3HZYA

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo(2.4)kdo
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
216
structure length
215
Chain Sequence
b'DIVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLRTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDIAVKWKIDGSERNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S73-2 Fab (IgG1k) light chain
molecule tags Immune system
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
total genus 47
structure length 215
sequence length 216
ec nomenclature
pdb deposition date 2009-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzyA01
4HIXL 2VXVL 2V9TA 4KK6C 2B5IC 1KN4H 4M6MH 2LV4A 3PQYA 1AGFB 4YHYB 2HVKA 5CHNB 1P4LA 2VISB 5EOQL 2BXYA 3AC0A 4LVNC 5IUSA 4KXZI 2ZUUA 5F8QC 1C5BH 1R3HA 4NFCA 1PFCA 4FQXC 2MSPA 3TT3L 5MHSD 4JKKA 5TE7H 4XNXL 2AABL 3T65A 1FL6A 5DMGD 4GAJH 1F90H 4OB5H 4X8JA 1J8HA 1V8HA 3U9PL 3L3GB 4LVNB 4YQXH 5LGJB 4S1QH 4PJEA 4JR9L 3V6FA 3V7MA 4R4ND 3QIUA 4KUZH 3WIFB 1FBIH 1QVOA 5AG9A 5I18L 1RUMH 2FSEA 4Z95L 1SEQH 3DX9A 4JANA 4NO2A 5BOZG 3CMGA 3MRLB 3NABH 4NQUA 1V3JA 4PRIE 1L4IA 3TJEL 1IE5A 1KN2L 2HAZA 2CIKB 4Y8DC 1IAKA 3L1OH 4L4VA 5DSCB 4ZNEE 2Z31B 3RDTA 4KH2A 2CDEA 4FG6C 3IXAB 5HYQA 1FVDA 2AEQL 1A7NL 1T1ZA 2A2QT 5I8KH 4MD4A 1BJ1H 5MERB 3ZE2E 3OR6B 2A77H 3GMNA 2ZZUT 4XCFH 1FL6B 3VFWB 3QG6A 4JM2F 4ZFOA 1IC5H 2C1OB 1K5NB 2X70B 2HG5B 3Q1SL 3RWFA 3NIFF 2V7HA 1XGPB 3IETB 3QEHB 2VQUA 4XGZB 3STZA 1CFSB 4L8CA 3MUY1 3L3HA 4GW5A 3F65A 5MI0B 4TUOB 2VLRD 2W0KA 5CBEB 1NEZA 1A02N 3O9WD 2EXWD 2AJVH 4ZS6D 4IIQA 2RBLA 3C5SA 5D2NE 5D7KD 2NY4C 4ZSOA 5DS8B 3F7YB 1JGDA 3FB8B 3IU4L 3WS3B 1FNGB 3JWOH 1GC1L 1WZ1L 4TVPD 4P23D 5HHVH 2Y07L 4RISL 4JFFB 3U4BL 2EDRA 2GTWA 3R8BB 5K93A 1G7PA 1H3PL 1FNLA 2XQYG 4IRZH 5FYKL 2IQAA 3VDCA 4J12A 1G7QB 5JA8B 4M5YL 1MCPL 1G7LB 4MCZA 2IAND 1KBGL 2E6JA 3JV6B 4G8GB 4GFTB 4CVZB 2YPVL 2ITDA 2AAVA 4HIXH 4OLVH 1KCVL 3CVHA 5CJQL 3O4LA 1I9JH 2VWEE 4QHUA 5ANMB 2B1AL 3FONA 3B6SB 4IRSD 3J8F7 3TJHC 1NDGB 4N90E 2HWZL 2MHAA 1DANU 4F9LC 4LNRA 4MJIB 1W0WA 2OI9B 5EBMA 5D7LD 1I8MA 4MB4A 1Q9WA 2R0LH 1ZGLM 4NN7C 4HK0B 3KPOB 1CF8L 5B3JF 3LB6D 4R0LB 4NN5B 4HV8B 2FWOB 1V5JA 3THML 2MQ3A 3C60D 3HE6C 4HWZB 5E5MA 1MHHB 5CWSB 4GUPA 1BHGA 3LSOA 3QEGL 5B39G 1BBJB 4N8PA 4YDVA 2NNAA 5EU4A 5C6TL 3SE8H 5CSGA 2OR9H 4PRBA 1OAXH 3RJQB 2A73B 1UJ3A 3AREB 3O81A 4FFZL 2X4NB 5A2KH 3O8XA 2Q8BH 3WIHL 2X89A 4F7CB 1Q38A 2QEJA 2V5YA 1YQVL 4FTVE 5SX4I 4KRNA 1D5ZA 1D9KB 3MV7A 3T0AA 4R7NB 4X4ZA 1XR9A 3PWJB 4PLKD 4RWYH 3VXUA 3DOSA 4XZUA 2HT2C 4WO4B 4AEIH 3QPQD 4I77L 2NXZC 3X13B 3FN0L 2BSTB 1MVUB 2Z8RA 4NKMA 3RU8L 4AQOA 4KROD 3FHQA 2RFXA 3DBXB 5SX4H 3SQBA 1WICA 5C0IB 1S9YA 4KY1H 4JKMA 3DUUB 2HVJB 4NWTL 3SE4A 5JXED 4ODUB 2BJMH 3RGVB 3JUYA 1H5BC 2NY2C 1BX2B 1BFTA 4NFBA 2JLLA 1KLUA 1DBMH 3WXVL 4P4KD 4KV5E 2BVEA 4NOFA 3SKUD 1CGXA 3WFCH 4F7MB 3IDNA 4ZUWB 4PR5A 3SOBL 2DQCL 1N7ML 1S7XB 5DJ0A 4H8WH 4JY4A 4PJAE 2XACC 5KVFL 4F7CA 4MJ6B 1NBYA 4ORZC 1DN0A 1QACA 4D9RD 4MDIB 3U9UB 1MCSA 2X1QA 4OZIB 5F7WC 2DL9A 1Y18A 5DUPH 1BIIB 4W81A 1VEMA 1FLTX 3MRGA 4LIQL 4D0BA 4EDXB 4IMLA 3P0VH 1MCDA 4UDUB 2CJUL 5JPNA 4PRHA 2OTPA 3QJFA 4FZ8H 5D1ZC 4DKEL 3VFSB 3L7EB 3ELAT 4U33A 1J0ZA 1UWGH 4I18B 2X9YA 3C5SB 2X4TA 2YUVA 4MA7L 2GSIA 4PJHF 5D70L 5DHVH 5DUMH 4I0PB 1J1XL 2D31B 4PJ5B 2IH1A 5I19L 1VFAA 5C07D 3P11H 1YDPA 4LIQE 5ESAB 1RJZA 1HSBB 4O5LL 5C0GA 5DD3L 5L2KB 3CSPA 4JCLA 3MSPA 1U9KA 3O6LH 4Q58C 2AJYL 5DD0L 3HZVA 5F7DB 4D9QD 5H35B 3BE1H 3WFDH 2CR3A 2CDFA 5J13C 4ZAKC 5EZOL 5BZWB 3V7AE 1F4HA 4Y4HD 5A1AA 5GGVH 2C3HA 2GSGA 3BGMA 4WENB 1Q1JL 5IHLB 4FFVC 5KSAD 1WQVT 1I8KB 2OTWA 4OD1H 3KLHC 1LP9A 2NX5D 4N8VA 3QRFM 2J2ZA 1KENL 3ULVE 3QDGA 3EYUH 3QEQE 4YXKL 3DARA 3OGCA 2Y36H 1T6VN 4G8EB 4ZTOL 1BQLL 1I7TB 1S7TA 1DQDL 5GSVA 4NQVA 3ZT5A 4U3CA 1KTRL 2D31A 4Y4FD 3MNZA 4PJBF 2E9WA 4LL9A 2HT2D 4JZJB 5EU5B 2CRIA 2NXZD 3ZE2F 3HC4H 1OGAB 2UVEA 5JO5B 3VXMB 3U36A 4MJ5A 3AS0A 4Q6YA 4U1IA 4X80L 3V2AR 5JQ6H 1OAQH 3OJVC 3ULVL 2H32H 4P5TD 3DV6B 4C4KT 2NW2B 5L6YH 1QBAA 4XXCA 1HYSD 5HDOA 2J8UE 3GMNB 4D8PB 4EEEA 4CADA 1R5VA 3GIVA 5CINL 3DTXB 5MERA 1UZ8A 1RZFH 2JCCF 4PGDA 1IAII 4LF3B 3LVEA 2WBJA 3AROA 2VXSL 1RIHH 2ENSA 1RJYB 1QKZL 3B9KA 4JAMB 4PB9L 1FH5L 3UTQB 2VXTL 5C0DA 2J5LB 2Y25A 3FHAA 1T20B 2BC4B 3S96A 5IIEB 1UZ6E 1FJ1B 5I1AA 3BKML 2IPKB 3KYKL 4X7TA 4NFDA 5J6HA 1QLRA 4QGTA 3ORJA 3FOMB 1T2QL 3IFLL 1U41A 5D70H 3HE7D 5T5FL 1IGIH 5F7EL 1KLGB 1WFUA 4RWHA 3WL9B 5J06A 4UIMB 5GGUB 2YPLD 4F7PA 5GISH 1KNOA 3RIFF 3EHBD 5IQ7L 2W91A 3NPZB 1A3LL 1T0PB 2NXYB 5DTFB 4BZ2L 2R29L 5F9DC 2KDGA 3IDXL 1PX3A 3VE0B 4AIXA 3IFNH 4BFIA 1A7QL 1ZLVK 5DJCA 4NM8H 4HGWB 3VH8A 4QCIB 5FKPA 5EZIL 1A6TB 5KW9L 5FYLD 4EDWH 3TPUA 4YHNB 3WCYA 1BFVH 1TMCB 1UWXK 1AFVH 1G0YR 2PYFA 3B9EA 4EUPH 2NY4B 4YHYC 4WFGD 2IAMA 3OJ2C 3RWJA 5HYJD 4LLUA 3FTGA 3MNVB 3VGDA 3RNQA 3FRUB 3BH9B 1JI1A 4XNUH 1W0WB 4LEOA 1FL5B 5J6GB 1T2XA 5IW1A 3OKMA 4ZAKB 3U46B 4C58B 3H9HB 3OL2A 5KZCD 5JDJA 2UZIL 5D71H 3TIDA 5L0QB 3V5KA 1ND0A 2AK4B 4X6DE 3VE0A 3MOBH 4TNWF 5E2WH 1E4WH 1OP9A 3ZTJH 3WO4B 4RISH 2YA1A 3U4BH 4HIIA 4I3RH 5JIHA 3B2VL 1HNFA 4P0DA 4NKDB 2ATKB 3GMMA 5I1IL 4MHHG 4Y4KB 5GGRY 2H8PB 4XCYA 3U2SA 2HTLD 1I85A 4JO4L 5F9OL 1OTTD 5FM4A 5HGHB 5JXEA 5DVOA 4JFPA 1DSFH 2XZAH 5ID0B 3GHBH 2WMPA 3BH9A 5LCVL 2EDHA 4R96A 4F33A 4UQ2A 4AL8L 2JJTC 1AGDB 4OCSH 2FO4B 2FH8A 1FZOA 3TWCH 1BECA 4NN5C 1QRND 1I9JL 3WLBB 1CQKA 3O45A 4LHUB 1UEMA 2VRAA 3ARFC 3ESUF 4L9LA 4M4PA 3BI9X 4U1LB 4D0DA 4FQCL 3KPNB 5BQ7A 1RPQA 4EUPB 2BNRD 2Y7QA 4GLRH 4PJFB 4QHKI 5E7BA 1N8ZA 4CGTA 4L4VE 5IBTL 2R0LL 4JPWL 2ZKHL 4JFEB 1KELL 4KTDL 4RAVB 1MJJB 1FV1A 1WAAA 3IDXH 3EYSH 4JRXD 2MPAH 4AIOA 2CXKA 3EOAB 5KANI 3ULUF 4HBCH 3MRDA 4IOIB 3UTSD 1A7QH 1EJ6A 3MZTA 4F57H 2ZCLL 2D9CA 3D85A 3QNYB 5ALCL 4GKZB 2ZUVA 4F33B 4F7EA 5IJVA 3LZFH 1T0MA 4ZOCA 3F12B 4PJHB 4XP1L 3OZ9H 2X6MA 3CXDH 4XPTH 3CLEL 1BFVL 3VD5A 2BDNL 1KPUB 2VDQL 4HMDA 4DCQB 2VE6B 3VCLB 5BQ7B 4NJ9L 4YJZL 4M7LT 4YHPA 5DRXB 3D69A 1NQBA 4MMZC 3U7YH 1YNTA 3T0EB 3WDIA 4DKAA 1H3UA 4U1MA 5ID1A 3SCMB 1OPGH 1U92A 3BEWA 3QQ3A 1YNKL 5DDHB 5LAXB 2FECI 3WIIH 4H1LB 2YOCA 5JTWA 5JR1L 2NXYD 4P2OA 1HHHA 2I07A 3CMOL 1RU9L 2NX5E 3T0EC 2Y4SA 4KY1L 3ARBC 1RMFL 3EJYC 2EH7L 3EHBC 4MS8D 4Q6IA 3BRFA 4FQXD 4L8SB 4DGVH 2B7DT 4I5BB 2X70A 3RWFB 4Q0XL 4H5SB 1Q94A 1DLHB 3UC0L 3H9SB 3VXQB 5TJWK 1JMXA 4YQXL 3V5HB 1D5ZB 3RKPA 1CXFA 2DQCH 4P3WA 5AUMA 3EJZC 1KCKA 1KIPA 4KZDH 3WHE1 5D5MA 3INUL 5K9QG 3G6DH 1HWHB 1Q0YL 2X4NA 4TRPH 5DGQA 4JDZB 1NEZB 3QIUC 3S3SA 2HTLC 3U30C 1A6PA 4PJGE 1FFNB 1G9NC 1HZHL 3C6LA 2G2RB 5CP7A 1HXMB 1LEIA 3W39A 1CG9A 2K1MA 3DRQB 1INEL 3NZ8B 3I6KA 5C0AE 1ADQA 1QA9A 4OLWH 4OCXH 5AWNL 3CVHL 5DVNA 4YBLC 5HD8D 4G6JL 2KH2B 5D5MF 1C8PA 1OARL 4PTTA 3P4LA 5IB2B 1CDUA 3OWEA 3CDGB 4ZUWA 4NDMB 3ARFD 4GQPH 2JCCE 2H2PC 3NVQA 1TTGA 5E56A 1YN6A 5HY9A 3ZE1E 4E41E 2DI9A 1P6AB 3MLWH 3MBXH 3DV4A 1G7QA 4I2XE 4R4FL 1GPOL 4I2XA 3W0WB 2IANA 4G6AC 1SEQL 2XN9E 1DQLH 1H8SA 2NY0C 3EYQD 4JFDE 4PY7A 2A6KA 5C0CA 1RHHA 5D72L 5DWUH 3HFMH 1I1YB 2YEZB 1V3KA 2F53E 1KIPB 2YMXH 5KSBB 4XMKH 2Z92A 3QA3B 4TSAH 1C16B 4QXWA 1R0AL 3IJHA 2R2BA 3LD8C 4S1SL 2P5EA 3T65B 3D25B 4Y4HB 2A77L 5E0QA 5CGYC 1P1ZB 3UYRH 2GHWB 3LN5B 4P3CH 4U6TA 4HJ0D 5CCKL 1QSEE 3V0WH 5C9KA 4FFYH 2CRYA 3NZ8A 3QPXL 4X7SH 4G8IB 1QYGH 2APVA 3R06B 3SDCB 4QYOB 2XG4A 3HE7A 3C87A 3CLFH 2VKXA 4L9LB 1A6AA 2CGRH 1MHHA 4OF6A 4O2FB 4XNYH 3VD4A 5EUOB 3AMKA 3MJ9A 5F6IC 2GSGB 2NYYC 2A1WH 3MV9D 3RDTB 3IDGB 2B20A 3DURB 5ICYA 1FV1B 5DURB 4J3WA 4FQQA 3W0WD 4NQSA 5H35A 1ZAGA 3C09C 3QIBB 2UWEA 2NY3D 1OY3B 1HSAA 4NRYA 2I27N 3HZKA 2D4FA 4KHXL 4IRZL 4OGXL 2BNRB 4GRLD 1TIUA 4OF5A 4IJ3B 4O2CB 3T0BA 1P4IL 4KTEH 1P7QA 4LSUH 2HT4C 1RI8A 5GHWL 3KNBB 1X5KA 2F9BT 5E08L 4XWGL 1NCWL 4J6RH 5D1QA 3BKYH 3OKYA 5FM5O 5BO1H 1IGYA 4A2LA 3NZHL 1CD1B 2OL3H 4P3DB 1WWBX 2EYSB 2YC1B 4OLWL 4UT7L 3SE8L 1YECL 1YMMA 3NN8B 3SQOH 5D93B 1IGFH 3QCTH 4NC1E 5C09B 2GJZB 3I9GH 2EDFA 5EA0L 4A6YB 2FEEI 1NCBH 3CJJA 3BP5B 3IS0X 4TN9A 5FGSA 1X7QB 3BUYB 3KYNB 4LDLB 3CX2A 5C71A 4YHML 5E7FA 4M6NL 2RQ8A 3DYMA 1NBYB 3PWUA 5F7NC 2ZOKB 3G08A 3W82A 4OQTA 1E6OH 5T5NG 1P7HL 5DHYA 5EBGA 2YD4A 1EVTC 4MAYC 1NGZB 2XA8H 1CFVL 5J3HC 1U3HA 5CZKA 3HFML 4Y88A 1I8MB 2NLJB 5SWSD 4OCMC 4Y16D 4M1GL 1DLFL 4EUPA 2CLVA 1TVHA 1IJ9A 2F8OA 3NN8A 2G9HB 4DN4H 3MROB 4LSSL 4HLJA 4PJ5A 3KPSD 3UO1H 3KWWA 3O4LE 4C54A 1KNOB 3S37H 5KS9B 2PXYB 3OHXB 3PDOA 3FRPG 5GS1A 1IGMH 5IVZA 1V7ML 3QPXH 3BUYA 4LASH 1GVIA 1NC4A 4X7SL 3G6JE 4BSVA 5EN2B 5T3ZH 3IFOA 5HBBA 2FBJH 1NCTA 3LQZB 1LEKB 3D39A 3G6AA 2VXVH 1TPXC 2HFEB 4UINL 2AKRB 4GAYA 5CS7A 4Y19E 3VI4F 3D18A 2XI9A 5MENE 4G6AD 1U8PA 1DJSA 1T04A 4MAUH 1MCFA 1C7SA 3PQYE 3CFDB 1WIOA 3DHMA 4Z5RA 1OTUD 7FABL 3WKMH 4JM4H 3QWRA 4MA1C 5EB9A 5IGXL 2P7TA 2CK0L 3Q0HA 1NGXB 3EAKA 4ISVA 3PQYD 3Q6GH 4TUOA 1RUML 4MNHA 1XGRB 1QBLH 3I84A 4DZ8A 3QH3A 4Q2ZA 3RPIB 4LHUD 3IGAA 3A67H 2YPKB 4KJWD 4FQIL 4C55A 1JMZA 5EUKA 3QQ9D 1BJ1J 1D5MA 5GJTL 2FL5A 3WNLA 3MTRA 3D3VA 2X4OB 4PUBL 3QXTA 3LH2H 1S7XA 1A5FH 4X9FA 3UJTL 3BHBA 2C3XA 5B3JE 2YD1A 3OAYH 5KN5B 2FO1A 3EO9L 4RQQA 5KSAC 4JRXB 4AH2A 1UADC 2IPUG 3VW3L 4KRLB 4OD1L 5JMRA 3FQTA 3LRGA 4JFDB 4YPGA 4G42A 1U8KA 4EVNB 3QO0B 2HJFA 4KTDH 15C8H 4NUGH 1NAMB 3EJJX 4F2MA 5F6IB 2MOVA 1NJ9A 1O7VA 3BKJL 1IZKA 3F58H 1CXHA 1RSFA 5L2JB 4ZYKA 1VGKA 1JUFA 1K3IA 4OTXL 1WVZA 2ICEB 3LQAH 3U4AA 4UIMA 1G7JA 2FJHB 3M45A 2VZ3A 3CZFB 1CL7H 4M1GH 4XPTL 3V8CA 5HHVL 5CEZD 5E4IA 1PYWA 1LO2L 1RJZB 5GRVL 5A43C 3QUZA 4WV1B 4XXCC 5CUSH 12E8L 2I60H 1WISA 5D1QC 2B39A 3U83A 1HYSC 2DQUL 1IAOB 4LRNH 5EU3B 5FO8B 2LTQB 5EOCJ 1JYXA 4R2GB 2JCCB 3QXDA 4RSVA 4DQOH 1EEUA 3EO0A 5GRWA 4QRUB 1UCTA 4PYGA 2FB4L 4KI5D 4HWEL 1XIWC 3QUYC 1R3IH 4XBGB 5T33L 1XGQA 5A16B 5F1SA 3KYOA 5T1LA 3QDGB 5ISZA 5LXGH 1T03H 3B5HA 4U1KA 3PP3K 3VXRD 2EDYA 4L4TE 3WLWD 5DEGB 4N1EA 3CSBA 4Z77A 4QRPE 3QUXA 3QUZD 3BT2L 3HG1B 3L3IA 3QUYB 1G0XA 3FT4B 5D6CA 4PJHA 1WF5A 4MZ2A 5FKAA 3TO4C 1G6RA 5DT1L 3WN5C 5ILTH 2Z92B 3QA3A 4KZDL 1IGJB 4YDLB 5I1HL 3UYPA 4MA3B 4HG4K 3NPSB 5LAXA 1ZWIA 4EXPX 2DJ4A 1A6AB 3QXAB 1I1FA 4HIEA 1BX2A 3D69B 5C1MB 3MV9E 1IAOA 1NC2A 4PB9H 4C56E 2D7MA 3L9RB 1T5WB 2AQ3A 4FFWD 2EZ0D 5HHOD 1MJ8H 3NGBC 4NO3B 5KW9H 1MNUH 4UT6L 4QKXB 4NNYB 4WVRA 4LRIA 4QWWD 4C56D 2EDNA 3UP1A 5CIPB 1IARB 5A16A 3DUSB 4KPHH 1WFOA 1ACZA 3N1PC 2HFGH 1M05B 4YUEL 2ED7A 2LQRA 1LVEA 1YYMH 1L7IL 3ARWA 2WWMD 2B0SL 1A3LH 1F02I 1G0DA 1NLDH 1FZOB 5EBLB 5D1ZA 4Z7OE 1EIBA 4ZFFB 4HG4J 3OX8A 4EI5B 5DEGA 3MXWL 1R24A 2A74A 4P5TA 1QD0A 3ABZA 4PRHB 3SE9L 4JKPL 1DQLL 5ID0A 1CG9B 1R5WB 4TSBL 2JIXA 4QF1B 2F19L 2GK0A 4CDHA 4MNQB 3PWLA 1CTNA 3U7WH 1Q9OA 3VWJD 3PV6A 1OTSC 1LO4H 2LVCA 3AGVA 3EDFA 1JTTA 3QIUB 4I0PA 5I0DA 5F3BB 1XF4A 4JFQA 4RFNC 4ZODA 3S6CA 1WBYA 4O9HH 3VMOA 2APXA 4OUUB 4MD5B 2XKNA 4G9FD 32C2A 4HZAA 3VFVB 4G6ML 2DIJA 3O3UN 4RAVA 4UNTA 1NCDH 2DQUH 2HKFH 3VXME 2VC2H 1CD8A 2YWYA 3EOTH 2FBOJ 4JO4H 3E6FA 1AHWA 4HGWA 3T4YB 1H15A 2ZUQB 4Z7QE 5MENB 3BGFC 3VXSB 2OP4H 4TUJA 1PKOA 1RZGA 1QLEH 2BHYA 5GSRA 4PJ5D 4YR6A 4BQBA 3AXLA 4NSKA 4NYLB 2VZOA 3LKSB 4D9QE 2EEAA 1JUFB 3RVVD 3MOBL 1I75A 1XIWD 2UZYB 3MLYL 2XTJB 2P5ED 4FQ2L 5F89B 1F3RB 2E6PA 5KVDL 2VLLB 3HNSH 1X5XA 5D7SH 3MC0A 5E9DE 1UC6A 1D6EB 4RIRA 4LLVA 4LPTA 4JY5L 3SE3C 4OLEA 4G7VL 5KVEL 4PJ8D 5FECA 4UNVA 3PWVA 5DJ2A 4DZBB 4I9WD 4UOW0 4XWOC 1PGRB 4RDQF 3AB0B 2N1KA 3AAZB 3AM8C 5F71A 1ES0B 4NGHH 4U6XB 5J1TC 2GY7B 5BS0D 2AJSL 5J57B 4XWGH 1NGQL 2H1PL 1BLNB 3STBA 4N90D 5IEKA 4E42A 4F3FA 1BF8A 4G43B 3TIDB 3QCVL 3JV6A 4G8GA 4HQQH 4JFXA 5MENA 3U1SH 2AKRA 3T4YA 1FPTH 3CC5B 1LNUA 5DK0A 2DMKA 3P3YA 1B90A 3LN4B 2BOBB 5M95B 3MGOA 1EH9A 2P8LA 1DVFA 5IBTH 4XX1E 1BVZA 5BV7C 4XAWL 5C07B 1VGEL 3QQ4B 4G6KH 2WIMA 2G2RA 4DVBB 3WHXB 2UUDH 3ILPB 4S10A 2NY5C 4M7ZB 2M8XA 3E6HB 2P7TB 3WLBA 5DK2A 2XTJD 3WIHA 4E5XB 1JGVH 4J3XA 2GEEA 3DRTA 3O6FD 3L5WB 1HOCB 5F1KC 4I3GA 4K7PY 1KEGL 4DVRH 1ACYH 1HHIB 1U95A 3GRWH 1LO0H 4CDGC 3S88H 4LSRH 3QH3B 2JK5B 4K3EH 3V79C 4FQHA 1JHLL 2P8PB 4YHZL 2Q7NA 4KHTH 3MRJA 4JM2A 5FYKU 1M7XA 1OF2A 1HI6B 3NPSC 5EU7E 4HW6A 1KF9B 2OQJB 5DTFA 1FP5A 2VLKE 2VDLH 4NJAH 5IFJB 5IMMB 1QLFB 3GSNA 3S35L 5ITFB 1EV2E 4CAGA 2VLJB 5E8DL 3WKNA 2DJSA 1HH6A 3STLA 3DIFA 4HX1A 2X1OA 1EUUA 1RU9H 3I3DA 4Y1AE 1RIVH 2B1AH 1KT2B 2IWGA 1A14L 5HD8C 3P2TA 5IMKA 4RMVA 4A6YL 4APQB 3G6JB 1K4DA 1QBML 5TQ2H 3IFLH 2JKXA 2QADC 1I7ZB 3ZTNH 3BSZH 3NA9H 3HNSL 3BKCL 5HDLA 4LLMB 4C83B 3MV9B 3OR7B 3TN0D 3T0ED 1MRFL 3RVWC 1FG2A 4MXQC 4P5MA 1RUQL 1UM4H 1GYAA 3CFBB 3ZE0F 5JORA 1FCCA 5K59E 3QCUH 1NUFA 1Z6JT 3C60B 3GSVA 5L9DL 1JVKA 5JXAH 3LHPL 1S7QB 4I0PC 5C0BA 4NHCH 1ZHBA 3U48A 5EWIH 4UI2A 1NGQH 2H1PH 3MBEA 2F74A 5CJ8A 2XZZA 5DWUL 2W59A 2DQGL 1RZJC 1AI1H 1KTDA 5E1AA 1B0RB 3B2UD 1N59A 3BQUB 3UJTH 5BXFB 1A0QL 5I15H 1X5JA 1BQUA 2V17H 3P4NA 4LKXA 3TPKA 3SCMD 1JF6A 2X44D 5EIVA 2OJZL 1MY5A 3KNBA 4GAYB 2BVQB 4XAWH 4FQXA 4MJ4A 3QUXB 5I1JL 3DX6A 4MVBD 1NC2D 5ANME 1LILA 3TCLA 3P4OB 2HN7B 4NUGL 1CD0A 1NFDB 4IRJB 1DFBL 2VABA 3BKJH 2Z35B 1VEPA 2FATL 1VFAB 3KJ4B 4RGNB 4Y16A 4G8GE 4XNYL 4KZEH 3O11B 3GRWL 4LNVA 4FOMA 3E3QC 2A38A 1FFOB 3MLTB 2A1WL 4L3EA 3UDWC 4E42B 4RA0C 5FOJA 3MV7E 1CL7L 5IR1A 4OZGB 1ORSA 4PTTB 4XBEH 1XIWB 4KHTL 3D0LA 1WGOA 1JTOA 2Z31D 3EBAA 4HULB 3ROLB 3S5LG 2I60L 1DUZB 4M48L 4XP9H 4NJAL 2FGWH 1F3JA 2FX8L 5IHZB 4PGBB 1P4IH 1VFOA 4QXGH 4XMPH 1ONQB 3GJFK 3VJ6A 2O93L 3T09A 4XPAH 3KGRA 2IAMB 1JHTB 2DBJA 5IFAH 1TQCB 4UTAL 2ICEA 4S2SB 4WW2B 1PW3A 1MVFA 2Q8AH 1CFNB 2AEPL 5E4EC 3V4UL 3MGAA 3PWNB 1FO0L 2OS7A 1F45A 1NJ9B 4D2NA 3WHXA 1ZLSL 2Q86A 3HAEB 4PG2A 3NFNB 3HE6B 1SJXA 2XN9D 1IL1A 1EVUA 4APQC 1JGUH 3PG2A 1QP1A 1JF1B 4X98B 5D7LA 3D0LB 3KXFA 1UM4L 4JPWH 3DBXA 1RIUL 3VXMA 4HWUA 4GRLA 2OCFD 4X7CC 3RWDB 3ZKQD 4GG6E 1WC7A 4HKBB 3KG5A 2PF6A 3OAYK 4KTEL 4JZJA 2GJ6A 1AQDB 4HC1A 5DI8A 3VFVA 4C56B 1YEEH 4G80A 3WYRA 1U93B 1FZJB 4YR6B 2IALB 4CVZA 4OCNC 4X0KA 2BVPB 4BZ1H 3SE4C 2HT4D 2VDNH 1RZ7H 4E0RB 4KMLB 3WFZA 1T6WA 3TBSA 2VERN 4G5ZL 1HYRC 1NGXA 4YO0B 3I9GL 1Z9SA 5I8OL 2DIBA 3BDBA 1MIMH 3T0VA 3UEZA 1JYNA 4OGYH 4OV5A 4QTIH 2FX7L 3C5JA 3TA3C 3ZKND 1TQBB 3EDEA 4ODTL 3F7VA 3SY0A 3D0VB 1I1AD 3L7FA 3RGVC 2FL5B 3PWPB 2ZNXA 2EIDA 1XF3B 4P99A 1FYTE 3PHSA 3ZYIA 2Q20A 4CN1A 2APWA 2FATH 2VDML 1HH9B 4Q2ZB 3SGKC 1BFSA 5C0BB 3DX8A 4GW4B 4YAQB 3HNTL 2LFGA 4NO3A 4F15C 2JJUA 1CWVA 5CZXD 3EFFB 1I3GL 1MUJB 2RR3A 3R1GH 4CU6A 4BH7B 5KVGL 2BY3A 1AXTH 3RL2B 1NAML 3BAEH 5GGRB 1F13A 3LKPA 1JZ8A 4POZD 3PWUB 4NZJA 4DN4L 2MKLC 4OV6F 2IPUK 3MUGB 4PBVC 2AS5M 1X5HA 3RPKA 4JZOA 2CMRL 3FOLA 5B3NA 4N8VG 1X7QA 4PRNA 5MP6H 4ODHH 1LMKA 3UJJH 4LFHG 3G6DL 1SY6A 2ZCKH 4Q9QL 3HCVA 3BP7A 4U6HA 5ACZA 2VDRH 4MNGE 2Y6SD 3GSRA 2VE6A 3K46A 5CP3H 3VCLA 5ICZB 5E8EA 3GI9L 4OIIL 4OCWH 1SBBA 1Z3GH 3F12A 1YMHA 1MCWM 1C5CL 4ZFFA 5I71C 2DMBA 4U05A 3BW9A 2GUOA 3QQ3B 1C1EH 1B88A 4R7NA 4IDLA 5DJYB 2UY6A 1J0HA 5DLML 4YHPB 5DRXA 3TIEB 5DS8A 3K8KA 5EUOE 1UA6L 1MRCL 4ODXB 1GAFL 5FCSH 1BEYL 4HFUH 5ENWB 4AIZB 5TE6H 4JRXE 3SDDC 5C0FA 3HMWL 3ARQA 3EFFA 5ESVA 1GPOH 1EA9C 2OSLA 1JPSH 3T2NL 1CFTA 4ZFGH 4KKNA 3KPSA 4X5WA 1E4KA 1B4JH 4HX1B 1YEEL 3WFBL 4Q97A 3HCVB 4WHYG 3BDYH 4KI5F 1GGBH 3CFEB 3GFUA 4NQDB 3BP4A 1KCUH 2BNUB 3WN5B 2VJXA 1KJ2L 1INQB 3IF1A 1DL7L 3VFSA 3D39E 2BVOA 1MAKA 5DEFA 4LLMA 3IDMA 5ETUA 1MFEH 2D7OA 4LMQI 5IMOB 2AERT 3G6JA 1AR1D 3ZKXB 1A6ZB 1PKQB 4OCYL 1WCBA 5I1CH 5FHBL 5J0BA 4YFEA 4JO2L 2P44B 5ENWA 4O02L 4PJ9D 2DWDB 1O7SA 3L95B 1X4YA 4AEIL 5D7JD 1SJEB 2Z9TA 1PY9A 2EXYD 5SWZE 1WZLA 1MREH 4NRXA 4PJEB 3V6FB 1AQDA 4RQQB 3EYFB 4F7TB 4F9PA 3SDXE 1DZBA 3AAZA 5HHNA 4L4VB 1M7IA 2HJLB 5IB2A 4XTRD 2VH5L 2Z8WC 3D2UA 5TE7L 2WUBL 3O3BB 4FNLH 2OZ4A 4LCIL 2KQNA 4HUVA 4GAJL 2YN3A 4PLJC 4N68A 3MPCA 2BOBA 3U0TA 1IC7L 4KWUA 1S9KC 2VZ1A 1EZVY 5C0AB 3O41B 4JDTH 3HRPA 2Q6WA 1ZA6B 5CUSL 3WO4C 3G5XB 1XR9B 2VAAA 3WUWB 4G8FB 4ODHL 3G5VB 2QADB 4TVSa 1IQDA 5JOFB 5HYEA 2X4RB 1N2RA 3SDDA 1GIGL 4ZMAT 3NIGE 1U8OB 1EO8L 2QLVB 5GS2H 4JREB 5GS2D 3BYTA 2PYFB 3ILPA 1IEBB 4WTXA 4NNXA 3KPPB 5DQ9A 3OAZH 3ARGC 3U46A 4Z7VA 4G9DA 4LHJB 5IB3A 4N5UA 5BZDA 4PJXB 2I9LA 3BD4A 3QUMA 4X99A 5I8KL 4J3VA 1F4XL 4LAQL 5FV1L 5TQ2L 1M71A 2IH3B 4KI5C 4ZOAA 3TBYB 5SWQA 5IR1B 4MD5A 2AK4E 1BQSA 1XZ0B 4JHWL 1L7IH 1QRKA 4ALAH 4BSVB 1T0NA 1AE6L 1YJDL 2VSDA 3LS4L 1X5LA 3MZGB 3SDDD 3EYSL 1G7IA 1R5IA 3AXLB 4JPVH 4NYLA 1O0VA 2HFFB 4KMTL 1YEGL 3QUZC 2XXMB 4JKLA 1RULL 3GJFH 1WAAF 1MH5B 3QG7H 2QSCH 1S78D 3EW3B 5EWIL 4XP4L 5AAMA 1PBYA 2J8UF 1AC6A 3UPRA 2HMID 3KPQB 3WSQL 3MFGB 3QO1B 3QISA 4DUXA 5IKCA 1MCIA 2QHRH 2ZJSH 4PD4J 5ALBH 5H37G 1J1OL 2YSSB 1YMME 4JN2B 1T89A 1N2RB 4O9HL 3SDDB 4XH2B 1CGSL 4WEMB 3KR3H 3BEVA 4M62L 4X8JB 1N0XL 2BRRH 1MFBH 1XMWA 1YN7B 2VTFA 4P2RA 5T1DH 3DGGA 3O6ML 1TJGL 2O5YL 1NLDL 1IAKB 5DSCA 3CH1A 3TH3T 3MJ7A 2KZWA 1JNNH 3QDAA 4GAGL 4Z7UB 2L0DA 2YPKA 3MXWH 3LD8B 3O2VL 4MHHI 4IRSB 3RX5A 1N3NB 4JANB 2G75A 4ONFL 3JTSA 1KJVB 4OLVL 2NNAB 4PGCA 4PS4H 4LKCB 4PJFA 2GAZA 1CE1L 3VGAB 2NQCA 4K3JH 4WI2A 1BJ8A 3HC4L 2NXYC 5C0FB 4ZFOB 4W4OC 3BP4B 4LKXB 4FQ2H 3H3PH 1BGXH 4HF5L 4UQ3B 1N5AB 4OUOA 2L7UA 4PJXE 2BX5A 2F15A 3BQUD 2ATPB 1OWWA 3MJ9H 3DUSA 3V6BR 1H3PH 2X10A 1QEWB 3PXJA 3GI8H 4HGMA 5C8JB 1L9MA 4LOUD 5DD6A 4IRJA 1HNGA 3R8QA 4LCYB 3VFPB 3H3BC 2NY1B 4P49A 1EO8H 2H26B 4KVNL 3FQNA 2BVOB 1J8KA 3MJ7B 1R24B 2UVFA 3FFCD 4I8DA 1YN7A 5CJQH 2DQEH 1MEXH 1FL3B 1TZGL 1QSZA 4WNQA 1EMTH 1A5FL 3PWLB 4XNZC 5GRJH 2XKSA 4HUKB 5F96H 5FV2A 1HI6A 2UZXB 4KJPC 1PG7W 1FGNL 3MRKA 5T5FH 1X9QA 3CX5J 4KGLA 5HVGB 4U4BA 3LPFA 2YBRA 2JJSA 3DO3A 1MRDH 4NKDA 4KROB 1FZKB 4U6HB 3HNVL 4OIAA 3IDGA 1JPFA 1JGLL 4FXLA 1ED3A 2IFGA 2H3NB 3VXTA 4JY4B 3HUJB 3O6KH 2ZOLA 4DEPB 4KVCL 5A2FA 1R5VB 4Z0BH 3GGWB 2NY1C 1MWAH 4YNYA 3MV8A 3QYCA 5JXEC 1K6QH 2HP4A 3LV3A 3OKKB 2NZIA 4P9HH 1RVFH 3L7EA 3ES6B 4EDXA 4Z77B 4KQ3H 3H7BA 4G5ZH 3VXRE 5AYQA 3K4DA 1PQZA 1GGIH 2I9LB 3WD5L 1BOGA 1KB5A 3UYRL 3KPNA 1PG7X 6FABL 5INDB 5IK3A 3IAQA 1ZWIB 5CCKH 2Z91B 4POUB 4Z0XA 4ZO6A 2J7LA 4ODTH 4I18C 4MZ3A 1HHJB 5LBSL 5HJ3B 3VDBA 3GMPB 4KDWA 1JGVL 1G7HB 2BSRA 2GT9B 3FB7A 5GRUH 5E6IA 2QKIA 4MMXC 1JNHA 1F2XK 5FXCH 5T3XD 2VYRE 2QQNH 1OQXA 1ACYL 1CE1H 1T1XB 1T7WA 2W9EL 1N26A 1UWGL 2FDBP 3O3DA 1YEFL 1QSFD 1BAFL 2X4UA 4LLQA 2HFFA 1EBPA 2YD8A 5D2NA 4OZHB 2VL5A 4LLUB 5IOPA 3HC0A 3I75A 4S1QL 1FNEA 1A8JH 5F7HA 1A1NA 4PJBA 1FNSH 1FRGH 3KJ6H 3BPLB 3GSOA 3U7AA 1HILB 4ZS7L 3O6FB 5IG7B 5DRZA 3BRGC 3MV7B 4M9PA 4AY0A 2DQTL 3RP1A 3IS1X 1AD0B 3RZCA 3NABL 3CGTA 5INDA 5ISZD 1S9YB 1BWWA 2DF3A 3TA3B 5BRZD 3C2AL 5CAYB 1NSNH 4JGUA 1CFBA 2F53A 4TPRH 4ZXBB 4LDOB 4UT9L 4LEOB 4ZNEA 4Y5XB 1JNHB 4Y4HC 3WE6B 5EULV 4U1IB 5C2BH 3MGTA 4MXWL 1QR1B 1HINH 3HRZB 32C2B 2V2WA 1U8JB 2AV1A 5H94A 3MUZ1 3ULUC 1F4AA 3KVQA 1U8QB 4QRRA 5I74C 5DMKB 4RBPK 4L4TA 1YY9D 3BO8A 4OLZL 5T3ZD 4KKBD 1AXIB 5I1JH 3E8UL 3RI5K 4ACPA 3BZDA 4H5SA 3VXSA 1GJIA 1E27A 3HMXL 3RZCD 3MRGB 4D0BB 3WFBH 2WSKA 1FORL 2X4SB 4XPGL 4JFED 1UWEL 3VI3F 5CD3B 3DROA 5CMAB 4RIRB 4NCC2 3BD5A 3LZFL 5DRZB 4HJGB 1KJ2H 2VLLA 4JRYE 1ORQB 1NGPL 1B6UA 1OGAE 2WV3A 4WNQB 4JFOB 1BPVA 2MJWA 3VXSE 2DOCA 3TFKD 1MY7A 1OVZA 1EJOL 2OMNA 2GITB 6FABH 4L8SC 1NUDA 4PGEA 4YEFA 3ARUA 1RZ8A 4M7LH 1XAUA 5KSAB 3DETC 2HLAB 2FX8H 5C0GB 4MQ7B 3ARGD 3MRLA 4X6DB 4PREB 3OXSA 5IVOA 1BQLH 5J12C 1G1CA 3RWGA 1TNMA 4XT1C 3BGMB 2AJ3B 3LEVH 3B9DA 4U7KA 1YEKL 1BZ7A 2QQNL 3VXTB 4IHOB 3MLZL 3CVIL 3IDUA 3TCXA 4XB7A 3IF1B 4QY8A 2FJGB 3MRDB 1JHKH 2LAAA 2GKIA 1F4WH 1P4BH 5CBEA 2ZPKH 3ISWA 5CLWA 5JQ6L 1CICD 5C07A 3P4OA 1IC7H 3FL7A 2GFBA 5EPMB 1UCBL 2DLEA 3UTTA 4JO1L 3EYVA 4CN4A 3QP3A 1ZHNB 2Y5EA 3AREC 3O2DL 4XMLH 2DQDH 3U6RA 4HSQA 2RAMA 1HQ4B 4L8CB 3OAZK 3LRHA 4NO0D 3MRNA 1W72A 3BMVA 2E9BA 1XR8B 4XP5H 4G3YL 3BFOA 3RY5A 2HRPL 3PWPD 3DGGB 1FNGA 4UILL 3TVMC 2OX5A 4NGHL 2FGZA 5EO9B 2G9HA 4K8RL 4GKSA 1LK3L 4HPOH 5JW5A 5JIKA 3SKMB 2EDQA 1NGYB 5ID1B 4QOKD 1EBAA 3D5OF 5EZLA 4ZUVB 1OHQA 1DBKH 1FDLL 2NY4D 3BZ4A 4K7PX 4QYOA 3MR9B 1ND0B 4Y1AD 3BWAA 3N85L 3OAUH 1CXEA 1EGJL 4J3SA 4WUUB 1YJDC 3LPGA 4GRWB 1H5BB 5I8OH 1CLZH 2DD8L 3I6GA 4UBDD 2AQ2A 4NQSB 1A2YA 4U6YB 3MRMA 3E8UH 1TXKA 1WEJL 3C6LC 4X9GA 3MLWL 2P4AB 1RZKL 2D2OA 4KKBC 1QHPA 2VN4A 4M8VA 4ZFZB 1MFCH 1SYSA 3TYFB 4LVOC 2NY7H 1P7QB 1YUHA 2E8YA 5FKAB 5DVLA 4ODVH 2YD7A 4I4WA 1OSZB 4NQXA 4UDUA 1W72B 3CIQA 5TE4H 4OFPA 2D4DA 4U1GB 3GSXB 1DBML 4LLVB 4TSAL 1DTUA 5DZOA 1AGCB 3WFCL 4D0DB 4NKOA 1BBJA 3AS3A 1P7KB 5JORB 2ADGA 4PP1C 4BFIB 5JW4Q 4XHQA 4LHUA 3T77A 4GKSB 4OM1H 5DZLA 1CQYA 2AXGB 4XCEB 5GRVK 5CGMA 3AREA 1U58B 2DQFA 5B4MC 5SWZD 3KXFD 4POYA 3JWDH 4KJPD 5E2TL 4KJQC 4Q74A 4GT7A 3FQTB 4DUVA 1RIVL 2HTKC 3QFJB 2APFA 4Y2OA 3OX8B 3P9MA 2K7PA 2R39A 5JHDB 3KHQA 1CGTA 4MA7H 4AENB 3H42L 4HF5H 4WHTB 5GGQL 5IW3A 3RTQA 3VXMD 3FQRB 1YPZE 1J1XH 3CCHA 3QWOB 1S7WB 2AI0L 2YEZA 2ZKHH 4EI6A 1CICC 5FYJU 4ZYKB 1KELH 1OLLA 1BF2A 1LO5A 3ARED 5AEAA 2LE9A 4POZC 4Q9CA 5JXAL 2OL3B 4U1HB 1EEQA 1C5DA 4MQ7A 4NNPL 2V9RA 1RUPL 2DQFB 5IESH 4WUUE 4OIIH 4KROC 2YRZA 2QTEA 3BKYL 5GPRA 2A83A 2P5EE 1C5CH 5BS0B 3SGEI 3BGFB 3EKCA 3FFCB 1PD6A 3FOLB 5EU6E 4P2QE 5EO0B 3I02A 4LSVL 4G8FA 4NKIL 1CLZL 4NC1C 3WDJA 3BIAX 3K3QA 5EC2B 5GGRA 4CNIA 4QWWC 4UTBL 1NCBL 4LCWA 1UA6H 1DQMH 1P84J 1RZGB 4UV7H 4HIHB 4PJ8A 1F8TL 5I73B 1SVZA 2DLFH 5I71B 2Y5TB 2RCSH 2CKBA 4PJ9C 2OI9C 1T22B 4I48B 4NBZB 3HLAB 2WWMC 1CL7I 1X5GA 4WWKA 4ISVB 2R2HB 4ZOEA 1YA5A 1LWRA 2ICWB 4EI5C 1XGYL 4JFFE 1HILA 3CFDA 3EOBA 1JE6A 4BQ9A 3UAJC 1ZS8B 3EO1A 3HI5L 4K55A 3QEUB 2X05A 4ELMA 5HHXH 3N1GC 1EO5A 3IGAB 4ELME 4RMTA 4YFLF 5E99L 1ZE3C 2EDDA 1Q9WB 2JF1A 3ULVH 3S3PA 1UXWA 1Q9KA 1QNZH 4YHOL 1E4XL 2H2SC 2CIKA 4JPIB 3ULVD 4WUUA 1HXYA 3MCG1 4M02A 1KGCD 2WUCL 5FHBH 2PW1A 2Q76B 3LCYA 1HSBA 4ODXA 1S7VB 5LQBH 4IOFC 3HZMB 3SDAB 1S5IH 4UB0H 5B8CA 2BRQA 1GZQB 5ITBL 3WUZA 5GS0C 2IALA 2ZNWA 4LSTH 3WN5A 4QRRD 4JFHD 4Y19B 4MA1B 4IBLT 2QR0A 4UTAH 1Y0LA 2EECA 3IDJA 3ZKXC 3PJSA 1KCVH 4NQED 1FNFA 1M05A 2PKDA 3A6OA 1G9MC 2VXTH 5JLZA 5DZNA 3TBTA 1MIEL 1T80A 2VLME 4F2MB 4MWFB 3SPVB 2FHBA 3NCCB 4L29A 1EHAA 1U2CA 2XYCA 3MLYH 1TVHB 3KYKH 3AS1A 4MNGB 1YEFH 2KUTA 1BOGB 4LCIH 5GS1C 3FRPA 5EOTA 1PZ5A 2ERJC 3RKDC 4FFVD 1JBJA 2VDPH 3EIFA 1FN4B 3NACH 4HUXA 4JFFA 4OJFL 3ARDD 2BMKA 1RIUH 3VD7A 3MRPA 5EU7C 5F7KC 5GGSB 1HHKA 2OZ4H 4LPVA 3JVGA 3MOQA 4S11A 5F1IA 4K2UL 3P77B 3F7YA 1Q0YH 3TJHD 1Q72L 1U8MB 3ZMRA 2AEWA 4PJ8C 1I8LA 2QSTA 5D2NC 1I3RB 3LMJL 1MCOH 2ED8A 4QRPD 3OKMB 3QEGH 2G75B 3MCKB 4PLOB 4RGMC 1F3JB 1I9EA 2LTQC 4BZ1L 5MEPB 1J11A 5CJOH 3LB6C 1MFAH 4XBGA 4O2EA 2H8PA 4GXVH 4XCYB 3QIBA 1HH6B 3STLB 1KCRL 4WWID 3ROLA 1R0AH 2QHLA 4KRPD 3UJIL 3SDXF 5JLZB 4GG8B 1CD9B 4ZQKB 3WNPA 2BNQD 1YQVH 1KYOJ 4JGJA 3A6CL 1A6UH 4ALAL 4PTUB 8CGTA 1YJDH 1ODAA 5GGTH 4EN3A 2WLZA 3EZ8A 5FUCC 3U6RB 4DK3A 1BFOB 5C09E 5E24E 3CK0L 3H9YA 5JPNB 1YMHB 4HCRL 3G04B 3JSSA 4MNGA 3EZJB 2I5YH 3RU8H 2CGRL 1JZ2A 1OSPL 3KHOA 3CNKA 4PJAA 5B38A 1UWEH 2VDOL 3ARBA 1Z9MA 4NQCD 2B4CH 1DDHB 3X3FH 1A9BA 3QUML 1A7PL 1G7MB 5E1HB 1JV5A 3QAZC 5DVKA 5JDSA 3JBG7 3K2UH 3MV01 4AEEA 1N7MH 2CMRH 3MGTB 4DEPC 4OGXH 5E1AB 1VACA 5CILH 4YX2L 3UZEA 5IT2H 5KVFH 5MP6L 4TQEL 4GMSH 3S37X 2DQHH 5F9OH 4N0UE 4QRSA 4PJFF 5I66B 4G8GD 3JV0A 1IEHA 4WDIB 4P23B 5DJCB 5FA3A 3AM8A 3HB3D 4CL7A 5C7XH 1I4FA 1TFHA 2I9TB 3BPCB 5FDWB 3MUHL 3GKWH 1KN4L 5GS3A 3NZHH 3PHQA 3CSGA 1CIDA 2C4FT 3FRUA 3X3GL 2ZSWB 3HG1E 4UAOB 4UT7H 3ULSB 5F8RC 5DMIH 1EAPA 3B5TA 4S0TD 2R69H 1OB1B 3N06B 4YFDB 3TBVB 3H9HA 1OOAA 4YIQA 4R3SA 3R06A 1INDL 4BYHA 4UAOC 4JFDD 1JRHH 2YKLH 5K9OB 3BESR 4P2QB 4M6NH 3QQNA 4F37F 3BN9C 4OZGA 2J8UA 4RFNB 1U6AL 2UWEF 3PGFH 2CPCA 3ZDXF 3IFOB 4PG9B 4XCEA 3H2WA 2EYTA 5I8CB 4D3CH 1A64A 1DBBL 2EYRA 4HPOL 1KN2H 2R2EA 5JZ7D 1D5IL 4MD0A 2DQGH 3DTXA 2LVEA 5GSRB 4J1UB 1ONQA 3VJ6B 2HFEA 3RWGB 4NT6B 4WHTA 5A2JH 4L8BB 4UT6H 4GXVL 5B8CB 1DLFH 5CEZL 4P9ML 4OZ4A 1QPPA 2QQKH 1MF2H 1GXEA 4NQCA 1J8HE 2LU7A 1OAKL 1HQRB 4JG1H 3DXAB 3TP4A 4J3TA 4MX7B 1WLHA 4RMRA 3JXAA 3W9DB 2YZ1A 4KK9C 5DO2D 4NO5A 4Z7VF 1S7WA 1IEBA 2Y36L 5E94A 2PUQT 1AGBA 4QHUB 5ANMA 4BH8B 3ZZ1A 2FBJL 1CFNA 3WIIL 4HCRH 1KLGA 1MFCL 3V7AG 4XNQA 1NGWB 4TSBH 4LPUA 3TN0A 3FN3A 3AUVA 3WNMA 1XR8A 1GC1C 5C0BD 3BOVA 1VPOH 3X3FL 4WTWA 3SJVB 4HK0A 2Z31A 3S3JA 5FYKD 4QRTB 4X80H 4YBLB 3LQMA 4Y1AB 2Z8VC 5DJ6A 4L3CA 5E8PB 4Z6AT 3RX7A 3G08B 4W6XB 1YEJL 3BZ4B 1P2CA 3ROOB 3TZVD 5I2IA 8FABB 4OM1L 1MCPH 4GKZA 5T1MA 4Y5YC 5CINH 3Q5OA 3UTZB 2CLRA 4QXGL 4XMPL 5C70A 1KPVB 5FO7A 4KAQL 5T3ZL 4PYHA 4X9BA 3JUZA 4M5ZH 1CVRA 1AGBB 3IU3B 1JPFB 2J5LC 2HH0L 2CLZB 5F88B 3CDCA 4PJXF 2VABB 1J18A 2YD3A 5CIPH 4WTZA 1OW0C 5L2KE 1R3KA 4DCQA 4OCXL 1UJ3C 3DO7A 3LN5A 4MXWH 4V1DD 5C08E 3F6IA 3BKMH 5I76B 3SKOB 5BVPL 1A6ZA 1PKQA 3UBXG 3G6JF 2N4IA 3KPRE 4P2OC 1HHIA 1TZHA 5HHQA 1C16A 1IGIL 1U92B 2F54B 1NBZB 3L5WA 2HKHH 1I8IB 3VFTA 2YKLL 3TGXA 2GJ6D 3S34H 5F3BA 1FNSL 2ADIB 1SJEA 4ZS7H 2Q76A 5HXMA 4J8RA 5CZVL 1A9BB 8FABA 2B1HL 4NNPH 4GW1A 3QG7L 3DX8B 4GW4A 1P4LB 1ETZB 4XP4H 4Y1AA 4GOSA 1SVCP 3GBNL 1U3HC 1AHWB 4Y4KD 3CFJA 2RJMA 3FQUB 4J23A 4XCNA 5CEYB 4HC1H 4MS8C 3KLSA 1AJ7H 4Y19A 5ITFA 3FB5B 2EO1A 4N1HB 3KYAA 3FQRA 4KKLD 1IGTA 1CBVL 3M1BB 1EAPB 3V9FA 4MA8H 3IRZA 3KR3L 4JZNA 5CD5D 1BD2A 1RZJH 4H88L 1NC4D 3MRNB 3L3IB 3VWKC 3KLAB 5HDQH 4R7DB 3P0YH 4KTYA 1GGCL 5I17A 3HZKB 1FLRL 3DETD 3EJZD 4ODSL 4GKNB 1J86A 1GGTA 4JY6B 4YLQT 2DYPD 1MI5E 3HMXH 4XX1G 2J4WH 4LEXL 4LBEA 4IJ3C 3S98A 3ARSA 3ILQD 3SGKA 5FGCE 4KK8D 4F3FB 5I1KH 5E5MB 4NQEB 5D71L 4GJTB 1NEZG 1NFDE 2NXZB 3ARTA 4AIZA 5ICXB 1C5BL 3PV7A 4NDMA 4M8QB 5KVGH 3BN9D 5TPWH 3TBYA 4CVUA 3EGSB 1LGVA 3HRZA 4U0RC 3ETBF 5CIPA 4YHOH 3BT2H 2ICES 3LRSA 4XRCB 3MLVH 2DB8A 4PG9A 3RVTC 4QCIA 2P47B 1LD9A 5HI3C 3QHZL 4M7LL 4Y5VA 1S7RA 4RGOL 1IM9B 3NH7L 2DQJH 3BEVB 5IHUL 4ONHB 1MCKA 4MQTB 4AL8H 3FTGB 4LSPL 4K7PH 3CU1A 4HWEH 3L1OL 3QUXC 2Y6SC 3ZKSD 5EOQH 1K3ZA 3TYGL 3E6HA 1TZGH 1UG9A 1CGUA 1A7NH 5DHVB 3VFMA 3HE7B 4R0LC 5CP3A 4GBXC 5EU3A 1KTLA 2HYMA 2JJTA 1T03L 4Y2DB 3VI3E 2ESVE 3MLXH 4M61B 5HYSA 1BEYH 1GOGA 4WUKH 5SWSE 3RL1A 2H6PB 4HCRA 4NUJB 3L3DB 4NO0A 3Q2CA 4HUUA 4D94A 2VQ1B 5CGTA 4MQXC 4GBXB 2AXFB 4JEGB 4RX4D 5FOBA 2DDQL 4NRXB 4KK5C 1E6OL 5JHDA 2VR5A 3C09B 1XCTB 4X7DC 3EO0B 3PGDA 2R56L 3UCRA 2AJYH 4YZFF 1GGBL 1CR9H 1W0YT 4TUJB 2VAAB 3WUWA 2F19H 3LAFA 2X7LB 3FT3A 3DHJA 1ZA6A 3WEXA 4PJ7F 4WDIA 1J0IA 4X5LA 1MJ8L 4P9HL 4Y4KC 4U6VL 4P46B 3LKRB 3HA0A 2P46B 2QJDA 2IEPA 3NCYP 3TBTB 3FAWA 4X9IA 2YC1A 2EC8A 4FTVA 3IDIA 4DOHE 3QWOA 1YYML 2HKFL 3VGFA 4ONGL 2AJXH 2QQLL 3ARRA 2Z93B 5KSUB 5H2BA 4HMCA 4KUCD 3WJLC 1U0QA 1Z2KA 4I0KA 2E27L 2DM3A 4B5EA 3TNNA 1PVHA 3RWIB 1YNKH 2WBJD 2X9WA 5JHDD 2J4WL 4LEXH 3QUKA 4BSWB 3DMMA 2BCKA 1N6VA 1QA9B 4GRLB 1MREL 4OI9A 5F7FA 1ZLUH 3TO4B 1M6OA 3T0WA 1X6NA 3F7RA 4OKDA 5K9KB 1HEZA 1P5VA 5EZLB 3U7WL 4G42B 4ZD3L 1RUKH 4YHKL 5HGBA 4R97C 1BM3H 1YY8B 1R5IB 4J4PC 1PX4A 3D85B 1N64L 2IFFL 2R8SH 4QOKA 1CYGA 3SGJA 3GGWA 3TBWB 3GHEH 4H20L 3VRIB 7FABH 4JDTL 1LE9B 1GL4B 2IQ9H 3MA9H 3QXWA 3JTTB 4DKDC 1T1ZB 1V05A 1VFBA 3FQXA 2CDGA 2A9NH 2VDKH 5GXBB 2L4OA 1TJIH 1KBGH 2Z4QA 1FVEA 4WWKB 1MELA 2VSCA 3VGBA 3DSFL 4JG0H 2EE3A 2YPVH 4JHBA 3LKOB 4L4VD 4YE4L 1FL5A 4B7LA 3W11C 3OXRB 4K7PL 3OKKA 4M1CC 3BISA 2IBGA 3OKLB 1JNLH 1E4KC 1CFQA 1HHHB 3DI3B 1KIRB 1IC4L 5DQDH 3PP4H 4ERSH 2AQ1A 4LSDA 5BVJA 5DDHA 5B4MD 1BBDL 1G7JB 2FJHA 1QRNE 1T2JA 2CRMA 2JCCA 1CT8A 4OZFH 2D0FA 5IMLB 3ILQC 2R1YA 2WQRA 4YEEA 1REIA 5F3HA 1YY8A 3RL2A 1ZT1A 1B9ZA 4RBPH 1OF2B 5D96C 4UV7L 1T83A 2PO6D 1FAIH 3I6LD 3HG1D 3QUZB 4LKCA 4NOBA 1AE6H 4Z18A 4K3GA 3ZTJG 4OLXL 4XNMB 3IKKA 3T3ME 2X4QA 2UWEB 4MWFA 1XCQA 3PGFL 4PV8A 5BRZE 3T0EE 5F93C 2Q3AA 4NHUA 4QY8B 1BD2E 1A7BA 2J1KA 2AV7A 5ICYB 3MRBA 3CCHB 2QHRL 5LGJA 3QCVH 1ZLUK 1EEZB 1IFHL 2AK1H 1R3LA 5IP4A 2XZQL 3O9WA 3WXVH 3TVMD 4X98A 5LVEA 5EUKB 2DLGA 2LAGB 5T1KA 3CH8A 1QFWI 4HS8L 2DL2A 3MXVL 4K9EH 5I1EH 3DRQA 2AJXL 2QQLH 3R0MA 4OF0A 3C8KB 4B53A 5A2IH 3QNXA 3U4EA 1F3DH 2CK2A 4GAGH 4LGPB 4TNVF 4GRWE 1J9CT 4OLYH 4GUPB 3IVKB 3SKMA 4X5XB 5C08A 1T1YB 3BPOB 1K9TA 1BLNA 2VDMH 4ZUTB 4P2OD 3OB8A 5B38G 5KG9B 3ARFA 1IBGL 4L9LC 5HHPA 2XNAA 1QR1A 3MLZH 1HDMA 2R0WL 4Z7UE 2A6KB 1P53A 2V2WB 2YS4A 5H94B 3H9SD 5HHXL 3VXSD 1D6VL 1I1YA 3H3PL 5E99H 2Y5TA 4YHLH 4YHZH 3LN4A 3BKCH 4YK4C 3O4LD 3K1DA 4Z7WA 3UAJD 3HC3L 1VB9A 1DE4A 4CNIB 3LV3B 1ADQL 5EORH 4H8WL 3L7FB 5ILTL 3RY4A 3RWJB 1R3LB 3V4VL 1S5IL 3ALWA 1WBZA 3VGGA 3HUJA 3B3IB 1NGWA 4M5ZL 3VXUB 4KVNH 5KSUA 3KPTA 4QHMB 2PN5A 5CMAA 5D6DA 1NCWH 4GRMB 1UH4A 5I75B 5BRZB 3DGCR 5DJAB 4H26A 4LVHB 2OL3L 3C8KA 2DLIA 1UJTA 4CW1A 1OLZA 4G8IA 2VR9A 3HS0B 1A47A 4ONOA 3T04D 5D7IE 5IW1B 1K8IB 1MNUL 4EIGB 3PHOB 4N1CA 1S8DA 3O8XD 4FQHB 5E6IB 3U79A 1FGNH 1AP2A 3GMPA 1MRFH 4ZSOE 3RIFK 1ZHLB 5IVZB 5FYLH 5HHNB 3SDYL 1MRCH 3JV4A 5JA9A 4JN1H 1UYWH 4F37K 2HTKD 3EYFA 4YXKH 2ORBH 4EN3C 3CPLA 4HFWA 1FIEA 4PGDB 4OLXH 4WY7L 3KPSE 1S7SA 2F5BL 1ZVSB 3VFRB 4HBCL 1I85C 3QFJA 4WI5A 1IQDB 5JOFA 3BPCA 5FYJL 5FDWA 4YC2C 1L0YA 4P59H 1OSPH 2P1YA 4LARH 3S96B 2VDOH 2F58H 3HZYA 3SGJC 3SDAC 1K4CB 5L7XH 5C0EB 4FMKA 5T1LD 1JZ7A 4OD3L 1IFHH 4ZTPL 5K59F 5TGBB 3CXDL 4WUUD 3I85A 3TIEA 3UJIH 3K80A 1CDYA 1IGYB 5CJXC 5I8EA 2OJZH 3KXFE 2P5WD 5J3HD 1GHFH 3UTSA 5B39A 1B2WH 3DXAD 1FLRH 1KC5H 2IBZY 3NAAH 2F74B 3RIAK 1Q0XL 1RZKC 1H3WM 4BK4A 2PXYC 1W72L 2R1XA 3QEQD 4HS6A 4NN6B 4UIKH 4ZPTA 4OLYL 35C8H 4DKFH 2OP4L 2IANB 2YA0A 4PJ7B 3P30H 3QXVA 1MWAB 2AEPH 2GK2A 2H9GA 2A6DA 4J8RB 4LQFH 5FYJD 2ITCB 5HVHC 3VFWA 4W6WB 1YN6B 4C56A 2Q87A 4PRPA 4F7EB 1WWCA 3GNML 2Q7YA 5KVDH 4HK3J 3RUGA 1T2QH 3S36H 5FIEA 3MYJA 4U6YA 1XCQB 1JGUL 1JF5A 1VHPA 4U7SA 4WI4A 3DMMD 5FHAL 2NX5B 5LGHL 2FYYB 3GBML 1CF8H 3QHZH 5JIIA 2BY1A 2GJ6E 2WM0A 2FGWL 4HH9B 4CUCA 1M1SA 5C0IA 4X6BB 4ZO9A 1NMAH 5IMOA 4JDVA 3IFNL 4F80A 4ELMB 2EIZA 2H2SD 3G9VA 1AO7D 1Z9OA 1RK0B 3G5YB 4UDTB 4UNUA 3EJYD 3GKWL 3WS3A 3D25A 4Y4HA 5JZ7C 3OJDB 4UT9H 2DM4A 3TT1L 5JW4M 4PR5B 2IMNA 3QWRD 1RZ7L 3QXDB 4P9HC 5KOVC 2GAZB 4LSQL 5I2IB 2NY0B 1KOAA 4XC3H 3WS6A 2B5IB 2BZDA 1P7KA 3MV8E 1F4XH 4Q6IC 4WEUD 3SDAA 1QFWM 4TVPH 4HDIB 4BH7A 5HGBB 2JELH 1EFQA 3O41A 2Q6WB 4V2CB 5DA4A 2C5DC 4KJWC 2D0HA 4W4OA 3P73A 4KK9D 5HPOA 1U2HA 4K71C 4G7YL 3O3BA 3V6OC 4HUWA 4MLIA 4RWYL 5ACZB 3SGDI 4HIIB 4JPVL 3O4OC 3Q3GA 5IG7A 2AGJH 4HPYL 2N7AA 2QSCL 2OBGA 4P59L 4NRZA 4GSDH 1C12A 2F58L 5JPMB 4HKZA 2NCMA 2DKUA 2WZPD 4HUXB 2H26A 1NFKA 5EZIH 4NQTA 4FQJL 5C0BE 3FO0L 5KANG 3NTCH 5FECB 4X6BA 5KS9E 4M61A 4X7TB 1AFVL 5D2LE 4EOWH 3B2VH 1QNZL 3I6KB 4HIJA 4CU8A 1F42A 2KZ1B 5DHVA 2ADIA 3V0WL 5F3HB 3UBXA 2H32A 4YHIA 1MCHA 3SDXB 4P4KB 3IRPX 1KIQB 1TZIA 5D1XA 4I0CC 3HHRB 4WFFD 2V5SA 2FLBT 2W0FB 2MFNA 2XFXB 4M6ML 3TWCL 3O0RL 1G9NH 1NEUA 1OTTC 4BM7A 4K3JL 3KPSB 5CFHA 2P8LB 1KXTB 4N0YH 3QO0A 4KKCC 1TDQA 5FKPB 1L7TH 1OW0A 5BVPH 3RBSA 1X4ZA 3CFCL 1UWXH 1IZJA 2WWKT 4RMQA 2P49B 4WWKD 5E00B 2C1OA 4XZUB 2BXZA 2X7LA 3MV8B 2VR4A 4V2BA 1GAFH 3K8MA 1KJ3H 1TPXB 3A0OA 3IJHB 3CZJA 5TDPB 4JR9H 2DLTA 2D03L 2FD6L 1A6VH 4NQEA 5CZVH 3E2HC 2NTFA 2R23A 1X6LA 2ICWA 1SEBB 1S5HB 1DSFL 2XZAL 2VXQH 3GIZL 4UILH 4MDJA 5C0NC 4PGCB 5TF1L 3LMJH 4M3KB 3EOYG 2WBWB 3LKQB 3QZWA 3OKNA 5T3XL 1MEXL 4Z7UA 3BD3A 2YD9A 1YECH 1U58A 3I3BA 4JCMA 3S4SG 4M4RA 1G9EA 4XVUD 3O2WH 3RDTD 1KIQA 1TVDA 1UZ8B 4OZFB 4XCCH 3VFGL 2Q7YB 4HKJA 5E8OB 2BSRB 1IM9A 2GT9A 3FB7B 4RX4A 3SO3C 3IAPA 4XVTH 4PB0H 2C7UB 1IQWL 5D2NB 4ONHA 1RZIB 2NW2A 4FG6D 1WBZB 5JW3L 3PABB 1U8HA 4LLYA 1JPGB 3SGEH 3VRJB 2IAMD 3OB0K 4ZTOH 5D9SB 3DECA 4KJYB 1BQHA 1CLOL 3FFCE 5ICZA 1FJ1A 5I1AB 3ZSSA 5HDBE 4PJDB 5CSZA 4N0RA 3HMXA 1MCBA 3G5ZB 1WUNT 2BY2A 4HAFA 2JJWA 5IHBA 1KGCE 2UY7A 4EBQL 4QHMA 1WT5A 3IU4H 3ZDYF 3TBVA 3MRQB 3CFBA 3JWOL 3W0WE 5KSVA 4RZCB 5IBLC 2AXFA 4ETQB 3QI9A 2QADD 1U3HD 1VFUA 4XBPA 1FO0A 1NCUA 5JOPD 1S9WB 3IKCB 4ZS6C 1GZPB 2ILLA 2GQHA 2Y23A 2ZWLT 1EDQA 1A4KB 4D0CB 2F53B 1OTSD 4OM0H 1ZEAH 4YXHL 4RGOH 2G60L 1T21A 3ZYZA 1LO3L 4QT5B 1I7RB 5IHUH 4HJJL 4OCLC 1S7SB 1BQHG 4HFWB 3ALPA 1AO7B 1ZSDA 5AWNH 2K7QA 1EX0A 1RMFH 3RWHA 4OV5B 3FQUA 5GZOC 1HCFX 2GK0B 1NCAH 2Z35A 4NO5B 5TPWL 3H42H 4Q0XH 1VFMA 3N50A 1BAFH 1R5WA 4Y16B 3GSXA 3GRWA 3KPLB 5DD1L 1U8LA 5J9PB 2Q3ZA 2HG5A 4WUKL 4FRWA 2NLJA 4MLSA 2J8HA 5FYLE 5GISL 2CH8A 2X1WL 1T7VA 5ADPL 3GK8L 1FG9C 2FIRT 4X7FC 3LS4H 4MQSB 2MCPL 2R9HD 2E9IA 4TRPL 3SKJH 4OFVA 3LOWA 3DPBA 4AG4L 4ZSOB 1NBVL 2Z8SA 3GJFB 4XPBL 1HCVA 2OTUA 3CVHH 5ALBL 1S7UB 3JVGC 5CLTA 3D85D 3U1SL 5CEZH 4KRPB 1T83C 2YXMA 3MNWA 2CIIB 2ZSVA 1LK2B 3NIGF 4OIBA 2B8OT 3ULUE 1QEWA 2VISA 4V1DA 5FGBA 3SBWC 2G5RA 1YZZA 4JHWH 3UTZA 1ZT7B 4BSJA 4KI5E 4OZIA 3QBTB 4GS7B 4O51A 3L3GA 1OQOA 4UQ3A 4F58L 4QGYA 1JNNL 1G6RB 2CDGB 4G6FB 4U1GC 2XWJB 4PG2C 2EH8L 2X09A 3CAFA 3PHQB 1A4JA 4HUMB 5E5UB 1L0QA 4ZXBA 3B4NA 2W07A 1QLRB 4BQ6A 2ZJSL 3RZCB 2A6JB 4OAWB 4D9LH 3ULUL 1JHLH 1KIUA 5HHMD 4WU5A 5CBAA 5C0ND 2GJ6B 2LABA 4X7EC 1EJOH 2DICA 2DKMA 3GKZA 5IMLA 2RGSA 1HHKB 5IVNA 1WC7B 3RWCA 1SQ2N 3WL9A 1B2WL 4ZDHA 3DX7A 3H7LA 4OI7A 1M7DB 2BSSB 3CFKB 2ZUYA 4Y2DC 4Z8FL 4AZ8A 2G60H 5JQHC 1HQRA 4ZXBD 3P0VL 3GI9H 1S9VB 4H25A 2W38A 4NWUL 5H8DA 4Y89A 4AMKH 1BVKB 3Q5TA 4P2RD 4I2XB 4X6EB 1AGEA 3RHWF 5J1SC 4E41B 3RNKB 1GCFA 1BZ9B 2FCBA 3SE3A 4WO4A 1RZIA 3SO3B 3TT3H 4X4XB 3WEXB 3O3EA 5IB1B 5F96L 3PWJA 2P5EB 4FQCH 3QEUA 1UVQA 5DK2B 1N64H 4OB5L 5KSVB 1QRNB 1DQJA 4NCC1 4HJGA 5CBAB 2PO6C 1T1YA 3HMWH 2VL4A 5TGBA 5A3ID 2A9NL 1DR9A 2MCPH 5FGBC 3SBWA 2C4XA 5I1HH 4TOYL 1Q72H 1U3JA 4JRYB 3QNXB 1MAJA 3QDGD 2DJUA 4PJCB 2VLRE 1IKFL 2M26A 1CK0L 3QJHB 5IBLD 2PYEB 2JIXD 3BDXA 3RVTD 3RVWD 3OQ3B 5C6PB 5JNYB 3Q48A 3DMMB 1HDMB 3WNNA 4P2OB 3WFDL 3TO2A 1NC4B 4NZTH 1DN0B 4LCCB 5HPMA 1X3DA 1D5XA 4U0QB 1LE9A 3ZE1F 1A0QH 5I15L 1Y6MR 3RVUD 2V17L 1CBVH 5C6WH 4XB8A 2DD8H 4NZUH 5FA3B 3BH8B 4IIQC 1RFDH 1P6FA 3FQWB 5EOTB 2I9TA 1EZVX 4JO2H 5HI4C 3O3DB 4BFEA 2YUZA 4P23A 2KQMA 3SO5A 3SPVA 1JYVA 1EUTA 3CK0H 4IEFB 1IGCH 3GSUB 4JAMA 1LO5B 1QVOB 5F89A 1AD0A 2AGJL 1TTUA 3O6KL 1F3DJ 3GSQB 2ID5A 4MA3A 5HGDB 4YFLI 1MI5B 4ZFOL 1D3CA 1MQKL 4G9FB 2VH5H 1XZ0A 3T8XB 3W9EB 3GMRA 4LU5L 5GRYA 3IDYC 1MJJA 4JRYD 3C8DA 4NZRL 1J87A 3UC0H 5DF0A 4K3HA 4U1HA 2IC2A 3V95A 4F8QA 4Y4FC 2HLFD 2A73A 4O58L 1CGWA 3WKML 5HDBF 4R4BA 3CC5A 5DK0B 2NTSP 3BWAB 5HYJB 5IGXH 2YD6A 3MCKA 3QG6B 4JFZH 5DEFB 1AKJB 4JRXA 2E9JA 4M7JL 4N0CC 3PGDB 4OFKA 1EXUB 2FX9L 1UENA 5C7XL 4P5TC 4N0FA 2H3NA 2Z0BA 3C2AH 3QULA 3V4UH 5DJXA 1G6RL 2IPTH 3VFNB 2BFVL 3B43A 3C5ZA 2JIXB 2VAJA 1NFDA 2FECL 5BMFL 3TCLB 4HIJB 3UZQA 3BXNA 4YHLL 1J1PL 3CH1B 3REVA 4MSWA 4R7DA 4JKWA 5EIIB 1FQ9C 1XIWA 2ZUXA 4RGNE 4TULL 4BSWA 2D03H 3S7GA 1PEZA 5EU6B 4Z78A 1FFOA 4TOYH 3FB8A 1WCQA 4NKOB 2E8ZA 2XA3A 3GSNB 2OK0L 2X4PA 3V4PH 1JI2A 3P4MB 4PP2B 5SWSB 1I1AB 5EOCL 1D9KC 5JOPE 2AJSH 3UBXB 1ITBB 1N3NA 3I3EA 1NSNL 3RVVC 2B4CC 3DVNA 1S9VA 2DBLL 3F7QA 4GRWF 3ME0A 1JK8A 2OR9L 2JB6B 4BFGA 2V2TA 4EDWL 3PWPE 3LRSB 3IU3A 4ORGA 3K7UA 4LLDB 2UWEE 1KB9J 5DEZA 2DTML 3RWHB 3P0GB 1QZ1A 5IROC 4OLZH 3QDJA 4R4NC 3FCTA 1KPVA 5FO7B 4I18A 3IFPB 3IAGC 3NMEA 3RAJL 2C3WA 2NY2D 1NMCC 2O61B 4EXKA 1JCKA 1KUMA 4BUHA 2DM7A 1HKLH 3MODH 2WW8A 2XXCB 5EIIA 3H9SE 1AKJD 1R3KB 1TJHL 1FORH 3OF6D 3UYOD 1NH6A 4PS4L 4JFEA 3KS0H 1ZTXL 1XGTB 3MJ8A 3CVIH 5TH2B 1UM5L 3DYPA 4TTGA 1I3RA 2YD5A 2FSEB 1I7UB 4ZD3H 4HDIA 4Y0GA 1E4WL 4XI5D 1CXIA 1A7RH 3P77A 4F15B 4WI3A 5DMKA 4E9LA 3SDAD 2CKNA 1YEHH 4HUUB 1ZT7A 4KHXH 3O2DH 4XMLL 3V0VA 5FHAH 5LGHH 2VDLL 5C3TA 1WT5C 2ICWJ 3MGOB 4YDKL 4MX7A 4R26H 5C0CB 4OI8A 3WLWC 3VH8B 4HAGA 1LNUB 4X6DF 4PJCF 2ARWA 2EKSB 4U3XA 3DSFH 3QNZA 5LCVH 3W0WA 2FEEL 3O9WC 4N0CD 2CXGA 4J6RL 2PTUA 5F70A 4H1LG 3PABA 1YUHB 5EBLA 5DJZB 4LQFL 3TT1H 1MPAH 1RJCA 3CDYA 4H0GA 3SQOL 2APBA 3VD3A 4FQ1H 4Y4FB 1U42A 4P23C 4OZIE 4YHIB 5E94B 1JGDB 2VLJE 4U1NA 4KPHL 2R1WA 2NW3A 3OTTA 1EK3A 5HYIA 3T0DA 4AT6B 4ZG1A 2PETA 3NACL 4N0UA 2A6JA 4OAWA 4G7YH 1MAML 3OPZL 4PGEB 3VRLF 3QCUL 1OCWH 2VZVA 2GTWB 4XP5L 3SKNB 1DUZA 2V2XB 4JO3H 4RCAA 4HK3N 4OT1L 5DD3H 3V4PL 1JL8A 1B4JL 4M8QA 5D7IF 2XNAB 3N1MC 4HXAH 3V0VB 4KVCH 4LF3A 3X12A 3LKSA 5J1AB 3QZWG 2J8OA 3BIKB 3REWA 3VFUA 5HVFB 5EZOH 2P5WE 2X4RA 1UB5A 1IM9D 4ODWA 1V7NH 3TN0C 1EGJH 1QTYT 5IHZA 5HHMB 4K94L 3AB0C 1T7YA 5I66A 3M17B 3UTTB 1N5YH 4MNHB 1ZHNA 2JELL 3BQUC 1MHPH 1K2DB 3MXVH 5B22A 5IB3B 3NCJL 3P0YL 5IFHH 5CD5C 2VC2L 4ODSH 2IG2H 5BRZA 1UH3A 4I0PD 1CD1A 1T7ZA 5FYJE 3OKEB 3SHSA 5I1GL 2YXFA 2EH8H 3SE9H 2YK1H 1TVBA 3QRGH 5GRXG 1QQDA 1DBJH 5GGSA 1PZUB 1MOEA 3L3JB 2F54A 1JWUA 4W70A 3MV11 4M43H 2E7LA 3H9ZA 4CN6A 2EH7H 1A2YB 2VLRB 3KYMB 4LGRB 1T5WA 1C5DB 1ROWA 3DVNB 3T2QA 2YRPA 4P2QA 5ESVB 4JJ5A 1GSMA 4WU7A 5D7SL 1ZA3B 4QHNA 3VGEA 3PGCA 4HWBH 2EXYC 3P4MA 1WSST 4YBHA 4L3ED 3GZKA 4Z76B 3VGAC 5I30L 4PTUA 1QSED 4NT6A 4R8WL 5EORL 1NCDL 5CILL 4YX2H 5IT2L 5CJ5A 3S4SA 4BQ8A 3JV5A 1C12B 4MD0B 5J11C 5BZWA 3B9KD 3L6FA 1U8NB 3GSNL 1HHGA 4XPAL 1UXSA 3TVMA 2FLRT 2QBWA 4OKVB 3CU7A 4G6FD 5FAAA 1E4XI 5IFAL 3A67L 3T1FB 1I7TA 3RVUC 5GGVY 1QFUL 5HHME 4JRWA 4GXUN 4AMKL 5IWLC 2NZ9C 5KJRL 3X3GH 4Z7VE 4XWOD 4YC2B 2PTTB 4JREC 1HH9A 4HH8A 1EEYA 4N0YL 4FXKA 1MJ7L 3I50H 5FO9A 1A4JB 3MRFA 4P4KC 1ZLSH 1LP9F 3CFCH 1KFAH 1Q9LB 5DURD 3SJVA 5GS0H 2HWZH 5EU6D 4LCWE 4HS3A 3NFSL 4RZCA 2IADA 1NCCL 3UXFA 2AI0H 1VGEH 4JN1L 4TSCH 3VWKA 1N6QL 5IQ7H 4HLZG 3MBXL 5MEQB 4R4FH 1CLCA 1OCWL 4X5XA 5DJ6B 1Q94B 1CLOH 2O5ZL 3THMH 1IMHC 1KJVA 4XP6H 2VXQL 3GIZH 1F4YH 3OXSB 5HYJA 2R56H 3T08A 1ZA3A 4QHNB 5D1ZD 3RGHA 1CR9L 4Y5YA 4I9WE 2DWEB 5C0AD 1LO0L 3T1FA 1MCWW 2Z4QB 3GB7A 4Y4KA 4LSRL 2VLJA 3UTTD 4PRNB 2YRLA 5E70A 5H37H 3TBWA 3VRIA 1EHXA 1FNEB 2P43B 3QT2A 2VITA 3H3KA 4R90L 1YPZA 4NZUL 2P8MB 2BMKB 3EYQC 1QSFE 5E2JA 1N0XH 1DQML 1AD9A 4G6KL 4PV9B 1TITA 3X17A 2WK2A 3BXNB 5MEND 5FUCE 1X5YA 1MSPA 4GRLC 4YXHH 3QDMA 1W72H 3X11A 1ZT4A 1RY7B 3MRIB 1KG0B 1PY4A 5FEBA 5DJAA 3LEXA 1XGUA 1UM6L 3V5DB 1CI5A 1ERNA 4PP2A 5GJSL 5SWSA 3QNYA 4KI1A 4AQ1B 2FHFA 4L4TB 3HKFA 1A14H 5LGKA 1CVSC 4PRDB 4GBXA 1AXTL 4O51B 1BM3L 2AABH 5JNYA 4RNRA 4EQ2A 5TDNA 3KYNA 3ZKMD 4N9GB 2HJFB 4L8DA 4PRBB 2BHZA 1JFQH 1NFIB 1T22A 3LIZL 5C0RL 3NIDE 2D9QB 4KUZL 4XHJD 2VLKD 3MREB 3MNVA 4ZUUB 1BJMA 2NR6D 2BSTA 1ZS8A 3EO1B 5DUPL 3PWPA 4HJJH 3TNNB 1HIML 1NBVH 2FEDC 2V5RA 3MA7B 4TNVK 4ZOBA 5KAQG 1Z3GL 3D0VA 5DMGC 4ETQA 1CU4L 3A6BL 4QRQA 1OGTB 5L2JA 4U1MB 3HI1B 3KPMA 3PP4L 4ERSL 3BN3B 4M1CD 1MJ7H 1KG0A 1S7VA 43C9B 4IRSA 2PO6A 3ARBB 1FGVL 1TCRA 4JJ5B 5DD1H 5F1NB 3PL6C 1Q9KB 2QSVA 1E4JA 3WO3B 4S1RL 4IS6A 3PL6A 2I07B 2XFXA 4WGWB 4PJIF 3K81A 1VKXA 3UROR 5FGCB 4WEBL 4K8RD 1U8PB 4WTZG 4DK6A 1MCCA 3DX7B 1AO7E 3B9AA 1XF2B 1FHGA 3LHPH 4LPYA 3SKJL 4XP6L 5IF0B 4ESKA 3O3EB 5EBWB 4MB3A 4MVBC 4MJIE 1I9IL 5TE4L 1BVKA 2AW2A 3QUYA 2PYED 4LCYA 5L8LB 3VFPA 1GOHA 2BY0A 4TUKH 5FM8A 2EDLA 1KCRH 5T1LB 5EO1A 3NA4A 3WD5H 2IH1B 5JHLH 2V5MA 4QRPA 5EFIA 4FHBD 4U1LA 3VFNA 1RZJL 1WAAE 4GAFB 4MDJB 2NW3B 4HS8H 1YEDA 1FCGA 2XQBH 1AQKH 4P5MB 1A6UL 2V7NB 1ZK9A 3HAEG 4OZHF 3IXTA 4RFEB 3MRHA 2OJEB 1U8JA 2AV1B 5E6ID 4C4KO 2R0KH 2FWOA 4R2GD 1HKLL 4O2EB 5DMJB 1U8IB 2ESVA 3BVNB 5C09A 1PKQE 2V2XA 4NO0B 1ULVA 4AK1A 1SM3L 2ZUTA 1MCLA 5ESAA 2OSLB 1LK2A 2WP3O 4LHUG 2ADJA 5HI5C 2V2TB 4OSUL 2YHGA 1D6VH 5MEQA 1SYSB 1XH3A 2GI7A 4CMHC 4BZYA 5DK3A 1WK0A 1INDH 3ARDA 1MI5D 2UYLA 1KJ3L 4PJ7E 1VCAA 1KSRA 3WV0A 2DTSA 1NDMA 1WWWX 3N0PB 3QDME 3ZKMC 3MCLH 2AXJA 1DEEA 5C0RH 1W8NA 2CLVB 3GB7B 4HEME 3JWNC 4APQD 2HVJA 1DQQA 4N8VB 2BK8A 3EDJA 5B38B 3F62A 4GW5B 5E5RB 1QKZH 2A9ML 1MVUA 4NKMB 1CU4H 4WW1A 3GMLB 1UXWB 1J05A 5C6TH 3TYGH 3RWIA 4F7TA 5DJ0B 1CDIA 5IB4B 4YDJB 5ACMA 4K07A 4ZXBC 2R69L 1VENA 2CRZA 4PGJA 1K85A 2NY0D 5HVHB 4JB9H 1QUNA 5D8JL 5EUOA 3RX8A 1T21B 2WLYA 1MFDH 1MHCA 2ITCA 1IAIL 2FX7H 5HI4D 3D87B 1GGYA 1X5IA 2X5PA 4BZ2H 4M1DH 2AJZB 4Q6IB 4KMTH 2F5BH 3QAZB 4PJIB 4NQCE 4JLRB 4QXTB 1CTOA 2NY5L 5FYJH 4RMWA 3NFPA 2FJGA 4S1DD 4QEGA 1QFWH 1T66C 4NPYA 1U8NA 3QIWB 1QRNA 4PJEF 3HI5H 5FB8B 3CUPA 3EFDH 1A1MB 4O2CA 1J1OH 1TZHB 5HHQB 3GO1H 3GDBA 5IB1A 2FO4A 4K3DH 1N5YL 3WIHH 2HT3C 5AYUL 1MIML 5E4EB 1GRWA 1PZ5B 1J05B 3CX5K 4JFHE 7CGTA 2GJZA 2FIKA 12E8H 3S35X 4P3CL 5FA4B 1MCRA 3SN6N 2M1KA 3VXOA 4LRNL 4JDVB 1KTLB 3UJJL 4ETYA 3ALXA 4XAKD 2J12B 2O5YH 1G84A 4YDVB 2R1WB 4Q9RL 3U0PB 4HKJB 5DHXB 35C8L 2OTUB 1NGYA 2CQVA 2X4PB 4OFYA 1WBXA 1WITA 1CN4A 2BERA 2FZ3A 4U6XA 5D7IA 4HKBA 1B3JA 5DRWB 3MRCA 2E7HA 5CEZE 4OSUH 1NAMA 3PL6B 1D5XB 3QO1A 4DVBA 1RUKL 4MAYB 1QSFB 5BMFH 3E2HB 1BGXL 4XNXH 5DJDA 3LEYL 1J1PH 5CKGA 4I3SH 1E27B 1WTLA 3OV6A 5IKCB 2PNDA 1XF5A 5DUBA 4EUPG 1DUYB 2DQDL 4ODWB 1W0VA 2BNQE 5H2BB 3GK8H 3MCLL 3MJGX 4HHAA 4X8XA 1H3GA 1OAUL 3TN0B 4K2UH 5C3LD 1WBYB 2VZSA 5B39B 1LQSR 1I9RL 2OK0H 1JIBA 2OMBA 1HHJA 2R4SH 4L5FL 4Y5VC 3U0WL 4NQVB 4Q9BA 1ZANH 2XV6B 4OCSL 2BP3A 2KBGA 2YPLB 3C9NA 5ECJE 3VG9B 3TO4D 4DOHB 2VWEC 5JW4N 4OBRA 1JZ4A 4X6DA 3OJMB 3DUHA 4I5BA 1TCMA 3P9WB 3RVXC 2IQAB 3D9AL 3RA7L 1C1EL 4EQ3A 3UTPD 4BJLA 4XXDA 1BOYA 4N9GA 1GZPA 4MAYA 4GS7C 4OCYH 4JB9L 1ORSB 2DTMH 4XCFL 1NCCH 5IWLA 1M7IB 2HJLA 1DANT 2HKHL 1T04B 5LG1A 1WZMA 3S34L 4IHOA 3HC0B 3CVHB 4NCDA 5HI5D 4LVOB 5JIPA 1RZKH 3NCEB 4PJBB 5HHOA 5F97E 4R96B 3RNKA 4U0RB 5IVXA 2GIYA 3TNMB 4LPWA 1JGEA 2ZP0T 4F57L 3BDYL 3NCFB 3DXAE 3PWVB 5DJ2B 4Z7WB 5CP7B 1MLCB