3HZPA

Crystal structure of ntf2-like protein of unknown function mn2a_0505 from prochlorococcus marinus (yp_291699.1) from prochlorococcus sp. natl2a at 1.40 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
MSSKEEILSILEAFASTERMGSFFLDNATADFLFIRPSGNPLDAKGFENMWSSGDLVLESAEITKVHKFELLGSNAAICVFTLGSKFTYKGTQNDDLPTVTSIFKKIDEKWKVAWMQRSSGQSDMTLW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NTF2-like protein of unknown function
publication title Crystal structure of NTF2-like protein of unknown function MN2A_0505 from Prochlorococcus marinus (YP_291699.1) from Prochlorococcus sp. NATL2A at 1.40 A resolution
rcsb
source organism Prochlorococcus marinus
molecule tags Structural genomics, unknown function
total genus 24
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2009-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12707 DUF3804 Protein of unknown function (DUF3804)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3hzpA00
4K1UA 3F8HA 3H51A 3LYGA 1O7NB 3E99A 5JPPA 3EC9A 8CHOA 3DM8A 3EX9A 2OWPA 1OF5B 3HX8A 4LEHA 3FKAA 3KE7A 4XDWA 2Z76A 3F9SA 5IF6A 3NV0B 1OPYA 3H3HA 4U13A 1QMAA 2QIYA 5CXOA 5HGRA 3DUKA 3GRDA 5KP4A 3VSYA 3FSDA 3UJMA 1ASKA 1W01A 1IDPA 1Z1SA 1HKXA 3GZBA 2HMOB 3FLJA 4XDVA 1JB5A 3OV4A 4HM6B 4HM5B 2B1XB 3EBTA 4STDA 3EHCA 3G0KA 1O7WB 2XR8B 2RFRA 2HMNB 1OF5A 2R4IA 4XM4A 3NV0A 3ER7A 1SJWA 2XSOB 2K54A 2Z77A 5EVHA 2JQ5A 2GEXA 3KSPA 4L7KA 1W02A 3CNXA 2HMKB 2YFJB 1W00A 5STDA 3MG3A 3RGRA 3JUQA 3MSOA 4WWUC 2GBWB 4L8OA 4LGQA 3GZXB 4R9LA 3M8CA 3HK4A 2RCDA 1ULJB 2XSHB 1DMMA 2IMJA 4KVHA 2F99A 4IIAA 1JN5B 3KZTA 1UUWB 1OHPA 3LZAA 5IG4A 5D81A 4I4KA 5AEUB 2UX0A 1E97A 4HM2B 1E3RA 4OUQA 5KP1A 1S5AA 3JUOA 3F7SA 1U5OA 3OX9A 3NBRA 3DMCA 5FW5A 3FF0A 1K41A 3NM2A 1OGXA 3G16A 1OH0A 2F86B 5CLKA 1JB4A 3FF2A 3DXOA 1STDA 4Q53A 1Q40B 1DMQA 1OCVA 1W6YA 4HM0B 3WMDA 7STDA 1JN5A 2CHCA 3B4PA 3OWUA 3F40A 3Q90A 3IPTA 5G2GA 2GXFA 3GZYB 3EQQB 4LMIA 2BMOB 4RZMA 4PEJA 3D9RA 4H3UA 1GY6A 4XB5A 3CNMA 1WQLB 4HM8B 3SEDA 5CK6A 5BXQA 3A76A 5IG0A 1OHOA 1OUNA 2BMQB 3S5CA 2XRXB 3CPOA 1Q42A 2YFIB 1O7HB 1ISKA 1JKGA 3GZRA 4HKVB 5AIFA 4ORLA 1Q40A 3EF8A 5D83A 4HM7B 5IEPA 6STDA 3B7CA 1UUVB 1OGZA 1ZX2A 5DRVA 3MG1A 2QGUA 3RGAA 1O7PB 2STDA 4HJLB 4R9KA 4WP5A 3VGNA 3OWSA 4R1KA 3UNLA 3EN1B 1O7GB 5IENA 2HMLB 1GYBA 3MHEA 3F8XA 3B4OA 3EN8A 5BVBA 1GY5A 2Z7AA 5AIGA 3MKIA 2GEYA 3OWYA 1DMNA 3T8NA 4XBYA 2GBXB 1OHSA 2BNGA 4HM3B 2BMRB 4J9AA 3MYTA 3K7CA 1E3VA 1TUHA 3OXAA 4K1VA 1JKGB 5AI1A 2A15A 5CF2A 3JUMA 5IG5A 5JPUA 1EG9B 3I0YA 4HZBB 3F7XA 1GY7A 4OVMA 4MJDA 3K0ZA 3T8UA 2CKFB 4X2HA 4WYKA 5AIHA 2YFLB 3G8ZA 1JB2A 5KP3A 5DREA 1CQSA 3NUVA 1VZZA 5IEOA 4CDLA 3SOAA 1ULIB 2PZVA 1EA2A 4HM1B 3SOYA 2I9WA 4GB5A 4FCJA 4X2OA 3ROBA 1ZO2A 1QJGA 1C7HA 2RGQA 2INXA 3EJVA 1NWWA 3MG2A 3JUNA 3FZWA 5TGNA 4XBXA 2HMJB 5IERA 3DZLA 3BLZA 3GWRA 5AIIA 1A2KA 2W2CA 3HZPA 3NXJA 4HZ9B 3STDA 3EBYA 3CU3A 5IG3A 1NDOB 5D82A 5CF1A 3ECFA 1GS3A 1O7MB 4N3VA 1TP6A 3KKGA 4XBTA 4HM4B 3JUPA 3FH1A 1BUQA 4WYKB 3FGYA 4L8PA 2F98A 3NHXA 2B24B 4HVNA 4FCMA 1NU3A 3BB9A 2HMMB 1AR0A 4J8TA 5AEWB 3F14A 3B8LA
chains in the Genus database with same CATH superfamily
4K1UA 3S27A 3F8HA 9RNTA 3H51A 4N6TA 3LYGA 1O7NB 3E99A 3LTBA 5JPPA 3EC9A 4ZM8A 3DM8A 3EX9A 2OWPA 8CHOA 4FMAA 1HU9A 3VF1A 1KD14 3LOYA 4HAAA 3X3YA 3HI7A 1ZS7A 2BIRA 1OF5B 2CH9A 2XEPA 3HX8A 4LEHA 3I563 3FKAA 1RDSA 3KE7A 2CFGA 1N9EA 4XDWA 1ROVA 3V98A 2Z76A 1W2B2 3F9SA 1BSAA 5IF6A 4OK0A 5GSPA 1JRQA 1GMPA 3NV0B 1OPYA 2ZA4A 3H3HA 4IT7A 1FW7A 4LSOA 4U13A 1FZUA 5BU4A 1QMAA 2OCTA 3EB8A 2QIYA 2MF7A 1RJOA 2HOHA 1UCLA 5CXOA 1BNIA 1UCIA 3CD63 5HGRA 3DUKA 3GRDA 4MMYB 5KP4A 1NB5I 2AADA 3KFQC 2BO9B 3QRDA 2RSXA 3VSYA 1VQ63 1I8VA 3FSDA 1T2IA 2UGIA 3SYUA 3UJMA 3BU4A 6GSPA 1Q9EA 2P09A 7RNTA 5AYSC 2LQVA 1K9M4 1ASKA 1W01A 2BHMA 1WTHA 1YVSA 4N6UA 1BNGA 1BRSA 1EQKA 1IDPA 1I3FA 4BTYA 1MNLA 1Z1SA 1X1UA 1HKXA 1W6GA 2Q07A 3GAXA 2L1SA 3BNBA 2YX9A 3DH2A 3Q2PA 3RNTA 3GZBA 2HMOB 5AYRB 1RNBA 3FLJA 4XDVA 3PGBA 1BANA 2H0IA 1BIRA 3FCSB 1JB5A 3OV4A 4HM6B 4HM5B 2B1XB 3EBTA 2SBLA 4FMDA 1MGWA 4STDA 1YIJ3 1I2EA 1Q824 3G6E3 1RN1A 3EHCA 4KZ1A 3UL6A 3IJEB 1MOLA 2JDIH 3G0KA 1V74A 1O7WB 2XR8B 1KQS2 3CXC2 2RFRA 3UB1A 2HMNB 2GU3A 1A67A 1QVG2 1NO3A 1OF5A 1WNHA 3Q1CA 2R4IA 4XM4A 1AY7A 1RGHA 3CC73 3G4S3 1BUJA 1LQMB 4WFOA 3MPHA 1KC84 1RCLA 1PFPA 3NV0A 3ER7A 4KFFA 1S723 1SJWA 2XSOB 2K54A 2Z77A 1GOYA 1HZ1A 2RBIA 5EVHA 3CCV3 2JQ5A 1VQN3 2W9QA 1DVDA 2ZDJA 1BRJA 3A5EA 1RGKA 2KRTA 2P05A 1GSPA 2GEXA 3K63A 4HYZA 3KSPA 1A90A 4FR9A 4L7KA 1UUGB 1W02A 3CNXA 1I70A 1JV2B 3O8YA 3AHSA 1TJDA 2HMKB 1VQK3 2YFJB 1QAKA 2ZHXB 5LC7A 3N9HA 3CME3 2CX0A 1LQGC 1W00A 2OOVA 5STDA 4FMBA 3MG3A 3WOEB 4I5QA 3RGRA 3JUQA 3IMAB 3NBBA 4HOHA 1M1K4 4TX4A 3DY5A 3UL5A 4KT3B 3MSOA 1GOVA 4WWUC 1BRIA 4J5GA 1VQ73 1LOYA 1BGSA 1UGHI 2GBWB 4L8OA 3WODG 4LGQA 3GZXB 3KN4A 4R9LA 2E2UA 3M8CA 3V99A 1YGEA 1FGOA 3DGYA 1BAOA 2RCDA 3HK4A 1UDII 1SIHA 1ULJB 2XSHB 3LT8A 3LXUX 2D1WA 1Q864 1DMMA 2IMJA 1X1XA 4KVHA 1B2MA 1YJW3 2F99A 2WO0A 4IIAA 1W4NA 1JN5B 2XGNA 3KZTA 3PCSA 1R4CA 1BSEA 1UUWB 1T5YA 1OHPA 4JF8A 3V92A 1B2UA 1FGTA 1BRNL 3LZAA 1IT8A 1TTOA 2PNCA 2IUKA 5M1AA 1RLSA 5IG4A 3LTAA 5D81A 4I4KA 3ZG5A 5AEUB 2OOVC 2UX0A 4MEIA 1FGQA 2BU4A 2CG1A 1GD4A 1BRHA 1RN4A 4RNYA 1YJN3 3T0UA 1E97A 1RSNA 1WMNA 2M7OA 2IY2A 4HM2B 1E3RA 4OUQA 5KP1A 3ALAA 1RGFA 1N5HA 1S5AA 3AGOA 3JUOA 3X3ZA 3LTDA 3NM7A 4DKIA 1GMRA 4N6V0 5ELJA 3F7SA 1U5OA 3OX9A 3EE1A 3NBRA 1LOXA 1SARA 3CCE3 3LMLA 3DMCA 1EUIC 4AKYA 4G1MB 1VQM3 4AKZA 5FW5A 3LT9A 1IQXA 1RRHA 3FF0A 1K41A 3CCU3 1BOXA 1UGIA 2W04A 1B27A 1AQZA 2SARA 3NM2A 1VQP3 2O3OA 1M9GA 4EYCA 2IUJA 1OGXA 1AV4A 3G16A 4R80A 4EXRA 1OH0A 2QA43 2F86B 3N8BA 5CLKA 1JB4A 2KF5A 3BNCA 2Z6BA 1UCKA 3FF2A 4RNTA 3DXOA 1M904 3K9MC 1STDA 3GSPA 2H0GA 3U97A 4KFEA 4Q53A 5JBSA 1Q40B 1Q7Y4 1DVCA 1T2HA 1DMQA 3NBJA 3S28A 3PS8A 5LC6A 1TRQA 1OCVA 1W6YA 2CW9A 4HM0B 3WMDA 2F5MA 1TRPA 7STDA 1UW1A 1QVF2 1JN5A 4LZIA 2CHCA 1D6ZA 3B4PA 1YVBI 2E2VA 5HOHA 1RTUA 1U8CB 1N9JA 2CK3H 1L5GB 1W2ZA 4NHFA 1VQO3 3OWUA 1RKYA 4N6LA 3F40A 1MWUA 3Q90A 3WR2A 3IPTA 4AEQA 5G2GA 2GXFA 3D5IA 3KSED 4EV5A 1I2FA 3EQQB 1B21A 2BMOB 3GZYB 4LMIA 4PEJA 4RZMA 3AMOB 3D9RA 4EC6A 2ML6A 1IVWA 2KCDA 4H3UA 1GY6A 2WOHA 2UUGC 3CNMA 1WQLB 4HM8B 4XB5A 3SEDA 1LXEA 1WMPA 1N5PA 2CWVA 4LYLB 1G02A 5CK6A 5BXQA 3A76A 1Y4KA 1BNRA 1BSDA 1RN7A 3X40A 1US1A 2CG0A 1YIT3 1IVUA 5IG0A 3HIIA 1DETA 1FUSA 1OHOA 1W6CA 2KXGA 2Y73A 2XF3A 3WOFB 1OUNA 2BMQB 5BIRA 5FGOA 3S5CA 2FXTA 3WA2X 4RBNA 1BSBA 2XRXB 1UCJA 1Q42A 3CPOA 3FG4A 1HYFA 2YFIB 2CC3A 1O7HB 1IYYA 1ISKA 1JKGA 4J5KA 2K0MA 2WOFA 3GZRA 5I97A 3SXXA 4HKVB 5AIFA 1B20A 2CWUA 1V57A 4ORLA 3WA3A 2BT3A 5M19A 1VQ83 2GU1A 1QALA 2E2TA 1J2BA 1Q40A 3EF8A 5D83A 1VQ53 1FGRA 2CIUA 1TIJA 2LYXA 2XGLA 4HM7B 5IEPA 6STDA 1TFOA 2W03A 3B7CA 3NQYA 1MWSA 2P38A 1W7CA 1UUVB 4BTWA 3PXMA 5G1LA 1OGZA 1ZX2A 2CWTA 1KSIA 5DRVA 3BNDA 4BIRA 1RGLA 3MG1A 2QGUA 3RGAA 1I3IA 1O7PB 1VQ43 1SIIA 3S67A 2STDA 1VQL3 4HJLB 3AMOA 4R9KA 3WHOA 3BNEA 1G96A 4WP5A 4R4KA 5M18A 4O2HA 3VGNA 3CC23 4NREA 1FUTA 1EEJA 1GOUA 3OWSA 1IK3A 4BL3A 4R1KA 1RMSA 3UNLA 3D3LA 5IW9A 1BU4A 3EN1B 2P0MA 3NQZA 2V1LA 1JJ22 1NJI4 2L4VA 1F8NA 2W56B 1YI23 3SX1A 1D6UA 1NNVA 1N8QA 3BIRA 1O7GB 5IENA 1MGRA 2HMLB 1JZDA 2MC8A 1GYBA 3FG1A 4K61A 2F5WA 2KAAA 3MHEA 3HOHA 2OTL3 1YNVX 3F8XA 3B4OA 1BRKA 3EN8A 5BVBA 1GY5A 2KF4A 2XFSA 1LOVA 2Z7AA 1AVKA 5AIGA 3MKIA 2GEYA 4MMXB 1YGWA 3DGLA 3OWYA 1DMNA 1IVXA 1RGAA 2W0QA 3KIIA 3SLUA 4BL2A 3T8NA 1RRLA 1IV9A 2FGTA 3PZWA 4XBYA 1B2SA 1RNTA 1WMOA 2GBXB 3DGMA 1OHSA 2BNGA 2CFKA 2QEX3 4HM3B 1N8R4 2BMRB 3MYTA 3K7CA 2CFDA 4J9AA 3D5GA 1E3VA 1TUHA 3OXAA 2IYJA 4K1VA 1RCKA 2CFWA 1BNFA 1GD3A 1DYUA 1JKGB 1IVVA 1YHQ3 5AI1A 2A15A 5CF2A 2IA7A 1B2XA 3JUMA 1YJ93 5IG5A 1OACA 3CC43 2WGOA 5JPUA 1EG9B 2H0HA 4CJNA 3I0YA 4GHOA 1A2VA 4O3VA 2O9UX 1FGMA 2J8XB 4HZBB 3F7XA 1Q814 3OW22 1GY7A 4OVMA 1BSCA 4GL6A 4MJDA 2WGQA 3LTCA 3D79A 2Y74A 3CMA3 2F56A 4NPBA 2CFLA 3K0ZA 3T8UA 2W56A 2CKFB 4RNZA 4X2HA 1V58A 4WYKA 2F4YA 3CCR3 5AIHA 3TDGA 4GSPA 2YFLB 1JZOA 3G8ZA 2K3DA 1JB2A 3K5TA 1SQWA 2P0XA 5KP3A 5A0OB 5EQLA 5DREA 5ELUA 1CQSA 2R41A 1T3BA 1IQYA 1SPUA 4BU4A 1IU7A 3URPA 3CCS3 3NUVA 1ZGXA 2W6JH 1M1XB 1LVNA 1VZZA 1DE3A 5IEOA 2KF3A 1LNHA 4CDLA 1FUWA 3DGNA 2D42A 3SOAA 1CEWI 6RNTA 1ULIB 2C10A 2PZVA 1EA2A 4HM1B 3I553 2GSPA 1KWIA 1UI7A 4H61A 5G1KA 3SOYA 1FYSA 2CX1A 1K28A 2I9WA 4FMCA 4GB5A 4ILFA 1AVLA 4FCJA 4X2OA 1MWRA 1A2PA 1W5ZA 3FG3A 2AAEA 3LH4A 3ROBA 1ZO2A 3PCRA 3QK9A 1QJGA 1C7HA 2RGQA 2INXA 3EJVA 4FCZA 3AHWA 1NWWA 2KF6A 1NB3I 1K734 3D4AA 1JNQA 2XH9A 3HIGA 3JUNA 3MG2A 3FZWA 4KFDA 5TGNA 1VQQA 3KCHA 4EV2A 4XBXA 2HMJB 1EKMA 3X3XA 1C54A 4EBGA 1BRGA 4O02B 3JVCA 8RNTA 1MWTA 5IERA 1K8A4 1LOWA 2OQEA 3DZLA 3NX0A 1X1YA 1I0XA 3BLZA 1GMQA 3GWRA 4K90B 4HBRA 4IPBA 5AIIA 1A2KA 3CCQ3 1B3SA 2W2CA 3N54B 3CCL3 3HZPA 1RHLA 1PYLA 1UI8A 1LRAA 4JRFA 4N6NB 5RNTA 1RGGA 3NXJA 4HZ9B 3STDA 1D6YA 1BNJA 3EBYA 3PYJA 3CU3A 4WHAA 5IG3A 1NDOB 2RNTA 3AGNA 5D82A 1FA3A 4BTXA 1G0TA 1QAFA 3ECFA 3WDGB 5CF1A 4O8SA 2ZL8A 1GS3A 5EEOA 4QWTA 1JBTA 1O7MB 4N6OB 4MMZB 4N3VA 1TP6A 2ML5A 3KKGA 2C4BA 4XBTA 1BNEA 3ZFZA 1PU4A 3CPW2 4HM4B 3JUPA 3U1WA 1CYVA 1IQ8A 3FH1A 3DGOA 1STFI 2W9PA 1BUQA 3ZG0A 4WYKB 3FGYA 3Q3FA 3J7Yd 4L8PA 1I0VA 1CYUA 3SVAA 2OTJ3 2F98A 7GSPA 2OQEC 3NHXA 2B24B 3S29A 1JBSA 2XFTA 4HVNA 4CCVA 1RGCA 3L0RA 1PY3A 1I2GA 1TU5A 3X42A 4FCMA 1R4YA 1NU3A 1RGEA 1VQ93 3MWZA 4CPKA 3BB9A 1LNIA 2HMMB 4EW5A 1IT7A 1CH0A 1BVIA 1X1WA 3CCM3 3CCJ3 1IV7A 1TFKA 2FNQA 1AR0A 3G713 4J8TA 2C11A 1ROAA 4N6MA 1B2ZA 5AEWB 3X41A 1JBRA 3F14A 1BNSA 1Q7HA 3RDEA 3B8LA
chains in the Genus database with same CATH topology
4K1UA 3S27A 3F8HA 3H51A 4N6TA 3LYGA 1O7NB 3E99A 3LTBA 5JPPA 3EC9A 4ZM8A 3DM8A 3EX9A 2OWPA 8CHOA 4FMAA 1HU9A 3VF1A 1KD14 3LOYA 3X3YA 3HI7A 1OF5B 2CH9A 2XEPA 3HX8A 4LEHA 3I563 3FKAA 3KE7A 2CFGA 1N9EA 4XDWA 1ROVA 3V98A 2Z76A 1W2B2 3F9SA 5IF6A 4OK0A 1JRQA 3NV0B 1OPYA 3H3HA 4IT7A 4LSOA 4U13A 1QMAA 2OCTA 3EB8A 2QIYA 2MF7A 1RJOA 5CXOA 3CD63 5HGRA 3DUKA 3GRDA 4MMYB 5KP4A 3KFQC 2BO9B 3QRDA 2RSXA 3VSYA 1VQ63 3FSDA 3UJMA 2P09A 5AYSC 2LQVA 1K9M4 1ASKA 1W01A 2BHMA 1WTHA 4N6UA 1EQKA 1IDPA 4BTYA 1MNLA 1Z1SA 3GAXA 1HKXA 1W6GA 2Q07A 3Q2PA 3BNBA 2YX9A 3GZBA 2HMOB 5AYRB 3FLJA 4XDVA 3PGBA 3FCSB 1JB5A 3OV4A 4HM6B 4HM5B 2B1XB 3EBTA 2SBLA 4FMDA 4STDA 1YIJ3 1Q824 3G6E3 3EHCA 4KZ1A 3UL6A 3IJEB 1MOLA 2JDIH 3G0KA 1V74A 1O7WB 2XR8B 1KQS2 3CXC2 2RFRA 3UB1A 2HMNB 2GU3A 1A67A 1QVG2 1NO3A 1OF5A 1WNHA 3Q1CA 2R4IA 4XM4A 3CC73 3G4S3 4WFOA 3MPHA 1KC84 1PFPA 3NV0A 3ER7A 4KFFA 1S723 1SJWA 2XSOB 2Z77A 2K54A 5EVHA 3CCV3 1VQN3 2JQ5A 2W9QA 1DVDA 2ZDJA 2KRTA 2P05A 4HYZA 2GEXA 3K63A 3KSPA 1A90A 4FR9A 4L7KA 1W02A 3CNXA 1JV2B 3O8YA 2HMKB 1VQK3 2YFJB 1QAKA 5LC7A 3CME3 3N9HA 1NB5I 2OOVA 1W00A 5STDA 4FMBA 3MG3A 3WOEB 3RGRA 3JUQA 3IMAB 3NBBA 1M1K4 4TX4A 3DY5A 3UL5A 3MSOA 4WWUC 1VQ73 2GBWB 4L8OA 3WODG 4LGQA 3GZXB 3KN4A 4R9LA 2E2UA 3M8CA 3V99A 1YGEA 1FGOA 2MC8A 3HK4A 2RCDA 3LT8A 1ULJB 1SIHA 2XSHB 3LXUX 2D1WA 1Q864 1DMMA 2IMJA 4KVHA 1YJW3 2F99A 2WO0A 4IIAA 1W4NA 1JN5B 2XGNA 3KZTA 3PCSA 1R4CA 1UUWB 1T5YA 1OHPA 4JF8A 3V92A 1FGTA 3LZAA 1IT8A 2PNCA 2IUKA 5IG4A 3LTAA 5D81A 4I4KA 5AEUB 2OOVC 2UX0A 4MEIA 1FGQA 2CG1A 1GD4A 4RNYA 1YJN3 3T0UA 1E97A 4HM2B 1WMNA 2M7OA 1E3RA 4OUQA 5KP1A 3ALAA 1N5HA 1S5AA 3JUOA 3X3ZA 3LTDA 3NM7A 4N6V0 5ELJA 3F7SA 1U5OA 3OX9A 3EE1A 3NBRA 1LOXA 3CCE3 3LMLA 3DMCA 4AKYA 4G1MB 1VQM3 4AKZA 5FW5A 3LT9A 1IQXA 1RRHA 3FF0A 1K41A 3CCU3 1VQP3 2W04A 3NM2A 2O3OA 1M9GA 4EYCA 2IUJA 1OGXA 1AV4A 3G16A 4R80A 4EXRA 1OH0A 2QA43 2F86B 3N8BA 5CLKA 1JB4A 3BNCA 2Z6BA 3FF2A 3DXOA 1M904 3K9MC 1STDA 3U97A 5JBSA 4KFEA 4Q53A 1Q40B 1Q7Y4 1DVCA 1DMQA 3NBJA 3S28A 3PS8A 5LC6A 1OCVA 1W6YA 2CW9A 4HM0B 3WMDA 7STDA 1UW1A 1QVF2 1JN5A 4LZIA 2CHCA 1D6ZA 3B4PA 1YVBI 2E2VA 1U8CB 1N9JA 2CK3H 1L5GB 1W2ZA 4NHFA 1VQO3 3OWUA 1RKYA 4N6LA 3F40A 3Q90A 4AEQA 3IPTA 5G2GA 2GXFA 3KSED 4EV5A 3GZYB 3EQQB 4LMIA 2BMOB 4RZMA 4PEJA 3AMOB 3D9RA 4EC6A 2ML6A 1IVWA 2KCDA 4H3UA 1GY6A 2WOHA 3CNMA 4XB5A 1WQLB 4HM8B 3SEDA 1LXEA 1WMPA 1N5PA 2CWVA 5CK6A 5BXQA 3A76A 1Y4KA 1RN7A 3X40A 1US1A 2CG0A 1YIT3 1IVUA 5IG0A 3HIIA 2Y73A 1OHOA 1W6CA 2KXGA 3WOFB 2XF3A 1OUNA 2BMQB 5FGOA 3S5CA 2FXTA 3WA2X 4RBNA 2XRXB 3FG4A 1Q42A 3CPOA 2YFIB 2CC3A 1O7HB 1ISKA 1JKGA 2K0MA 2WOFA 3GZRA 5I97A 3SXXA 4HKVB 5AIFA 2CWUA 3WA3A 4ORLA 2BT3A 1VQ83 2GU1A 1QALA 2E2TA 1J2BA 1Q40A 3EF8A 5D83A 1VQ53 1FGRA 2CIUA 1TIJA 2LYXA 2XGLA 4HM7B 5IEPA 6STDA 1TFOA 2W03A 3B7CA 3NQYA 2P38A 1W7CA 1UUVB 4BTWA 3PXMA 1OGZA 1ZX2A 2CWTA 1KSIA 5DRVA 3BNDA 3MG1A 2QGUA 3RGAA 1O7PB 1VQ43 1SIIA 3S67A 2STDA 1VQL3 4HJLB 3AMOA 4R9KA 3BNEA 1G96A 4WP5A 4R4KA 4O2HA 3VGNA 3CC23 4NREA 3OWSA 1IK3A 4R1KA 3UNLA 3D3LA 5IW9A 3EN1B 3NQZA 2P0MA 2V1LA 1JJ22 1NJI4 2L4VA 1F8NA 2W56B 1YI23 3SX1A 1D6UA 1N8QA 1O7GB 5IENA 2HMLB 1GYBA 3FG1A 4K61A 3MHEA 2OTL3 3F8XA 3B4OA 3EN8A 5BVBA 1GY5A 2XFSA 2Z7AA 1AVKA 5AIGA 3MKIA 2GEYA 4MMXB 3DGLA 3OWYA 1DMNA 1IVXA 3SLUA 2W0QA 3KIIA 3T8NA 1RRLA 1IV9A 2FGTA 3PZWA 4XBYA 2GBXB 3DGMA 1WMOA 1N8R4 2QEX3 1OHSA 2BNGA 2CFKA 4HM3B 2BMRB 3MYTA 3K7CA 2CFDA 4J9AA 1E3VA 1TUHA 3OXAA 4K1VA 2CFWA 1GD3A 1DYUA 1JKGB 1IVVA 1YHQ3 5AI1A 2A15A 5CF2A 2IA7A 3JUMA 1YJ93 5IG5A 1OACA 3CC43 2WGOA 5JPUA 1EG9B 3I0YA 1A2VA 4O3VA 2O9UX 1FGMA 4HZBB 3F7XA 1Q814 3OW22 1GY7A 4OVMA 4GL6A 4MJDA 2WGQA 3LTCA 2Y74A 3CMA3 2CFLA 3K0ZA 3T8UA 2W56A 2CKFB 4RNZA 4X2HA 4WYKA 3CCR3 5AIHA 3TDGA 2YFLB 3G8ZA 1JB2A 3K5TA 1SQWA 2P0XA 5KP3A 5A0OB 5EQLA 5DREA 5ELUA 1CQSA 1IQYA 1SPUA 1IU7A 3CCS3 3NUVA 2W6JH 1M1XB 1LVNA 1VZZA 5IEOA 1LNHA 4CDLA 1FUWA 3DGNA 2D42A 3SOAA 1CEWI 1ULIB 2C10A 2PZVA 1EA2A 4HM1B 3I553 1KWIA 1UI7A 4H61A 3SOYA 2I9WA 1K28A 4FMCA 4GB5A 1AVLA 4FCJA 4X2OA 1W5ZA 3FG3A 3LH4A 3ROBA 1ZO2A 3PCRA 3QK9A 1QJGA 1C7HA 2RGQA 2INXA 3EJVA 4FCZA 1NWWA 1K734 1NB3I 1JNQA 2XH9A 3HIGA 3JUNA 3MG2A 3FZWA 4KFDA 5TGNA 4EV2A 4XBXA 2HMJB 1EKMA 3X3XA 4EBGA 4O02B 3JVCA 5IERA 1K8A4 2OQEA 3DZLA 3NX0A 3BLZA 3GWRA 4K90B 5AIIA 4HBRA 4IPBA 3CCQ3 1A2KA 2W2CA 3N54B 3CCL3 3HZPA 1UI8A 4JRFA 4N6NB 3NXJA 4HZ9B 3STDA 1D6YA 3EBYA 3PYJA 3CU3A 4WHAA 5IG3A 1NDOB 5D82A 1FA3A 4BTXA 1QAFA 3ECFA 5CF1A 3WDGB 4O8SA 2ZL8A 1GS3A 5EEOA 4QWTA 1O7MB 4N6OB 4MMZB 4N3VA 1TP6A 2ML5A 3KKGA 4XBTA 1PU4A 3CPW2 4HM4B 3JUPA 3U1WA 1CYVA 1IQ8A 3FH1A 3DGOA 1STFI 2W9PA 1BUQA 4WYKB 3FGYA 3J7Yd 1CYUA 4L8PA 3SVAA 2OTJ3 2F98A 2OQEC 3NHXA 2B24B 3S29A 2XFTA 4HVNA 4CCVA 3L0RA 1TU5A 3X42A 4FCMA 1NU3A 1VQ93 3MWZA 3BB9A 2HMMB 1IT7A 3CCM3 3CCJ3 1IV7A 1TFKA 2FNQA 1AR0A 3G713 4J8TA 2C11A 1ROAA 4N6MA 5AEWB 3X41A 3F14A 3RDEA 3B8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1U A;  3F8H A;  3H51 A;  3LYG A;  1O7N B;  3E99 A;  5JPP A;  3EC9 A;  8CHO A;  3DM8 A;  3EX9 A;  2OWP A;  1OF5 B;  3HX8 A;  4LEH A;  3FKA A;  3KE7 A;  4XDW A;  2Z76 A;  3F9S A;  5IF6 A;  3NV0 B;  1OPY A;  3H3H A;  4U13 A;  1QMA A;  2QIY A;  5CXO A;  5HGR A;  3DUK A;  3GRD A;  5KP4 A;  3VSY A;  3FSD A;  3UJM A;  1ASK A;  1W01 A;  1IDP A;  1Z1S A;  1HKX A;  3GZB A;  2HMO B;  3FLJ A;  4XDV A;  1JB5 A;  3OV4 A;  4HM6 B;  4HM5 B;  2B1X B;  3EBT A;  4STD A;  3EHC A;  3G0K A;  1O7W B;  2XR8 B;  2RFR A;  2HMN B;  1OF5 A;  2R4I A;  4XM4 A;  3NV0 A;  3ER7 A;  1SJW A;  2XSO B;  2K54 A;  2Z77 A;  5EVH A;  2JQ5 A;  2GEX A;  3KSP A;  4L7K A;  1W02 A;  3CNX A;  2HMK B;  2YFJ B;  1W00 A;  5STD A;  3MG3 A;  3RGR A;  3JUQ A;  3MSO A;  4WWU C;  2GBW B;  4L8O A;  4LGQ A;  3GZX B;  4R9L A;  3M8C A;  3HK4 A;  2RCD A;  1ULJ B;  2XSH B;  1DMM A;  2IMJ A;  4KVH A;  2F99 A;  4IIA A;  1JN5 B;  3KZT A;  1UUW B;  1OHP A;  3LZA A;  5IG4 A;  5D81 A;  4I4K A;  5AEU B;  2UX0 A;  1E97 A;  4HM2 B;  1E3R A;  4OUQ A;  5KP1 A;  1S5A A;  3JUO A;  3F7S A;  1U5O A;  3OX9 A;  3NBR A;  3DMC A;  5FW5 A;  3FF0 A;  1K41 A;  3NM2 A;  1OGX A;  3G16 A;  1OH0 A;  2F86 B;  5CLK A;  1JB4 A;  3FF2 A;  3DXO A;  1STD A;  4Q53 A;  1Q40 B;  1DMQ A;  1OCV A;  1W6Y A;  4HM0 B;  3WMD A;  7STD A;  1JN5 A;  2CHC A;  3B4P A;  3OWU A;  3F40 A;  3Q90 A;  3IPT A;  5G2G A;  2GXF A;  3GZY B;  3EQQ B;  4LMI A;  2BMO B;  4RZM A;  4PEJ A;  3D9R A;  4H3U A;  1GY6 A;  4XB5 A;  3CNM A;  1WQL B;  4HM8 B;  3SED A;  5CK6 A;  5BXQ A;  3A76 A;  5IG0 A;  1OHO A;  1OUN A;  2BMQ B;  3S5C A;  2XRX B;  3CPO A;  1Q42 A;  2YFI B;  1O7H B;  1ISK A;  1JKG A;  3GZR A;  4HKV B;  5AIF A;  4ORL A;  1Q40 A;  3EF8 A;  5D83 A;  4HM7 B;  5IEP A;  6STD A;  3B7C A;  1UUV B;  1OGZ A;  1ZX2 A;  5DRV A;  3MG1 A;  2QGU A;  3RGA A;  1O7P B;  2STD A;  4HJL B;  4R9K A;  4WP5 A;  3VGN A;  3OWS A;  4R1K A;  3UNL A;  3EN1 B;  1O7G B;  5IEN A;  2HML B;  1GYB A;  3MHE A;  3F8X A;  3B4O A;  3EN8 A;  5BVB A;  1GY5 A;  2Z7A A;  5AIG A;  3MKI A;  2GEY A;  3OWY A;  1DMN A;  3T8N A;  4XBY A;  2GBX B;  1OHS A;  2BNG A;  4HM3 B;  2BMR B;  4J9A A;  3MYT A;  3K7C A;  1E3V A;  1TUH A;  3OXA A;  4K1V A;  1JKG B;  5AI1 A;  2A15 A;  5CF2 A;  3JUM A;  5IG5 A;  5JPU A;  1EG9 B;  3I0Y A;  4HZB B;  3F7X A;  1GY7 A;  4OVM A;  4MJD A;  3K0Z A;  3T8U A;  2CKF B;  4X2H A;  4WYK A;  5AIH A;  2YFL B;  3G8Z A;  1JB2 A;  5KP3 A;  5DRE A;  1CQS A;  3NUV A;  1VZZ A;  5IEO A;  4CDL A;  3SOA A;  1ULI B;  2PZV A;  1EA2 A;  4HM1 B;  3SOY A;  2I9W A;  4GB5 A;  4FCJ A;  4X2O A;  3ROB A;  1ZO2 A;  1QJG A;  1C7H A;  2RGQ A;  2INX A;  3EJV A;  1NWW A;  3MG2 A;  3JUN A;  3FZW A;  5TGN A;  4XBX A;  2HMJ B;  5IER A;  3DZL A;  3BLZ A;  3GWR A;  5AII A;  1A2K A;  2W2C A;  3HZP A;  3NXJ A;  4HZ9 B;  3STD A;  3EBY A;  3CU3 A;  5IG3 A;  1NDO B;  5D82 A;  5CF1 A;  3ECF A;  1GS3 A;  1O7M B;  4N3V A;  1TP6 A;  3KKG A;  4XBT A;  4HM4 B;  3JUP A;  3FH1 A;  1BUQ A;  4WYK B;  3FGY A;  4L8P A;  2F98 A;  3NHX A;  2B24 B;  4HVN A;  4FCM A;  1NU3 A;  3BB9 A;  2HMM B;  1AR0 A;  4J8T A;  5AEW B;  3F14 A;  3B8L A; 
#chains in the Genus database with same CATH topology
 4K1U A;  3S27 A;  3F8H A;  9RNT A;  3H51 A;  4N6T A;  3LYG A;  1O7N B;  3E99 A;  3LTB A;  5JPP A;  3EC9 A;  4ZM8 A;  3DM8 A;  3EX9 A;  2OWP A;  8CHO A;  4FMA A;  1HU9 A;  3VF1 A;  1KD1 4;  3LOY A;  4HAA A;  3X3Y A;  3HI7 A;  1ZS7 A;  2BIR A;  1OF5 B;  2CH9 A;  2XEP A;  3HX8 A;  4LEH A;  3I56 3;  3FKA A;  1RDS A;  3KE7 A;  2CFG A;  1N9E A;  4XDW A;  1ROV A;  3V98 A;  2Z76 A;  1W2B 2;  3F9S A;  1BSA A;  5IF6 A;  4OK0 A;  5GSP A;  1JRQ A;  1GMP A;  3NV0 B;  1OPY A;  2ZA4 A;  3H3H A;  4IT7 A;  1FW7 A;  4LSO A;  4U13 A;  1FZU A;  5BU4 A;  1QMA A;  2OCT A;  3EB8 A;  2QIY A;  2MF7 A;  1RJO A;  2HOH A;  1UCL A;  5CXO A;  1BNI A;  1UCI A;  3CD6 3;  5HGR A;  3DUK A;  3GRD A;  4MMY B;  5KP4 A;  1NB5 I;  2AAD A;  3KFQ C;  2BO9 B;  3QRD A;  2RSX A;  3VSY A;  1VQ6 3;  1I8V A;  3FSD A;  1T2I A;  2UGI A;  3SYU A;  3UJM A;  3BU4 A;  6GSP A;  1Q9E A;  2P09 A;  7RNT A;  5AYS C;  2LQV A;  1K9M 4;  1ASK A;  1W01 A;  2BHM A;  1WTH A;  1YVS A;  4N6U A;  1BNG A;  1BRS A;  1EQK A;  1IDP A;  1I3F A;  4BTY A;  1MNL A;  1Z1S A;  1X1U A;  1HKX A;  1W6G A;  2Q07 A;  3GAX A;  2L1S A;  3BNB A;  2YX9 A;  3DH2 A;  3Q2P A;  3RNT A;  3GZB A;  2HMO B;  5AYR B;  1RNB A;  3FLJ A;  4XDV A;  3PGB A;  1BAN A;  2H0I A;  1BIR A;  3FCS B;  1JB5 A;  3OV4 A;  4HM6 B;  4HM5 B;  2B1X B;  3EBT A;  2SBL A;  4FMD A;  1MGW A;  4STD A;  1YIJ 3;  1I2E A;  1Q82 4;  3G6E 3;  1RN1 A;  3EHC A;  4KZ1 A;  3UL6 A;  3IJE B;  1MOL A;  2JDI H;  3G0K A;  1V74 A;  1O7W B;  2XR8 B;  1KQS 2;  3CXC 2;  2RFR A;  3UB1 A;  2HMN B;  2GU3 A;  1A67 A;  1QVG 2;  1NO3 A;  1OF5 A;  1WNH A;  3Q1C A;  2R4I A;  4XM4 A;  1AY7 A;  1RGH A;  3CC7 3;  3G4S 3;  1BUJ A;  1LQM B;  4WFO A;  3MPH A;  1KC8 4;  1RCL A;  1PFP A;  3NV0 A;  3ER7 A;  4KFF A;  1S72 3;  1SJW A;  2XSO B;  2K54 A;  2Z77 A;  1GOY A;  1HZ1 A;  2RBI A;  5EVH A;  3CCV 3;  2JQ5 A;  1VQN 3;  2W9Q A;  1DVD A;  2ZDJ A;  1BRJ A;  3A5E A;  1RGK A;  2KRT A;  2P05 A;  1GSP A;  2GEX A;  3K63 A;  4HYZ A;  3KSP A;  1A90 A;  4FR9 A;  4L7K A;  1UUG B;  1W02 A;  3CNX A;  1I70 A;  1JV2 B;  3O8Y A;  3AHS A;  1TJD A;  2HMK B;  1VQK 3;  2YFJ B;  1QAK A;  2ZHX B;  5LC7 A;  3N9H A;  3CME 3;  2CX0 A;  1LQG C;  1W00 A;  2OOV A;  5STD A;  4FMB A;  3MG3 A;  3WOE B;  4I5Q A;  3RGR A;  3JUQ A;  3IMA B;  3NBB A;  4HOH A;  1M1K 4;  4TX4 A;  3DY5 A;  3UL5 A;  4KT3 B;  3MSO A;  1GOV A;  4WWU C;  1BRI A;  4J5G A;  1VQ7 3;  1LOY A;  1BGS A;  1UGH I;  2GBW B;  4L8O A;  3WOD G;  4LGQ A;  3GZX B;  3KN4 A;  4R9L A;  2E2U A;  3M8C A;  3V99 A;  1YGE A;  1FGO A;  3DGY A;  1BAO A;  2RCD A;  3HK4 A;  1UDI I;  1SIH A;  1ULJ B;  2XSH B;  3LT8 A;  3LXU X;  2D1W A;  1Q86 4;  1DMM A;  2IMJ A;  1X1X A;  4KVH A;  1B2M A;  1YJW 3;  2F99 A;  2WO0 A;  4IIA A;  1W4N A;  1JN5 B;  2XGN A;  3KZT A;  3PCS A;  1R4C A;  1BSE A;  1UUW B;  1T5Y A;  1OHP A;  4JF8 A;  3V92 A;  1B2U A;  1FGT A;  1BRN L;  3LZA A;  1IT8 A;  1TTO A;  2PNC A;  2IUK A;  5M1A A;  1RLS A;  5IG4 A;  3LTA A;  5D81 A;  4I4K A;  3ZG5 A;  5AEU B;  2OOV C;  2UX0 A;  4MEI A;  1FGQ A;  2BU4 A;  2CG1 A;  1GD4 A;  1BRH A;  1RN4 A;  4RNY A;  1YJN 3;  3T0U A;  1E97 A;  1RSN A;  1WMN A;  2M7O A;  2IY2 A;  4HM2 B;  1E3R A;  4OUQ A;  5KP1 A;  3ALA A;  1RGF A;  1N5H A;  1S5A A;  3AGO A;  3JUO A;  3X3Z A;  3LTD A;  3NM7 A;  4DKI A;  1GMR A;  4N6V 0;  5ELJ A;  3F7S A;  1U5O A;  3OX9 A;  3EE1 A;  3NBR A;  1LOX A;  1SAR A;  3CCE 3;  3LML A;  3DMC A;  1EUI C;  4AKY A;  4G1M B;  1VQM 3;  4AKZ A;  5FW5 A;  3LT9 A;  1IQX A;  1RRH A;  3FF0 A;  1K41 A;  3CCU 3;  1BOX A;  1UGI A;  2W04 A;  1B27 A;  1AQZ A;  2SAR A;  3NM2 A;  1VQP 3;  2O3O A;  1M9G A;  4EYC A;  2IUJ A;  1OGX A;  1AV4 A;  3G16 A;  4R80 A;  4EXR A;  1OH0 A;  2QA4 3;  2F86 B;  3N8B A;  5CLK A;  1JB4 A;  2KF5 A;  3BNC A;  2Z6B A;  1UCK A;  3FF2 A;  4RNT A;  3DXO A;  1M90 4;  3K9M C;  1STD A;  3GSP A;  2H0G A;  3U97 A;  4KFE A;  4Q53 A;  5JBS A;  1Q40 B;  1Q7Y 4;  1DVC A;  1T2H A;  1DMQ A;  3NBJ A;  3S28 A;  3PS8 A;  5LC6 A;  1TRQ A;  1OCV A;  1W6Y A;  2CW9 A;  4HM0 B;  3WMD A;  2F5M A;  1TRP A;  7STD A;  1UW1 A;  1QVF 2;  1JN5 A;  4LZI A;  2CHC A;  1D6Z A;  3B4P A;  1YVB I;  2E2V A;  5HOH A;  1RTU A;  1U8C B;  1N9J A;  2CK3 H;  1L5G B;  1W2Z A;  4NHF A;  1VQO 3;  3OWU A;  1RKY A;  4N6L A;  3F40 A;  1MWU A;  3Q90 A;  3WR2 A;  3IPT A;  4AEQ A;  5G2G A;  2GXF A;  3D5I A;  3KSE D;  4EV5 A;  1I2F A;  3EQQ B;  1B21 A;  2BMO B;  3GZY B;  4LMI A;  4PEJ A;  4RZM A;  3AMO B;  3D9R A;  4EC6 A;  2ML6 A;  1IVW A;  2KCD A;  4H3U A;  1GY6 A;  2WOH A;  2UUG C;  3CNM A;  1WQL B;  4HM8 B;  4XB5 A;  3SED A;  1LXE A;  1WMP A;  1N5P A;  2CWV A;  4LYL B;  1G02 A;  5CK6 A;  5BXQ A;  3A76 A;  1Y4K A;  1BNR A;  1BSD A;  1RN7 A;  3X40 A;  1US1 A;  2CG0 A;  1YIT 3;  1IVU A;  5IG0 A;  3HII A;  1DET A;  1FUS A;  1OHO A;  1W6C A;  2KXG A;  2Y73 A;  2XF3 A;  3WOF B;  1OUN A;  2BMQ B;  5BIR A;  5FGO A;  3S5C A;  2FXT A;  3WA2 X;  4RBN A;  1BSB A;  2XRX B;  1UCJ A;  1Q42 A;  3CPO A;  3FG4 A;  1HYF A;  2YFI B;  2CC3 A;  1O7H B;  1IYY A;  1ISK A;  1JKG A;  4J5K A;  2K0M A;  2WOF A;  3GZR A;  5I97 A;  3SXX A;  4HKV B;  5AIF A;  1B20 A;  2CWU A;  1V57 A;  4ORL A;  3WA3 A;  2BT3 A;  5M19 A;  1VQ8 3;  2GU1 A;  1QAL A;  2E2T A;  1J2B A;  1Q40 A;  3EF8 A;  5D83 A;  1VQ5 3;  1FGR A;  2CIU A;  1TIJ A;  2LYX A;  2XGL A;  4HM7 B;  5IEP A;  6STD A;  1TFO A;  2W03 A;  3B7C A;  3NQY A;  1MWS A;  2P38 A;  1W7C A;  1UUV B;  4BTW A;  3PXM A;  5G1L A;  1OGZ A;  1ZX2 A;  2CWT A;  1KSI A;  5DRV A;  3BND A;  4BIR A;  1RGL A;  3MG1 A;  2QGU A;  3RGA A;  1I3I A;  1O7P B;  1VQ4 3;  1SII A;  3S67 A;  2STD A;  1VQL 3;  4HJL B;  3AMO A;  4R9K A;  3WHO A;  3BNE A;  1G96 A;  4WP5 A;  4R4K A;  5M18 A;  4O2H A;  3VGN A;  3CC2 3;  4NRE A;  1FUT A;  1EEJ A;  1GOU A;  3OWS A;  1IK3 A;  4BL3 A;  4R1K A;  1RMS A;  3UNL A;  3D3L A;  5IW9 A;  1BU4 A;  3EN1 B;  2P0M A;  3NQZ A;  2V1L A;  1JJ2 2;  1NJI 4;  2L4V A;  1F8N A;  2W56 B;  1YI2 3;  3SX1 A;  1D6U A;  1NNV A;  1N8Q A;  3BIR A;  1O7G B;  5IEN A;  1MGR A;  2HML B;  1JZD A;  2MC8 A;  1GYB A;  3FG1 A;  4K61 A;  2F5W A;  2KAA A;  3MHE A;  3HOH A;  2OTL 3;  1YNV X;  3F8X A;  3B4O A;  1BRK A;  3EN8 A;  5BVB A;  1GY5 A;  2KF4 A;  2XFS A;  1LOV A;  2Z7A A;  1AVK A;  5AIG A;  3MKI A;  2GEY A;  4MMX B;  1YGW A;  3DGL A;  3OWY A;  1DMN A;  1IVX A;  1RGA A;  2W0Q A;  3KII A;  3SLU A;  4BL2 A;  3T8N A;  1RRL A;  1IV9 A;  2FGT A;  3PZW A;  4XBY A;  1B2S A;  1RNT A;  1WMO A;  2GBX B;  3DGM A;  1OHS A;  2BNG A;  2CFK A;  2QEX 3;  4HM3 B;  1N8R 4;  2BMR B;  3MYT A;  3K7C A;  2CFD A;  4J9A A;  3D5G A;  1E3V A;  1TUH A;  3OXA A;  2IYJ A;  4K1V A;  1RCK A;  2CFW A;  1BNF A;  1GD3 A;  1DYU A;  1JKG B;  1IVV A;  1YHQ 3;  5AI1 A;  2A15 A;  5CF2 A;  2IA7 A;  1B2X A;  3JUM A;  1YJ9 3;  5IG5 A;  1OAC A;  3CC4 3;  2WGO A;  5JPU A;  1EG9 B;  2H0H A;  4CJN A;  3I0Y A;  4GHO A;  1A2V A;  4O3V A;  2O9U X;  1FGM A;  2J8X B;  4HZB B;  3F7X A;  1Q81 4;  3OW2 2;  1GY7 A;  4OVM A;  1BSC A;  4GL6 A;  4MJD A;  2WGQ A;  3LTC A;  3D79 A;  2Y74 A;  3CMA 3;  2F56 A;  4NPB A;  2CFL A;  3K0Z A;  3T8U A;  2W56 A;  2CKF B;  4RNZ A;  4X2H A;  1V58 A;  4WYK A;  2F4Y A;  3CCR 3;  5AIH A;  3TDG A;  4GSP A;  2YFL B;  1JZO A;  3G8Z A;  2K3D A;  1JB2 A;  3K5T A;  1SQW A;  2P0X A;  5KP3 A;  5A0O B;  5EQL A;  5DRE A;  5ELU A;  1CQS A;  2R41 A;  1T3B A;  1IQY A;  1SPU A;  4BU4 A;  1IU7 A;  3URP A;  3CCS 3;  3NUV A;  1ZGX A;  2W6J H;  1M1X B;  1LVN A;  1VZZ A;  1DE3 A;  5IEO A;  2KF3 A;  1LNH A;  4CDL A;  1FUW A;  3DGN A;  2D42 A;  3SOA A;  1CEW I;  6RNT A;  1ULI B;  2C10 A;  2PZV A;  1EA2 A;  4HM1 B;  3I55 3;  2GSP A;  1KWI A;  1UI7 A;  4H61 A;  5G1K A;  3SOY A;  1FYS A;  2CX1 A;  1K28 A;  2I9W A;  4FMC A;  4GB5 A;  4ILF A;  1AVL A;  4FCJ A;  4X2O A;  1MWR A;  1A2P A;  1W5Z A;  3FG3 A;  2AAE A;  3LH4 A;  3ROB A;  1ZO2 A;  3PCR A;  3QK9 A;  1QJG A;  1C7H A;  2RGQ A;  2INX A;  3EJV A;  4FCZ A;  3AHW A;  1NWW A;  2KF6 A;  1NB3 I;  1K73 4;  3D4A A;  1JNQ A;  2XH9 A;  3HIG A;  3JUN A;  3MG2 A;  3FZW A;  4KFD A;  5TGN A;  1VQQ A;  3KCH A;  4EV2 A;  4XBX A;  2HMJ B;  1EKM A;  3X3X A;  1C54 A;  4EBG A;  1BRG A;  4O02 B;  3JVC A;  8RNT A;  1MWT A;  5IER A;  1K8A 4;  1LOW A;  2OQE A;  3DZL A;  3NX0 A;  1X1Y A;  1I0X A;  3BLZ A;  1GMQ A;  3GWR A;  4K90 B;  4HBR A;  4IPB A;  5AII A;  1A2K A;  3CCQ 3;  1B3S A;  2W2C A;  3N54 B;  3CCL 3;  3HZP A;  1RHL A;  1PYL A;  1UI8 A;  1LRA A;  4JRF A;  4N6N B;  5RNT A;  1RGG A;  3NXJ A;  4HZ9 B;  3STD A;  1D6Y A;  1BNJ A;  3EBY A;  3PYJ A;  3CU3 A;  4WHA A;  5IG3 A;  1NDO B;  2RNT A;  3AGN A;  5D82 A;  1FA3 A;  4BTX A;  1G0T A;  1QAF A;  3ECF A;  3WDG B;  5CF1 A;  4O8S A;  2ZL8 A;  1GS3 A;  5EEO A;  4QWT A;  1JBT A;  1O7M B;  4N6O B;  4MMZ B;  4N3V A;  1TP6 A;  2ML5 A;  3KKG A;  2C4B A;  4XBT A;  1BNE A;  3ZFZ A;  1PU4 A;  3CPW 2;  4HM4 B;  3JUP A;  3U1W A;  1CYV A;  1IQ8 A;  3FH1 A;  3DGO A;  1STF I;  2W9P A;  1BUQ A;  3ZG0 A;  4WYK B;  3FGY A;  3Q3F A;  3J7Y d;  4L8P A;  1I0V A;  1CYU A;  3SVA A;  2OTJ 3;  2F98 A;  7GSP A;  2OQE C;  3NHX A;  2B24 B;  3S29 A;  1JBS A;  2XFT A;  4HVN A;  4CCV A;  1RGC A;  3L0R A;  1PY3 A;  1I2G A;  1TU5 A;  3X42 A;  4FCM A;  1R4Y A;  1NU3 A;  1RGE A;  1VQ9 3;  3MWZ A;  4CPK A;  3BB9 A;  1LNI A;  2HMM B;  4EW5 A;  1IT7 A;  1CH0 A;  1BVI A;  1X1W A;  3CCM 3;  3CCJ 3;  1IV7 A;  1TFK A;  2FNQ A;  1AR0 A;  3G71 3;  4J8T A;  2C11 A;  1ROA A;  4N6M A;  1B2Z A;  5AEW B;  3X41 A;  1JBR A;  3F14 A;  1BNS A;  1Q7H A;  3RDE A;  3B8L A; 
#chains in the Genus database with same CATH homology
 4K1U A;  3S27 A;  3F8H A;  3H51 A;  4N6T A;  3LYG A;  1O7N B;  3E99 A;  3LTB A;  5JPP A;  3EC9 A;  4ZM8 A;  3DM8 A;  3EX9 A;  2OWP A;  8CHO A;  4FMA A;  1HU9 A;  3VF1 A;  1KD1 4;  3LOY A;  3X3Y A;  3HI7 A;  1OF5 B;  2CH9 A;  2XEP A;  3HX8 A;  4LEH A;  3I56 3;  3FKA A;  3KE7 A;  2CFG A;  1N9E A;  4XDW A;  1ROV A;  3V98 A;  2Z76 A;  1W2B 2;  3F9S A;  5IF6 A;  4OK0 A;  1JRQ A;  3NV0 B;  1OPY A;  3H3H A;  4IT7 A;  4LSO A;  4U13 A;  1QMA A;  2OCT A;  3EB8 A;  2QIY A;  2MF7 A;  1RJO A;  5CXO A;  3CD6 3;  5HGR A;  3DUK A;  3GRD A;  4MMY B;  5KP4 A;  3KFQ C;  2BO9 B;  3QRD A;  2RSX A;  3VSY A;  1VQ6 3;  3FSD A;  3UJM A;  2P09 A;  5AYS C;  2LQV A;  1K9M 4;  1ASK A;  1W01 A;  2BHM A;  1WTH A;  4N6U A;  1EQK A;  1IDP A;  4BTY A;  1MNL A;  1Z1S A;  3GAX A;  1HKX A;  1W6G A;  2Q07 A;  3Q2P A;  3BNB A;  2YX9 A;  3GZB A;  2HMO B;  5AYR B;  3FLJ A;  4XDV A;  3PGB A;  3FCS B;  1JB5 A;  3OV4 A;  4HM6 B;  4HM5 B;  2B1X B;  3EBT A;  2SBL A;  4FMD A;  4STD A;  1YIJ 3;  1Q82 4;  3G6E 3;  3EHC A;  4KZ1 A;  3UL6 A;  3IJE B;  1MOL A;  2JDI H;  3G0K A;  1V74 A;  1O7W B;  2XR8 B;  1KQS 2;  3CXC 2;  2RFR A;  3UB1 A;  2HMN B;  2GU3 A;  1A67 A;  1QVG 2;  1NO3 A;  1OF5 A;  1WNH A;  3Q1C A;  2R4I A;  4XM4 A;  3CC7 3;  3G4S 3;  4WFO A;  3MPH A;  1KC8 4;  1PFP A;  3NV0 A;  3ER7 A;  4KFF A;  1S72 3;  1SJW A;  2XSO B;  2Z77 A;  2K54 A;  5EVH A;  3CCV 3;  1VQN 3;  2JQ5 A;  2W9Q A;  1DVD A;  2ZDJ A;  2KRT A;  2P05 A;  4HYZ A;  2GEX A;  3K63 A;  3KSP A;  1A90 A;  4FR9 A;  4L7K A;  1W02 A;  3CNX A;  1JV2 B;  3O8Y A;  2HMK B;  1VQK 3;  2YFJ B;  1QAK A;  5LC7 A;  3CME 3;  3N9H A;  1NB5 I;  2OOV A;  1W00 A;  5STD A;  4FMB A;  3MG3 A;  3WOE B;  3RGR A;  3JUQ A;  3IMA B;  3NBB A;  1M1K 4;  4TX4 A;  3DY5 A;  3UL5 A;  3MSO A;  4WWU C;  1VQ7 3;  2GBW B;  4L8O A;  3WOD G;  4LGQ A;  3GZX B;  3KN4 A;  4R9L A;  2E2U A;  3M8C A;  3V99 A;  1YGE A;  1FGO A;  2MC8 A;  3HK4 A;  2RCD A;  3LT8 A;  1ULJ B;  1SIH A;  2XSH B;  3LXU X;  2D1W A;  1Q86 4;  1DMM A;  2IMJ A;  4KVH A;  1YJW 3;  2F99 A;  2WO0 A;  4IIA A;  1W4N A;  1JN5 B;  2XGN A;  3KZT A;  3PCS A;  1R4C A;  1UUW B;  1T5Y A;  1OHP A;  4JF8 A;  3V92 A;  1FGT A;  3LZA A;  1IT8 A;  2PNC A;  2IUK A;  5IG4 A;  3LTA A;  5D81 A;  4I4K A;  5AEU B;  2OOV C;  2UX0 A;  4MEI A;  1FGQ A;  2CG1 A;  1GD4 A;  4RNY A;  1YJN 3;  3T0U A;  1E97 A;  4HM2 B;  1WMN A;  2M7O A;  1E3R A;  4OUQ A;  5KP1 A;  3ALA A;  1N5H A;  1S5A A;  3JUO A;  3X3Z A;  3LTD A;  3NM7 A;  4N6V 0;  5ELJ A;  3F7S A;  1U5O A;  3OX9 A;  3EE1 A;  3NBR A;  1LOX A;  3CCE 3;  3LML A;  3DMC A;  4AKY A;  4G1M B;  1VQM 3;  4AKZ A;  5FW5 A;  3LT9 A;  1IQX A;  1RRH A;  3FF0 A;  1K41 A;  3CCU 3;  1VQP 3;  2W04 A;  3NM2 A;  2O3O A;  1M9G A;  4EYC A;  2IUJ A;  1OGX A;  1AV4 A;  3G16 A;  4R80 A;  4EXR A;  1OH0 A;  2QA4 3;  2F86 B;  3N8B A;  5CLK A;  1JB4 A;  3BNC A;  2Z6B A;  3FF2 A;  3DXO A;  1M90 4;  3K9M C;  1STD A;  3U97 A;  5JBS A;  4KFE A;  4Q53 A;  1Q40 B;  1Q7Y 4;  1DVC A;  1DMQ A;  3NBJ A;  3S28 A;  3PS8 A;  5LC6 A;  1OCV A;  1W6Y A;  2CW9 A;  4HM0 B;  3WMD A;  7STD A;  1UW1 A;  1QVF 2;  1JN5 A;  4LZI A;  2CHC A;  1D6Z A;  3B4P A;  1YVB I;  2E2V A;  1U8C B;  1N9J A;  2CK3 H;  1L5G B;  1W2Z A;  4NHF A;  1VQO 3;  3OWU A;  1RKY A;  4N6L A;  3F40 A;  3Q90 A;  4AEQ A;  3IPT A;  5G2G A;  2GXF A;  3KSE D;  4EV5 A;  3GZY B;  3EQQ B;  4LMI A;  2BMO B;  4RZM A;  4PEJ A;  3AMO B;  3D9R A;  4EC6 A;  2ML6 A;  1IVW A;  2KCD A;  4H3U A;  1GY6 A;  2WOH A;  3CNM A;  4XB5 A;  1WQL B;  4HM8 B;  3SED A;  1LXE A;  1WMP A;  1N5P A;  2CWV A;  5CK6 A;  5BXQ A;  3A76 A;  1Y4K A;  1RN7 A;  3X40 A;  1US1 A;  2CG0 A;  1YIT 3;  1IVU A;  5IG0 A;  3HII A;  2Y73 A;  1OHO A;  1W6C A;  2KXG A;  3WOF B;  2XF3 A;  1OUN A;  2BMQ B;  5FGO A;  3S5C A;  2FXT A;  3WA2 X;  4RBN A;  2XRX B;  3FG4 A;  1Q42 A;  3CPO A;  2YFI B;  2CC3 A;  1O7H B;  1ISK A;  1JKG A;  2K0M A;  2WOF A;  3GZR A;  5I97 A;  3SXX A;  4HKV B;  5AIF A;  2CWU A;  3WA3 A;  4ORL A;  2BT3 A;  1VQ8 3;  2GU1 A;  1QAL A;  2E2T A;  1J2B A;  1Q40 A;  3EF8 A;  5D83 A;  1VQ5 3;  1FGR A;  2CIU A;  1TIJ A;  2LYX A;  2XGL A;  4HM7 B;  5IEP A;  6STD A;  1TFO A;  2W03 A;  3B7C A;  3NQY A;  2P38 A;  1W7C A;  1UUV B;  4BTW A;  3PXM A;  1OGZ A;  1ZX2 A;  2CWT A;  1KSI A;  5DRV A;  3BND A;  3MG1 A;  2QGU A;  3RGA A;  1O7P B;  1VQ4 3;  1SII A;  3S67 A;  2STD A;  1VQL 3;  4HJL B;  3AMO A;  4R9K A;  3BNE A;  1G96 A;  4WP5 A;  4R4K A;  4O2H A;  3VGN A;  3CC2 3;  4NRE A;  3OWS A;  1IK3 A;  4R1K A;  3UNL A;  3D3L A;  5IW9 A;  3EN1 B;  3NQZ A;  2P0M A;  2V1L A;  1JJ2 2;  1NJI 4;  2L4V A;  1F8N A;  2W56 B;  1YI2 3;  3SX1 A;  1D6U A;  1N8Q A;  1O7G B;  5IEN A;  2HML B;  1GYB A;  3FG1 A;  4K61 A;  3MHE A;  2OTL 3;  3F8X A;  3B4O A;  3EN8 A;  5BVB A;  1GY5 A;  2XFS A;  2Z7A A;  1AVK A;  5AIG A;  3MKI A;  2GEY A;  4MMX B;  3DGL A;  3OWY A;  1DMN A;  1IVX A;  3SLU A;  2W0Q A;  3KII A;  3T8N A;  1RRL A;  1IV9 A;  2FGT A;  3PZW A;  4XBY A;  2GBX B;  3DGM A;  1WMO A;  1N8R 4;  2QEX 3;  1OHS A;  2BNG A;  2CFK A;  4HM3 B;  2BMR B;  3MYT A;  3K7C A;  2CFD A;  4J9A A;  1E3V A;  1TUH A;  3OXA A;  4K1V A;  2CFW A;  1GD3 A;  1DYU A;  1JKG B;  1IVV A;  1YHQ 3;  5AI1 A;  2A15 A;  5CF2 A;  2IA7 A;  3JUM A;  1YJ9 3;  5IG5 A;  1OAC A;  3CC4 3;  2WGO A;  5JPU A;  1EG9 B;  3I0Y A;  1A2V A;  4O3V A;  2O9U X;  1FGM A;  4HZB B;  3F7X A;  1Q81 4;  3OW2 2;  1GY7 A;  4OVM A;  4GL6 A;  4MJD A;  2WGQ A;  3LTC A;  2Y74 A;  3CMA 3;  2CFL A;  3K0Z A;  3T8U A;  2W56 A;  2CKF B;  4RNZ A;  4X2H A;  4WYK A;  3CCR 3;  5AIH A;  3TDG A;  2YFL B;  3G8Z A;  1JB2 A;  3K5T A;  1SQW A;  2P0X A;  5KP3 A;  5A0O B;  5EQL A;  5DRE A;  5ELU A;  1CQS A;  1IQY A;  1SPU A;  1IU7 A;  3CCS 3;  3NUV A;  2W6J H;  1M1X B;  1LVN A;  1VZZ A;  5IEO A;  1LNH A;  4CDL A;  1FUW A;  3DGN A;  2D42 A;  3SOA A;  1CEW I;  1ULI B;  2C10 A;  2PZV A;  1EA2 A;  4HM1 B;  3I55 3;  1KWI A;  1UI7 A;  4H61 A;  3SOY A;  2I9W A;  1K28 A;  4FMC A;  4GB5 A;  1AVL A;  4FCJ A;  4X2O A;  1W5Z A;  3FG3 A;  3LH4 A;  3ROB A;  1ZO2 A;  3PCR A;  3QK9 A;  1QJG A;  1C7H A;  2RGQ A;  2INX A;  3EJV A;  4FCZ A;  1NWW A;  1K73 4;  1NB3 I;  1JNQ A;  2XH9 A;  3HIG A;  3JUN A;  3MG2 A;  3FZW A;  4KFD A;  5TGN A;  4EV2 A;  4XBX A;  2HMJ B;  1EKM A;  3X3X A;  4EBG A;  4O02 B;  3JVC A;  5IER A;  1K8A 4;  2OQE A;  3DZL A;  3NX0 A;  3BLZ A;  3GWR A;  4K90 B;  5AII A;  4HBR A;  4IPB A;  3CCQ 3;  1A2K A;  2W2C A;  3N54 B;  3CCL 3;  3HZP A;  1UI8 A;  4JRF A;  4N6N B;  3NXJ A;  4HZ9 B;  3STD A;  1D6Y A;  3EBY A;  3PYJ A;  3CU3 A;  4WHA A;  5IG3 A;  1NDO B;  5D82 A;  1FA3 A;  4BTX A;  1QAF A;  3ECF A;  5CF1 A;  3WDG B;  4O8S A;  2ZL8 A;  1GS3 A;  5EEO A;  4QWT A;  1O7M B;  4N6O B;  4MMZ B;  4N3V A;  1TP6 A;  2ML5 A;  3KKG A;  4XBT A;  1PU4 A;  3CPW 2;  4HM4 B;  3JUP A;  3U1W A;  1CYV A;  1IQ8 A;  3FH1 A;  3DGO A;  1STF I;  2W9P A;  1BUQ A;  4WYK B;  3FGY A;  3J7Y d;  1CYU A;  4L8P A;  3SVA A;  2OTJ 3;  2F98 A;  2OQE C;  3NHX A;  2B24 B;  3S29 A;  2XFT A;  4HVN A;  4CCV A;  3L0R A;  1TU5 A;  3X42 A;  4FCM A;  1NU3 A;  1VQ9 3;  3MWZ A;  3BB9 A;  2HMM B;  1IT7 A;  3CCM 3;  3CCJ 3;  1IV7 A;  1TFK A;  2FNQ A;  1AR0 A;  3G71 3;  4J8T A;  2C11 A;  1ROA A;  4N6M A;  5AEW B;  3X41 A;  3F14 A;  3RDE A;  3B8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...