ZGLA 1Q9KA 4MAUH 3ULVH 1AFVL 2A73A 1F6FB 4QXWA 4FQQA 4OZIA 3GSQB 5I18L 5JXED 2UZXB 2VDQH 1P7QA 4JDZA 4AIOA 4UT9H 3U7WL 1QO3B 4NRZB 5FYKU 1G1YA 4H1LB 2OTUA 3RVUD 4AQOA 5HYFA 3OR7B 2AERT 4TVPL 3NABL 1LP9E 2BOCB 5EOCJ 2O61B 2HFEB 4KUZH 4WHYH 3MMEB 4NQVA 5D1QD 5D1XB 4HIEA 3FQRA 4JZNB 1NFIA 3SE9H 1AXSA 3ULUE 2HH0H 3E3QC 4Y16C 4OAWB 1HXYB 4UDTB 4RAVB 4G3YL 3VFTA 2VLKE 4Q7DA 5B39B 5FK9B 1A6TA 4JPVL 1IFHH 2C3XA 4BJLA 1MLCB 1KTLA 1OP5H 3QDMA 4XWOC 1YYMH 1FGVL 4ODTL 1IMHC 1UQSA 5GISH 4O02H 4HKJB 5SWZA 2OQJB 4U1JA 3GMOA 5GRXG 1CDYA 1FNSL 3A6OA 3DSFH 1FNAA 1PZ5A 4UBDD 3BP4B 1C1EL 3CFBA 5IM7B 2DIBA 3TLRA 5CKAA 3MYJB 4PJEE 4KK5C 1BF2A 4NRXA 4I9WE 3WMSA 3RTQA 3LEXB 1A6ZA 2YPLD 3BZFB 4W4NA 4L4VA 2AI0L 1QTYT 4FQ1H 4AEEA 4UNTA 1LEGA 2NNAA 4PRIA 3ULVF 1CT8B 3SDCD 4BZ1H 5BW7A 1MFDL 1PAMA 3PIQB 1OAYH 1KBGL 1AR2A 4G7YH 2EC8A 1AKJB 4X7CC 5CILL 1NGZB 1A6AB 3G5VA 1AXIB 2VLJA 2JB6A 5SX5H 3LV3A 1OAZL 1NCTA 5LQBL 2AJYL 1BJ1J 1EHAA 3L95A 4CL7A 5D1XC 5TQ0L 1MVUA 1S7UB 2O5ZL 3EDFA 2MHAA 4CW1A 1I8IA 1UYWL 2OZ4H 4XC1H 1BD2E 3S35H 5E95B 1BEYL 3VXOA 1S7WA 4DQOL 5JW4Q 3MV7B 3T8XA 4NZDA 2C26A 5C6TH 3IDIB 1BQHB 2NMSA 1RHFA 2P4AB 4WWKC 3PL6A 3S5LA 1MVFA 3KWWB 3P73B 4OTXH 3BGMA 5IUSA 4KAQL 4QHLB 4RGMC 5JW4N 4H26B 4DZBB 3NBNA 1CTOA 4IM8A 4PTTA 5AAWA 5MERA 3K2MC 2ZJSL 1PZ5B 2BNQA 4X6DA 4O51A 3OGCB 4NO0A 1LEIB 1NGZA 4WEBH 4K7PL 3SKMA 3FCTA 3FQXB 4NRXB 5DJ8A 3RWCB 1U6AH 4GBXC 2VWEE 1ZHKB 1K4CB 5ICYB 1KCUH 3I75A 5IMLB 3KLHC 3RHWK 1ZEAL 1MCJA 3PWVA 1WBYA 3NCEB 3BGFC 1UENA 4UV7H 5CWSB 3BPNC 2VXVL 1BLNB 3MCKB 1DVFA 4A2MA 5C0RL 3VW3L 5MI0C 3IS1X 3MFFB 4NO5A 4JFDB 2NR6C 3DSNA 3VFSB 3QDGA 4YQXL 2Y25A 1I7UA 1EO8L 3H9SA 5BJTB 5JXEA 1K9TA 4PJ5A 3C5SA 4LHUD 2R4RL 2EYRA 1BVZA 1A1NB 4PJ8A 4W68A 3CVHA 4X80L 1TQCC 4V1DA 3RI5K 4JN1H 3ZO0A 1S9WA 5DUML 1JYXA 3EO9L 1S7WB 4P48A 3MA9L 4LLDB 1FYTA 4XNMB 4JANB 2IPKA 4YX2H 3LKRA 1TVHA 4H26A 4IRZH 1BFVH 1S8DA 4KKCC 5F7YC 4YHPA 4MAUL 4KUCD 4LLYA 2VO5A 4XB8A 3IFNH 4MXVE 1MHHA 1CLCA 3AFLA 4HC1A 4PJ9A 4K23L 3U7WH 3RVTC 4FFZL 2D31B 5B3JE 5D2NC 3UTSE 4MNQB 2F53A 2OSLB 5F9OL 2A83B 3O4LD 4YFLI 2R0WH 4M6OL 4CGTA 4M93B 4TUJB 1RK1B 3EYOA 1E4KC 4H0HB 2EXWD 3DO7A 1KCVL 4MNGE 4NNXB 3QH3A 4DVBA 1GAFL 3OZ9L 2IADA 2KPNA 4XVUC 3IDXL 1UKSA 5C6WH 3MCLH 2NY5C 1A9EA 3WHE1 2VIRA 4BYHA 3FOLA 1NCAL 4XNMA 3LSOA 4RA0C 4W6WB 4TULH 1MCWW 1HI6A 5DMGC 1OD9A 2Y6SC 4JKWA 2CGRH 3O3BB 4GRLC 1UGNA 2A1WL 4NNYB 1OVZA 3WDHA 1EXUB 5MENB 4HS3B 5T1KA 1G7HB 4GAGH 4KK9C 2XYCA 4M7KL 3BWUC 2YRLA 3TN0D 1S9XA 4HUUA 5H8DA 1DBMH 1UT9A 3B6SB 3T2QA 5D7LE 2QSCL 3FFCE 3S36X 4GRWF 1RU9H 4X4YB 4NUGH 5C6PB 1WIUA 1C5DA 3MJ6A 3V52L 1MSPA 1J0HA 4JFQA 2X70A 3G6AA 1TJGL 3AGVA 5C0DB 1ETZA 2W0LA 2VLLA 5ANMA 5EZOL 1XF5A 4P3DB 5ENWA 5CHNB 4XC3H 1UZ6E 2OP4H 5IB1A 2DQCH 3K2UH 3RVXD 1GC1H 2IPTH 2Q6WB 1SBSL 3DMMA 3BZEB 4XZUB 1F4YL 1K3IA 3SHSA 4PP1C 4JRYA 4LLUA 3U7AA 3HS0A 1C08B 4K23H 1G9NL 4BFBD 2XQBH 2EDWA 2XN9D 3ZZ1A 1DVFC 4JHBA 4GKZA 2R0WL 2HT2D 5DK0A 1QLFB 1WJ3A 1G7MB 3LH2H 3WHE0 1YEIL 2KDGA 2AGJL 4C4KT 1OB1A 4TSBL 4Q6YA 1FNLA 5E2VH 1NMBH 3DYMA 3WUWG 3S4SG 4HX1A 1WLHA 1EZVX 4NQDE 5BQ7A 3R8BB 1CLOL 3TV3H 4ZFFA 5EZLB 5ADOL 2QQLL 1ZV5A 4JGJA 5JNYA 4Y2DD 3TNNA 3ARYA 4R4NC 3QFJE 4X80H 3IF1B 3G9VA 4GG6F 1CE1L 2ZUWA 2NXZD 3PL6B 1Q9WB 4DJMA 2BVPA 4U49A 5T1LA 3HC3L 4PJ8D 4M3JA 1EMTH 1NAML 2CH8A 5LGKA 4G6JL 1SYSA 4JFFB 5MHSD 2JJTA 2P5EE 3CDYA 4YDJB 1AIFA 3QWOA 4LK4A 4O51B 1KV3A 3V6BR 4KGLA 4U6HA 2FWOA 3NCJH 3EYFB 3ARFD 3S9DB 3FL7A 4XX1G 3EO1B 3WUWA 4FS0A 4Y1AE 4GRMB 1N5YH 2QHRL 5CIPA 2I9LB 3QRGH 4WUUB 4QHKI 4FXGB 3L1OL 5JUEH 3V6OE 4EVNB 2EDFA 4D9QE 1V7MH 3HI5H 3RVVC 1FGNL 2E9IA 5J0BA 2HVKB 1IT9L 3O4LE 1D5ZB 1N7MH 2DJUA 3HFMH 3RIFF 4MJ6B 3TVMA 3SE3C 4LLWA 2FO1A 2DAVA 5TGBB 4POZC 4HKJA 2R1WA 2B5IB 5GGTA 3SJVD 1NAKL 3T3MF 1EUUA 4K9EC 3VG0L 4GT7A 35C8L 4KPHH 2ZCKL 3HUJA 1PQZA 3O4LB 3KGRA 2EDQA 1I1AB 4IIQB 3SDDA 1FYHB 5MEPB 4Y16A 2I60L 2J88L 4HG4K 2R69L 5FIEA 3WIHA 4PY7B 3KPQB 2BC4B 3RTQB 1D9KC 3N1PC 1I1FB 1HHJA 3GMRB 1N2RA 5HHXH 4TSAL 3V4UL 2IPKB 3RZCD 5I73B 1INEL 4WI3A 2Y7QB 3VGAC 2PXYA 1BZ7A 4Q9BA 4OUUA 4M9OA 2FATH 1F2XK 4IMKC 1FIGL 4MXWL 3OAUH 1N0LA 2VNCA 3P9MB 4HV8A 5L2KD 2VLMD 2W1NA 5CLWA 3ZT6A 2EC9T 3UTSB 5F1SA 3D87B 3HNVL 1A6ZB 3H0TB 2V17H 3JWNC 4ZUWB 1OLZA 5I9QC 1WICA 5HHPB 4Z7WB 1GPOH 2IBGA 5DMJB 3QIWD 4R97C 4RX4D 3CUPA 2OXHA 4PRHD 1D5XB 3OWEA 4X7EC 4LPXA 4NQCE 4YQXH 3ULVC 3LIZH 1EUTA 3QZWA 5KSBE 2DWEB 4HQQH 4ZPTA 3L3IB 2VABA 4XVJH 3H7BA 3I6GA 1GZQB 4XXCA 3GO1L 5KS9E 5IJVA 1JTOA 1NMBL 4LVOB 3T0BA 3V5KB 3C08H 1KLGA 1OHQA 3W5MA 4FQCL 1AQKL 4MNQD 1J0YA 1YQVL 3WFDL 3RWCA 3VG0H 4ZS7H 2W9DH 3RRQA 4GRWH 4PRBA 4KI1A 4CN6A 4XC3L 3SO5A 5C08D 5KSAD 2NYYD 1CG9B 3SGEH 5GGUB 4DTGL 2HFFB 2JELL 5E6ID 4JG1L 4Y5XB 1CFBA 1DBBH 1F02I 1ZHBA 3BKYL 1KCSL 1YEJH 4JHAH 3C8KB 3K3QA 1ZA6B 3V79C 4ZFGL 3F5WB 5HDQL 1ZXQA 3MV01 2Z91A 5D7LB 4HSQA 1NFDA 4AENB 3T08A 4CMHC 3MXWH 3RWGB 1AGEA 3Q6FB 4ZOCA 3O6FB 5GRYA 1RIVH 2X1PA 2NW2A 4NN6B 5DEFB 3WS6A 1YEEL 5SV4A 4TNWK 2A0LD 3ZTNL 4EUPA 1CLYH 1DE4B 1F6AB 1S5HB 2HT4C 4YHMH 3PGFL 4J12A 4ZYKB 5F96H 5EORL 1LO4H 2V7NB 5INDB 4MQ7B 4GBXD 3OG6B 1UM6H 2A6KB 3O9WB 3PGCB 2KZWA 3KYMB 5CJBA 4LEOA 4MCYB 2Y72A 1IC4L 4M03A 3MLRL 4NQED 5DLMH 3IU4L 4JVPA 4NKIL 1FLRL 4JVUA 4ONGL 4LCIH 4YK4C 3IFLL 3T04D 3HE6A 4JRXD 3HN3A 3QIUB 4HK0B 3C6LA 1HYSD 3KPMB 5GZOD 2D31A 2NTFB 3L5JA 2BVPB 4JB9L 2OTWA 4BQBA 2X2YA 3MRNB 5GS1C 4MS8D 4RGND 2AJVL 5AWNL 4PJAA 5IBUB 5FM5O 3KYAA 2W9EL 4F7PB 5L88H 2W38A 4P5KB 2NY4B 2B7DT 1FG9C 4P5MB 5DUBA 5D7KE 2DDQH 1O7VA 2EE9A 3V4VL 3RVUC 4UU9B 1L4IA 5AYUL 3RAJL 1MFCH 2ZOLB 4X99A 3DGGB 1MHPL 3V6FA 5IV2B 2PXYD 1M7IA 3LZFH 1CQKA 1CICB 1T2QL 3VXMD 3W2DL 4N0YL 1FSKB 3O8XD 2GYSA 2RHEA 1FSKC 2APVA 4EKXA 4Y2DB 4DWHA 1A2YB 3G08A 3PJSB 1U8NA 4O5LL 3QIBD 5FYKD 3TBTB 4U1MB 3FT2A 1MAKA 3IGAB 4PJGB 3LEVL 4M5YH 4PS4H 2JK5A 2DL2A 1UWEH 4TQEH 4ZPVB 1KJMA 1W0VB 5KSAB 5CD3B 1SM3L 3HCVB 5CILH 2F58H 4LEOB 4MCYA 5D7IE 4DGIL 3EJJX 5E8OA 5FO8A 1JUFB 3G6DL 2ZOLA 2IAMA 3GJEA 3V4PH 5JQ6L 1GJIA 1S9XB 4HUUB 5BRZE 1QFWH 4OZHF 3B6SA 4GRWE 4JM2C 1SJVA 4P4KB 3VD7A 3WBDA 5GGVL 1MF2L 2NZIA 2Y7QA 3O6FD 2YN3A 2NXYB 3NIFF 4LSSL 4OUUB 3ARUA 4KY1H 4PJ7B 2A6DB 4QRUA 4F7PA 3RZWA 4QWWC 3KG5A 3F7YA 1Q72L 3BDXA 4OI9A 4BH8B 3VWKA 3T2OA 3VXRE 1EFXA 4OF8A 1JBJA 1OGAB 3U0PB 3IU3A 1R5IA 3ZE0E 1AD0B 2P5WD 3QEGH 1DQJA 3BO8A 4GKSA 4OCRL 4K8RL 4Z6AT 3BRDA 3CJJA 3TJEL 1JPSH 1SYVB 5E9DA 3BXNB 5EIQA 4YFDB 1YEKL 5L2JB 5H94B 1XCTA 3FO9A 2CKBL 4YHNB 4X7TB 5JTWA 3H9YA 2CO6B 4R3SA 1ITBB 1DLHA 1NL0L 1SJHB 3CPLA 3S88L 1ZA3A 1HSBB 3TO4B 4PJFF 2CDFB 1AO7A 4BK5A 3ALPA 4OLVL 5KJRL 5FOBA 2V5MA 5I75B 1J10A 4HCRH 3V9FA 1CFQB 2AK1H 5EZIL 3KYNA 2Q76A 3MNWA 4PP2B 3IJSA 2YSSA 3QCVL 5EZLA 1KFAH 1IL1B 4RWHA 3WUWB 5DRWB 2ILLA 2KZ1B 4WTWA 1JJUA 2NQCA 1CICD 1P9MA 2UVEA 1V3MA 5D9SA 4ODXA 4PB0L 3FJTA 1OGTA 2HFGH 4PRDA 2GSGB 2X4OA 1RI8A 1GSMA 4NM8L 1OAXL 3QT2A 5EU7E 1MCPL 1B0RA 1EEZA 3ARDD 4PJ8C 2AJVH 3VGFA 5LJYH 4FQ1L 1FFNB 4PGDA 3ULSA 2GJZA 1MY5A 1PX4A 1KC5H 4XWOD 1YN7B 3T09A 4OJFL 3EYFA 1IGTA 2HJLA 4XHJD 4ZQKA 3RY6A 4JFDA 1O0VA 4ISVB 1GPOL 3CX5K 1NC2D 5TFSL 4FFVD 1T2JA 2E8YA 3MUGB 4PJBB 5JHDB 1EVTC 3ZDYF 3NZHH 5I1IH 3T4AA 4ZUUB 3W39A 4MA1B 1JHKL 1Q9OA 3MRJB 1KT2A 2FSEB 4C58B 5I15H 4CUCA 1LD9B 1VEMA 5GS2D 5JLZA 5KVDH 4R26H 3N1QC 1Z9LA 3RVTD 2E8ZA 3D3VA 4J4PA 4D8PB 3KXFB 5GRZA 1OM3H 3OF6A 4S1RL 4F80A 4XMLH 3VGGA 3JSSA 3SE9L 3ARTA 2Z8WC 1A4KA 5IMOA 4QF1B 4D9RD 4GQPH 4JY5L 4MCZA 4XWGH 2NW3A 1WISA 2Q76B 1WITA 3HUJE 2GHWB 2H6PB 5T5FL 2HJLB 4PJXE 1VERA 2X4SA 3QJFA 5F9WC 1V7NH 4OFYD 2C4XA 4F7TB 3OX8A 1LMKA 1MHPH 4DVRL 3D0LA 3SY0B 3BGMB 3RX8A 3MV9A 3TBYB 2IAMD 4UNUA 1WT5A 4MVBD 4ZUVB 1TJIH 4X8XA 1Q9LB 2EEDA 1ACYL 1DQML 4RFEB 5ALCH 1QZ1A 3CFEA 5EUOE 4KK9D 4FFYH 1PVHA 2DQFB 1GOFA 2SEBA 2VXVH 4GSDL 5DD0L 1IGYB 3QUZA 5EU4B 5EH1A 5E70A 4P9ML 4P4KD 1H15A 1N5AA 2HLAB 2FJFB 1EXUA 1E6OL 5T3ZL 3WD5L 5MENA 5FGCE 3QHFL 3LEYL 3OAYH 4JY6B 1KCRH 3VFMB 3I3EA 2WK2A 3EBAA 4NPYB 1XIWD 2GJ6A 3ARGB 4MDIB 1FZOB 3B5HA 1RV6X 3MO1B 4K7FB 4M1DL 5IJKC 1JFQH 4KJPD 5T3XD 5HDBF 3SQOH 1I1AC 2J4WH 4KRPC 4XHQA 3R1GL 2E9BA 4E41D 1N3NA 5F21B 5F9DC 1ZHBB 4CU8A 3BD5A 4FHBD 4LHJB 1NCNA 4X7SH 4PUBL 2E9JA 1ZLWK 5F89A 5HSFA 1MFAH 4FTVB 1J1PL 4MSWB 4M4PA 3N06B 2EDXA 3DYPA 4LPUA 4FOMA 4CVUA 4UNVA 4GG8A 4HIIB 1NKRA 4F7CB 5F7MC 2AXHA 5EBLB 2ZUUA 4S10A 2ADFH 4JRYB 4W70A 4QRRD 3OJMB 5KOMC 3H9HA 5E2WH 1Z9SA 1YDPA 4LCWA 3BMVA 4Y5XA 4YR6A 4D9LH 4DUWA 1OGAE 4QXUL 1TQBC 5JDJA 3F58H 4XBPA 1ZWIA 4GAYB 4BFIA 5ACZB 2W60B 3ULVE 2BVOB 1DBAH 1HWGB 2P24A 3ARBB 3DBXA 1KELL 3TM6A 3NA9H 1OP5K 5IF0A 1I7UB 1MCIA 5FO7A 4YDLB 4PJ5B 4N9GA 4OF3A 2YC1A 1A6PA 3JV5A 3K81A 4U3HA 4XHJC 3UO1H 1FZMB 3HI6L 2XZZA 2X9YA 4HLZG 2R9HD 3SE8H 4K3EL 3FMGH 3EYQD 1V7ML 2X4TA 4PJFE 3J7HA 1IM3A 4G9FB 4R26L 3MGOA 1TPXB 3FTGB 5JQHC 4HIJA 3FQTA 4UT6L 3F12B 1AD9A 4S1RH 1AC6A 8CGTA 4XVUD 2WANA 3EYQC 4LVNC 1ORSB 4HJJH 2A6IA 4XMKH 5A2JH 2JB5L 1HH9A 1CK0L 4MQTB 1CF8L 2AEPH 3QCTL 5EIVA 4OZFG 1IVLA 1VKXA 1KULA 3LN5B 1MIEH 2AJUL 4QTHA 2YPKB 3KLDA 4W81A 1E28A 3TA3D 4Z95L 4L3CB 3FO1B 3QIBC 4G8GE 1YY8B 1FG2B 4F2MA 4MX7A 2E7CA 3VFGL 4X9FA 4JVWA 5F1IA 4BM7A 4JHWL 5HI3D 1IQWH 1G6RL 2PYEA 3OAZH 2GAZB 2EYTA 5F1OB 3MLTB 1I8MB 1LWRA 1D5BA 1VDGA 3BQUD 4NWTH 1LE9A 5FHBL 4QT5A 4UIMB 2WWMD 2VZOA 3EDKA 1FL5B 1MPAL 5DQDH 4U6XA 4I18C 3ZDXF 4AJ0A 1C5CH 3WFCH 3O3BA 2YD8A 3OKLB 4OIIL 1MH5B 1OPGH 4ONOA 3VWJA 1DBAL 3RL2B 2A74A 2RAMA 2YKLH 2OJZL 4XX1E 5F97E 4P2OA 2XKUA 1NLBL 1MFEL 3FO1A 5I17A 3NAAH 5JDSB 1U3ZA 2AK1L 4EIZC 4OZGB 3RKDC 1TZHB 2Q7NA 2OYPA 5IMOB 2YHGA 5FB8B 3RFZC 3ELAT 5I1LB 4PLKD 5EZIH 1RZIA 4XMPH 4G42A 5E8NB 3WXVL 1ORSA 4MJIE 4P57B 3L3DB 1P5UA 1DBML 3PQYB 3CXHJ 5EC2B 3UYRL 1EFXB 3KR3H 5GS1B 4OCXH 5DD5H 4B41A 7FABL 3NIGF 4H8WH 1LE9B 5FCUH 1EDQA 3MREB 4ZO7A 5F7EH 3NGBC 1NMCC 3RWDA 3I9GL 5ITFA 2EDKA 4YNYA 2XY2A 2H2SC 3P0VL 1U2HA 4U6YB 5IMLA 1XAUA 3PNWB 5CZVL 3ZMRA 4Z77A 3MZTA 1IARB 4Z7QF 1K8DA 2X5PA 4YDJA 3QISA 4RAVA 5D72H 3MOBH 4KXZI 1CL7L 4NZTL 5TFSH 1UEYA 2FHCA 1PKOA 3MRFB 3MRBA 32C2B 5CINH 4QRRE 1T03L 1UKTA 4NZUH 2BSTA 3MJGX 1MCDA 1II4E 1K8IA 4HBCH 1YPZB 5TQ2H 3U46A 4MD4B 3UYOD 1T7VA 1Z0NA 1BFSA 3P4MA 4AMKL 2R23B 3MRLA 2R0KH 4NKMA 2IBZY 3U7YL 4IRSA 4OB5L 2C1PB 2NY5L 2GJJA 2ATPA 5I71B 3ET9F 5C08B 2QHLA 5GGRA 4JN2A 1A7QH 5BOPA 4CNIA 3PNWA 3V5DA 2A9MH 1TZHA 2DI9A 2A38A 5E2TL 5FV2A 5EO0B 5HHOB 5IOPA 2GJZB 3TF7C 2VXUH 4XPHL 2CLRB 5HI5C 5HD8C 1CLZH 1NANI 1OCWL 2P43B 5T5FH 3L3DA 5BO1L 3GSXA 2YSSB 3CSYA 4BZ2L 3G6JA 3D2UA 4P46C 1JWSA 3UX9B 4NKOB 3QUYC 2PKDA 1PW3A 2IC2A 3QNYB 2Z8RA 5HPMA 3QB7C 2R8SH 3WL9A 2C3GA 4HXAH 4JDVA 5LKNA 5IVNA 4AIZA 3RWDB 4LQ1A 5GS2H 1RZ7H 2A6JB 1WWAX 3V6OC 1RZGB 2DTSA 4G8GD 5E03A 5AD0A 5ELIA 1L7IH 4X4XB 1PKQE 4JR9H 1MI5B 3S6CA 3DX9B 4O00A 5I75C 1JWUA 3I6KB 5EPMB 4P2QD 3O9WC 4JRXB 2I5YH 4RGMB 3UDWC 2R2HB 3M8OH 3KPOA 1B0WA 1S7UA 5EC1A 1F90H 4XPBL 2FO4A 3REVA 4GS7C 3QXTA 4YC2B 3X17A 3VDAA 3V5HA 5JPNB 3L3OB 4JAMA 1DBKH 3MGOB 1F3JA 4JPWH 1MHEA 2XWTA 4QLRA 4TPRL 4X9IA 4CNIB 2VKXA 2J8UA 1GZQA 5CJOH 4WI9A 1WAAF 4PJBE 5JHDE 1FE8H 2XXMB 3D5OF 4MCZB 4I3RL 5FYJU 1KLGB 3WXVH 4PTUA 5SWZD 1KEGL 2VXTH 4ZFGH 5KW9H 3GJFA 5K93A 2ZNWA 4FMFA 3B8YA 2ADFL 1Y6NR 1FCCA 1E4XL 4Z7WF 4WI7A 1GIGH 2VTFA 3L3HB 4KUZL 3ZKQD 2VWEC 3BPLC 1QLRB 4BZ2H 2I26N 1QBML 3AB0B 1IM9A 2Y06L 4X5LA 3FT2B 1KJVA 2ENYA 4XNZB 5DUPH 2DBJA 1FNEB 3O2DA 2ARJB 2IH3A 3RZCC 3ARSA 4AH2B 1CGSH 1X4ZA 4MA7L 4NQCD 4P3CL 3HPJB 4UIKL 4X6DF 4WO4C 1FRGH 1XGPA 3VFRB 4OD2B 5DJ0B 3UPCA 4KH2A 1ACZA 2CUMA 3DO3A 2XT1B 5IJVB 4BSJA 2X4NB 3ARVA 2MKWA 1RPQA 3VW3H 3FB6A 3IVKB 3CVHB 1TXKA 1HKFA 3MJ9A 2RJMA 1ZGLM 4J3SA 4KUCF 4U1IB 1XGRA 5CIPH 1IGCL 4I2XB 2DQDL 3UTZA 1F58L 1MHCB 2I27N 2E27H 3KYMA 4J6RL 1U92B 4X7DC 5J1AB 4K94C 1MUJB 3BOVA 5DQ9B 2AP2A 3CZFA 3PDOB 4X5WB 2NY3D 5EC2A 3MYZA 4BFEA 3S34L 1CGWA 4OZFH 1FL6B 1T4KB 4ZAKA 4XCFL 4Q97A 4H8WC 1HH6A 1F11B 4GMTL 1QA9A 4HPYL 4ZOBA 4ELME 5EBLA 5JW3H 2LU3A 5TE7L 4NDMA 1PLGH 2HLFC 3BW9B 3MRDA 2F5AL 3KJ4B 1T1ZB 2FEEL 2HAZA 1YECH 4Z0BL 3MR9A 3V7AE 1C8PA 4MNHB 2O26U 5TH2B 4E42B 1R3JB 5DRZA 4XVSL 5SWQB 1X5XA 4P2OC 2R1YA 4AYFA 1H8SA 1TNMA 4X5XB 4M5YL 4NT6B 1KYOJ 3IKCA 3SDDB 4LLQB 2OJZH 1J8HD 2FHBA 4AM0B 2R29L 1T5XB 3NTCL 4PG2A 3BKMH 1G7HA 1W8OA 3OXRA 4FQHB 3V2AR 5TF0A 3QP3A 4UTBL 1JV5A 1NLBH 1JGDA 2EXWC 5EWIL 5BO1H 4UB0H 3MV8A 2HT2C 3QFDB 2P42B 3PWPA 2W0FA 4ODSL 1P9MC 3PHQA 4LQFL 4NKIH 5IOPB 3AUVA 1LGVA 4MX7B 4Z7VB 3ROLB 5E6YA 1MUJA 5DQ9A 4Y5VB 5DFWH 3BWAA 4OZFA 3MR9B 5J6HB 1QRKA 4CMMA 1RU9L 4IMLB 1TTUA 1PG7H 3GSOB 4Z8FH 4NUGL 5IROC 2DD8H 3HZKB 3WNMA 3OKDA 4LRIA 3D9AH 4L8DA 5C71A 3VJ6A 4NJAL 5CGYD 3JUYA 1QBLL 5D1XA 3BN9D 3FFCD 3TYGL 2DJSA 2FGZA 1AXSB 1HHHB 3F7VB 1IZJA 3VXME 5IQ7L 1NLDH 3SKJH 2X4UA 1U8OA 3MX0A 5HYJD 1UZ8A 4K3GA 5E56A 3IF1A 5JW5A 2RR3A 1HQ4A 2F53D 4MD0A 2DWEA 4X4ME 3WKNA 1NCCH 1LO3H 4E9LA 4K2UL 5C0AE 2OTUB 2CJUH 3VFSA 1GCFA 5SWZB 4MB5A 1CFTB 5C0AA 2E5EA 2HFTA 1KJMB 1QFPA 2R1XB 1BM3H 3E6FB 3LS5H 3QEQD 5C2BL 1IEAB 2IH1B 2DKMA 1NGQL 1G7JB 1RMFH 5B38B 3GGWA 3MTRA 2X1OA 1WIOA 3QPXH 4NFBA 4KWUA 4RRPG 4OAWA 5F1NB 4XVSH 3WN5C 1F4HA 4Y4FA 1E6OH 5T3ZH 1DQQA 4OD1H 3JTTA 3VJ6B 4QCIB 1OSZA 1T3FA 4PRAB 4JPKL 5FGSA 1P6FA 2Q8AH 2XKSA 3I3BA 1AO7B 5I16A 2IGFL 1CLOH 5ESVA 3TV3L 3DETC 3LD8B 4X6CA 5IMMB 5JOFB 3WLWC 2YA1A 3D3VD 4XPGH 5I1GL 3GIVA 4UB0L 3VXPA 1QFUH 3WN5B 5FKPA 2XTJE 5DJAB 3TBWB 5T1DH 1NJ9B 1H0DB 4F9LA 2IFGA 3OV6A 4CMHB 4PLOB 1P84K 4S1DD 3VCLB 2A77H 4OFPA 5L6YL 2DQGH 1IAIH 3B9KA 2VDKH 4C83B 1M05A 4LGSB 1GC1L 4YDVA 5E00A 2NPLX 4Y16B 4NYLA 2XTJB 1I8IB 1PG7L 2ZWLT 1I9JL 1CT8A 3GKWH 4JQVC 1QRNE 1GH7A 5KVGL 4UQ3B 1V8HA 4K7FA 4LLWB 4Z0BH 3MBXL 4Y88A 3MRGB 2VLJB 3C5ZD 3X11A 5KTEL 3UTQA 2NTSP 1TTFA 5TE4H 1P53A 3WCYA 5HI3C 5HXMA 1NEUA 4R90H 4XXDB 1AC0A 1B88A 1RK0B 4LVOC 3AM8C 3GSXB 4K2UH 1A3RL 1FO0L 3QA3A 1F8TL 4CW1B 4X8JA 4LSPH 5F6HI 4OZGF 3T3PE 1FV1A 2NYYC 4OLWH 5TDOB 2WBKA 1YNLH 1KJ2H 1V7NL 5LGHL 1RVFL 3ZL4H 5GGRB 5K9JL 4HWUA 2BHYA 4K94H 4PJEB 4JZOB 2AK4B 4LLMB 1U92A 3RU8H 3HI6H 2BNRE 3O3EA 3VGAB 4D9RE 1GZPA 1A4KB 4WCYL 5INCA 4KU1A 2OL3L 4LKXA 1KFAL 2DWDB 3P40A 1MJJA 2EDEA 3OPZL 3V0WL 4IMKA 4WJ5B 1TJIL 2ARWA 4GSDH 2JIXD 1C7TA 1GIGL 4ZNEE 2V2TA 1H3TA 2WUCL 5DFVC 1U8PB 1GGBL 1IBGH 4WY7H 3QDJE 4ZTPL 3HZMA 4LEXL 1OTTC 4ORGB 4EOWH 2VLRD 3L1OH 3V5KA 1CFNA 2W59A 2CRMA 4FQJH 1NLDL 4UDTA 1D5XA 3CK0H 3HMXA 2IPUG 5GPRA 3VU2A 1T6WA 4YBLB 4Q2ZB 3VFGH 4D8PA 1ROWA 1U8KB 2CXKA 4YBLC 4X6FA 3HCVA 3OKEB 3ZHKA 3UPRA 1B6UA 1YNKH 4MWFA 1QSZA 4RQQA 4GOSA 5DTFA 3VXSE 4PJGF 1A1NA 4UT9L 4U3CA 4UI2A 1BFTA 1RJYA 2VDOL 4TVPE 3IDNB 3REVB 2ESVE 1KOAA 5KTEH 1FPTL 1CE6A 2QSCH 4GQ9H 4BH7B 5IESL 3SDXA 2UY7A 4ZTOH 1JI1A 2GITA 3JTSB 4WWKB 4ZO8A 1IEHA 5KSBB 2VZUA 1J1XL 1JF6A 1F3JB 4IOIA 4Y16D 4HT1L 1MELA 3INUL 3QG7H 4ELMF 3ESVF 1IJ9A 2V5RA 2ESVB 4KAQH 1GZPB 1WFUA 4OZFB 1N3NB 3PG2A 1RZJC 3Q48A 5K9KB 1DUZB 1KENH 5GISL 3KJ6H 1MJJB 2E6JA 3AREB 1P2CB 4NZRH 1WFOA 2PF6A 3K1DA 3VFNA 4HJ0D 1MWAH 5E2UH 2ZUTA 3TN0B 4ZMAT 4G80B 4DTGH 5D7LA 1GRWA 4HFUH 4J7RA 4HS3A 4WRLA 2RGSA 1EO7A 1HZHH 3L95B 3TC9A 1YEJL 1EH9A 2HG5A 1JGLL 3TA3A 5ICZA 2GJ6E 4U7KA 5FUZH 4PB9H 4ZDHA 3W9DB 2XICA 3ROOA 1OGAD 5MI0B 1H3VA 2WV3A 5JOEA 5GZNC 4HHAB 3TFKC 1EAPA 2BVYA 2CLVA 5DRNB 4OIAA 3CSGA 1ZLSL 3M17B 3MRCB 2JJTC 2A6KA 4LIQL 1BGXH 3CSBA 1MREL 3U48A 1UM5L 4ERSL 1J12A 2OMBA 2JCCA 1AGCB 3SDAC 4R8WL 2JCCE 2WWKT 3GB7A 4CDHA 4U6VH 3CX5J 3MNVB 3UTPD 4RCAA 1TFHA 4O2FA 1FO0B 1N8ZB 3JTSA 4WWKA 4FNLH 2IAND 1KJ2L 5LGHH 3UYPA 1MHCA 2Z35B 2GQHA 4BKLA 1MRCH 4FQXD 5KANI 3HE7A 5LGJA 4MQSB 3Q6GL 3FZUD 1J1PH 3HC0B 4H1LA 4KVCH 3DTXB 3L3KB 3TWCL 3IGAA 1ZGLP 2BNRD 2X89D 3AREA 1R3JA 4M7LT 2N4IA 4WU5B 4KZDH 1IQWL 4DFHA 4DGVL 2BCKB 4M43L 3ARBA 1NFIB 1IC7L 3JVGC 1RY7B 4ZUUA 5BOZG 3CUPB 3BP7A 4IDJL 4YGAB 2C1PA 2ZKHH 1HKLL 1BOGB 1JVKA 4EOWL 1RUKL 1A6TB 3C2AH 3P11H 3CU1A 4PRID 4O9HL 4JPVH 2VLRE 1RZ7L 2HA1A 4QRPA 5HHOD 3RVXC 2JK5B 2MKLC 3DI3B 3JWDH 4NOFA 2E6PA 4E5XB 1CD1A 5ADPH 5B4MD 2JLLA 4C59B 1WZ1H 3FQRB 4JZNA 4U1GB 3V6OA 5IW6B 5GGSY 4LP4A 2IBZX 3NFSL 3QI9D 2AXFA 3CDGA 4J3XA 1R3KB 4TQEL 1CCZA 2V7HB 4JPKH 3VXTB 4L5FL 3EJYD 3SKUD 1HEZA 2O5YH 3BYTA 4JZOA 5BV7H 3W11D 2Q8BH 2CUIA 3MV8B 4IRSD 1MI5E 2PO6A 5F6HJ 1XFPA 1ZT1B 3HG1A 4FZ8L 2J5LC 5CBAA 3TPUA 5E9DB 1T5WA 4IDLA 5IVOA 2H2PC 3GI9L 5AZ2L 2ZSWB 5J6HA 2L7UA 2QR0A 5KN5A 1CXHA 5IVZB 1MIML 4LL9A 3WHXA 4LSVL 2XA8H 4FXKB 4WNQB 1QQDB 4R3SB 3PHSA 1LO4L 1MRCL 3EOBA 3ULVL 1A1MB 4JFEE 3ILQD 1RZJH 1K4DB 1C5BL 1NGWA 1NUDA 2MHAB 5I8KH 4EIGB 2EDBA 2P46B 4PP2A 4JZJA 4PGEA 5E6ZA 4XNZC 1RURH 3KPQA 3IU4H 2H3NB 5E5UB 3DV6B 4R2GD 3UBXA 2H9GA 3UCRA 1BQUA 3G5VB 4X4YA 1LO2L 1YEIH 1FZJB 3LRHA 1FBIL 2FBJH 3K8MA 4NUJA 2FYYA 4GXUN 4TSBH 1UWXH 1I8LA 1LO0L 2G75A 4HC1L 4RIRA 1QSFB 3QIWC 5DMIH 3VXRA 1CFQA 1F13A 1U8JB 1I85A 1KN2L 4HUVB 2F58L 5DVNA 1GOGA 2J2ZA 1QQDA 3WJLA 2XN9B 1NDGB 4TNVF 2ZJSH 4LBEA 4WEBL 1F97A 4L3ED 1JRHI 2LABA 2VXQH 4OLYH 4FABL 5IK3A 1S7QB 4HCRL 3QXDA 5HI4D 3QXAA 5FECB 2E7HA 3NVQA 4YXHL 3KHOA 3DUSB 4Z78B 1YMMD 3HG1B 2B39A 3KXFD 2IQ9H 4GJTB 4KQ4L 1NANH 3MZGB 3L9RB 2ZP0T 3BD3A 1KCSH 1MOEA 1CXIA 3FHQA 1K5NB 1KLFA 4QOKA 2VH5L 5IV2A 4LFHD 3OKNA 4M7LH 4WIQA 2HP4A 3VRIB 4JRWA 5DZLA 2OJEB 1YYLH 1MCCA 1OB1B 3C5JA 1G9ML 4GW4A 4M7ZB 4QRRB 1CYGA 5DMKB 1SHMA 1YEGL 4J3UA 3EHBC 1YPZA 3U46B 3RGVC 5SX4H 2DMCA 1D5IH 5D7JA 1LDPL 4FG6C 3TBTA 5A16A 4YUEL 5L2KB 2EZ0C 4F7MA 1YMHA 4QHMA 5GSVB 4D0BA 3QDHA 4PJHB 3QEUB 1YEKH 1B6DA 5KG9B 3LKPB 4J23A 3QXWA 4LU5H 4N0RA 5D8JH 4F8QA 2Q86A 4OGAC 1I9IL 2E7MA 1AD9B 5DJYA 2XKNA 1MQ8A 5J89A 3O2DH 4FQXC 5E8OB 1B9ZA 2DTMH 3P4OB 1LE5B 4NHCH 3ZKXC 3O6KL 4WI6A 4HWNA 4MA3B 3NIDF 4HF5H 5DFTA 3VFVA 3T0DA 5E2VL 4C56A 3MNVA 3IS0X 3MACH 3MRMB 5J6GB 1NGPH 4YH6A 3TWCH 2GT9A 1Y6KR 2OJEA 3U79A 5BRZB 3HRPA 4QXTA 3VH8A 2AQ1A 1SJXA 3NFNA 2HLAA 4KZDL 6FABH 5EU7C 3NPSB 2EDOA 1A7RL 3IAQA 4JM2D 5GGRY 1NC4D 5HYSB 1Y6MR 5SWZE 2YK1L 2ERJB 4XTRC 3W0WD 3QIUD 1DQJB 5B3JF 4Q9RH 4NM4L 3RTQD 2YD6A 4QO1A 3LV3B 5FHAL 1JN6A 3RIAK 3BD4A 1H15B 1AGEB 1NCAH 3VMOA 3ZE0F 1RZ8B 1T0PB 3OKLA 1A22B 3GHBH 2P8PB 5FKAA 4MHHI 3IJHA 3PP4H 1A7PH 2BY0A 3G6JE 3GHEL 2GITB 1FZOA 2D7NA 5LAXA 2DQTL 4K7PY 1PG7W 5L7XH 1FC1A 4AL8L 3PHQB 4XNUH 3O8XC 5HHNB 5I76B 5GSRB 5I30L 4IEFB 4PRPB 2BNRB 2AXFB 1N7ML 3I02A 3SDAA 4HC1H 5DS8B 2Z31B 1DBKL 5I1DA 1S7VA 4P4RB 4Q6IA 3P77B 2BY3A 1UCBH 4CVZB 1A1OA 1MQKH 3M1BB 2GFBB 5I2IA 2P48B 1CFVH 2DQCL 5DJ6B 4ESKA 4LSSH 1CU4H 4KTEL 3K7UA 2ICEA 3RDTA 5DO2D 1T0MB 3ROOB 1W0WB 4Z7OE 1MCQA 4R97B 3MQIA 5K9KA 4GKZB 5CEYB 5HYSA 1QLFA 5K9OA 3QZWB 4Y0GA 1YMME 1FAIH 1BECA 1H5BB 2BSTB 3KXFE 2EE2A 4IS6A 4PR5A 2IFFL 4HUWA 1TITA 3CFCH 1FIGH 4HD9A 4XAWH 2F15A 1F11A 2E7BA 5EU3A 2A6IB 1KUMA 3DETD 3OAUL 4ZFFB 3HS0B 1KT2B 1RIVL 2WBJA 4XPAH 1T7YA 4Y1AD 5SX5K 1TETL 3BP6A 3K46A 1CGUA 4YHML 3JWOL 1J9CT 1E27A 3B3IB 1P1ZA 5C92A 2D9QB 4U1NA 1R3LB 4ELKA 3S97C 3IXAB 3KPRA 4O2EB 4QF1A 3GHBL 3QIBB 3RDTB 4BK4A 3B83A 5DR5H 4HMCA 2EC9U 4Y8AA 1VCAA 4YK4B 5SX4I 4OZ4B 5I76A 5A3IC 1GC1C 1ONQA 1HHKA 5JORB 5HYQB 4DZ8A 3SOBH 4JKMA 4JO2L 3EOTL 3IETA 3QUKB 4M1GH 1EGJH 4WW2B 4HQQL 3KDMA 2QQKL 5DYOA 5JIHA 3DURB 1PX3A 4L8BA 3MRIA 4R9HA 3SCMB 1NGYA 3V0VA 1QRNA 4PY8J 3R06A 4G7VL 3GRWL 4NN6C 1FYTE 2GSIB 1EHNA 2NW2B 5DEFA 3HI5L 4OLZH 4HWBH 5KS9F 5DC4B 2NCMA 3QUML 4EEEA 3MOAL 4L8SC 4I5BB 1UH3A 5FOJA 1ZT4B 3FHAA 4LGPB 1D5BB 1HI6B 4HUKB 4EBQL 4OBRA 2FJFA 2I24N 2OK0H 4XP6H 5B22A 1UWGH 1VESA 3NIFE 1INDL 2OR9H 4L3EB 2BSSA 2DIAA 1WAAE 4HMDA 1I3RB 4DAGL 4LASL 4L9LB 3EHBD 4KRMB 2IF7A 3I50H 1LO2H 1M71B 3MXWL 1H8OA 2YPLE 3V6ZA 1A3LH 5I1KH 3PDGA 3QEQE 1BJ1H 2AQ2A 2XACC 3CK0L 4JFEA 1R3HB 2QQLH 4Z76A 2IH1A 1FN4B 2XFXB 3TH2T 5T1KD 3IDMA 4NIKB 5TE6L 2JIXB 1WCQA 4WUKL 2BHZA 2A0LC 2P47B 4KDTC 3VFWA 1ZT4A 3KPSA 1LQSR 4K55A 4P46B 2VZ3A 2NXZC 4PJIE 4ZS6C 4HK3J 3F58L 1NCWH 1UM4L 5F8RC 2A77L 1VFBB 4LPCA 1P7KA 5T33L 3SDAD 4QHNA 2MTPA 4M6AA 4N1CA 5F70A 2FR4A 4GRLA 2WLZA 4MNQE 3BMWA 1G9MC 1R5WB 3MCKA 1HOCB 4LPYA 5C0NC 2ZOKA 4JY4B 5IVZA 3QRGL 4Y7MA 5I71C 3WJJC 1G7MA 3BPCA 3A6BL 2B8OT 3GHEH 5E6IA 1W0VA 5KSAA 3LMJL 2J6EL 3FT4B 4YIQA 3SDYH 4FQIH 4HS6A 2EE3A 3K0WA 5GJTH 3E6FA 1QPPA 4TTDC 5LXGH 4NKMB 3QHZL 3LZFL 4YBQC 3T4AB 2A9NL 3W39B 3N85L 4UAOB 3GGWB 3OGCA 3G6JB 1HHIB 4BQ9A 4P9HC 1CN4A 5KVEL 4F7TA 3EGSA 3ARZA 5K59F 1A7OL 1BAFL 2WSKA 1AHWA 5DHYA 3CCHA 3RKPA 4AG4H 1DANU 2VZVA 1K6QL 1X5ZA 5ETUA 3O3AA 1HOCA 4LASH 4Z9KB 4QXGH 5C0BA 4OQTL 3W9EB 4EQ2A 3D3VE 2YOCA 3GJFK 4RZCB 1SY6H 4S1QL 4YHLL 1HHGA 3VRIA 5ERWA 1RUQL 1XIWB 3FT4A 2B1HL 3D39B 4XPHH 3LQZA 5E4IA 4R8WH 1VFMA 2CQVA 2GEEA 3R4DA 4LOUC 1JNJA 5KOVC 3Q5YA 4QHNB 4CADB 1QFUL 3HE6D 2D03H 5FDWA 1QFWL 5CEYA 1RULL 3V4PL 3CFJB 4ZTPH 5IR1A 4FQJL 2YPLA 1XGYH 4HW6A 1IAIL 4QYOA 2WUBL 4NN5C 4QT5B 5D6DC 3HRZA 5T5NG 4PRPD 4NHUB 5C8JA 3G5XA 3QDJD 25C8L 3A67L 3ARGC 1U8HA 5T3ZE 4HJ0C 1XEDA 2DQHH 3HB3D 5EN2A 4P0DA 4U1LA 4LCIL 2NTFA 2KH2B 3DXAD 5FA4B 4X8JB 2XZAH 5DLML 4H5SB 2QADD 2ZUYA 3ULUF 3VH8B 4B50A 2P49B 3VD9A 1JPSL 5A2LH 3NN8A 1P4BL 3S98A 2VL4A 3SJVA 1I7ZA 2EO9A 1HKLH 1R24A 3K74B 5EUKB 2DI7A 4PP1D 5I8CA 1UADC 4ZTOL 4ZUSA 1A3RH 2J8UB 5GXBB 2N56A 3NCYP 1VFAB 4HT1H 5IR1B 4YHKH 4RMVA 5ADPL 4LSQL 4MJ2A 3CMOL 4Y4KC 1CE1H 3HMWH 4DK6A 5KZCD 1NCDL 4ALAL 4KZEH 1UJ3B 5I1EL 2WMPA 1NAMH 4RMQA 3D39A 1YEDA 1LEGB 1KN4L 1S7TA 3AMLA 3GSNH 2OK0L 5LWYL 3ARFC 5E8DL 3DO7B 2BNUB 2KUTA 4EI5B 1JE6A 2VXSL 1FZKB 4OQTA 3CD4A 4AEHL 1NEZB 2IH3B 1EIBA 5C0AB 1CBVH 4R7NA 3QBTB 5B8CA 4XVTL 1LNUA 1MNUL 1OW0C 5JO5A 3RVWC 3FN9A 1RZFH 5AG9A 5D7JC 2Z0BA 4LFHG 3FO2A 3WNPA 3RGVA 3OZ9H 3GUTB 5H37G 5FO8B 4MA1C 1RJLB 4R0LC 1UXSA 3S37X 2X4NA 2VDLL 5CJQL 4XCNB 1JGEA 4EI5C 3ARBD 4PJHF 4P23C 3T2NH 2A9NH 3E2HB 5DR5L 4JGMA 4XP1L 4G9FE 1CD8A 5E9DD 3P4NB 5FFLA 4KK8C 2NX5B 1PEZA 4EDXB 3AU1B 2UWEB 3QDAA 3DECA 5ANME 5D71H 4JFZL 4TUOA 3MLYL 4HJGB 4ZXBC 2DM2A 4KJQC 4RDQG 2AEQH 2EH8L 1I7TA 4LKCA 2AKRA 1IAIM 1VACA 3WLBB 4UILH 2QV2A 4UV4L 1H5BA 3G6AB 1QSEB 2X70B 4PR5B 4Y4KA 4YE4L 5HVWA 2CIIA 4BSVB 4NP4H 3ARGD 4PJDA 3C9NA 1MCEA 1AO7D 2O5XL 2VL5B 4AQ1B 3WFHA 4CVZA 1JZ6A 2VSCA 2YMXL 4XCCL 1P7KB 5DJ6A 3QRFM 2JJSC 1A0QH 1EA9C 3DI2B 1P4IH 1UG9A 1XH3A 1MJ7H 2Z35A 5DVLA 1T83A 3TJEH 5HGBB 1EERB 1C16A 4WTZG 1IGML 3HE7B 5LGJB 1IAOA 4HWBL 3DVGA 2BNUA 1FAKT 3O45B 4QNPE 3MOAH 4HCRA 1V05A 1T03H 4X4XA 5F9JB 4GMTH 1X6NA 3LRSB 4HPYH 1NEZG 4G6JH 5EO9B 5I6XC 5TQ2L 2AABL 4L4TD 2Y23A 5I1LA 1B0GA 3E2HC 3WKMH 3M17A 4G42B 3ARRA 2G75B 3BPOC 4TULL 2D0GA 4RMTA 4GMSL 1ZLUK 3V7MA 4HIHA 4MDJA 5AEAA 3DX7B 5IKCB 2AGJH 3OG4B 3IETB 3QUKA 4KROC 2FD6L 1EEYB 3OB8A 5BZDA 1CL7I 3S5LG 4PRIE 3TZVC 2UVFA 3A0OA 3AS0A 3QCVH 4NCDA 4JANA 5EA0H 4W6XB 4YUEH 4LCCC 3R06B 3I85A 3GSNA 1INQB 4XP9L 5C0CE 4QTIH 5TE6H 5IW6A 4O4YL 4DKFL 2Y36L 4M3KB 5EOCH 3CFBB 5CZKA 1TQBB 4UT7L 5H37H 1PKQA 1GGCL 3ZKMD 5DDHB 4KROD 3RKDD 2WIMA 1LK3H 1CGSL 2GK0B 4L8BB 5GQBA 1N4XL 2K1MA 2R23A 3MRLB 4PJCF 1QRNB 2BXYA 5IB4A 5IGXL 2FSEA 1KPRB 1KPVB 4KKLC 4F7MB 1EHXA 4QWWD 2G9HA 3DVNA 5T3XL 3OJ2C 2JJUA 3VMPA 3QEGL 1OAKL 3DX8A 1BHGA 3DV4A 4ZXBD 3N50A 3BKCL 5HDOA 3MRBB 3KXFA 4ZPTB 2YPVH 3JUZA 5CSGA 3DWTA 4LCUA 4FP8H 4J3OC 1CBVL 5HHOE 3GI8L 2UUDH 1HWHB 3B2UC 3BPOB 4PJBA 5JHDA 4L1DA 3EDEA 3QULB 3IVKA 1JUFA 3C2AL 1A7BA 1JPTH 3CX2A 4LARL 5DK3A 5I1CL 5CP7B 2FX8L 4X6BA 2DS4A 2HT4D 4FG6D 3O11B 2MSPA 5ESAB 5HYJE 2V5YA 1MCOL 4P59L 1BD2B 1BM3L 5L2KE 4RGOH 3UTSA 5D7JD 1OT2A 2YS4A 3QUZC 5DGQA 1BQHA 1CDUA 2VC2L 4F15C 2DLTA 2ZCLH 2YXMA 5MEND 3DRQB 5GRJH 1ED3B 3AMKA 1T0NB 5C0EA 1VFAA 2ZSVA 4YXLL 1FVEB 5KANG 3GMMA 2DLHA 4AIXA 5ID0B 3QO1B 3BZ4B 4AEIL 2F19H 3PE9A 4P3DA 3KR3L 2VH5H 4L4TB 1XF2A 3QQ4B 1GGUA 1CDIA 1DQMH 4FZ8H 3GM0A 4ZO6A 4M9PA 4NP4L 4D94A 3UXFA 2HKHH 2YA0A 4V1DE 1SEBB 2NX5D 1RZKC 5GGQL 4EUPB 2CKNA 2J8UE 3WFBL 1YYLL 1TNNA 4F37K 4GLRH 2GJ6B 3ARGA 4NC1C 1AY1H 4A6YL 4P2RE 2CKBA 5J4MA 2D7PA 1K5NA 3CXHK 3DIFA 1FDLH 1EFXD 3MBEA 4WUUE 2AXGB 3DRTA 3WE6A 2XWTB 2X41A 4JCMA 3P30H 4JM2A 2WQRA 1AFVH 5C08E 4JG1H 4CKVX 2J4WL 5GSRA 5FOBB 1OAZH 5GZOC 3ZSSA 4KRLB 1JHKH 2DWDA 1D6VL 4UAOC 4LHUA 3QIUA 3NABH 2VZTA 3LS5L 5E8NA 1W72A 5IM7A 3ULVD 4HUVA 2JE8A 2F8OA 5C0IA 2BVUA 1BWWA 1JNHB 3MA7A 3QNXA 4XPTH 3L7EB 4NHCL 5DC9B 4CU7A 1HQRA 1G6RA 4M48L 3QQNA 3FQWB 1Y18A 3SCMC 3MACL 2BX5A 1F8TH 1RZKH 2UWEF 5C0EB 1DSFH 1TVHB 5F96L 4HGWA 4HKXB 1VACB 5DD3H 1P4IL 5J11C 1KXTB 3QO1A 4LMQI 1KPUB 1ZAGA 4Z18A 4FQ2L 4TRPH 4KV5E 5JQ6H 1G7LB 4Q2ZA 1MCHA 4JJ5B 1FNSH 1EHLL 5ERWB 5J12B 2Z91B 1H3PL 3MUZ1 2BSED 4JO2H 4R4BB 4HXAL 4HG4J 7CGTA 4I0PA 5I19H 3PV6A 1LP9B 1S5IL 4U1MA 4GW5B 2ZCHL 4XT1C 4IBLT 1KIPA 1W0YT 2WIIA 1LD9A 5DD5L 3QWQB 1YMHB 3VXSA 2D4DA 2HJFA 5KSAC 4U31A 1ZWIB 3GRWH 3RDTD 5B8CC 2WBJC 3FTGA 1EBPA 5J3HC 1P5VA 1TCMA 4X6FB 3U1SH 2IPUK 5EA0L 5BVJA 1HSAB 2HN7B 5DD1H 1O7SA 3U0TB 1ND0A 3SE4C 3BQUA 5DHXB 5BMFH 2K9UA 2VLLB 4I0KA 4M5ZH 4YXKL 3BDBA 1TZIA 1T7WA 4YO0A 2UUDK 3R1GH 1KLUA 4UINH 3ESUF 3GSWA 1P6AB 1XZ0A 3GMLB 3LKQB 1S7TB 3G04A 1ZVSB 1B2WL 3VXNB 3QI9B 15C8H 5L0QC 1C08A 4WFGE 1XR9A 2B2XL 3LHPL 1WV7T 2WIIB 4KI5E 5M94B 4NJ9H 4NRZA 5FM5M 5F8QC 5MENE 4DQOH 3VGBA 4L4JA 4KJPC 3BIKA 5TH2A 4E42A 3CMGA 2JTDA 3QG7L 3LKOA 1U91B 4KMLB 1BD2D 4G5ZH 1A0QL 1JWUB 5I1AA 4LLQA 1MCPH 3AB0C 4CRPA 4LNVA 2IFFH 3REWB 2KQNA 1MH5A 3MV11 1T0MA 4M8VA 1HILA 3MJ7B 4R90L 3GB7B 4G6FD 1WK0A 3X12A 1FO0H 5DEGB 5JDSA 1DLHB 1SJHA 2HH0L 3L3OA 2YEZA 5IQ9B 3QFDA 3RBSA 4FZEL 3CLFH 3ILPB 4MAYB 1QOKA 2OQJA 4KHXH 4I18A 4NBXB 5F7HA 4WW2F 3O6LH 1FL5A 4GBXB 2CIKB 1AIFB 3QWOB 1AP2A 4KI5F 3EFFB 3LOWA 3BIBX 4AM0A 4M02A 1IC4H 4P46D 5GZND 1JZ8A 1FNFA 4OCWL 1OAQH 4JM4L 5D9SB 5LBSH 2CK2A 5BW7C 1MHHB 2GJ6D 1A6VH 5D2LF 2MQ3A 5HYJB 3VXMA 2Z92B 3LKOB 1U3HD 4XP9H 2IG2L 5LXGL 5ISZD 1XH3B 1R3IL 3L3JB 5IP4A 2BJML 4M48H 4IRJA 1CICC 3H3PL 1IZKA 3VD3A 4TUOB 4W4OC 4JFFA 4OLXL 4OZ4A 2DIJA 3GMPB 1AGDB 3VFUB 2DQJH 3MUJA 5JORA 1I4FA 1FVCB 2D0HA 3WLBA 5C0FB 4G6ML 1OD7A 4BZ1L 1QSEA 4Y4KB 1AY1L 4A6YH 4K3JH 4IRZL 1UEMA 3KDMB 4CJ0A 5IGXH 2EIZB 2JKXA 5D5ME 3T3ME 4ZSOE 3TNMA 2EICA 5E2UL 1FE8L 1MRFH 4NZUL 1RHHA 5CEZH 4QHUB 1RD6A 4I3SH 5CJXA 1DEDA 3I2CL 3QNZB 2ZCHH 3SKOB 4MD0B 5C07A 3P9LA 1T3FB 1U8KA 2AQ3A 1S9YA 3FONB 1A7QL 4MWFB 1GHFL 4PTTB 5MERB 5DTFB 2ZUSA 5GGSA 3PWUB 3B9VA 5EU6E 1C5DB 4P59H 2IALB 3P11L 4PY8I 4RGOL 4LSPL 1HHKB 4XI5D 2N7AA 4KDWA 1UKQA 3H9SD 3NZ8B 4MA7H 4P3CH 3GSUA 4ZQKB 3CDCA 4P2QA 3VMNA 1ULVA 1KTKE 1XF5B 5C0JA 4RMRA 1JFQL 3TNMB 1LEKA 1K2DA 4JO4H 5JHLH 3FQNA 5FAAA 2ITCB 4OM1H 2P44B 2LAGB 1EEZB 3PWVB 1SEQH 1SVZA 2EEAA 5EUOB 3UP1A 2Z31C 1Z5LA 3STZA 5J56B 2X1XR 1B4JL 1T20A 4PRNA 5ABDE 2Q3ZA 1EGJL 3SPVA 3PF2A 3DGGA 4M1CD 1C12A 3DNKA 3B5TA 1G0XA 3MLZL 4PJDE 3I9GH 3KNBB 5DRZB 4ZAKC 5IW1B 4HLJA 1AGFA 4PLNC 4PG9A 4MA8H 5I8OL 2JJWA 2GIYA 3AC0A 4UIMA 2YN5A 3K4DA 4DN3L 5DZOA 1QR1B 4DW2H 3T0EE 3TO4C 3VFMA 1VPOH 1X5GA 2X89A 5FKAB 3TGXA 1TJGH 4AY0A 3MO1A 1EAPB 2P5WA 4GKOA 4FQHA 5F7DA 2BSSB 5FF6A 5I1JH 5TDOA 1OSPL 3LAFA 1JGDB 1P7QD 4FA8A 1LO5B 1KIQA 3EUUA 1NCCL 1NFDF 3MRGA 2DYPA 1QFWI 3UJJL 2PXYC 4JQIL 4Z7VE 5ILTH 1IM9D 1H9VA 2F5AH 5E4EC 3WNKA 2E7LC 4M6ML 5ID0A 4RIRB 3O6LL 1ZMYA 3IRZA 1T1WA 4AG4L 4YX2L 4BUGA 5CJOL 2W65A 4KKAC 2X6MA 1MJ8H 2V5TA 3KNBA 3QUXA 3QUZB 3MXVH 2BFVH 1FBIH 2FBJL 1RZKL 1Y0LB 1AJ7L 1A4JA 3GMLA 3LKQA 1F3DJ 1JMXA 4K8RD 2VQ1B 2FX9L 2FL5B 5I1HL 1KB5A 1NAMA 3D1MC 5DD3L 3HHRB 1ZHNB 4MD5B 3VDBA 3O2WL 1SBBA 4DCQB 5DXWA 3P2TA 4RZCA 2UY6A 4PD4J 3GBNL 4JQXC 3ZE1E 4NQDD 1JYNA 1NUFA 3L5WA 3RWJB 5F3BB 1NBYB 4GKNA 1KNOA 1DLFH 4RQQB 4YZFF 5M7QA 1MAMH 3V95A 1U36A 2WUBH 5ALCL 3S3SA 3MV9E 2DD8L 4JEGB 1LE5A 3KLHD 1FZMA 2AVGA 5DD0H 4EXPX 1WZ1L 5EU5A 1JZ4A 1L6XA 1BBDH 3NCCB 5MHSE 2X4TB 1EJOL 1OQOA 3MRNA 3DX6A 1YEGH 1X4YA 2QQNL 3GSVB 3VI4F 4AH2A 4X6DE 1FCGA 3F12A 2VLRB 2UWEA 1SVCP 4G9DA 2AEWA 1LHZA 1OM3L 3VRJB 4LRNL 3C60D 2EDDA 1TIUA 1I7TB 4LKCB 3KS0H 4JFQB 1BIIA 5D1QC 4WENB 1JPGA 2AK4E 4OKVB 5FGBA 3VA6A 3V6FB 3JV4B 1FFQA 2OMNA 2Z92A 3HLAA 3RGVD 2GI7A 3O3DA 4PRDB 1WCBB 2DMBA 3RNKB 5D2LB 4Y4HB 1QACA 5DK2A 5I66B 5D7IB 4Q6IC 5HJ3B 3PL6D 1RVFH 4ODHH 3ZL4L 3ZDZF 2N1KA 4IRJB 5SV3A 3GMPA 1FFNA 4YDLC 2HMID 4M7ZC 1NAMB 5E7FA 5D1ZA 3WIFB 4S1SL 3U9PH 4OF5A 3MLVH 3KLSA 5EU5B 4PGZA 1CTNA 1F4YH 5HGHB 1PZUB 3OPZH 3V0WH 4XH2B 4OCXL 3TO2A 1AI1L 1MRDH 2WP3O 1BVKA 2FATL 1YJDC 4RAUA 3BH9A 4NN7C 4PREA 2EKSA 3TBSB 3VFOA 3EW3B 3DOSA 2VKWA 3O2WH 2JB5H 3QWRD 3QAZC 3H6JA 4JZJB 3CC5A 3QAZB 1CIUA 4XNXH 5JXAL 2R2HA 4HIHB 4HMEA 2HG5B 3IFOA 2YD1A 3DX7A 3WD5H 5T3ZD 1H8NA 4Q58C 3BI9X 2RB8A 5I17B 2FHFA 4OZGE 3T3PF 1IGIL 3JXAA 5BS0D 1FO0A 2LU4A 4FZEH 1UQSB 4AT6B 2DQGL 1NUNB 1S78D 1FZJA 4X6EB 2VDPL 3HG1E 1HCFX 2FYYB 3SJVB 4IHOB 1WAAA 3S36L 5KVMC 4YDIH 5C9JA 5GGUA 1HIML 4O58H 2A2QT 3QIUC 3FB7A 4RSVA 2IQAA 4OGYL 4YHPB 3MNZB 2IQ9L 5SWSB 1JPGB 3VWKC 1A6VL 1YN6A 2QBWA 1I8MA 2YPKA 3KYOB 4LHQB 3BH9B 4GKSB 4Y1AB 3FQNB 2DLGA 5ID1B 1N59A 2ATKB 4PV9B 3OJDB 3X14B 5L8LB 2MJWA 4KMTL 2VXUL 1HXYA 5FYJL 4FQXA 4F2MB 3WIFA 1HNGA 2AJ3B 2DQFA 4KC3B 4BH8A 5TGBA 3RU8L 5EULV 3DUUB 5ESQB 1NPUA 2NZ9C 3P0YL 3QZWG 1YPZE 4H88H 4K94L 1LVEA 5ACMA 5HBBA 3WV0A 1ZANH 5JW3L 4IRSC 5B8CB 1PG7X 1XGTA 2MWCA 4J4PC 4RISL 5IB5A 3ZYIA 1MWAL 1T89C 4H0GA 2VDQL 5KVFL 3FFDA 4DFIA 1HZHL 3PWJA 5L2KA 4LGRB 4H8WL 1UXSB 1YC7A 2N7BA 1DQQB 4UOJA 2HKHL 4EUPH 3BP6B 5C0RH 3MJ8B 2J6EA 3S37H 2V9RA 2DF3A 3A6CH 3V5DB 1F5WA 4B53A 5KSBA 4XNXL 3FN3A 2IWGA 5E9DE 2PNDA 1XR8B 1IRAY 5L7XL 4MJ5B 1I1AA 1UB5A 2ITDA 2R56H 3PABB 1T1YB 1M7DB 1MFEH 4WV1C 3IAPA 1FGVH 4JFPA 3G6DH 4HPOH 4YHIB 1OL0A 4OV5A 1U42A 3UC0L 4ODSH 4MXWH 1VFUA 1BFOB 3VXQA 1FFRA 4YWGH 3BEWB 3VGDA 3O6ML 1S9KC 3RGHA 1N4XH 4LLUB 5D2LE 4LVHC 4Y2DC 2FJGB 2VDOH 5DJDB 4UV4H 3ULUH 7FABH 1P7QB 4JDZB 3MV7A 5CBEB 2EIBA 2BVOA 1G6RH 3BISA 4KTDH 3FAXA 1ZT7B 5E2TH 5EPMA 4MA8L 3V6ZB 3WIHL 3D18B 5KW9L 2EIZA 1OAKH 1Z6JT 3MRKB 2XOTA 3DMMD 3BRFA 4XXDA 1MFCL 1RZ8A 1QSFE 2VR5A 5EN2B 1G0DA 4OIBA 5GGVY 1A6WH 2WINB 4XAKD 12E8L 4NO0B 1PSKH 3OXRB 1XGQB 4F8TA 3PWNB 1JV5B 2CLZA 2HVJA 2EDRA 3E1F1 5D7KD 5EOTA 1IGIH 1XF4A 4PB9L 4MJIB 5EFIB 2B0SL 3ZTJG 3UTQB 4KFZC 3U7YH 1JGLH 4C4KO 1TCRA 1YNLL 1IILE 3QUMA 3DLQR 3TFKD 4WCYH 1D5ZA 1F4AA 4P2RA 3UPAA 1ZVYA 4OI7A 3ES6A 5AD0B 4CJ1A 4OCYL 4X83A 3DGCR 5CSBA 1T04A 2CK0H 4LLAA 1RIUH 3OR6A 4JFYA 4NN5B 1WBZB 3I6KA 5HPMB 1MRDL 4XRCA 4JRXA 2QQKH 3BHBB 1R0AH 1FG2A 3I84A 4LCYB 2PYFA 2LQRA 5GS0C 1BVLB 3GMMB 1TJHH 1BMGA 3MV8E 3CFKA 2VE6B 3S34H 5D72L 3GIZH 4P3WA 5KZCB 1YEEH 1LK3L 2P8MA 1ORQB 1E4WL 3MOQA 4OD2A 3CCHB 4N5EC 4NJ9L 2XNAB 5DA0B 2IPTL 3ULUL 1F42A 3GUTA 2VZSA 5BRZD 4OZHE 5IFHH 4LPTA 3BH8A 1G7JA 2GCYA 4N0UA 3IDNA 5D5MF 4K3DL 5C3TA 2G60L 1DN0B 5D7LD 4ELMB 4PJIA 3KPRE 1OAUL 4U1IA 1HHIA 3MGTB 1RJZA 5AUMB 2AV7B 5IW3A 4XC1L 3SE4A 3LKPA 4MGXA 4N1HB 1EEUA 5E0QA 1N2RB 3NACL 2Q86B 1D7FA 1BBJB 5HHPA 1KB5B 1RUKH 3AXLB 3LH2L 4HJGA 4QHLA 3UDWA 3B9AA 3FKUS 4L1HA 4QRTA 5HYQA 5FYKL 2ZSVB 1A5FL 4LSRH 3QDJB 3PQYA 1KTDB 3WNLA 5HVHC 3QJHA 4KMTH 1U0QA 3UTOA 4G6KH 3NA4A 2W60A 4OM0L 1VB9A 1F3RB 3P9WB 1DFBH 1TVBB 4HV8B 3FCTB 3FQXA 3P9MA 4DKAA 5ID1A 3MREA 2ID5A 4ZOAA 5IF0B 4EDWH 2G5BB 5BVPL 2X4PB 4RNRA 5MP6L 3GJFB 2HTKD 3U30B 3SGDH 5ICYA 2J8HA 4U1HB 1VGKB 4V1DD 5L9DH 5KVFH 4JRYE 4ODVH 2CLVB 1QKZH 2X4RB 2H3NA 1OP9A 3CFKB 2XQYK 4QRQA 2OR9L 3LRSA 5LAXB 2HLFD 3DV6A 1AR1D 1SY6A 3CFCL 1XGTB 3MPCA 4PIRF 4MVBC 1I7ZB 2NY4D 3LCYA 3EO0B 1L7IL 2X7LA 1W2KT 3HRZB 2XNAA 2EDTA 3T0XA 4NUJB 3HE7D 2LE9A 3MRRA 4WEUD 1QFHA 5DUPL 5ICZB 1V3JA 1RUPL 3QA3B 5DURB 1G7IA 4TTGA 3MLPA 4GAJH 4I77H 5E99L 5HVFB 3M1BA 1IGFH 3QFJA 5TDNB 2VDMH 2WWMC 3TT3H 4NO3B 1WT5C 2P8LB 3BW9A 3MA9H 4YBQD 2B0SH 4FN0A 3GNMH 4PRPE 4QRSA 3FB8B 5CMAB 5D1QA 1A7NH 5F6IC 4BZYA 2BP3A 5D5MA 3BPLB 3D2UB 4LF3B 3MLTA 3WNNA 2VRAA 3L3GA 4S0TD 2QTEA 3NFPA 1IGYA 3VFOB 4ZAKB 4Y4HA 4MNQA 3VXUE 4F33A 5F88B 1IKFL 2CR6A 2XTJC 3MMEA 4NQVB 3NTCH 2Y1VA 3Q6FA 4XWGL 3KPPB 5FYJH 1OTSC 2X09A 3C6SB 4NNXA 3SBWA 2VXQL 4OLYL 5DZNA 3DHJA 4D3CH 4NZRL 3MLXL 4K8RH 1KIPB 3BP5B 3ECBB 3UBXG 2EDJA 1QLEH 1Q9WA 1FZKA 4IDJH 2ICWA 1I1YA 4XP5L 3IU3B 3QG6B 1CR9H 1QUNA 3HNSL 4PJXB 1MLBA 3MRKA 43C9A 5E8DH 3GMOB 3JVGA 1UWGL 3V8OA 3CLFL 3CDGB 1MCKA 3GKWL 5CCKH 3Q5OA 4PJFB 4WI2A 1DTUA 1A14H 1AXTL 3PP3H 2PTTA 3CDFA 4OZHB 2WZPD 4Z7UA 4NJAH 2Y5EA 2X4OB 4U7SA 3OXSA 5GIRA 1G9MH 1IGJB 3CSPA 4YDKL 2W0PA 4R0LA 1KCRL 4F7CA 2DQIL 2X1WL 4LVNB 3KPLB 1OTSD 2XWJB 5ADOH 3BGAA 5FB8A 4PGDB 4JDTH 4YHOL 5D8JL 4Y5VC 4HUXB 4Y5VA 3LQAH 1YN7A 3MFGB 4P57A 4YXKH 1T6VN 2VLME 3CFDB 1I3GH 3DUUA 5ALBH 1ETZB 1S7XB 1WWBX 5HTSA 4Q0XH 1U8QB 5AZ2H 1MLBB 4K3JL 5ISZE 1M7IB 2Z8SA 4ZUWA 2Q6WA 4Z7WA 3HR6A 2R69H 5IB2A 3EYUH 3OJDA 3MC0A 3UJTH 4MDJB 4Y2DA 2UZYB 4B7LA 2E3VA 3ABZA 4HEME 4YHZL 3BE1H 3C6SA 2X4UB 1JNLH 4PGCA 4ZNCD 4OD1L 3SDDC 1J0JA 4E41E 3ARQA 3UBXB 4H20L 1I1FA 1G9NH 1YEHH 3GMRA 4KTDL 2Z31D 3RNQB 1VSCA 3EDJA 3OSKA 4JRYD 5IMKB 5E2WL 4TNVK 2KKQA 4YHYB 3Q2CA 4I18B 2EXYD 4OBSA 3THML 2YK1H 4PGEB 4WFHE 3EFFA 4XMLL 5J57B 2CJUL 1A64A 2NY2D 5DS8A 3VXUA 3M07A 2G5RA 4JY5H 3QNYA 4Q9RL 1XF1A 3NOIA 3BVNB 1KTLB 1T66D 1KN2H 4YZFE 4D0CB 1A4JB 3QDME 4WHTA 3D0LB 4M6NL 1KIRB 2FEDD 4JFFE 5FUCE 4R7DA 1KG0A 1YY8A 1BBDL 3BXNA 2XZQH 3ZDZE 4FABH 1IKNA 5D6CB 4CU6A 3MBXH 2NW3B 4OCYH 1T80A 3BEVA 5C0GB 4TSAH 5GRVK 4UT6H 2GAZA 1ZT7A 1S3KH 3EO1A 1JWSB 1RUQH 3NGBB 4F58L 3QDGB 1AD0A 1TZGH 4ONHB 1RUAH 4XNUL 1YEFL 4OFIA 4XBEL 4MXQD 1L7TH 4C83A 2BNQE 2XG4A 4Z0XB 4HIEB 43CAA 4H1LG 2BSRB 4RFOH 3LN4A 4X0KA 3TESA 4G6MH 4POUB 4PGCB 3GSRA 5IEHB 3HNVH 2Q7YB 5CBEA 2BDNL 1G7QB 3SN6N 1AHWB 5DHYB 1FYTB 2FIKB 4KQ3L 3KPRB 1TDQA 4POZD 5IMKA 4HFUL 3LKNB 3TIDA 1G84A 2ZPKH 2MCPL 5IFHL 3HNSH 3U0WL 4EI6A 4JQIH 2HFFA 5T3XH 3U0TA 4LCWD 1RJYB 2HKFL 4LSDA 1ONQB 1CI5A 2G60H 3BP4A 1G7PB 2NZ9D 1LDSA 3ALWA 5C2BH 4TVSa 5EU6D 4S2SA 2VJXA 1R6VA 1YQ2A 2EH8H 4R6UA 4D0BB 4H0IA 5B39G 2OZ4L 4ZFZA 3OR6B 2YD9A 3NMEA 3MODL 2EE6A 2QKIA 4LVEA 2V9QA 1REIA 5J7CC 2VITB 2L0DA 5GS0L 3SDDD 2P1YA 5C09E 1NMCB 3DPBA 3QO0B 4RX4A 1CDHA 3DROB 2F5BL 4OLWL 1JTPA 4NC2B 4K07A 1DCLA 4QTIL 1I1RA 2VDPH 4HXBL 1YY9D 2DQEL 2D7OA 2QSVA 2FB4L 1LEIA 4I0CC 3RZCA 2C3VB 1CGXA 4GFTB 4N8CH 1MAJA 5JHLL 3NFPB 4UZGA 1WFNA 4MQ7A 5GRJL 1HIMH 3QI9C 4NC0B 2JB6B 2V2TB 2APBA 3TPKA 1JRHL 3UYRH 5D70L 1MAML 3SGKA 3IFLH 2FL5A 3ORJA 4P5TA 2AJZA 2ZG3A 4FTVD 1PEWA 1PY9A 1T66C 3BSZH 2R4SL 1T7ZA 3BYYA 4GS7B 1FL3B 2ADGB 3T0ED 4L8CA 5C3LD 2F54D 4UV7L 2EO1A 2OTWB 3GSRB 3NN8B 1PFCA 3IDGA 5CZVH 1Z3GL 5E8PB 3T8XB 4MAYA 1ORQA 3WJJA 1YEHL 5I8EB 5KS9B 4UQ2B 1UA6L 4C55A 4ZUVA 5HDLA 1VPOL 3N1MC 4JFDD 1CLYL 1G1CA 1JK8A 1YUHB 4PRPA 4DEPC 4HKXA 3FB7B 3SDAB 3P0YH 4FQIL 1R5VA 4H88L 3CFEB 4K9EH 4NKQB 5F44A 5DHVH 3THMH 4U1LB 5IFAH 5BZDB 1ZVHA 4LLVA 1CVSC 3AS2A 1XIWC 3B8SA 1UC6A 2GUOA 3C08L 3TN0A 2Q3AA 5KVEH 4G6AD 2HTLC 5E5MA 2GTWB 4Q0XL 4WFHD 2YUVA 3WS3B 3D25A 3S88H 1GGCH 4XCEA 4P5TB 4JFZH 3SY0A 3X14A 3EKCA 3UTZB 1CG9A 1EEQA 4JFOA 4ODUA 4JY6A 4CN4A 2EYSA 3DXAB 5GS3A 1EVUA 5F1IB 5C6TL 2ADJA 3VXRD 3I50L 3CZFB 5J11B 3CFDA 1UACH 3WFEL 1RZGA 2OI9C 1DUZA 3IDUA 4QRQB 4RFEA 4S0SD 1EGJA 1DBBL 4OI8A 2O5YL 3EO0A 1OY3B 5SWSE 5L88L 2D9CA 1BGXL 1BZQK 2RFXB 3OKOA 2VXTL 2R56L 4RAHA 4PJCE 4F58H 1QG3A 1A7RH 3W11C 1FFOB 4RNRB 4N8VA 4NQSB 3EYOB 2HN7A 1R5VB 4L3AA 3BESR