3HZYA

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo(2.4)kdo
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
215
Chain Sequence
DIVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLRTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIAVKWKIDGSERNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S73-2 Fab (IgG1k) light chain
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 215
sequence length 216
ec nomenclature
pdb deposition date 2009-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzyA01
3CC5B 5FM5M 4X80H 1YEJL 2A2QT 3SHSA 4M9PA 1KT2A 4ORZC 2RCSH 1JWMA 4RZCB 1IGIL 2DQGH 4NJ9L 5F93C 2A74B 4K9EL 1N0XH 3O3BA 2ITCA 5I8KL 3H0TA 1GIGH 4JN1H 2AXHA 1GZQB 4Y1AA 1T1WA 1HHKB 3U2SB 3BGMB 2LABA 2NW2B 4D3CL 4D2NA 3B9VA 3QQ4A 1MRCH 3QDGD 2Y07H 2YPKB 5I2IB 2CRYA 4JDVB 3ILQD 4QRTA 1T83A 2DQFB 1AP2B 3DMMA 2BSRB 5EO1B 4PJCF 1HINH 1L6XA 4GAGH 3D18A 2HJKB 1RURH 5C0AA 3ZDZE 5SWSB 1SQ2N 1R5WA 5GRYA 3S98A 1OCWL 4WU7A 3S34L 2WANA 1MREL 1S7WA 1KELL 3D25A 4NRXA 5D2NC 5D7SH 3S37L 4APQB 1F8TH 4JHZA 2Y23A 4GKNA 4BFEA 1F3JB 1YMMA 4L29A 3IJHA 5JQHC 2FEEL 3RY4A 4GXVH 1LE5A 4OLWH 4H1LG 2WM0A 1IBGH 4EUPA 5DC9B 1I85A 5E2UH 1EHLH 5BS0B 2VDNL 3RIAK 4PIRF 4WI5A 4FTVB 2BDNH 5ITFA 3BZFA 5EUOF 5MEQB 5E5MA 5IOPB 4UUJB 3HNSL 35C8H 3P0VL 4Y16B 5L2KB 1CGUA 4O00A 5DJYA 2Z92B 1MCHA 3IGAA 5B4MD 5MHSE 4IDJH 3LH2L 2VXTH 2P8PA 3AB0C 3ARDB 4I0PB 3T4AA 1VFUA 1RY7B 4R8WH 4NZTL 1FFOB 2EIZA 5IJKC 3O8XA 2Y25A 5D2LA 4UV4L 1MF2H 1KEGL 4IRSD 4GMSL 3SPVA 1JNNH 3ILQC 4P2QB 1JBJA 4F37F 2UVFA 4GW4A 4F7EB 1PEWA 3KPOB 5D1XB 3SE4C 4U1SA 3DV6A 5H94B 3WL9A 3H6JA 4L8BA 4LSUL 4KDWA 1RHHA 1AFVL 1NEZA 3EW3B 2R0KL 1BQLL 3MV9A 1RMFL 4HIXH 5HGGS 3BAEH 4DTGH 5JIIA 2E9IA 2FJHB 4NZRL 1M7XA 1E6JH 1MAKA 5GZND 1AQDA 3GHBL 4QGTA 5CLTA 1GH7A 3FFDA 4FHBD 4UTBL 1FPTL 1QSEB 2GK2A 2YOCA 3GMNA 4M1DH 2WP3O 3QZWB 3PGCA 3VWKD 3VFVB 4DQOH 3N06B 2BVPB 4EOWL 3EOBB 5D7LD 1XIWB 3ARGB 4XP5H 1N5AA 3V4PH 1E4WL 4KRMB 4YUEL 4ELKB 5IMKB 3EO1A 5AUMA 3T2NH 2FWOB 3BSZH 5EA0H 4IHOA 3DOSA 1Z9MA 4G9FB 3VFUB 4JFEB 3RQ3A 5F71A 2Q7YA 1UA6L 4U0RB 1OW0A 1NFIA 5DDHB 5ECJE 1HE7A 3HUJE 4IRSC 3GJEA 4Q9RL 1NGPL 4J12A 5T3XD 4GUPB 2H9GB 1U8NA 2A9ML 3IDIB 3SCMB 1T7YA 4OF7A 1UJ3A 4LVOC 2XTJD 3BQUB 4HGKC 5B22A 3X17A 3RRQA 3RWDA 5CBAA 2UV3A 1CXLA 4NQVA 1W8OA 3GO1L 4N9GA 1Z2KA 1FVDB 4F7TB 4M1GH 3KYNB 3BVNA 4PJAE 5MEPB 4M7JL 3ILPB 1X5GA 1U92A 5GZNC 1TPXC 3O81A 3STLA 3VG0H 1Z6JT 3KPPA 2IBBA 3TIDB 1CDIA 5CZKA 2J5LB 2IBZY 1NDGB 2FJGB 5GJTH 2P5EB 1HWHB 5JLZB 3FTGA 4OV5B 1SBSH 2PO6A 3VRLF 5I8EA 4W70A 3OZ9H 1KPUA 3VWKC 5I18H 2C3VB 4HDIA 5FKAA 1OAQL 4JFYA 5E6ZA 3OJVC 4EN3D 4XVSH 1QSFD 5DR5H 3VCLB 2CUMA 3C60A 1V7ML 1WBYA 4QTIH 5B39B 1TZGL 1J11A 4HIHB 4N0YH 5HYQA 3P4OA 3BMWA 4PD4K 1OB1A 4ZSOE 3UTTD 1Z3GH 1EEYA 1R3IL 1VFOA 2EXWD 2CIKA 1ZV5A 5GSVB 4MJ2A 5JW4N 3X3FH 4PY7B 1KG0B 4ZFFA 5DI8B 3X14B 3QUMH 1BJ1H 4X6FB 3X11B 1I7ZA 2HG5B 5LBSL 4G80A 2XTJC 1FVEB 2Y36H 1I8LC 1F42A 1GGUA 2Z93B 3KPRD 4J8RB 4Z76A 5FA3B 1HSBA 1HHIA 2VDML 4UDUB 3IS0X 2KBGA 4ALAL 4PJXE 4B0MM 4LF3B 4S1RL 1J18A 5DVOA 5I17B 5KS9B 4G6ML 3BZ4A 3QEQB 4PRAA 1G7HA 3LSOB 3IDXL 4R2GB 5F7EH 3RVUD 3KPSA 5JW4Q 4J3XA 4WW2B 5K9JL 3RBSA 1JZ4A 4PJ8B 3FONA 1P5VA 4EN3C 1QEWA 1S9XA 3W81A 3O6KH 3RVWD 1GGBL 2VZOA 1JPTL 2C1OA 2VQ1A 3MRJB 5IFHL 2VLJD 3HE7B 2JTDA 1B0RB 1KSRA 1S8DA 4ZAKD 5MI0B 1S5IL 4GLRI 1ZANH 2BHZA 4O51B 5IQ9A 2HA1A 4OI8A 1SVCP 4G8EB 5I1HH 12E8L 2EXWC 3GBNH 4DK3A 1WBXA 2LAAA 3C5ZA 4I18B 5EOCJ 5DD3L 3MSPA 4I9WE 3MMEA 4MD4B 3GNML 3B9KD 3D39B 4WNQB 4J3UA 2CH8A 5F96H 2F53B 3KXFD 3WFZA 4UT9H 2HFFB 2KKQA 4G8FA 1RV6X 1BJ8A 2B1HL 2IGFL 5IB4B 3QUMA 3H9SE 3S4SG 3TF7C 4Z78A 5CEZL 3NTCH 4HQQH 3ARBB 1NLBH 4KJYB 1U6AH 1RFDH 3AU1B 1U8PA 4IS6B 5DD5L 5IQ7L 3UJIH 1K6QH 5MERA 1C5BH 2CK0L 3D3VA 3L3IB 3T3ME 2NY0B 2Q86B 1R5VB 3GFUA 3QCVL 4RMRA 2BVEA 5FHAH 1KB5H 4WTZA 5EU5A 3E8UL 5CSBA 1IM9A 1LO2H 3U7YL 4YHYB 2N56A 4BSVB 3P4MB 2IANE 3CXHJ 4M1CD 3DURB 3G5ZA 4TVSa 3RVWC 3U79A 1JNLL 1ZA3A 4Z7OE 4LVEA 3NZ8A 3U82B 4MB4A 4N0UE 2VWEC 3FKUS 1YYMH 4ZAKC 4MJIE 1NCAL 2WBJD 4LVHB 1XF4A 3CD4A 3DO7B 1QTYT 1ZK9A 5HGHA 3F12B 4NCDA 2X4RA 4EDWH 1OQOA 1KJ3L 4PJ5B 1A1OA 3L95B 3B9KC 3MLSH 1MUJA 4AM0B 5D71L 2V5MA 1VKXA 4X7SL 2EDYA 1F6AA 3BRFA 5F1OB 1Q0YL 5TE6H 5EIIB 3VI3E 2AK4D 5I1GL 1DL7L 3HR6A 2YEZA 4FFWD 4M48L 1CGTA 1WZMA 1SHMA 4XPHH 1OGTB 2PR4H 2ENSA 2ADJA 5ACLA 1A6AA 3MLVL 4ZD3H 5IGXH 4P23B 3PF2A 1H9VA 5FIEA 4FQ2L 4X7DC 4JKPL 1OAZL 1MWAB 5HJ3B 4CL7A 4GKZA 3RWIB 3CK0H 2EECA 5FECA 4LEOA 1E28A 2E27L 5E2VL 2EDRA 2AEWA 3CFBA 4M1CC 4M6NH 4JFDB 3AFLA 1BZ7A 1KB5A 4Z7UB 4Z7VA 1UB5B 3KPLA 5I19H 5E6IA 1NCDL 5IIEB 3IF1A 4OTXH 3O3EA 2Y06H 3RFZC 4BK4A 2WBJC 5F72S 5I0DA 3T2PA 5CD3A 1BQSA 4YDKL 4O02H 3HHRB 1J1XL 4FABL 1IGFH 1MAML 1SY6L 5HDBF 4WUUE 1L0YA 4X0KB 1NGZA 1T7WA 3GZKA 3A6BL 1C5DA 2FHBA 2YN3A 4WEUD 3FB7A 1CFSB 3QHZH 4ZTPH 5CZVL 4ZUUB 5TE7H 2P4AB 1XZ0A 4W68A 3LQAH 5IM7A 1RJLA 5IMMA 4P5TD 5EFIB 4U1NB 3HMXH 4FFWC 1KJVB 4FQ1L 4NM8L 4PG9B 4D8PB 2ICCA 4TQEH 3T8XA 2R8SH 3E3QE 2VJXA 1R6VA 1JZ2A 4O9HL 3OG6B 1M05B 5J3HD 4RZCA 2GAZA 4F9LC 3P30H 1UWXH 2A74A 4MWFB 5DD0L 1KIQA 2R9HD 3MRFB 4MHHG 1BEYH 4YE4H 3RZCD 4TRPH 3V52H 1HHKA 3C8KB 3U2SA 4HFUL 3BUTA 2NW2A 1FNSH 4LPUA 1UYWH 3HE6D 2DYPD 2K3TA 5I2IA 3ULUH 4HUKB 5EZJB 5HYSA 5E5UB 2FDBP 3VD5A 1AP2A 2BSRA 4XMPH 5I8OL 5EO1A 1V7NL 43CAB 5EUOE 3PG2A 4DVBA 1BFOA 2HJKA 4LHUG 1IAII 5SWSA 4G8GE 1LGVA 5KAQF 1LVEA 3QUZB 4YH6A 4M6OH 3MJ7B 4HEPG 5E2TH 2K7QA 3I84A 4NCC1 3DX6A 5FGRA 1MI5E 4LPXA 4X8XA 1FYTD 3SDXB 3S36L 2GSIB 1GGIH 1F3JA 4CGTA 1S9YB 1P53A 3DHMA 1L0QA 1UENA 1FN4B 5DWUL 4K55A 5ESQA 3U9UA 1Q9WB 1GGTA 2PCPB 4P5TC 5BS0A 3OR6B 1RULH 5HHMB 4DK6A 4U6VL 3ECBB 1TVHB 1NUGA 5B8CC 4HIIB 2FLRT 4U31A 1EHXA 5E2JA 2ICES 5MEQA 2P42B 1S3KL 5IOPA 4UUJA 4RA3A 1U3HB 4Y16A 3W9DB 5L2KA 4KY1L 2CJUL 5J3HC 3HMXA 3CZFB 2Z92A 4RGMB 4X7EC 2X9WA 3FRPA 1HZHL 1TETH 5GPRA 4WI2A 3FT2A 2R9HC 1IGJB 1PSKH 1RVFL 4JFFE 5AYQA 4PGZA 4P3WA 3ARDA 4I0PA 4OD1H 4GAFB 3W0WA 2E5EA 1PAMA 4LU5H 1FFOA 5I1AB 4JPVH 5GGVH 5DLML 3HE6C 5DJXA 1HKLH 4NYLB 4PREB 1ZOXA 2EC9T 4FG6D 4AENA 4P2QA 5EPMA 2D7TH 3R0MA 1X5AA 2LU7A 5F9OL 5KW9H 3I6GB 4F7EA 5EZOL 2GJ6B 5D1XA 1UACL 4KDTA 3Q3GB 1MJ8H 4L3CB 3S35X 5CWSA 4XX1G 5H94A 5C0JB 4QLRA 3MROB 1IAIL 2MSPA 1TJGH 4NNPH 4NQDE 2FJHA 5DC0A 4WTWA 3ZT7A 1WEJH 4PLKD 3ZYIA 1NH6A 1N64L 1QSEA 3ZZ1A 4CKVX 3MYJB 5HHNA 2HRLA 5SX5H 3QZWA 3E6FB 3MBED 4M7ZC 3VFVA 4JM2B 3EOBA 3VH8B 1WIOA 1XIWA 3ARGA 3QUYD 5EC1A 1FLTX 1D6EB 1H5BB 3LRSB 4ELKA 5J6GB 5IMKA 4FXKB 4M4RA 2FWOA 3VXSB 3ZHLA 3C5JA 1NC4D 2VL5B 4O58L 1C1EH 4G9FA 5SX4H 4OCMC 3VFUA 4C83A 4IOIA 4PJGF 5DK0B 2VXVH 4NQTA 5TGBA 1AKJA 3L6FB 1CDYA 1SJHA 4NQXB 4CDHA 4Y4FB 3U46B 2VN7A 4FG6C 4GUPA 2H9GA 3IDIA 4FQIL 2DQIH 3L3GB 4DKFL 1C8PA 5FYJD 5T3XL 3GIZL 4ZQKB 5KVFH 2N1KA 2I07B 3P4NA 3QQNA 1I3GL 4PJCB 5DD1L 1ROWA 4RIRB 3FT4A 2WMPA 3NIDF 3MBXH 2E6PA 1DBAL 2VDRH 1FVDA 2EDTA 2VYRE 2QQLH 4F7TA 4MXVF 3KYNA 4Z8FH 5MEPA 1SYSB 3NOIA 4PLKC 5DHYB 3TIDA 1A6UL 1WISA 4P9HH 4NBZB 3NA9H 1I7TB 2DQUH 2X7LB 4XNUL 1DEDA 2J8OA 3CDGB 1MCJA 5CSGA 1NDGA 2FJGA 4OCYL 3OB0H 2VLRE 5GISL 2BY0A 2LV4A 3SDCB 3PWUB 3QNZB 3P0GB 2NNAB 3MBEC 5HYIA 1HH9A 2C3VA 3OWEA 4Z0XB 2FRGP 2IAMD 5EIVA 4UZGA 2BRRL 1L7TH 3QUYC 4HUUB 4WWID 3KR3H 2C1PB 1HCVA 2MKLC 4S1QL 1LO3H 4Z7WF 2J4WH 4L9LB 3S6CA 4C56E 2I9LB 4LCWB 2DQTH 1F02I 4PV8A 1QFWL 5ADPH 3BX7C 2W59A 5B39A 4HIHA 4WUKL 2W1NA 4KRPD 5ELIA 3JWDC 4YFDB 1P4BL 4YDLC 3S5LB 3T0EB 3VXUB 2YHGA 4RGNB 1NKOA 1HHGB 3BKJH 3GBLA 5IB2B 4PY7A 1KG0A 3MCG1 3X14A 3L5XL 4QKXB 4UNUA 5EU3B 4JRXE 1B6UA 4LLVB 3WFDL 4I77H 2AV1B 1D6VH 2Z93A 2Q8BH 2YPVH 4J8RA 5T1DH 4R7NB 4OB5H 4A6YH 4XC1L 4OQ1A 4UDUA 1XF2A 4Y5XA 3TWCL 5BVPL 5A2IH 5JXEA 4XCNB 5IESH 4JFZH 1FZMB 2G60H 1P4IL 3MXWH 3A67H 3VWJB 5I1CH 1RUQH 2R1WA 5FGBC 2DRUA 4PJHE 5JW5B 3ZDYF 5I66B 5F9JB 3QEQA 3DYOA 3LSOA 4NRZA 2QKIB 3G04A 1SMAA 5I9QC 4FZ8H 2E7LA 1R3LB 2FX8L 4LPWA 3CLEH 2V17H 2YSSB 3MRCB 4NWUL 4WW2A 1VGKB 2IAMC 2VZTA 4NQEB 5ETUB 3MRPB 4PJ8A 1RAMA 1AGDA 4ZMAT 3UYPA 1YC7A 4KUZL 1FRGL 4NFCA 3MRJA 2VKXA 1B0RA 5DJ2B 2WBKA 1RUKH 1KNOB 25C8L 4WY7H 1LWRA 5CHNA 4KRPC 1GVIA 5J1AB 3LN5A 1NFDF 4XCCH 4NBYB 4N0CD 2BERA 4G8EA 2DQJL 1MNUH 4AY0A 1JRHI 3SKJH 5EOCH 4I18A 4KZDH 5ALBL 4RBPH 2E3VA 5JXAH 2XNAB 3D39A 4ODXA 2Q76B 2F53A 2NY2B 1KC5H 4P3CL 2H8PB 1OGAB 2HFFA 3TPKA 4AH2A 4U1HB 3I3BA 4R9HA 2BHYA 5IB4A 1KTDB 2EXYD 4PB0L 2ZKHH 5GSRB 1CICB 3ARBA 2ORBH 1RIHH 1ZA6B 3DROB 3KGRA 4KJYA 4IS6A 1UVQA 2QADD 3V95A 2NXYB 3QUXD 4ZUWB 4R26H 4EQ3A 2NX5B 2VZ1A 5D2NE 4JQVC 3AM8A 2OX5A 1CL7I 4UTAH 1R5VA 3B9EA 4FFYH 1ACYH 4TN9A 4X4XB 4XXCC 1UZ6E 3U9PL 3HUJA 2BOBB 4HLZG 4BSVA 5CEYB 3P4MA 4PRPD 1NC2D 1EPFA 1ERNA 3I3DA 3VD4A 4HUWB 4OCXL 1H3VA 3H3BC 4Q6IB 3WNNA 1T2QL 3EJZD 2RQ8A 2FHFA 5EBGA 3HFMH 4LLUB 1JHTB 1DLFH 1MCWM 3LDBB 4QEGA 1QFUH 1FZKB 1Q0XL 3DO7A 3KG5A 4CVWA 1D9KB 4MB5A 4N0CC 5CCKL 1Z9OA 1HEZB 3F12A 4XB8A 2OM5A 1WF5A 4PJAA 3QDJD 3D69B 4FRWA 4MCZA 2YMXH 1G6RL 4PJ5A 3L95A 4AM0A 4HWBL 4WU5B 4LHJB 5F6IB 4Q0XL 4X6DB 3HMWL 3LCYA 1F5WA 2H6PB 3BPOB 5CBEA 1O7VA 4KRLB 5D70L 5C08E 5DQDL 5E8EB 4XI5D 8FABB 2FHCA 4LEXL 2EXYC 3UJTL 1X7QA 7CGTA 4B50A 4D0DA 5E24E 1OGTA 4L4TD 2QADC 4XMLH 3QUXC 5C9KA 1KENL 1Q1JL 3VXPB 3LZFL 1LO4L 2VXQL 3SDAB 4P23A 5HDBE 2NMSA 5IROC 4LSQL 4ZSOA 5GHWL 1MWAA 3LOWA 1CYGA 3PE9A 5HYJB 1I4FB 1N3NB 4BA8A 4NC1C 1CL7L 1PBYA 5EU6B 2QBWA 4KFZC 1INEL 1IAOB 1I9IL 3SGDI 1N59A 4MA1C 3NAAL 4ETYA 1T1YB 5ADOL 4Z7UA 5D1ZB 1UB5A 1E4KA 5IIEA 3EJZC 5FV1L 3HAEG 1V8HA 2A9NH 4XP6L 4AJ0A 2AJSL 2WV3A 4Y8DC 1KXQE 4KROB 3U0PA 2R0WL 3KPMB 2JELH 4DGIL 1FFPB 3FMGL 4N5ED 1E4XH 1PG7X 3DNKA 3KS0J 4X0KA 2OS7A 1TTGA 2VXSL 1ZLVK 1C5CH 5TFSL 1EZVX 5FV2A 5E94B 1YEJH 3ULSA 1CFSA 3S9DB 4ZUUA 1MHEB 1IGIH 1OP9A 1IGML 4NJ9H 4K9EH 4XI5C 5E9DD 5EFIA 3RKDD 4U1NA 5I8KH 4ONGL 1KJVA 4I2XE 4PG9A 3WBDA 3BZEB 2BSSB 4D8PA 5MP6L 3WJJC 2EEBA 5L8LB 2MCG1 5DHVB 4YIQB 2AI0L 4D3CH 4YHZL 3DO3A 4WI7A 2OI9C 2JB6B 3LEVL 1J9CT 3DVFA 1FAIL 4OLXL 1XCTB 5HVHC 1JNJA 3KPTA 3UJJL 2GITA 2DM4A 4K7FA 1G7QB 4URTB 1NDMA 3WXWL 1I1FA 4Y5YC 4U6HB 3UMTA 3K3QA 4PB9L 3HG1D 4M5ZL 2XIDA 3F7RA 1OCWH 3ARED 4LASL 3S34H 4PJ7F 3LS4L 1MREH 5EZJA 1KELH 1BD2E 5KSUB 3OF6A 5GGSB 3S37H 1YZZA 3PQYE 2AS5M 4X4ME 2BMKB 5JZ7D 1LILA 2N7AA 3VGAC 2HAZA 3JTTB 2GT9B 4JLRA 3H9SA 3C09C 5H2BA 2VITB 1FC1A 3QUZA 4N5EC 1T6WA 2VDNH 3MJ7A 2VAJA 1KYOK 4RQQB 1OVZA 3RTQA 1ZHKB 1Q9LB 3PV7A 1UJTA 4C58B 4KPHL 5KVMC 4MD0B 1A21A 3HNSH 3EJJX 1S9YA 2VUOA 3P0VH 5T3XE 1FN4A 1YY9D 5DEGB 1QHPA 1CFNB 4EBQL 4OQTL 5C2UB 1FNLA 3OR6A 3LH2H 3ECBA 1TVHA 1OAUL 4HIIA 4BQ8A 4I0KA 2A38A 4NZTH 5HGDB 3M1BB 1DQDL 3TN0D 4EVNB 1U3HA 1YNTA 4UV4H 1KEGH 3W9DA 5KVDL 3DUUB 3NH7L 4GMSH 3CZFA 3GK8L 1V3KA 1UC6A 1WTGT 1IGJA 1MCBA 4L8SA 4PRIE 1A3LL 2XN9E 1OP3H 4EXPX 4HH9A 3CDYA 1AE6L 4MNGB 1QSZA 4PJEF 3AREC 2W91A 1KJ2B 4PJBE 3FQRB 2OQJB 1C12B 1AFVH 4PREA 4WFGE 3QDGB 2R0KH 1BQLH 2FYYB 1RMFH 2D31B 4OD2B 3LKQB 5JZ7C 4NZRH 1XR9B 1J0HA 1QKZL 5C0ND 5K33A 5IKCB 2BVQB 5SV3A 3GHBH 4R90L 4BSWB 3Q3GA 5H35B 4L3CA 5AG8A 1KGCE 1U8IB 1FPTH 4UTBH 5C0JA 2VDKL 3MROA 3EYOB 2D7MA 2L0DA 4PR5B 3NACL 4NN5C 3GSWA 3IB4A 1GSMA 3U7AA 3PWNB 4EOWH 4M7LT 4PFEA 1E4WH 3WYRA 1HYRC 1MCLA 1IAMA 4KI1A 1BP3B 2O61A 4YUEH 4YEFA 1YY9C 3IKKA 1MRDH 4JN2A 3ELAT 5JW4M 3MYJA 1IC4L 2MTPA 2R1YB 3EKCA 3E6FA 2V5YA 1OAYL 1UA6H 3RVVD 4KI5F 3VH8A 4RNRB 3TN0C 3VXRB 4S0SD 1D6EA 1FSKC 3LRSA 5J6GA 4Q9RH 3JV6B 4FXKA 1NGPH 5F9DC 4XBGB 1JGDB 2X9XA 4OFYA 2A9MH 5H37G 3VXSA 1PYWB 3FO9B 5CSZB 2JCCE 2VL5A 5FYKD 2BNRE 5JTWA 4JREB 5DK0A 2CR3A 1SJEB 5C09D 3IJYB 4NQXA 2EE9A 4ELMF 4QHUA 4Y4FA 3U46A 1ZVHA 3GO1H 3JWDL 1AO7E 2FIRT 3NPZB 3FL7A 4L4VD 1HXMB 4M7JH 4DCQB 3L3GA 5C0NC 3VXMB 1T4KB 1ZHLA 2ESVE 1N7ML 2VLJE 2VWEE 2I07A 3SQBA 4RIRA 1WGOA 2AGJL 2OCFD 5FYJL 1MIML 1RPQA 3LKOB 3ZE1F 3MRGB 3MRDB 1EMTL 1B3JA 5CINL 4LLAA 1SYSA 3WNMA 1OAQH 1JN6A 3O4LD 3KLDA 5AWNL 1MJJB 1I7TA 5JW4R 1FGVL 3CDGA 3DUSB 3JTSB 1V7MH 1X5KA 1YEHL 5LKNA 1TZGH 3SDCA 1A6VL 3PWUA 3QNZA 1AR1D 4KWUA 3RVVC 3TH4T 1R3IH 3S36X 4HUUA 5D7LB 1XF5B 2C1PA 4WIQA 2M2DA 1E27B 5EUOA 3NPSC 3P9LB 5TDNB 4JKMA 4PJFF 5LBSH 2Y5TA 1JPGB 4KQ4L 2IPTL 2I5YL 3W9EB 2JIXD 4F15B 5HHOB 3S5LA 4EDXB 3T0EA 2AP2A 4LBEB 2VDMH 1HHGA 3KWWB 4P2RD 3FHAA 4X6EA 4XBEL 5EU4A 5IB2A 4ALAH 4EIZC 3V7MA 5EU3A 3D2UB 3MREB 4S1RH 4U2ZA 3U0WH 1EXUB 4RDQG 3RWEB 2XTJB 5ABDE 5DVKA 5F88A 2BRQA 4QRPD 5HHXL 4CADB 2EE6A 4G6MH 4FQCL 3IDXH 1CGVA 2FO4B 1P69B 2GI7A 4ISVB 1CD1B 4XCNA 4JHAL 4Z0BL 5HVGB 1A3QA 1IC7L 3VWJA 4H88L 1OTSD 2O5XL 1GGBH 3DRTA 1JPTH 2AEPL 1BVZA 1NCWL 1TNMA 5IFHH 2D3VA 5JW5A 5I66A 3EBAA 5F9JA 4HW6A 5HDOA 1S5IH 5DZNA 2QKIA 1ZLSL 4UB0L 1R3LA 2AK4E 1AR1C 4R7DB 2YSSA 1J0JA 3MRCA 5DJ8B 3WUWG 3WO3B 1VGKA 12E8H 4NQEA 5CZXD 5ETUA 5C0BB 4JY4B 4LLDB 1SYVB 4V2CB 5DJCB 3DHJA 5DK2B 1QSFB 3KPQA 5HDQH 5DD3H 5JDSA 4NPYB 2CXGA 4AT6A 3GNMH 1FL6B 5DJ2A 2UWEF 2J3SA 3HRZB 1RJCA 4KTDL 2YD7A 1SEQL 1VENA 3BOVA 3UTTB 2B1HH 3TA3B 2IGFH 4X4YA 4NQDA 4PJGB 4N1EA 2R0LL 5CEZH 4YDJA 2XNAA 2ZSVB 4HKZA 4ETQB 5FOBB 5DD5H 3IJSA 5IQ7H 2H32B 3B8YA 2Q76A 5FGCE 5JOPD 2H8PA 2O93L 2CK0H 3KPRB 1OGAA 5C07E 5CP3H 4OLEA 4U1HA 3CPLA 3QCVH 3BPNC 2X1QA 4N5UA 2BNUB 1KTDA 3E8UH 3RWCB 2E9WA 1I1AD 3K8LA 2Y7QB 1CICA 2PW1B 3U7YH 1U8QB 1ZA6A 2BVOB 4LDLB 1EFXB 1JHLL 4QRRE 2HJLB 5T3ZD 4K23L 1OTSC 3OKKB 1I3VA 4ZUWA 2NX5A 4K3JL 4CU7A 1JNLH 1FL3A 3MGAA 2DS4A 4I13B 2KZ1B 4PJDE 5GJSL 4JVPA 4TUKL 1NCAH 2X1XR 3BPLC 5F7DB 4X4XA 1MJUL 1N5YL 2BOBA 1M4KA 4YBLB 5CEYA 3SE9L 5CZXC 3O3DA 3V5KB 5HBBA 4DUXA 4G8IA 4GG6F 2ICEB 3HCVB 4GLRH 4NHUB 1NMCC 1DSFL 4WO4D 4WI8A 4Q6IA 2YA0A 4WVRA 1KJ3H 2B7DT 2DIJA 1GOFA 4JO1L 4LLUA 5JOEA 1JHTA 1PGRB 5D71H 4HC1L 3WKML 1QD0A 2ZPKL 3H9HB 4MCYB 4Z7WB 3UPRB 4X7SH 1VCAA 1FZKA 1Q0YH 2DWEA 4TUJA 4OM1L 3CFCL 1HEZA 5I1GH 1DL7H 5D1QB 1QA9A 1EERB 3W11D 1KLUB 4F2MB 3D69A 4PRBB 3BXNA 4M48H 5I73C 1OY3B 3T1FB 3GI9L 5HHQB 3B9KB 4WU5A 3D48R 3MUJA 4KK6C 3MLVH 3BD4A 4OLVL 5DMIL 1H8SA 2H6PA 3KXFB 3U0TB 3MV8D 1J8HB 4XNXL 3TZVD 3UTSD 5E8EA 4FQ2H 4JKPH 5I76A 1OAZH 4FMKA 4ZXBD 8FABA 4FQXC 1I1AC 2DTML 2YA2A 5FEBA 5KBNC 5T5NG 5KSBF 1VGEL 4AEFA 1ZKAA 1GJIA 2E27H 4C56A 3SKMB 5E2VH 5CP3A 4R0LB 3I02A 2BFVL 4QHLB 4F9PA 5FM4A 3W5NA 3VXPA 1FYTE 1NCDH 4Q2ZB 3SJVD 1HNFA 3OAZK 1CLYL 2DQHL 2VISB 2XZAL 3ALWA 1UB6B 1PZUB 3QIWD 5HYJA 1I4FA 5C0CD 4YDKH 4M93C 1J1XH 4P46D 4FABH 4JVUA 5EU6A 4QXTA 3T3PF 2GY7B 4M6ML 1MAMH 1SY6H 1MLCB 4HXBL 3HZYA 5C0GB 1T1YA 2ADIA 1W0WA 3NCCB 5D1ZA 2APVA 1RK1B 4WO4C 3UDWA 3A6BH 4NIKB 3TPUB 5DEFB 5CZVH 1T21B 3ZLQC 3KPMA 1FFPA 3W11C 3Q1SL 4FQ1H 3KS0H 1NFDB 2FJFB 4NM8H 1SJXA 1I1YB 5D96B 3G9AB 4HKJB 4LGRB 5DJZA 3O6FB 4S1SL 4Y0GA 3TV3L 1I1RA 4NN6B 2XWBB 4O9HH 4WHTB 1MHEA 3MGOB 5GRZA 1F6FB 5DD0H 3TZVC 4ZXBC 2EO9A 2ARWA 3BZEA 1ZHBB 2BSSA 2ARJB 4U6YB 2X5PA 4HFUH 5DHVA 4YIQA 4JZOB 1F3DH 3FQWA 3HZKB 2HTLD 2JB6A 4EI5D 5HI3D 5BW7A 1I75A 5IEHB 3VFGL 2O5YL 4P4KC 2CQVA 3TH3T 3N1FC 5I8OH 2B5IB 1V7NH 4MJ6B 3VFTB 3ARUA 3I6LD 3VXNB 3QIWC 4U6HA 4AEEA 3EJYD 2RIKA 3MA9L 1XT5A 4Y5VB 5KTEH 2YPLB 1AR2A 3KJ4C 5KSUA 4Z77B 5GGSA 5D93B 2F54D 3S36H 2BMKA 1UFUA 2IC2A 4FOMA 3W2DL 1RJYB 4B53A 2PETA 2J8UB 5DWUH 5EN2B 5D6CB 2UZXB 3EFDL 3JTTA 1EEUA 2GT9A 3M45A 2C3GA 3SKNA 4K2UL 2VITA 4JR9H 1A4KB 4HKXB 4U6VH 4RQQA 4BZYA 1Q9LA 4GMTL 3O6LL 4FP8L 1J0IA 1S3KH 4MD0A 3IFOB 5IK3B 2Z8SA 4GW1B 3IFNL 2CJUH 4KY1H 1JF6A 4Z7QE 3B83A 3VFRA 5DEGA 1CFNA 3RNQB 1HZHH 2DM3A 4XX1E 5FYJE 1RVFH 1TVDA 1T3FB 5DTFB 2FL5A 4XRCB 1ETZB 4RRPG 2C7UB 5DJDA 5HGDA 1ZVSB 3M1BA 5DLMH 5E8DH 4EVNA 2HTLC 3DUUA 1BVLB 4EI5C 1PW3A 5HI3C 4ZNCD 3QWRD 1UWEL 1DQJA 1UT9A 5F9OH 5EZOH 2ZUSA 1UACH 3ZKXC 3RZCB 2UYLB 4F8TA 3EJYC 4NP4L 1RUPL 2DBLL 2P5WE 1OM3L 5BV7C 5IJKA 4H25B 4MNGA 2AQ3A 4LRIA 2IFFL 5DQJA 3FQRA 2OQJA 1C12A 3O3AB 5JO5B 1HILB 1UGNA 2GTZB 3QDGA 2WUCL 1NAML 1IAIH 2PYEB 2RJMA 4OD2A 1LNUA 1WWWX 4F33B 2EYSB 1XR9A 3G5VB 5IKCA 4H26B 3MV7B 2BVQA 4BSWA 5DD6B 5L0QB 4F7MB 1YEFL 4IRJD 1U3JA 4QXUL 1N64H 1U8IA 5E8OB 3EYOA 4N9OB 4PR5A 2FGWH 4XB7A 3BJLA 2CDFB 1X5ZA 2X70B 3GMLB 3V2AR 5J4MA 1FP5A 5CGYD 3LKNB 4OSUL 1A1MB 3K80A 4J4PD 2GEEA 1QVOA 2ENYA 4X9FA 2DJUA 4O58H 3ETBF 2XRAL 3U36B 3ZTNL 4XP4L 4HZAA 1YQVL 2B1AL 5C0EB 4RNRA 1QSVA 3SBWC 1QR1B 4ZO7A 3QYCA 1MQ8A 1G9EA 3JV6A 4Q7DA 1JGDA 4ACPA 4FQIH 3D9AL 1Z9LA 3INUL 4DKFH 3VD3A 5JUEL 1WFNA 5T3XH 3GIZH 4OAWB 4JFOB 1WWAX 2XQYG 3RPKA 1I3GH 5DD1H 5FYKL 5IBLD 2GJZB 3IJYA 1DBAH 1HXMA 5BOPA 7FABL 1XF3B 4DCQA 4PJ7B 3VXMA 3A0OA 5J12C 2RR3A 2XI9A 2P8LA 4LPYA 1A6UH 4FNLL 4IRJC 4OKVB 3Q6GH 2ADGB 4XNUH 4FA8A 1EFQA 4PRHD 4OCYH 4WFHE 1N6QL 4GQ9L 4S0TD 5GISH 3RJQB 3LKOA 2UUDH 4DKEL 3MRGA 3PGDB 1KB9K 4K71C 1INQB 1FZOB 2BRRH 4UIKL 1LP9E 3ZYZA 4MLSA 1YY8B 5CGYC 3VRJA 5AD0B 4S1QH 4J4PC 4LQ1A 4QXGL 4M03A 3D85D 3DX9A 1MJJA 1UKSA 5F8RC 3DUSA 1GGYA 1QFWH 3JTSA 4WUKH 1JWUB 3GIVA 1NMAL 1P4BH 1OD7A 2VLLB 3W5MA 2VIRB 4NRYB 3VA2C 4GQPH 5D5MF 5D7LA 4JFXB 3U4AA 1XF5A 2X10A 5FO9A 2FD6L 4X4MA 4OZHF 1E27A 3ZO0A 5E70A 3L5XH 3P9LA 4HWEL 2VZVA 3CX5J 3FRUB 3WFDH 4KTEL 1IFHL 3W9EA 3IXAA 1CD8A 5HHOA 3GKZA 1RZ8B 5JHDB 4EDXA 2LTQC 4MMZC 1QPPA 4HHAB 4XC1H 5IBLC 1CDCA 4LBEA 4C55A 3KWWA 1X5JA 3WFBL 5TDPB 1AHWB 3MOQA 4NC1E 4D9LL 4PRPE 3TWCH 5BVPH 5GS0D 2XICA 3D2UA 4PJEB 3MREA 1EUTA 3HNVL 4OIIL 1P4IH 2NY5C 1G0DA 1S9WB 1I8LA 3MRRB 4KKBD 3WN5B 2EO1A 4XNMB 5TE4L 4MDJB 5K9QG 5F7WC 5D7IE 2FO4A 2FX8H 4ISVA 1LK3L 4NWUH 3QEUB 3QDJE 4QGYA 1C08B 4ODBD 4KUZH 1FRGH 1NANI 2HMID 2C4FT 2XPGB 3MOBL 3I50L 2FNBA 1CTNA 2DQEL 4HKBB 25C8H 5AZEL 4R7DA 5DJ8A 2DQJH 1XAUA 3IFLL 4JY4A 4LLDA 4R4ND 1SYVA 2IAMB 3BH8A 4JRYB 5DJCA 5DK2A 4EN3A 5AYUL 4J2XA 1QSFA 5ALBH 2PTVA 3H3PL 1T0NB 4NPYA 3VE0B 1FL6A 3HLAB 1RIVL 1DN2A 4DZBA 1JZ7A 2E7HA 3KHQA 3HRZA 3RAJL 3E1F1 3V5DA 1MCWW 4KRPB 4P3CH 4DFHA 3NZHL 1FZJA 1SM3L 1N8ZA 4OZIE 3GSUB 3UTTA 3TA3A 5J13C 1YC8A 4PJGA 5F3HB 1KYOJ 3JSSA 4M4PA 3HPLA 4PB0H 3WMSA 5GS0C 2ZSVA 5SWZE 4ELMB 3VFNB 4MMXC 1OPGL 2H32A 2EC9U 4IIQB 2JJUA 5J1TC 4KKBC 3KPRA 2FR4B 5ANMB 2FSEB 4DGYL 3RWCA 1CDHA 3U9PH 2Y7QA 1U93B 1U8QA 2BVOA 1EFXA 4E9LA 2HJLA 2BJML 2HYMA 5JHLL 1FG2A 3AVEA 2HMIC 4OCXH 4JAMB 1T2QH 1IGTB 3UTQB 3MRLB 5M94B 5T3ZL 1QHOA 4KK5D 3F7YA 1MCQA 5F7DA 4Y4HD 1FC2D 2X89A 1ADQL 3OR7A 5DC4B 5A40E 1PDKA 3V5KA 5CCKH 4R4NC 2DWDA 1NBYB 1FNGB 2X4SB 1UG9A 3HCVA 5GRVK 4JY5L 4NHUA 2VZSA 1N26A 5IMLB 1G6RH 4HXAL 3DGGB 3BHBB 4OZFB 4J6RL 2VLJA 2B4CC 3BKYL 2Z9TA 4HWBH 4BJLA 4Z7WA 3UPRA 3P2TA 4Q0XH 4ZAKA 3CMOL 5F1NB 3HMWH 3V5HB 4FQQB 4QHKI 4L3ED 5DVNA 5MEOB 3WKNA 4PJFB 5D70H 5DQDH 5D1QA 4NQCD 1KLUA 1K5NB 4F2MA 4LEXH 1F2XK 4XXDB 2CGRL 3SKUD 3UJTH 3HG1E 3WHXB 3T1FA 4JANB 1RZGB 3B9KA 3WFHB 3ARFB 1F00I 3TBWA 1KENH 3HS0A 2Q8AL 1JPSL 1Q1JH 3LZFH 1LO4H 2VXQH 5KANG 3KXFA 3U0TA 2IPUG 3LKRB 3WIIL 3I75A 4LSQH 2OXGA 5GHWH 4Y19D 2WP3T 1CL7H 4YHOL 4I4WA 1INEH 4NN7B 2WSKA 4R0LA 1OF2B 4QHLA 1I9IH 3L3OB 2VDPL 4LPCA 3NAAH 3JVGA 3QUXB 5BZWB 5ADOH 5BRZE 2VRAA 3VD9A 3FB8A 1K4DB 5CKAA 4KK5C 4XP6H 2AJSH 4X7TB 3AAZB 4Y4HC 2EICA 2D9CA 4OZ4B 2IQAB 5KSAD 2R0WH 4JFHE 1VESA 4DGIH 2XQYK 5FUOL 3OJMB 3FMGH 3SGKA 3D6GA 1DUZA 5C0GA 5KSVB 1ZEAL 2V7HB 1RK1A 3NA4A 4YPGB 1EEQA 2VXSH 4YHPA 5TFSH 3QI9B 4RMUA 2I9TB 4PJIF 4YBQD 5DEFA 3TPUA 2F8XC 4X5LA 1UZ8B 1T21A 3IDYC 1A6TA 1VEMA 1IGMH 2UWEB 3GB7B 3UYRL 4JDZB 4GBXD 1BQHG 3FOLB 2H1PL 2XXCB 3BW9A 1NFDA 2FJFA 2L7UA 3PWJA 1I1YA 4HKJA 3DPBA 5MP6H 4XAKD 5IF0B 3O6FA 4O2FB 1YYLL 2AI0H 2EKSB 4YHZH 2XWBA 3WIHL 1INDH 1D5MB 4ZOCA 1KPRB 3LEVH 4WHTA 1TZIB 4MX7B 1FAIH 2X9YA 1XGRB 5GRUL 2AK4A 3UJJH 3OKDA 3TBTB 2A77L 1UH4A 2MQ3A 3WXWH 1ZHBA 2F58L 2BNQB 2ARJA 4U6YA 4DAGL 4YR6B 4PB9H 4M5ZH 3PIQB 3ARWA 2V9RA 4L4TB 4LASH 4I48B 3CFKB 2M1KA 3LS4H 3VFMB 3QIUD 4ONOA 5IEHA 3L3JA 4LCUB 4X8JB 4MJ6A 3SGDH 3VFTA 4JZJB 4YLQT 1TQCB 3PL6B 3V7AG 5KSAC 3KYKL 4XNYL 1ITBB 5GGRB 2YPLA 3Q6FB 4HS3B 3N1PC 1JTTA 4Z77A 2BK8A 5I1IL 2DL9A 5BV7L 4KPHH 5EBWB 4GG6B 1HN1A 4L1DA 4YBQC 5I1DB 5JW3L 1EIBA 3DARA 5ENWB 5D6CA 4XCYB 4EBQH 1XGYL 2COQA 4U1IB 4OQTH 4GBXC 1CQKA 2AVGA 1A4KA 4HKXA 1AY1L 2XACC 4KMLB 4LGSB 1OAUH 4KGLA 1YPZE 2EDNA 3FT3B 4P4RB 4JPKL 5A43C 5C1MB 3RNKB 1DQDH 3IFOA 5IK3A 5I15L 4PJDA 5KVDH 2LFGA 4L4VE 4X6BB 3NH7H 3BKML 3GK8H 2A6KB 3RNQA 2R2EB 1QFHA 4AMKL 3VFOB 1DANU 5E9DB 1A3LH 4XRCA 1ETZA 2APWA 1AE6H 1ZVSA 3TBVB 2GJJA 1H8OA 1BQHB 1S7QB 1BVLA 5KSBB 3QIUC 1JUFB 4V1DB 5IUSA 4ZYKB 2RFXB 3U6RA 4EUPG 3UPAA 1QKZH 4MNQE 1CS6A 1XH3A 4R90H 3RZCA 2UYLA 5K59F 3NCEB 2ZWLT 3IDUA 4NNYB 4KKNA 1KN4H 3LD8C 4WV1C 2X4PB 1NGYB 1BZ9B 2VDKH 4XC3L 1S7RA 2R2BA 3TP4A 1BPVA 3MJ6A 3EYVB 3HE6A 5FA4B 3O3AA 5JO5A 2DYPA 3AREB 1HILA 2GTZA 3NACH 4BKLB 3QXWA 4NKQB 4QTHB 4N1HB 1ND0B 2EYSA 3OL2A 4Y1AD 2A1WL 3WFEL 3G5VA 1S7UB 5GS1B 3QDMB 4F7MA 2HH0L 5E8OA 1IC4H 2ZUQB 1L7IL 3BFOA 1WVZA 2IAND 4XPFL 1OAYH 2CDFA 4UU9A 2X70A 3GMLA 4UIMB 4OQTA 3REWB 1IQWL 3LKNA 1U8OB 4O4YL 1A1MA 4KV5F 2XKUA 3NBNA 2I27N 1JWMB 4MJID 5C0IB 4IOSD 4M8QB 1MCDA 1VFAB 1WFUA 3OHXB 3Q48A 4P2OD 2BVUA 2YUZA 3GJFB 1QBBA 4QRPE 3GMPA 3N0PB 1ZLWH 1FBIL 1NEZG 1R3JB 4CU6A 1YMMD 3EO0B 1LDPL 3QXVA 5DF0A 5E0QA 3OTTA 4FQHA 5FFLA 3JWDH 3QQ4B 3O4OC 1H3PL 4IDLA 5JMOC 2ZG1A 5D7JB 4OIAA 4RISH 2OMBA 2YN5A 4GRWE 1EBAA 1RZKC 1N7MH 4W6XB 3D18B 4JFOA 1GGCL 1NAMB 4LSSL 2GJZA 3BDBA 1R5WB 2AGJH 5FYJH 2ZNXA 2A73B 1MIMH 4PJ9B 4WU7B 2UZYB 1EMTH 4NRXB 4PBWD 5CINH 1II4E 3DX8B 4PJ7A 2EZ0D 1EH9A 2OL3B 3O8XD 5AWNH 4L29B 1P4LB 1ZS8B 2NZIA 2WINA 4G6JL 5IG7B 4W81A 5EO9B 4OZHE 1NGXB 2IPUK 2NY5L 1YEHH 3DWTA 1T66D 4KHTL 5HSFA 4YHIB 1A6VH 4YDVB 2IH1B 5I1KL 3PGDA 4XPTL 1INQA 2J6EL 4K94C 1OOAA 5AD0A 5E5MB 3HPJB 2NTSP 5DS8B 3ZDZF 3LIZL 4KKCD 4DW2L 1NCNA 4P99A 1WT5A 1LMKA 4NKDB 5JR1L 5DJYB 1IM3B 4P2OC 3MV9D 3LMJL 3EYQD 2YWYA 3K81A 1JWUA 4KQ4H 2IPTH 1A9EB 2I5YH 4U4BA 4ODSL 3MBEA 5EG6C 1FAKT 3T4AB 2LU3A 2VIRA 4NRYA 5MENE 5E08L 5KVEL 1IC1A 3HRPA 5C0DA 5A3IC 4XBEH 1AD0B 5SX4I 4ONHB 1KCVL 5IV2A 3O6ML 5HI5C 4ZTOL 3NPSB 5T3ZE 3ZT5A 3PUCA 4KXZI 3T0DA 1NC4A 2BHUA 1F2QA 3FRUA 4GW4B 3EYFB 1UQSB 1M7DB 3NFSL 1RZ8A 2L7JA 4HHAA 4YC2C 4L8DB 5C09B 3U4BL 4KDVA 4FQCH 5TDPA 1AHWA 1EVUA 1CXIA 4YK4C 4WI3A 1UM6L 3QEHB 3CVIL 4I1NB 2OYPA 4MQTB 4JHAH 4PJEA 3OAYH 4W6WB 4Z0BH 2EZ0C 1IC7H 4H88H 1S9WA 2O5XH 3O8XC 5GS0L 3MRRA 3ZKSD 1UM4L 1AQDB 1SBBA 2AEPH 1P84J 4LCCB 2A6DB 4HK0B 1NCWH 4XNMA 1ZE3C 1T66C 4CMHC 5D4QA 5KZCD 3TO4D 1ZLSH 5FYJU 4UB0H 4ZNEA 1CXKA 3GUTA 4OIBA 3PGCB 1DBJL 3VD7A 1YJDC 1C08A 4WI9A 1N5AB 3TBYA 4KJWD 1HHHB 3O4LB 4R4FL 1MFEL 1G7PB 5AUMB 4HKBA 3EYQC 4IHOB 4G8GD 4KTDH 3VMPA 1SEQH 1I9JL 4QY8B 3BT2L 1VFBA 2IAMA 1DR9A 2PXYB 2AJ3B 1MI5D 2HRPL 4HJ0D 3CNKA 3BN3B 5ISZD 2AXJA 2R0LH 4QF1B 3GJEB 2Z8RA 1CCZA 1X5XA 3VE0A 3ZDXE 3TT1L 3HLAA 1ZT1A 2NY6D 1HKFA 3EYUL 3FJTA 2UY6A 4ODTL 4W4OA 4P57B 3SJVE 2MJWA 2GIYA 4J23A 4F7PB 3LPGA 1I7RA 1GL4B 3VJ6B 2B4CL 5ID1A 3RUGE 3OXSB 4P2RB 5F3HA 1P9MC 3RIFK 1RZ7L 5GXBB 5DFVC 1EK3A 4ELMA 3VFNA 1JHLH 4JG1L 4K23H 1OL0A 1FFRA 4K3JH 3EOAB 1U92B 4HUNB 5J56B 3STLB 1T20B 1QLRB 1VA9A 2W9EL 2B8OT 4JFFD 4X6CE 5GJSH 4QRQA 2FR4A 2XXMB 1Q94A 3O9WB 4TUKH 4YHLL 1TZHB 5EDXA 1UJ3C 1MJUH 5F9AC 3TO4C 1N5YH 4MQ7A 4PGDB 2PO6B 3SE9H 4OZGE 5E03A 5FKAB 2NTFA 1T5XB 1FL5B 5LGJA 4JFYB 5EB9A 4KJWC 1DSFH 3BGAA 3L5IA 3KAAA 4JAMA 4JQVA 2PYFA 3MRLA 3C60B 4JO1H 3WKMH 3MNWB 4HC1H 5CJ5A 3RVXD 2ZPKH 1BM3L 2PNDA 5J1SC 5HYQB 2X09A 1GYAA 4XVJL 4XT1C 4OM1H 4ZFOL 4U1MB 3CFCH 5E00B 1IQDB 1NBYA 2X4SA 4HJ0C 4YFLF 3KJ6H 1I1CA 2CRMA 1ORSB 5IMLA 1NMCB 3DGGA 3BHBA 4OZFA 4YFLI 3BD5A 4UDTB 5D5MB 2NY6C 4ZFFB 4F3FB 2R4RL 2BXZA 2HTKD 4OZHB 4WTZG 3F7VB 4OLVH 3CIQA 1CXFA 5F1NA 3UX9B 5DMIH 3V5HA 4FQQA 4DOHE 5MEOA 1KJMB 4X9GA 2F19L 4PJFA 2GY5A 1TQBB 3G6JE 3LKSA 1B88A 2D2OA 1HHIB 3F6LA 3BO8B 3CMGA 3QFJE 2DTMH 1QBLL 3WHXA 1VGEH 5I73B 4PTUB 4JANA 4QOKB 1RZGA 5DUPL 2BFVH 4CJ1A 2VAAB 1WUNT 4XBPA 5T33L 1U0QA 4DJMA 1MHHA 2F54E 1U9KA 3QXAB 2DI8A 3TESA 2AEQL 3LKRA 1CLYH 2DQHH 2QV2A 2NZ9D 1OAXL 2XZAH 3L5JA 4RWHA 5FUZL 1F3RB 1TJIL 4M6MH 5ACZB 1OF2A 5E95B 3L3OA 4HXBH 2NY4C 3QUXA 5BZWA 3FONB 1QEWB 1UCBH 3VXQB 5I6XC 3RHWK 3FFCB 5IW3A 1GAFL 5K9KA 1K4DA 2HFGL 3B2VL 5IROA 3RVXC 3OXRB 3N1QC 4X7TA 4LCIL 1FCGA 2AJYL 2IQAA 4OZ4A 2XA3A 2WIIB 4IJ3C 1U36A 1KN2L 4PJXF 4M93B 4ZOAA 3D3VD 4MXQC 3T08A 3C8DA 3OJ2C 3Q1SH 3BGFC 3PABB 4HC1A 1DUYA 4QHKJ 3LN9A 4YPGA 1IGCL 2YBRA 5JOFA 5L2JA 4S1SH 3TV3H 3QI9A 2I9TA 3WDJA 1T22A 2HTKC 4OF3A 4XMKL 4E41E 4Z6AT 2HN7B 1NAKL 2Z91B 5F7YC 4C57C 2VLRD 2UWEA 3GB7A 5ICYB 2XWTB 2GKIA 4JDZA 4G8FB 3X13B 3FOLA 4BZ1L 4KJQD 3QUMB 1UEMA 4WHYG 2ZUTA 1FNAA 3ZHKA 1P6AB 4U3HA 4CVXA 1J05B 1U8JB 4J1UA 4O2FA 2EKSA 4RMSA 1T2XA 2KDGA 3C8HA 1D5MA 1QRND 2QHRL 2EDFA 1TZIA 2HLAA 3G5YB 3VFGH 3Q5YA 1XGRA 2O5YH 5MERB 3MV8B 5C9JB 1F4YL 2NZ9C 3ARSA 3UTSB 2ZUUA 4ZXBB 4HWZA 2BNQA 4BQBA 4NQSB 4YR6A 1IM9B 3WJJA 4QNPE 1ZLUK 3MA9H 4L4TA 4I48A 5DZLA 3CFKA 3UAJD 4F7CB 4JRXD 1MY5A 4XVTL 4M7KL 3V6FB 5DSCB 1NJ9A 4X8JA 5I71C 3H3KA 1AIFA 3W2DH 4JZJA 3WE6B 4XPAL 2HLFD 4HMDA 4Y5YA 2OZ4L 3EFDH 5HYEA 4N8VB 2O5ZH 5C0CB 4HJJL 2ARJQ 4P46B 4JCMA 5GGRA 2EIEA 3L7EB 1RUAH 3Q6FA 5BVJA 3GDBA 1U95B 2VDLL 3T3MF 2CDGB 4LIQL 2HKHL 1FO0L 4GMTH 1MFCL 3O6LH 4FP8H 5EBWA 3IAGC 1A1OB 4GG6A 3QG7L 3GBML 1MUJB 1WBZA 4E0RA 3IFNH 2J12B 5ESVB 1F6AB 2BSTA 4XCYA 4U1IA 5E1HB 3CSYB 1MHPL 5L7XL 2Z31D 4RAVA 1WJ3A 4DWHA 4XTRD 4DEPB 1G1YA 4KJQC 5CIPB 4Z7OF 4X9BA 2CRZA 5HYSG 4P4RA 1JCKA 4HUMB 3GJFH 3R8BB 1LEGB 3U1SL 3RNKA 4RFEB 4BFIB 4L3AA 3THML 3HZVA 2ADJB 3QNXB 3CSPA 5DURB 5IHUL 1UWEH 5EWIL 4G7YL 2A6KA 2R2EA 4UQ2B 2JB5L 3VFOA 1T03L 5E9DA 4HPOL 4GKZB 4NP4H 2P7TB 1RUPH 2DBLH 1OM3H 3MLPA 3PHSA 4RFOL 1QYGL 3BE1L 3F7QA 1QLFB 4I3SL 2IFFH 5DJAB 1S7QA 3UAJC 5KSBA 3G5XA 2WUCH 1NAMH 1JUFA 4V1DA 4EI5B 5CLWA 3VI3F 4ZYKA 2H2SD 2RFXA 1OTUD 4NGHL 2C26A 4KMTL 1W8NA 4GOSA 3BI9X 4U33A 3ZKXB 1YEFH 5IVZB 2PW2B 4G5ZL 4NNYA 4QXUH 4RX4D 2X4PA 1NGYA 1G9NC 4D0BB 3JV0A 2V7NA 5EBLB 3PGFL 3AREA 1RZKL 4UT7L 1PEZA 5L6YL 1NGZB 3C5SB 1VFMA 3FRPG 2IALA 4OSUH 3FB7B 1JE6A 2GFBA 2VL4A 4P59L 5F7FA 1CFVL 4JQIL 3LEYL 3V8OA 2Z31C 4C59B 4PJIB 3A6OA 4XTRC 1WFOA 5I16B 2K7PA 5C6TL 3RBGA 5IMMB 1CGWA 2XRAH 3ZTNH 4KAQL 4XP4H 6CGTA 1JZ6A 1CBVL 3D0VB 3K7UA 1YQVH 2B1AH 4UIMA 1PY4A 4H0HB 5SWSD 3REWA 4JFPB 1NCCL 4R6UA 1U8OA 3NGBC 4NZUL 3MJGX 2AKRB 5C0IA 4K94L 1Y6KR 2GAZB 3D9AH 4M8QA 4XAWL 1VFAA 3OHXA 3INUH 4IBLT 5E7FA 4NUGL 3GJFA 4PRNB 2W9DL 1DQQA 1KIQB 1T1ZB 2IQ9L 5E4EB 3T0AA 4LLWB 4APQD 5JUEH 4UQ3B 1UH3A 1R3JA 4UBDD 4WDIB 3EO0A 4TULL 5FYKH 2R4SL 2AERT 1EAJA 5BS0D 2H2SC 5HYSB 1OTUC 4MQSB 3BZDA 5D7JA 7FABH 4FTVD 3LEXA 1YDPB 1VSCA 4U05A 1GHFL 1L9NA 1MELA 5C08D 4OFIA 3QZWG 1F58L 4FNLH 4DVBB 1BFOB 1JZ8A 2ZSWB 4B7IA 1NAMA 5L2KD 1EV2E 3BEVB 2FIKA 3FN0L 4LFHD 5TH2B 1N6QH 2A73A 4GQ9H 4PJ9A 2F74B 4DKEH 1XGQB 3TM6A 3DX6B 3GMQB 1U2HA 4AQ1B 3DX8A 4UIKH 1PY9A 3LV3B 3OKOB 3HI5L 5EORL 2OL3A 4QXGH 4HG4K 1TVBB 1P4LA 1ZS8A 2PKDA 3V6BR 4IRJB 5EO9A 5IG7A 1Y0LB 5ESQB 3U9UB 1NGXA 3REVB 3IFPB 3C6SA 4KZEL 2AK1L 4YHIA 5CJQL 4YDVA 2IH1A 4JGJA 4HEME 1DN0A 1NMAH 2XQBL 5D1XD 1A7QL 1L0XA 1M7IB 1BFVL 3HPJA 2FD6H 1CDGA 5DS8A 2VLKB 4HWEH 4NKDA 1YJDL 5GS2D 1IM3A 4JY6A 4YHML 4APQC 3FT2B 4POYA 4KTEH 1DDHB 1A9EA 1IFHH 1LD9B 4UBDC 5DUML 3DXAB 5E8PB 3UCRA 3JZ7A 3W0WB 5TJWK 3JV4B 2V2XB 1TDQA 1RHFA 1VHPA 4N0FB 3WFBH 1AD0A 2VOTA 4ONHA 5DJXB 4D9LH 5DRZA 2OTPA 4AIZB 4AENB 5EPMB 3HNVH 4OIIH 3EYFA 1UXWB 1Q9OB 3KNBA 1U8MA 1UQSA 3ARGD 1M7DA 3VFSA 1BLNB 2X41A 5TE4H 1I8IB 4L8DA 5C09A 5CWSB 2D7QA 5FYKU 1OP5H 3QEHA 3VFPB 3WHE1 4L4VA 1LK3H 4B41A 4JFED 4WENB 1FFNB 3VW3L 2W9LA 2YD3A 5B39G 4AQOA 3RI5F 1XEDA 2ED7A 2FATL 4LCCA 3MOBH 2A6DA 4HK0A 4MJ4A 3I50H 3VMOA 5J11C 4XCFL 2DQEH 4PRHB 5HHNB 3SCMD 4L3EE 1CT8B 1LHZA 5AZEH 4HZLB 3BQUD 5D1XC 4BELD 4NQCE 3ESUF 3IFLH 1BD2D 1I8KB 2A83A 3WLBA 1E6OL 5AYUH 3PQYD 4HCRL 5EC1B 1HHHA 3O4LA 3H3PH 1EEZB 4XNZC 3ZKND 1VB9A 1G7PA 4RA0C 1RIVH 5T1KB 3IDNB 3C5JB 3RAJH 1WQVT 4TSAL 5CJ8A 4C83B 3NZHH 4IOIB 4QY8A 5TGBB 1SM3H 1R0AL 1AKJB 4Y19E 4JKKA 2PXYA 1SJHB 2AJ3A 4H0GA 1A0QL 4JJHA 4QF1A 2P5ED 3RX7A 5DRNA 5ERWB 1OPGH 3BAEL 4P57A 3ARGC 4F7PA 1ULVA 3VJ6A 2JIXA 3HKFA 4WGWB 3SO3C 4DGYH 2MQCA 3P4NB 3AUVA 4P48A 1J87A 3OXSA 4P2RA 3FT4B 3FOMB 1TTFA 4NO5A 4OCRL 4K7PL 3MGTB 4ORGB 1K4CB 2BJMH 3SGJC 4U0RC 2Z0BA 5EZIL 3EOAA 5JHLH 4KK8D 3FQNB 1T20A 1QLRA 4XWGL 1JPFB 4PRID 4QRPA 2XN9D 5T3ZH 3O9WA 3U4EA 1TZHA 4P5KA 3SCMC 1NANH 4PGDA 3BQUC 1ADQH 1X4YA 2D0FA 3B5GA 4WFGD 1HH9B 4YEEA 4HK3N 1KV3A 3R1GL 1T5XA 1FL5A 4JY5H 4XAKE 4EJ1C 1X3DA 3MLTA 5CJXC 3PDOB 4HXAH 3ZKNC 1DTUA 4J6RH 4GO6B 3BKYH 3MNWA 4PV8B 5JXED 2CKBL 1KGCD 3CMOH 1WAAF 3F58L 4YO0B 4LPTA 4U1MA 1NGQL 5E00A 2NCMA 1IQDA 2J5LC 2VZUA 4ZS7L 1J0KA 2W38A 2CGRH 1ORSA 3K74B 3QEQD 5FDWA 4UDTA 5D5MA 4F3FA 4R2GD 1F45A 4OZHA 3F7VA 2Q8AH 1JPSH 1WFTA 1N0LA 2R2HB 4FXLA 1KJMA 5FB8B 2EDQA 1GXEA 3WIIH 5FHBL 3BO8A 4X5XB 3HE7D 1UWXK 4LIQE 1YEDA 1XF2B 4Y5XB 4PTUA 3ARVA 2P8MB 2VXUL 3RIAF 1NGWB 4QOKA 5BMFL 1OAKL 2VAAA 2VDPH 4KK8C 3JWNC 4BUGA 3QXAA 4DUWA 2BNRD 2V6HA 3IKCB 1U8LB 2R1WB 1HH6A 3ZSSA 3PXHA 4NRZB 3G04B 1BQUA 2OBGA 4BFGA 3SDDD 1AO7D 4BYHA 5ACZA 5FUOH 1T80A 3RU8L 2W0FB 1ZEAH 1AGDB 2YD6A 3VXQA 4R4BB 3ARZA 1Z9SA 3FFCA 4L8CB 1U58B 1ADQA 2ESVD 3OXRA 1OLZA 5JXEC 3ZYOA 3S7GA 5CHNB 2WIIA 3L7FB 1Z5LB 3LN5B 3UYRH 1J86A 3PDDA 2H1PH 5LCVL 3PABA 4TSCH 1M71A 5EBMA 4WO4A 4TPRL 3RPIA 1IAKB 4PJHF 2HFEB 5B3JE 4R2GC 1YYLH 4WCYL 3WIHH 1B0GB 2DM2A 5CIPH 1JK8B 4WW2C 2DI9A 4ODXB 3V7AE 3MYZA 3ARRA 2HN7A 2Z91A 1G7JB 5ICYA 3B5HA 3VG9B 1ZHNA 2XWTA 5GRUH 4AH2B 2QQNL 5FM5O 3X13A 5HDLA 3BIKB 2A77H 3HE7C 3RVTD 2F58H 2ED8A 4DAGH 3T2OA 5MI0C 1KCUL 1J05A 1U8JA 4YGAB 4K8RD 2E7CA 4A6YB 1UVQB 2FLBT 3M8OL 1F4HA 4H8WC 3G5YA 3O11B 2GTWA 4PUBL 2KQMA 4Y1AE 1JVKA 3MV8A 5C9JA 3TZVA 4OF8A 3UTSA 1GC1C 3H7BB 4ZXBA 2X4NA 3KYKH 4NQSA 3U7WL 5FO8B 4K3EL 3HUJB 2W0LA 3D0LA 4XNYH 1T1XB 5F6HI 3SDDC 1BHGA 3WO4B 4WWKB 4FXGB 3EO9L 2DIBA 4F7CA 3C87A 3V6FA 3FCTA 5I1IH 3DSNA 5DSCA 5C0AE 5BV7H 1A5FL 1AC0A 2V5SA 3KLAA 4LLYB 4NHCL 3MRNB 4LSPL 4W4NA 4WI6A 5JW3H 5BO1L 1NMBL 3WE6A 4PLNC 3CH1B 3QIWA 4X9HA 4N8VA 5KSAB 5C0CA 1XGYH 4P46A 4UINL 4IMKA 1MFDL 3U83A 3L7EA 2DDQL 2ZCLL 5DRXA 1AY1H 1U95A 1YMME 5FF6B 4PJAB 2CDGA 4MCZB 3I9GL 5CAYB 3GHEL 1G9NL 4JPKH 1TCRA 3FAWA 5SX5K 1QO3B 3UTPD 2DKMA 4YHYC 5I15H 1UZ6F 3BKMH 5ESVA 4JFDD 1MCOL 1ZXQA 2LQRA 3CSYA 3TIEB 4TVPD 4OV6F 5CBEB 4AMKH 1E4JA 1JI1A 1L9MA 2MQ0A 3WIHA 3RVTC 2Q87A 5CIPA 3SE3A 4B5EA 5FAAA 1CVSC 1X7QB 2IPKB 4K8RC 3BP7B 1LEGA 1RJZB 4NUJB 5F9WB 4NWTL 1IAIM 4RFEA 2KZWA 4RFNB 4BFIA 4D0DB 4HWNA 3QNXA 4ONFL 2PTTA 4NKIL 5T5FL 4UQ2A 1KCLA 1A7RL 3UP1A 5B38A 1YA5A 3OMZA 5D2LE 4ZSOB 4JB9L 4YNYA 5LGHL 4OLZL 2P7TA 4OGZA 1J0ZA 4O5LL 4XC3H 1QLFA 2GHWB 5DJAA 2V5RA 2JLLA 1N59B 5LXGL 3ALXA 4EI5A 1FYHB 3QIUB 3OKMA 1CD0A 2ERJC 3SY0B 3FZUD 3QG6B 2A1WH 2XFXA 3WFEH 5C07D 1RK0B 1T2JA 1CQYA 3PHQB 4HLJA 3CU7A 5IVZA 1T7XA 2PW2A 3MV9E 1YEKL 2HH0H 3U0PB 3LD8B 4QWWD 4WV1B 1FO0B 4D0BA 1L7IH 1A7OL 5EBLA 2Q3ZA 2G75B 4XPGL 3IDJB 5DMGD 4PJXB 4XPFH 4S1DD 1CFTB 2IJ0C 4QRRD 3OB0K 3C5SA 2XYCA 3EDDA 3TCXA 2F54A 4M9OA 3IU4L 3V6OC 1IQWH 4O4YH 4FFZL 4PV9B 4QO1A 3UBXI 3ULSB 3WJLC 3FN9A 4ZUVB 1IEAB 5CGTA 4PJIA 1NBQA 2OSLB 5I16A 4Q9QL 3BDXA 3QHFL 4Y4KD 1WCBA 1FBIH 2LVCA 3D0VA 4CJ0A 3GMOA 1LDPH 3AXLB 3PXJA 1NUDA 4K3DL 2YD9A 1UWGL 4JFPA 1FORL 1OLLA 3OB8A 3QUZD 2AKRA 1H3PH 1QFOA 3NFNB 4PRNA 1T1ZA 2QJDA 2GITB 4LLWA 3CFJB 4UQ3A 4P0DA 2VLMD 4K7FB 1NDMB 4WDIA 1I1FB 4I5BB 1GGCH 4LSSH 2H45A 3SBWA 3QWRA 3FZUC 3B43A 1YDPA 3DRQB 5C6PB 3OQ3B 3O2DL 1CXHA 2ZSWA 4G6JH 3ZMRA 3BEVA 4QWWC 2NY5H 4JLRB 3H9SB 1FNHA 1EO8L 4MGXA 5H2BB 5TH2A 3MLRL 3VH8G 1TTUA 4IMLB 2F74A 2WWMD 3B9DA 5I1KH 5DMGC 4XPTH 1BWWA 1XGQA 3QRGL 4S1DC 4UNTA 5D6DC 3RTQB 4R97B 3GMQA 5A1AA 1CLZL 2J6EH 2D7OA 3LV3A 3OKOA 3EIFA 5ISZE 2XY1A 1TVBA 3LIZH 2UZIL 4UV7L 4DW2H 4IRJA 1Y0LA 5JR1H 4CW1A 3DTXA 3REVA 3IFPA 1WIUA 3LMJH 1LO0L 3QCTL 4Y4KC 4NKMB 4ODSH 2IANB 2GJ6D 5TDOA 1M7IA 3ARQA 4BSJA 2MWCA 5E08H 5KVEH 4N0UB 1KCVH 1YNTB 4FN0A 3QUZC 3O6MH 4J4PA 2VLKA 4ZTOH 3AMLA 2OK0L 4MJIB 2Q3AA 2OMNA 2HFTA 4P2OB 2KUTA 1DDHA 2P48B 1LD9A 4L8SB 3DXAA 5E8PA 3NFSH 4CU8A 1IEBA 4NFBA 4HH9B 3JV4A 3ROOA 2V2XA 4I0CC 3U4BH 3MCLL 4N0FA 3BP5B 1K3ZA 1FJ1B 4OGXL 1UM6H 3JXAA 1A6PA 1U2CA 4AIZA 3CVIH 3FQTB 1U91B 1K8IB 1IKFL 3SO5A 4LHUD 1Q9KA 1QR4A 1UXWA 4P9ML 4JM2D 2ILLA 1MEXL 1Q9OA 3KLSA 4BQ6A 2EKJA 5GS0H 1UM4H 1DVFD 3PHOA 3ZYJA 1BLNA 1I8IA 2HP4A 2AQ1A 4RGMC 4ZPVB 2VC2L 4UAOC 2WWMC 3MO1A 4G9DB 2AAVA 3L3DB 2EH8L 3VFPA 4TNWK 4ZS6C 3GSWB 4Q9CA 1DBJH 4LVNB 2WWKT 1FFNA 3QP3A 3LQZB 1T0MB 2O61B 3CXHK 4R4FH 4JDTL 4Y4FD 1MFEH 4M3JA 4JN2B 3KPSE 3S5LG 4PJBF 5HPMB 4PRHA 2J6EA 2ZCHL 3QIBB 2CMRL 1CT8A 1PKQE 4HZLA 4JPWL 4B7LA 1I9JH 3BT2H 2VABB 3PWPD 4NOFA 1I8KA 1QFWI 3ORJA 2HRPH 2WK2A 1EEZA 1D7FA 3D85A 3TT1H 5T1KA 3IDNA 3RGHA 3OJDB 3EYUH 4ODTH 3R8QA 3ZHDA 3ZT6A 4YGVB 5KS9F 1I3RA 4MD5A 2B4CH 4ODHL 3O2VL 4KXZH 4NFDA 2VTFA 4H20L 4WUUB 4GS7C 2JK5A 4QHUB 4HPYL 1RZ7H 1V5JA 5ERWA 5BXFB 4JG1H 1FGNL 4JM2C 4OF0A 4WHDA 4JPIB 1ZHLB 1DVFC 3DSFL 2JE8A 2W9EH 3O2WL 1H5BC 2R2CA 1QPXA 3QH3B 3WDIA 4LCWD 4YHLH 3G6DL 5DJ6B 3RWGA 3FOMA 1BBDL 4U3XA 3D3VE 2JCCF 4QHMA 3CZJA 1WAAE 4L9DA 2D0HA 3MGTA 4ORGA 1K4CA 1ZWIB 3T0ED 1JN6B 2KQNA 3FQNA 4RGND 3VXUD 4HMCA 4Y4FC 1BWMA 1JPFA 1G7LA 2AQ2A 5CP7B 3CH8A 5I0ZA 3QWOB 1MCCA 2P5WD 1BM3H 3BP6B 3SE8L 3TO4B 4KVCL 4XVJH 3LQMA 2MHAA 4JGUA 3S37X 1G0XA 2LAGB 5KOMC 4N90E 3PP4L 3PDOA 4ZFGL 2A0LD 1NKRA 5EUOB 2R4RH 1QRNE 5E7BA 4EI6B 3IU3B 1DQTA 4ZFZB 1HQRB 3F5WB 2Y5TB 4G8GB 4MZ2A 5F44A 4YO0A 1CDUA 2VB5A 3VWJD 2W60A 2F19H 4JHWL 2EH7L 2F5BL 3DYMA 4CVUA 3LS5L 3AY4C 3C08L 1MI5B 1P7KB 4PY8I 4X6EB 1QBLH 5EU4B 3IS1X 3UTZB 1WC7A 3FQUB 4QYOB 5DUPH 5T33H 3QCUL 4NQED 2WQ8A 2R2HA 5FB8A 2AEQH 1P5UA 4L9LC 5DFTA 5F88B 5I74B 1OAXH 2BXYA 4X5XA 1MCKA 1R5IB 5FUZH 1ZGLB 5C3TA 2P8MA 3QQ3B 1AJ7L 1NGWA 1TJIH 4ODWB 5J0BA 3HN3A 3IDMB 3T0EC 2XY2A 4RGNC 3QXUA 3DRTB 1FVCB 4JFFB 3IKCA 3LVEA 1GAFH 1U8LA 3O45B 1OD9A 1LO3L 2HFGH 3B2VH 3VI4E 3S88L 3GKWL 4H8WL 4LCIH 2AJYH 1BJ1J 4Z7VE 1KN2H 2X1OA 2XZCL 5CILL 3P3YA 4LLMB 2NY2D 3GSNL 1GC1L 1OGAD 2Y72A 4YWGL 2W0FA 1TCMA 4R4BA 3STZB 4RGOL 5CEXB 4WW1B 2A0LC 3WS3A 5I6XB 3KPQB 4L8CA 1IGCH 1U58A 5JDSB 4YZFE 4AT6B 3HA0A 5JIKA 2APXA 3E2HB 4XMKH 4Y4HA 4YHNB 2EDHA 1NAKH 3L7FA 1RZJC 4WFHD 3VWJC 1C7SA 1Z5LA 1SEBB 1CD9B 1TITA 2W65B 4POZD 4BZ1H 1MLBA 1MCPL 2DI7A 3RWFB 4X4YB 4NQDB 1IAKA 3RJDA 2HFEA 2YD4A 4TUOB 1B0GA 1WZKA 3NN8B 4YDJB 1JK8A 1H0DB 4HKZB 3TBSB 3IJSB 2NQCA 2QHRH 4DN4L 1G7JA 1OSZA 2G60L 4Z95L 1F4YH 3L3HA 5ACMA 3BIKA 3CPLB 3IXTB 4J3VA 1WK0A 4NZJA 2NY1D 4MA7L 2OJEB 3F62A 3QFDA 3ABZA 1D9KD 4A6YA 1EZVY 3BJ91 4XVTH 4M7KH 1MFBL 3O11A 4QCIB 1FL3B 4K8RL 1KUMA 3PNWA 5IWLC 5GGQL 1IKNC 3TT3H 3H7BA 4MAYD 3G6AB 4XPAH 1UCTA 5FO8A 2OZ4H 1CFBA 2Y4SA 4U1GB 2RAMA 4HJJH 1T1XA 2NY2C 2CR6A 1A7BA 3O3DB 4WWKA 4K7PX 4FXGA 1N4XL 1EHAA 4G8IB 4TTGA 3OV6A 2VDLH 3GGWB 4LIQH 2HKHH 1FO0H 3GSVB 1MFCH 5SWSE 1KTLB 3QG7H 4LLYA 3GBMH 3MRNA 3DLQR 3QDHA 5DRWB 3SN6N 3MXVL 4YXLL 2I26N 3KYMB 3CH1A 4NM4L 5KSAA 4V2BA 2DWEB 1MHPH 2NLJA 4EXKA 5L7XH 3SDAD 4TUJB 1KC5L 4POZC 5CFHA 1QA9B 3MV01 1JHKL 5FF6A 3QEGL 3BXNB 4PJDF 3U1SH 4PLJD 1QO3A 1X9QA 4LKXB 1C5CL 5BS0E 1A6WL 3THMH 5F7KC 3RA7L 1MWAL 5IHUH 5EWIH 4G7YH 4FTVE 4Y89A 3TIEA 5D1ZD 2VLRB 4JO3L 2JB5H 1CE1H 2ICWJ 3R4DA 4GBXA 1T03H 2FCBA 2Q20A 4EEEA 5I76B 2NY1C 4HPOH 3LDBC 5IFAL 5L2KE 4HT1L 4TVPL 2YC1A 2IPKA 3BP7A 1JGLL 1RJZA 4NUJA 4RFOH 3BE1H 4I3SH 3MUGB 1D9KC 4C56B 3ULVD 1J8KA 3I02B 1WTLA 3SDXF 3CFDB 5F6HJ 4F37K 4LNVA 4Q74A 3BKCL 4MAYC 4KMTH 4KRNA 1O5DT 4G5ZH 3C9NA 4P2QE 2EDWA 3HI1B 5E8NB 3NFPB 3BPOC 1D5ZB 3FB5A 5IFJB 2X4TB 5DYOB 4XWOD 3PGFH 4QXTB 1RZKH 5SWZD 3HZYB 4GKSB 4JRXB 2ADIB 1W0WB 3QAZC 3QIUA 4UT7H 3SY0A 3ULUE 5L6YH 5F21B 2OZ4A 3QG6A 1RK0A 2DLGA 3U30C 3QUKA 3PHQA 2DD8L 4P59H 1CFVH 1HNGA 4JQIH 3JWOC 3LEYH 3SDAC 4WV1A 1FO0A 3NIGE 1U8HB 2AXFB 5C6TH 1GZPB 4PGCB 3T1WA 2G75A 4RSVA 3IDJA 4KAQH 1CBVH 4PJXA 4OJFL 4DVRL 1CFTA 3WNKA 1HOCB 1ZGLP 1MQKL 4PLJC 1FH5L 1QSEE 1OT1A 5DJZB 1IE5A 1NCCH 3S35L 4PV9A 5C3LD 4NZUH 4PJHB 3MLUL 4ZUVA 1IEAA 4XMLL 4K94H 5D1ZC 4XAWH 2OSLA 3V4UL 4NUGH 2IWGA 2W9DH 2IQ9H 2NXZD 4HUXA 3AXLA 4TULH 1HIML 5JA9A 2R4SH 2Q6WA 3ULVC 5GGUB 3WNLA 4BUHA 4G9FE 3K4AA 3NIFE 3FQWB 4JFEE 4MHHI 2IH3B 5GGSY 1QG3A 3NFNA 5FXCH 4EUPH 3EDFA 1GHFH 3CFJA 4Q6YA 2HKFL 5GRWA 1F58H 2A9NL 1DP0A 3SDYL 4I5BA 1XGUA 4PD4J 3FN0H 4XWOC 1B4JL 2GQHA 4PTTB 4MB3A 1TIUA 1ODAA 4GSDL 3K1KC 4JM2F 2C3XA 4D0CA 3P40A 3HI5H 5EORH 1EUUA 1FNEA 4MZ3A 2DBJA 1PG7W 3DRQA 4OLUL 4W6YB 2E6JA 3EYSL 5DGRA 3LKPB 5IMOA 5BW7C 3CXDL 3SKNB 3FO0L 3ESVF 4KZEH 2AK1H 4IMLA 5CJQH 1N6UA 5DVMA 3P0YL 1GPOL 2V9TA 3CU1A 5GRXG 2XQBH 1EAPB 1A7QH 1NUFA 2CLRA 5BRZD 5D2NB 1BFVH 2VR9A 2P5EE 3MZGB 4JHBA 4LCYB 1KTRL 2ID5A 1T89C 1YJDH 4FQJL 3PP3H 3VFRB 5DA0B 2DLIA 4HS6A 4JFHD 4YHMH 2CK2A 4NKMA 5DUMH 4KKLD 2IANA 2OP4L 2QSTA 3BRGC 2NXZC 3DVGB 4I3GA 2FL5B 3HB3D 3JV5A 2G2RA 2C3HA 5DJDB 2EEAA 1B2WL 4N0UA 1LK2B 1OTTD 3C6LD 5EOQL 4MJIA 5C7XL 4GXUN 15C8L 3EZ8A 1DQJB 4JM4L 5HD8D 4P2OA 3VXTB 2GSGB 4Y8AA 1NBVL 4HWUA 1AH1A 4ENED 4OFDA 1XMWA 4OI7A 3AB0B 4D9RE 2H41A 5KAQG 1YEIL 3DVIA 1SJVA 4F80A 2NY3D 3BP5A 1FJ1A 4Z7QF 4LSUH 5DQJB 3FQTA 1RD6A 1U91A 1K8IA 4PP2B 1JIBA 4GG8B 1LNUB 1RZIB 3MLXL 3VW3H 4KHXL 1R3KB 4DN3L 2UY7A 4JJ5B 5C08B 2FATH 3VXRD 2D4FA 5C2BL 1W0YT 1ZT7B 2J8HA 4NJAL 4XCFH 1CIUA 4ZPVA 1KIPB 1C16B 4G9DA 5SWQB 4LLQB 1Q38A 1H3WM 3L3DA 4TOYL 4OI9A 3VFWB 5HXMA 1T04B 2AJXL 3VGBA 3QPXL 5FYLD 5KS9E 3BEWB 3DIFB 3LQZA 3FO2B 1E6OH 3QEQE 4HCRH 1T0MA 2AJUL 4LRIC 3UBXB 1JI2A 1QVOB 1BMGA 3DUHA 5J11B 5HPMA 1G7MA 5HTSA 1AC6A 4TSAH 3QIBA 4KKLC 2C4XA 3VXMD 1IL1A 1ZLUH 2AXGB 2VABA 3HB3C 4FQPA 1R0AH 4P2YA 1DFBL 1A0QH 4MSWB 4LHQB 1OTTC 3C6LC 4M3KB 4LSVL 1WWBX 4XNZB 5HD8C 1F4XL 3OJDA 5DO2D 3V8CA 4ENEC 4YGVA 4YHKL 4LPVA 2APTA 5LGKA 3WNOA 3U48A 4WUUA 3D39E 2NY3C 3AS3A 2CUHA 4KH2A 3HC4L 2Z35A 2F53E 4IRSB 2OR9L 4C4KT 5BXFA 1H15B 4OCRH 4K7PH 4R96B 1MH5B 5F89B 1ONQA 5EZIH 2X4UA 4JPIA 4JZNB 4HUVB 4LVOB 1BOGA 4XWGH 2P8LB 9CGTA 3QH3A 3MLWL 4S10A 4I2XB 1EX0A 3BPCB 2X40A 3SO3B 1MRDL 2N7BA 3NMEA 5DJ6A 1P9MA 2ADFL 5D8JL 5B4MC 1XCQB 4OCNC 4JREC 4X5WA 4H5SB 3DI3B 3R1GH 2M8XA 5HHOD 1YEEL 1ZWIA 4H1LB 3K4ZA 3MRBB 3VRJB 1X6NA 1TPXB 3STBA 4MNQD 2VO5A 3TYFA 3DX9B 4OM0L 5CP7A 4U1KB 1MAJA 3QULB 4KK9D 1LE9B 1OWWA 3BD3A 3QWOA 2CKBH 3D2UD 5E2WL 3BP6A 2V2WA 3TO4A 3F58H 2JJTC 4HCRA 4JO2L 4LQFL 5J89A 3GIVB 1NGQH 3T0VA 3VWKB 4WFFE 1BD2B 1ZTXL 2EDLA 3EAKA 4ZS7H 4LNRB 1MCRA 3PQYB 5FO9B 2IF7A 2ATKB 3MLYL 4EI6A 3IU3A 4ZFZA 1HQRA 5DO2C 1MJ7L 3F5WA 4E5XB 5L88L 4G8GA 3IXAB 4PJ5E 3RY5A 2VN4A 4Q58C 1LP9F 1U8KB 5FHBH 4NQUA 2YRZA 1MI5A 4KVNL 2J2ZA 1P7KA 1RZJL 3MUZ1 5ISZA 3V0WL 3UTZA 4CNIA 2VXUH 3FQUA 4QYOA 5BMFH 1OAKH 2EYTB 5IR1A 1IILE 5C0BD 1CFQB 3V0AC 1J5OL 1A3RL 4GRLD 4GFTB 1J0YA 1WSST 3IVKA 3GSQB 1R5IA 1ZGLA 1FDLL 3QQ3A 4ODWA 2DQCL 3LAFA 5K9JH 4F15C 3IDMA 3RU8H 4NNXB 3TA3D 2ZJSL 5GGTL 4M7LL 1FVCA 2FH8A 3UTPE 4JFFA 3O45A 4PRIB 5IB1A 3V6OE 2XN9B 4PBVC 4KK9C 3OG4B 4X6DF 1NCBL 4JFDE 4AK1A 2J7LA 4Z7UE 4TVPE 5A2LH 4JG0L 3DX7A 4LLMA 4PJBB 2B39A 5LCVH 2VSDA 1RUML 3BH8B 3STZA 3RY6A 4EN3B 5CEXA 4WW1A 2CKBA 4TPRH 4WCYH 5IHZA 5D7IF 1KPVB 4DZBB 1EFXD 1HI6A 2O26U 3QHTC 4YHNA 1P7QD 4OT1L 4PY8J 4PG2A 3KYOB 3MCKB 3U0WL 3V5DB 5DMJB 5BJTB 4HAFA 1SEBA 2QQNH 1FZJB 3QBTB 1N8ZB 2W65A 3RWFA 1KCUH 3HPLB 4U6TA 4TUOA 2Y1VA 3NN8A 4Y88A 1H0DA 2X89D 3TBSA 3M8OH 1IC5L 4KK6D 3MOAL 3N50A 4PUBH 2IMMA 1CGYA 5HVWA 5JPMB 1PG7L 4GRLC 5F1IB 3B9AA 1PKQA 3IXTA 5IBTL 2QEJA 3ULVF 3U7WH 4FQXD 2VSCA 2PTUA 5MEND 5TQ0L 1DEEB 4LKCB 4K3EH 3MODL 2OJEA 3I2CL 3T04D 1A14L 4RMVA 3EO9H 4PGJA 3TA3C 1S7TB 2QSVA 5D1QD 2JCCB 1FG2B 4QCIA 4OZIF 1A5FH 2BNRB 4ZODA 5HDQL 4NHCH 4LSPH 3GSNB 3KHOA 1PLGL 3G6AA 5BO1H 1NMBH 3F7YB 1JFQL 4LL9A 3LB6D 2FECI 4UINH 1MFDH 3OR7B 3SDDB 1AO7B 2DDQH 2ZCLH 2DWDB 1J8HD 2IBZX 1J1PL 2YS4A 3GGWA 3I9GH 2NW3B 3GSVA 3GHEH 1G9NH 1H3GA 1KTLA 32C2B 3OGOE 3ZE2E 2ESVB 2VLJB 5DRWA 4P2CG 1A4JB 3KYMA 5IJVB 1CGXA 4ZAKB 1MCOH 4F8QA 2XOTA 3VDBA 1VDGA 2H26A 4M62L 3SDXE 2VLME 2WQRA 5IHBA 4GH7B 1BECA 1WAAA 3MRIB 2BY3A 3JUYA 2I24N 3JWOL 4WHYH 2CSPA 2G9HB 4NWTH 1S9VB 4LKXA 4O2EB 4YBLC 3RVUC 3QNYB 1A9BB 5HHME 4XP9L 3TBWB 4ONFH 3HS0B 4NKIH 2FGZA 2I25N 5T5FH 1CLOL 2VLRA 1A7RH 2D03L 3I75B 4X98B 5BQ7B 5J6HB 4JB9H 4WJ5B 1MPAL 1OWRM 5LGHH 4OLZH 1YQ2A 4LK4A 4O5LH 4I4WB 3MUGA 1KULA 4CN1A 1QRNA 1Z0MA 3RDTD 1BAFL 1AXSB 5D1QC 5LXGH 1MY7A 1T0PB 3CFDA 3K46A 3ULVL 1S5HA 5LVEA 4P4KD 3FB8B 4ZG1A 3O6FD 5CJOL 4Y2DD 2PF6A 3LB6C 5EH1A 1YEKH 3HI1A 5E8NA 3NFPA 1W72L 4YFEA 1D5ZA 5IFJA 2X4TA 5DYOA 1A7OH 4WHCA 3ZTJH 2GJ6E 4XPGH 4GKSA 1DUZB 1NL0L 4JRXA 2FECL 3IRPX 4ODVL 4OBSA 3VDCA 2BOCB 1JYVA 1EJOL 2ERJB 4YHPB 5C0FB 2UUDK 3IU4H 4FFZH 2JJSC 4P5MA 1IGYB 4R0LC 2WBJB 1OSPL 5CGMA 3JVGC 3TJHD 1A6TB 1RZFL 3OKYA 1U8HA 2AXFA 3QHFH 4Q9QH 1G6RB 1GZPA 4PGCA 3O3UN 4G6KL 1HSAB 3BW9B 1VEPA 3OPZL 3PWJB 5ITBL 1HOCA 1FQ9C 5JIHA 2HWZL 1EO5A 2VQTA 4MA3B 1H3TA 4YBHA 4K3DH 5T1LD 1UWGH 4UMGA 1FORH 1ES0B 1MCSA 4PJHA 3SGKC 2YPLD