3HZYB

Crystal structure of s73-2 antibody in complex with antigen kdo(2.4)kdo(2.4)kdo
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
226
structure length
219
Chain Sequence
EVKLVESGGGLVQPGGSLRLSCATSGFTFTDYYMSWVRQPPGKALKWLAFIRNKAKGYTTEYSASVKGRFTISRDNSQSFLYLQMNTLRAEDSATYYCARDINPGSDGYYDALDYWGQGTSVTVSRAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibodies raised against chlamydial lipopolysaccharide antigens reveal convergence in germline gene usage and differential epitope recognition
pubmed doi rcsb
molecule tags Immune system
molecule keywords S73-2 Fab (IgG1k) light chain
total genus 44
structure length 219
sequence length 226
ec nomenclature
pdb deposition date 2009-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hzyB01
2C7UA 2VL4A 5F7NC 4D9QE 1T1ZB 1BECA 2YC1A 5F9DC 3QDAA 2ARWA 2A6DA 4EDWH 2EDQA 3HLAB 4UB0H 3FB7A 4FQPA 5IJVB 4KQ3H 1P4BL 2KUTA 3VW3L 1E4XH 1JMZA 2V7HA 4DGYL 3MRLB 1MSPA 4C56B 4EVNA 1FIGH 1YY9D 2H2SC 4J2XA 1OOAA 1MCWM 3DMMA 4OZFB 3X3FH 1U8OB 1S5IL 3MNWB 5FXCH 1OSZB 4P46A 4XCEA 5J9PB 4JO2H 1PG7H 1AR2A 4WTZG 2GCYB 4PBWD 5EBMB 3VXOB 3KLAB 2PTUA 4DVRL 3BFOA 5F21B 4EI5A 2FR4A 4R4FH 4DKAA 3QUXA 4ZS7H 4TRPL 3C60D 4I9WD 4HXBH 3T4AB 5C07B 1XR8B 2H2PD 2W0LA 5CJ5A 2DLFH 3VFVB 1K8IB 4JQIL 4JRYD 4NWTH 4NQCB 2CXKA 3ECBB 4UIKL 1C5DB 4WGWB 1N5YH 3ZDXE 5FGBC 1A21A 2D0HA 2I24N 4MVBD 3EOYG 3X13B 4ETYA 4FQJH 2XA8H 3U6RB 1WV7T 3SGKA 4OCXH 2JK5A 5AYUH 5J11C 5MP6L 5B39G 3BT2L 2WLZA 2YSSA 5KS9B 3MO1A 1PKQA 1T0NB 2DIBA 4G8EB 3RX7A 3WFCL 2V5YA 1IAIH 4P3DA 1Z9LA 3KLSA 1CE6B 3GSNA 1D9KA 5K33A 3P4OA 1XF2A 3QUXC 1JGEB 2ENSA 4HIJB 4ZO9A 5GRYA 4P2QE 2QSVA 4YHML 4PLJC 5J11B 2ZUSA 3MZTA 4J4PD 2FBOJ 5MENA 2ICES 1XCQB 1ND0A 1QG3A 1J18A 2Q8BH 3ARGA 3B4NA 1AI1H 1FVEB 3RUGF 2A0LC 4RMUA 4ERSH 1CBVL 5AAMA 1KLGA 3OBAA 1DUYA 2P5WD 2BZDA 4X5WB 5ACMA 1KCKA 4PJEE 5INCB 3AM8C 4Z95L 2UZIL 5HYEA 3RWHB 4XHJC 3EO1B 3ZSTA 1PEZA 2EZ0C 4M5YH 4P0DA 5I76B 1NBYA 4L3CB 1N3NA 1QFWL 3QXTA 3NCYP 2DBLH 2FDBP 2VDLL 5SWSA 3VE0B 1LDPH 3LKOB 1JWMA 5L7XL 2HLFD 3LB6D 1WSST 1DL7H 4JO4H 4OKVA 3I6KB 4X99B 4M6NH 1U2HA 2MMXA 2EDWA 5BRZD 2CDFB 2XZCH 3KWWA 4LSVH 1P7QB 3X17A 1EVTC 2EDHA 2EDRA 2JB5H 5E00B 4D0DA 2XV6B 3KYNB 3CSBA 1GGBH 4YBQD 5MI0B 1U8NB 2IBBA 4KDTA 5ANME 3BPOC 3L5WB 3WEXB 1ODAA 2DD8L 4EOWH 2F53A 2HFFA 5F1NA 5LWYL 2VZ3A 2MOVA 4ZS6C 3B6SB 2R39A 2CLRB 3FOMA 4GW1B 4NQEB 3UEZA 1M7XA 1U9KA 1UM5L 2GKIA 3W82A 2JB6B 5DRXB 3PL6B 1YN6B 2XZAH 4PJIF 4WO4C 5ETUB 3ZYIA 2IAMC 4QXGH 1NPUA 1RU9L 3MJ9L 3VG0H 1WQVT 1SBSL 4IDLA 5F6IC 2YKLL 2NY1D 4JFQB 1QR4A 5CILH 3W9DA 3T0WA 5E8NA 2BC4B 2E7MA 2OL3L 1O7SA 1R5IA 3IJYA 2FHCA 2QR0B 3MLXL 5E5RB 1JRHL 5D7LD 5F88B 1BVKA 1WJ3A 5CKGA 1ED3B 5SWQA 5F9OH 4G80B 5C0IA 2BSSA 5HHMD 4OM1H 2DQJH 1A7PL 4MD5B 1G7JB 4BSWB 1H3PL 5DMGC 3LH2H 1KCSH 4NN6C 1CK0H 2P5ED 3IU3A 4MB3A 1KBGH 4PJEF 2BOCA 5CJQH 3SY0A 4P2RD 3S3SA 4MD4B 3ZTJG 4FG6C 1XIWB 4RQQA 5D70L 3TA3A 4L8SA 3QUMH 4IRJC 1MI5B 3KDMA 5FAAA 1FFPA 4JRYE 1GGCH 4OFPA 4D9RE 4ZXBA 3BH8A 5K9OA 3PQYE 2RFXA 5F7LB 4YZFE 4JPKH 5F1OB 2ZCHH 1Q0XH 4CRPA 5A2IH 2WANA 3VXQB 4XGZB 4HGKC 2E7LA 1BQHG 5MENB 4KV5E 5HHQB 1VA9A 2BHYA 1ND0B 2VDPH 5FV2A 5C6PB 2Y4SA 2DBJA 4Y88A 5FHBL 4G6FB 3IDYB 3SDCB 3D0VA 3VRJB 1CFTB 5E5MA 3QEHB 5I73C 1ZGLP 3HZVA 5F9JA 3GMLB 3WUZA 4KXZI 5KVGL 3A6CL 4W70A 1DBML 5CMAB 3QO1A 2V2TB 4JLRA 1ZA6A 2ERJC 2QADD 4ALAL 4LSUL 1WAAA 4HFWB 4X7EC 1Q9OA 4Y2DA 3OR7A 4ZG1A 4AG4H 2FX8H 4D2NA 1MIMH 4O2EA 2I9TB 5GS0C 5MI0C 3DRTA 5TJWK 1AXTL 4GS7B 2NTSP 3MXVL 1U58A 2V9RA 2DLTA 2MJWA 1QTYT 2DM2A 4OZHE 5E94B 3LN5A 2B5IB 2WP3T 1DE4A 5HHOA 4RMQA 4PJIB 2X4NA 4EXKA 5CAYB 3F7VB 1UJ3C 1GC1L 1GZPA 2VL5B 4KRPD 5EU3B 2XZQH 4OD3L 3VFMA 4KK5C 3D3VE 1OAXH 3AGVA 4NQXB 2AV7B 5E2TL 4UV7L 5J0BA 4N90D 4KQ3L 1I7RB 3GKWH 2ARJQ 3MCLH 1KACB 1L0QA 4MDIA 1ZVHA 5E2WH 4AENA 4U49A 2Q6WB 4NUJA 4P2QD 1ZANL 3QDMD 4J8RA 4YWGH 4U6XA 1KIPA 2AGJH 2COQA 5E99H 5C6TH 3RU8L 3OKNB 1Q9WB 4P2RB 4G9DB 3TCXA 3P9MB 3D0LA 3VFUA 4ZTPH 3AMKA 2Z91A 3S88H 2AEQL 5DJZA 1D5XB 1E4JA 2Q7YB 2BNRD 3O0RH 4WW2C 2QL1A 2R69L 5JQ6L 3AS3A 4HS8L 2R1XA 3V6OA 3QG6B 1CZ8L 5FYJH 5FUCC 3IF1B 5MHSE 3IU3B 4PJBE 1UZ8B 1KJVA 1KN4L 2CJUL 4M7KH 4O2FA 4LNRA 1JF5A 3IGAA 3DX7B 1YY9C 1JTTA 5ALBH 2DQUL 3TBSB 1A6ZB 1HIML 1KNOB 2BVEA 3V6ZA 1A6AA 2JB5L 3MTRA 4Z6AT 3QRGH 4Q6IC 3MRGB 3WO3B 3ARDC 2D7TL 3KYAA 3PNWA 4C56E 3A6BL 1YJDC 4OM0H 4A6YL 5F93C 1VHPA 3MPCA 3CXHJ 4QT5B 3ZE1F 4HW6A 2I07A 3DJ9A 4J3UA 5JXEA 2JCCE 4PRNB 4Y4FB 4TNWF 3UTSB 4LQFL 4I5BB 4FQIL 2PXYC 4IRJD 4JFEE 3LPFA 3MRFA 1FYTA 4LCIL 1S7XA 4K3EH 4QHLB 1A5FH 1FCCA 3SE9L 3BPNC 3ARDB 4YGAB 1BJ8A 5F6HI 2FEDD 1KYOJ 5E95B 5CZVL 5E5MB 3O4LD 3W0WB 1VESA 5I9QB 1L6ZA 5IQ7L 3MXWL 4Y5VB 3QUZD 5KVFL 1OSPH 4H1LH 4IMLA 4PJAE 2X4RB 2OSLA 4F37F 2ZUQB 3T3MF 4F57L 1HCFX 2C1OA 3H3KA 3W2DH 3MROA 2IALB 3MJGX 1LD9A 4GKOA 3RVVD 3TYGL 4HUWB 5FB8B 1LDPL 5D7KE 4DVBB 3X14A 4LRIA 4MDJB 2QEJA 5SWZD 1TPXC 1V3JA 5GS2H 3GBLA 4QTHB 2VWEE 3HLAA 3UYRH 5FO8B 4KTDH 1W0VB 1U8MB 3CCHA 2UZIH 2VDQL 4OLWL 5J3HC 2H8PA 1A6VH 1E6JH 1D3CA 2WBJA 3K4ZA 4D3CL 1C12A 1KULA 3LRHA 1ZA3A 5D72H 2PW1B 3ILPA 3MRBA 5JORA 12E8L 2BNQE 1BQUA 5I71B 5JOFB 2AJYH 4YEFA 1NSNH 5IG7B 1UWXK 4LCWD 5E2JA 5AD0B 2VC2H 2VLJE 3O4LB 4PGJA 2CMRH 1KFAL 1BM3L 3QUZA 2DLEA 2ADJA 1ERNA 1M6OA 1LNUA 2HLFC 1SBSH 4ODXB 2QQLH 5KOVC 1JHTB 2AI0H 1DJSA 3SE8H 3MNVA 1U42A 3EO9L 1EPFA 4JKPH 2P7TB 4JRYB 1C5DA 4NQTA 1KELH 3S5LB 5J6GB 3MV9D 3QUYA 1NGXB 1X7QA 2OTPA 3SDAD 1QPPA 1OCWL 2Y1VA 3VXUD 4H8WL 4JPVL 4NC0B 2ZUUA 3MRIB 2NNAA 1UKTA 2Z92A 5T3ZL 3SDXB 2BERA 1U91B 1K9TA 3C2SA 2YPKB 3P4OB 1QSZA 4K8RL 4DAGH 5DC4B 2X70B 2ITCA 2C7UB 4P59L 4PP2A 5EOCL 4JY4A 1GIGH 4WTZA 1X6LA 2O93L 1IZJA 3VMOA 4D0CA 1B4JH 1XGQB 4OLUH 3WS3A 2B1AL 1WFUA 2XZCL 1BFTA 1CTNA 1KCVL 4WIQA 4FXGB 4HGWA 1A4KB 4K3JH 4QRQB 3OPZH 1KJ2B 2EE2A 4L3AA 1CFVL 1QKZH 5DZOA 2PXYD 1MH5B 2G60L 3IFNH 4PJ8A 4P2YA 4O51B 1EHLH 3KNBA 4OZGB 3BZ4B 2G5BA 1F13A 3C6SB 4R2GD 2IAMB 3IETB 3MROB 3AXLA 1H15A 3CSYB 1OGAA 5IQ9B 2EH7L 3TEUA 2XA8L 5EU4B 3V7AG 2AXFA 4JM4L 4YDLB 2FNBA 2A6KA 2MFNA 4TUJA 4BKLB 1DANT 3AM8A 5I8OL 4X6FB 3F65A 4YBHA 1DUZB 1HILB 5FO8A 1T03H 1U8HA 2W9DH 1U8NA 4LEXL 4XCFL 1FNEA 1I7UB 4FP8H 3WEXA 1EXUB 4JRWA 2UWEF 4YHIB 3WJJA 2QQLL 1F8TH 4ZXBD 1J12A 4L8DA 1R5VA 4GAFB 2FX8L 3MQIA 2N7BA 1D5BA 2ICWB 5F8QC 3AY4A 3DROA 4HUMB 1VACB 5IB3A 1H3PH 4NGHL 5IBUG 1AGEB 1G6RA 3VFOA 3T2NL 4Z7VA 5T1LD 1R5WA 3T04D 2VZOA 3ARPA 4N1CA 5KAQF 4L3EA 2JELL 4P2QB 3HPJA 3QQNA 2VZ1A 5IEKA 1MOEA 3RAJL 4CMMA 4IMKC 1A2YA 4PREA 3G6JE 4BUHA 2XZQL 4OD3H 1IC4H 5C8JA 5T3ZH 4U1NB 1I8IB 4KWUA 1YMMB 4XBGB 3B9KD 1IARB 2UZXB 4Q6YA 4UT9H 1VGKA 1FSKC 5MEND 4N0YL 1XH3B 1INQA 1K6QL 3FB6B 1J0YA 1XGTB 2XTJB 3TYFA 5IVXF 3L3OA 4JAMA 4HLZG 3S35L 4GMTL 4MD4A 1K4DB 3RX8A 4JN2A 3RWHA 4GAGH 1MQKH 3G6DL 5GRJH 1JHKH 5J13C 1YEIH 3LRGA 5ACZA 4XNQA 5IMKB 3QNYB 1HINH 2EDYA 4X8XA 1EEQA 3N50A 1S5IH 2L4OA 2Z4QB 4UTBL 4KUZL 1CN4A 5HHNA 1U6AH 2NX5D 4LKXA 3ZTNL 2QBWA 3S3PA 3IKCA 4UILH 4PP2B 1KEMH 5HHQA 5FUZH 3A6BH 3QIWC 4GRLB 3N1MC 4PJ5A 4X9HA 3OKKA 1F4WL 1K8DB 3WXVL 3Q0HA 1C7SA 1A6WH 5L88H 1ZMYA 2NW2A 3SDYL 4HIXL 4UV4H 4NZDA 3H0TB 1QLFA 3E6FA 1AC0A 1LWRA 5ANMA 4R26H 1URLA 2J5LC 3WO4C 4PRBB 4UDUA 1T03L 3VGFA 2DM3A 3DX9B 1TVBB 1CS6A 5DJDB 1QSEA 3T1FB 3ZDZE 3B9EA 5L2JA 1GH7A 1YMHA 5E2TH 4JE4B 2HRLA 1DN0A 2AJVL 4WI5A 5DDHA 4L8SC 1TNMA 1NJ9B 5CJQL 4Y2OA 5H94A 2UY7A 5IB2B 1ED3A 3WKNA 2N1KA 2VXSH 3CZFA 2VLKB 5JPNA 4FTVD 3V7AE 3CJJA 1DUZA 3EYSH 2O26U 4R2GC 2VDNH 4H0IA 1UADC 1DQQA 1IEAB 3KG5A 1AGCB 4LPYA 3SO5A 2AABH 4NQXA 1A3LH 5LCVH 5KSBB 4L8DB 4DAGL 4J1UA 4FZ8H 1G7HB 3ABZA 2EECA 4F57H 4Y4KB 1U8LA 5E4EC 3TNMB 3AVEA 4TTDD 5JW3L 3TIEA 1A22B 2C3GA 4QXUL 4TNWK 1FH5L 5I1CL 4HKZB 4Q6IB 2PO6B 1VFAB 1RZGA 3M8OH 5DI8B 3OB0H 5EUKB 4KVCL 4F7CB 4QXTA 1AY1L 4X4ZA 2R56H 5I8EB 5E8DH 1AXIB 1FE8H 2EDNA 1YEJL 2P8MA 3G5VB 2XZZA 4KUZH 1H3GA 3QG6A 3WFEL 5EZJB 4PJ9A 2V5TA 4AH2A 1P2CA 3ORJA 3C5JB 3MFFA 5L9DL 4G8IB 2AEPH 2BVQB 1B88A 4G42B 2XG4A 4OLYH 3DVNB 3VFSA 3CFBA 4X9BA 4AY0A 4MNHA 4GUPA 3ZSSA 4KTEH 1ETZA 4PJCB 1P9MA 3CK0L 1JGUH 4NKDB 3VD3A 4HFWA 1BHGA 5LBSL 2P49B 2LABA 1MRCL 5I16B 2AI0L 1BVZA 2AJXL 5EU7C 4TVPD 4KZEL 3MRNA 3D25A 3RUGB 3U7YL 3H8NA 4JFFE 4JY6A 4YDKH 5KSAA 1U3YA 5FGRA 3TBTB 5KOMC 3UBXI 4DW2L 3QSKB 4S1QL 4TTDC 3TT3H 1A7NH 2FD6L 5D7LB 4XNMA 2X4NB 1QFPA 1Q9LB 3IAQA 2DQGH 4LSRL 1Q9KB 1NFIA 4U0RB 3KPQA 1AQKH 3CAFA 4JO1L 2NTFB 3MLPA 5EBLA 4P5TC 3ME0A 5EUOE 5HHVH 2J8UB 4KHTH 4KC3B 4TUOA 1LEGB 1BEYL 4LSQH 5GRUH 1CDHA 3AB0B 3O4OB 4RBPH 1FJ1A 4HH8A 3STBA 5GGRB 3S8WA 2FX9L 1WWBX 5DJYA 3FQTB 5HY9A 5ID1A 3BP6A 3UPCA 2FJFA 1OLZA 3QI9D 3DX8A 3V52L 1ZHLB 3S37L 3TN0A 3TO4B 1QSVA 5JHLL 5DJDA 5KVMC 3QZWB 1GGIH 3VFPA 3HC0A 3B5TA 5T1KD 4LHJB 5E08L 1YMHB 5FKPA 2G60H 3TVMC 4KKBC 3VXMA 4Q58C 4WDIB 2FZ3B 5EBWB 4ZO7A 2CK0H 4G6JH 1JV5B 4H88L 4X6CA 4HWBH 3DO7B 1SEQL 4PJFF 3L3IA 1KCVH 1OP3K 4JO2L 5D96C 1MCFA 4MS8C 1CL7L 4P2OA 4NZUH 3B83A 3X13A 4XP5L 4PJEB 4PJHB 3IAGC 2VLJB 2APBA 2VZSA 1D5ZB 4WUUA 3BW9A 4F9PA 1EBAA 3V6FB 2R4RH 4POZC 4RMWA 3CX2A 2BMKB 3R8QA 1YC7A 4ZUTB 1A3RH 2Z35B 2EH7H 4AT6A 1EHAA 4KFZC 1TJIL 1NDGB 1CQKA 3CFJA 3EYFA 1CE6A 1W72L 1F4WH 5KSUA 3MUHL 1DVFD 5D1XD 1BPVA 4JG0H 2H6PA 4UQ3B 4D0BA 3RWGB 5DEFB 5DHVA 2A6IB 4GMSH 3MX0A 4LF3A 2GK0B 5FK9A 4ZUVA 2X10A 4KRNA 2E8ZA 4XVTH 1IAOA 3VWKA 4IOFC 1QVOB 3O3BA 1PYWA 4WJ5A 2VLRA 5T33H 3GHBL 3I75A 1I1AC 2Q1EA 1CE1L 4NKMA 2M2DA 1OY3B 1YJDH 4G8IA 1IC7H 1YMMD 2FECL 3NFNA 4P57A 4Z0BH 4YAQA 1PG7X 1NANH 1D9KD 4Y5YB 1K5NB 3OJDA 4RFNC 1ETZB 3CDFA 3NCCB 3UTQA 8FABA 3MJ7B 3BYTA 4I18B 1BIHA 4Y16C 2GTWA 3IDMA 3LV3A 2WINA 1J10A 3LKOA 2W38A 4YIQA 1FGVL 5TE7H 1JGVL 5CLTA 3HG1B 3KAAA 5K93A 3HAEH 4P5KB 2DI9A 4N8VG 2XFXB 4LVHC 1REIA 3EYVA 1NC2D 5DSCB 4FZ8L 3ZMRA 4XMPL 2Z31B 4HWZA 5HDOA 3C09B 4RFNB 3MLUL 4XNMB 1L9NA 3V8CA 3ZDYE 4TULH 5HHPA 2EXYD 3JWDC 4KGJA 3LMJL 4LL9A 3N9GL 4BFIB 1AO7E 5B3JF 3T09A 1FO0H 5C3LD 4YBLB 1KCUL 2EEAA 4ESKA 2AVGA 5GXBB 4HWNA 4WUUD 3LHPL 3SDYH 4GW4B 3C6SA 4HBCH 3ZDZF 1TCMA 5FKAA 2ADJB 3C9NA 5D96B 3LRSB 4MCZB 4KHXH 4IHOA 3DLQR 5F88A 2OMNA 3QQ9C 5C0CD 1RIVL 4RWHA 1R3LA 1O7VA 5CP3A 4MSWA 2GQHA 1U8HB 4R0LC 1OAYH 1XGPB 4FQIH 3RHWF 3PGDA 1WIUA 3NCYS 2X4UB 1FSKB 1DLFH 4JFZL 1WBYB 4MJ2A 2XTJC 5L2KA 1XZ0B 3OAUL 4RQQB 3HMWL 5T1LA 1B0GB 1QFHA 4OFYA 3KDMB 2OP4L 2YPLE 1ES0A 4C55A 5DXWA 4WU7B 4F9LA 1INEH 5TDOA 1MY5A 4RGMB 3MCG1 2FL5B 5AUMB 3PUCA 2CGRL 3HKFA 3ZKXB 1ZHBA 4WI8A 4P9MH 4PTTB 3WN5A 2H6PB 3CLEH 5FGCB 1HQRB 1MELA 1NANI 4MCYA 1MLBA 4E0RA 4CMHC 1BLNB 5KANI 3F5WB 3AS0A 6FABL 2C1PA 1FV1A 5IV2A 3T65A 3HR5B 2H45A 5IB5B 5D2LF 3NCFB 1YQVH 2VERN 1JZ4A 4ACPA 1BD2B 3U83A 1U95B 4YE4L 1PBYA 4JDZA 4ZTPL 3Q6GH 4OBRA 5T3XL 1CFTA 3SGEH 3QA3A 4AJ0A 2ADFL 4RFEB 1BBJB 4JM4H 5AG8A 3V4PH 5E8PA 2R9HC 2PR4H 2GI7A 3RGHA 3SN6N 2G5BB 1C5CH 4JM2F 4V1DE 3VWJC 1FAIH 4HV8A 5IVNA 3AREC 2W65B 3NBNA 5D72L 4XP5H 4A6YA 2AJYL 2OJEB 5I15H 3VXPB 3V6BR 3K46A 3IDUA 4X7SH 2CIIA 1X5IA 4GT7A 3QFJD 5A16B 3VXNA 3NN8A 5GPRA 1EERB 1LO0L 1CWVA 4ONFL 3IDXH 4JFPB 3BI9X 3L1OL 5KVEL 1OF2A 4GRWE 2D9CA 3CK0H 1UEMA 2ZZUT 1H3TA 1HOCA 1IEHA 4ELMA 4N8CH 3SJVB 5E1AA 1WZ1H 3D39D 3UAJD 4XPFH 1U41A 3RPKA 4OD1L 5DMJB 4KHTL 1YN7A 2R1YB 5EBMA 5FYLL 3VXOA 2JCCA 1I9JL 1TVBA 3RBSA 4KI5E 4K7PY 1DBAL 5D1ZA 2BOBA 4U1JB 3BWAB 4ZO8A 3H9YA 4G9DA 4KXZH 3P30H 4W81A 3CC5A 3RVUD 2X1OA 5IQ7H 2V6HA 4APQA 3ESUF 5KANG 3VFVA 3LKSA 4UBDC 2XNAA 1Q0XL 3QXUA 5D1QD 3SBWC 4JM2B 5EDXA 3SKJH 3ARSA 3ZE1E 1I3VA 4XBPB 2DYPD 3V5DB 4KTYA 1KLUB 1MLCA 3ULUL 3EDKA 4LLMA 3PV7A 1DQQB 1IEAA 3QPXH 2PW2B 5EIIB 4PJBA 2VZUA 5HYJB 4OQTA 1ORQA 5CIPB 3LQMA 3ZL4H 4K9EL 1TJHL 1MFNA 1M7DA 5DUMH 5ACZB 5DJ6A 1HYSC 3UTPD 1DEEA 2F9BT 3R1GL 3H42H 4HCRA 1FGNL 4KK9C 3QYCA 4ZYKA 5FCSH 3IYLW 1H8NA 3NZHH 3ZTJH 4YHLH 2MQCA 1M7IB 3GMOA 4YDVB 1HQRA 1I8LC 3F12A 4WW2B 1ZLSL 5DO2D 2EH8H 4YNYB 2OTUA 5D1ZD 3HRPA 3CUPA 4UT6H 2C4FU 3UBXB 1CT8B 3B9DA 1TVHA 4JZNB 4QCIA 3OKKB 2IPTH 1DQML 3AFLA 1P4LA 3GBNL 3ULVC 5ITFB 4EUPH 4P2RE 4Z7NE 4MHHI 4NM4H 3D3VA 3DYMA 2X4OB 5KTEH 3WLWD 5I66A 4PYHA 4DCQB 2GT9A 4YHMH 5BO1L 4P4KA 3NA9L 2R29H 4H20L 1OB1B 1W0WB 2DQHH 5IK3A 3WMSA 1LO3L 3DX9A 4X7FC 4ZOCA 4JGJA 2JIXA 5CUSH 3HC4H 1G0XA 1HSBB 2WIMA 1VEPA 2Q7NA 3ISWA 2EIZA 4I48A 2J6EA 4HUVB 1UM6L 2DOCA 5DJ2B 1FN4B 2Q76B 5JIHA 4DOHB 3U79A 3BHBB 1DVFC 5CEZD 4XXCA 1G1CA 5A16A 1NDMB 1OGTB 5K59E 3TBWA 3PP4L 3O2DH 1NH6A 3TV3L 3OGCA 4TUKH 2NW3B 4H1LG 1YYMH 2FH6A 3L5IA 4KRPB 3IDGA 4KK8D 5CSGA 4P4RB 1H0DA 5DMKA 1I1FA 5I17A 2C9AA 1KB5H 4NNYA 2J8UA 4HHAB 3KPRB 4PRHA 3RVXC 5EZIH 3SKMB 4DKEL 4P59H 4LLWA 3SGKC 1CLYL 3NACH 1QP1A 5EU6D 3MACL 2VO5A 1T5WA 2DMCA 5E1AB 2PW1A 3ILPB 5JORB 1QA9B 4YUEL 1A1NA 4ZOEA 3CXHK 2C4FT 4U6TA 4M1CD 2B1AH 1RURL 1TETH 5C1MB 3LQAH 2AERT 3P73A 5CIPH 3SGJC 3W0WE 1HINL 3Q1SL 4WUKL 5LG1A 4CJ0A 5C09B 3VFGH 1MCRA 4DGVL 3VI3F 3DO7A 3SCMD 5TDPB 3C8KA 4PRDB 1NKRA 3JTTA 4GG6E 3FFCB 3CX5J 3QCUL 1V3LA 3VXSE 2LE9A 4LHUB 4WU5A 5ALCL 5MEOB 3BX7C 3PJSA 1OM3H 1W0YT 3HE7B 3M17A 5C71A 2I9LA 1E0OB 3CFBB 3RTQB 5A3ID 4WI9A 5FA4B 4X5XB 3KPSD 3TIDA 3VXTA 2YUWA 4FFYH 3DO3A 5HI3D 4KHXL 1N59B 3ZHLA 4DK3A 4K71B 4ZYKB 5C0FB 5JIKA 4XCYA 1YNLH 3SQOL 4YHOH 1BFVL 4BZYA 1I8KB 1UWXH 5DHVB 2E6PA 4WHTA 1NCWH 1FG2A 1XIWD 5K59F 3PDGA 3LDBB 1IRAY 3G6AB 2V2XB 2I60H 1XGQA 1VKXB 1NEUA 4G3YH 2YEZB 5JPMA 4M62H 4WTWA 4GKZA 4XNUL 1WEJH 4S2SB 3UTTE 1NBZB 3KS0H 1UJTA 3DVIA 1XGYH 3WNMA 4ELKA 5A1AA 4E41D 1T22A 3KJ4C 2FHFA 4IM8A 2Y06H 4XC1L 3HZVB 3QIBA 3ULVL 3MGTB 2XIDA 2JJTA 4KROD 4HWBL 1VFOA 5DYOA 4P2OC 4U1MB 2ZWLT 3MJ7A 1Q9OB 1G9MH 4PJDB 1J87A 2HKFL 2DM7A 2HJLB 2ED9A 3MYJB 4TSAL 1CR9H 1CDCA 4WHYH 5EU4A 2AEWA 1I3GL 3QCTL 1J0KA 5EBWA 4KI5C 5I1IL 1I7TB 2R0WL 2UYLA 5L6YH 4X6CB 3RHWK 1IKFL 1RK1B 1T7ZA 3HNTL 2EKSB 1CICD 3VFRB 5F1SA 4GO6B 3N1QC 3QRFM 3M8OL 4MXWL 1HDMB 5IJVA 2FJGA 2X1QA 3PWPE 4HEME 3L95A 1NLDL 4MD0A 1G6RH 1T0MB 5J4MA 2J4WH 3VFGL 4JKKA 2M8XA 1GGBL 3QJFB 4Y4HB 3SKMA 1N7ML 3WFEH 2HTKC 3RDTA 1FNLA 5JHDB 2VXQL 3O6FA 3VCLB 3QAZC 3CSPA 5EU6E 5IROC 3FCTA 4CVXB 1LO4L 1LGVA 3O3AB 2DQFB 5KSUB 3RGVA 4L4TE 1Z9MA 5IT2L 4KPHL 5MEQA 3PWNB 4H8WH 3CFKB 4KKCC 1JGLH 1WIPA 3QIUC 1U8IA 3PF2A 4CN4A 5HDBF 4WWID 4KKLC 5C0GA 1VGEL 3MUGA 1YEEH 3KXFA 4OD2B 1IQWH 3T3PF 4XXDB 4YC2B 4XAKE 5TDNA 1B2WL 3STZB 1PKQE 5GRZA 4XPGH 4MSWB 5F6IB 4FZEH 2IANA 1MWAH 2VKWA 3MREB 3FB6A 1RAMA 4QOKE 5IEHA 1S7VB 3GRWH 5E5UB 4HUXA 4OI9A 1JYVA 1QOKA 3U7AA 4JHBA 1X4ZA 3KLAA 1NUFA 3MNZB 4QRRA 1C8PA 3OAZH 3VA2C 2F74A 2YK1H 3E0GA 1N5AA 4RGNE 4R8WH 4U1HA 4P23B 3REVB 1A6AB 3S88L 1HK6A 8FABB 1TZGL 2GSGB 1GAFH 3RWJA 4X5XA 4EN3A 1N59A 2Z4QA 5F89B 4JRXB 2FYYA 1XGYL 1E6OH 4ZUSB 3JVGA 3D18B 3I3BA 3GSOB 3IFNL 3U48A 3PWLB 1OL0A 5E6IA 3GUTA 3ARRA 4PRNA 3O9WC 4NN5B 5CSZA 2IPKA 5D7SH 4E42A 1FG2B 4B41A 5F1KC 1P5UA 4CU8A 3TLRA 4XP1L 5KS9A 4UBDD 5KZCD 4XH2B 3WNNA 3QEQD 3K81A 1A4JB 5EA0H 35C8L 5IKCA 1KJ3L 3QDJB 1N6UA 1DUYB 1F4AA 1QLFB 1FGNH 4OZIE 4GXVH 1IE5A 4OQ1A 4I2XB 1YEHL 4ZOAA 1I3RB 1T2QH 2FWOA 3IS1X 1EO8H 2OI9C 4OZIA 1Y18A 3C60C 4EI5B 5ICXB 5LWYH 5L9DH 3RDTD 4ZO6A 3WNPA 5KSAC 1RULH 3PWVA 2W9EH 4UUJB 4YLQT 5I6XB 1J86A 4K9EC 1AKJB 1X5HA 1N6QH 4XPTL 4NWUL 3WL9A 1RZKL 1MFDH 2XZAL 1FZMA 5I8KL 4G9FB 3SDXF 1G9NL 3C6LC 4M7LH 4HCRL 4V2BA 5BZDA 5JLZB 5L8LB 5ISZB 1PGRB 1KEGH 1U8KA 2F54A 2OP4H 3IJSA 1W0VA 1F4YL 3WUWG 4EKXA 4YK4C 1T0MA 1MF2L 3WV0A 5C0EB 1KXQE 5GGRY 1E27A 4P9ML 2VQ1B 2CLRA 5E2UH 4GS7C 4OSUH 2A73B 4LCCC 1CQYA 1NBVL 1S8DB 5LGJB 1CICC 1F97A 5ETUA 2VLRD 5ADPH 5J1SC 3V0VB 4DQOL 4Z76A 4NC1E 4U1IA 1CK0L 5T5FH 1RK0A 3HG1D 4LCYA 5IJKA 4PP1C 4Q6IA 4WCYH 2X44D 3FO2A 1EIBA 4PTTA 15C8H 3WN5B 3GSVB 3PWNA 4U05A 2R2EB 4MCYB 4F37K 3GEWB 1RZ7L 4LAQL 3VRIB 4Q9CA 3UTTD 3KXFB 4OD2A 3QXAA 4HK3J 1I7ZA 4F15B 4TTGA 5H8DA 1GXEA 2P8MB 1FVDB 3G5VA 5C09E 1A9EB 1HYSD 3VXRB 5IOPB 2LAAA 4ODSH 4UNUA 4L4TA 2ADGA 4EDXB 3BN9D 3VH8B 2QQNL 2DIJA 4L29A 1VADA 4K7FB 2F8XC 2VITB 1DBJL 1CXEA 3SDDC 5E4EB 5EU6A 1T83C 4NJAH 1QSFA 2NR6C 4PTUB 4H5SA 4W4OA 4PG2A 1HXMB 1IM9D 2HT4D 4OV6F 1KT2A 4HV8B 3OKDB 2G5RA 2YPKA 1AGBB 3WLBB 4Z9KB 4MD5A 4S1SL 1JCKA 5BS0A 4QHNA 4XHJD 2HT2D 5FECA 2MWCA 3RRQA 5EFIA 4E42B 3BH9A 2OTUB 1I4FA 5EORH 3VXNB 5D93B 4U6VL 1ZGLA 4L3ED 4WI4A 3ROLB 2BCKB 1B6DA 4ZQKA 3T1WA 2H1PH 1MIML 2F54E 2NZIA 4FQ2L 3SDCD 4EZMA 1MJ7L 4JQXA 4TVSa 1INDH 4M8QA 3O2DA 4X6CF 6CGTA 4X6CE 1UB6B 4LCIH 1OP5H 4KPHH 4ZAKC 4HGWB 1W72B 2QLVB 1FJ1B 2R0ZL 4BYHA 1CGTA 1JVKA 5E4IA 3GHBH 4LMQI 4ERSL 5ID0A 2A83A 1A7NL 2FD6H 1E4XL 2R1YA 3TN0B 2W9LA 1OP9A 5ILTL 2PYED 3HC0B 4LCCA 4M7JH 4MNGE 1FPTL 1QNZL 4M5YL 2IADB 1N4XH 4LCUB 3VXMB 1RHFA 5E70A 2HRPL 3MLRL 1DQTA 5IB1B 1INEL 3WJLC 4MJIA 4PJ5E 3EJZD 1TXKA 2AJSH 2E6QA 5BW7C 2RGSA 4PJIA 4RAVB 1U8KB 5DURB 1EHXA 3OGCB 5JR1L 2R1WB 1UG9A 2ZJSH 3GMLA 1Z2KA 1DBBH 3DMMC 4N0CC 3RL1B 4QRUA 1JPSL 5D8JL 3WN5C 3KYOA 4PB9H 1F3RB 5HGDA 4M03A 1BX2B 1UACH 4W4NA 4FQJL 4U6XB 4RBPK 3G5YA 3OAZK 4OJFL 3R0NA 2X4PA 5MEPA 5E94A 2F58H 2NY1B 5HHOB 4HH9B 1B0RB 5EULV 2E9JA 4HLZH 5DJXB 1MVUB 1NL0L 1HHJB 1CU4L 3MBED 1OQOA 1IAOB 3VWKB 3E3QC 3OKOA 3ES6A 1BJ1H 2XY1A 3VD4A 1EFQA 3DOSA 3HAEG 1SY6H 1S9XB 1MCNA 4GBXD 5D1QC 2ITDB 5GGVL 1S9WB 4JHWH 2UVEA 2AXJA 2SEBB 4KQ4H 4WO4D 1IGYA 3SDAA 1MCQA 4JGMA 4MWFB 1J1XL 4NO0A 1JUFB 4QOKB 5DR5L 1AQKL 1YECL 1CGSL 2E7CA 3GSXB 2V2TA 3GRWL 4PFEA 2Z0BA 3T77B 3DX6B 1B0WA 3HC3H 1ZLWH 2NY2C 4NNPH 4N0RA 4DUVA 3C60A 1CE1H 4QHKI 3D85A 3FB8B 1WBXB 3OXSB 1I8KA 4GG6F 2XWBB 4Y4KD 1KUMA 3MJ6A 2K9UA 4HK0A 1RUAH 3GO1L 4I5BA 4Z7VF 1E4KC 3MCLL 4LNRB 1A0QL 3G6AA 2YUVA 1L9MA 4ONHA 2EIBA 3NZ8B 3LAFA 4JN1L 1H8OA 1VKXA 2XRAL 4FQXC 4Y89A 4YDIH 1JMXA 4NFDA 4WV1A 3VFMB 1TZIB 4R8WL 5FO7A 1CFSA 2FO1A 1AO7A 3MRGA 3BD5A 2FB4L 3K4DA 5DC0A 1LO5A 4HWEL 4LGSB 1T5WB 5E8DL 2DMBA 3ARBC 2ZSWB 3FZUD 4PBXA 3T0EA 1UWGH 5IFHL 5FUZL 4YDJA 1NLDH 4HPYH 4K3JL 4M7LT 4HG4J 1BBDH 3LS4L 1AE6H 5BQ7A 1CXIA 4CN1A 4RWYL 3HUJF 4P2RA 1OW0A 3D87B 4D9QD 2B0SH 4MAUH 5IB1A 3FQUB 3WFBH 3OG4B 1NJ9A 2IAND 4LIQH 4NQDD 2APTA 3P0YL 4WWKB 1T1YA 1LVEA 3QHFH 2EKSA 1S9KC 4ZUWA 3S36H 4NYLB 2WBWB 4M9PA 1BM3H 2Y07H 5IM7A 3MBEA 1IFHH 3CMOH 1QHOA 1GSMA 4ZSOB 4C4KO 1GRWA 5D2LE 5L2KB 1ZS8A 4JDVB 2X05A 1Z0NA 3HUJB 4RAUA 2NY5L 4HUNB 4PRIB 5SV3A 2DWDB 2VDOH 5D2NB 5F96H 3OSKA 3TIDB 2DQTH 5B4MC 5D71L 2D03L 2R8SH 4CNIB 1BFOB 5C0CE 4FQ2H 1KBGL 2V7NB 3CFEB 4OZHF 2R29L 4H20H 2AJ3B 2DTMH 3PWJB 3ULSA 3PP3K 2VAAB 1ZANH 4Y5XB 5DI8A 4O02L 3RWDB 1CGSH 4Z77B 2AGJL 2IQAA 2Q20A 1F2XK 2GW5A 1DQJA 4WEBL 3ARGD 3UYOD 3O9WB 4NN5C 1EFXD 5LJYH 4GG6A 2OR9H 1L4IA 2R0LH 3C5JA 3MFFB 1A9BA 2VSDA 3BXNB 4NP4H 1FL3A 1BIIA 2ZOLA 4QXWA 4TVPH 4JKLA 5D7SL 1F2QA 3W0WA 3DNKA 2W0FB 1WK0A 1UFUA 1Y6NR 3DBXA 1NBYB 4ELMF 5T3ZE 3R4DA 4WI2A 5C0DB 5F7KC 3QIBD 2I5YH 2OI9B 3TZVD 5AZ2H 3MV7D 3BGMA 5DRWB 1I8LA 1P4IH 1LK2A 3OF6A 4ZDHB 4Q7DA 1Z5LB 4H25A 1J0ZA 5DK0B 1G7LB 1DBMH 1S7QB 4UTBH 2V2WB 1DQDL 3QH3A 5J8OA 4LDOB 4ALAH 3EFFB 1MCJA 4XB8A 3LQAL 5J3HD 4GAYA 1BBDL 5IVZB 1H5BB 1PSKH 4HXBL 4ODHL 4NOBA 2V17H 4FQHA 4Z5RA 4BQ9A 9CGTA 4UILL 3P0VL 2BRRH 3OGOE 2NTFA 4TSCH 4FFZL 1OF2B 2HJFA 2YN3A 4MXVE 1LEGA 3QHFL 1NUDA 1ZHNA 2G75A 4PYGA 2CKNA 1NEZA 2CO6B 2NY3B 2OK0H 3QHZL 4JEGB 1EJOL 5EN2A 3DX8B 4NUGL 3WHE0 1SYVA 4M6OH 5I1HL 2O5XH 3QZWA 3SGDH 3V4UH 3RGVB 4OAWB 2B8OT 1JIBA 1U2CA 4LFHG 3WL9B 1P5VA 4B7LA 1SM3L 1E4WL 1JI1A 4W6WB 3Q5TA 4FQLH 3FJTA 2VABB 5C0BD 1N4XL 2HFGL 2HT3D 3MRJA 3UTPE 1MLCB 3LZFL 3ARWA 1L7IL 1VPOL 5CEXA 4Q9RH 1FFNA 4PJ8B 1U8QB 5DJ0B 1ORQB 5IP4A 3AROA 4NCC1 2DJ4A 3MNZA 4QRRB 4RGOH 4PGCB 4L8SB 3LEXA 5DFVD 1PX3A 1JNLH 4HS8H 3CDGB 2ICWA 5IMLA 3EHBC 2AXFB 1A1MA 3OZ9H 3WHE1 1CF8L 3HMXH 4JFYB 1NFDB 5B22A 2X9WA 2PN5A 5LAXB 2YPLB 1KN4H 2G2RA 4QEGA 3LEYL 5L0QC 2QQKH 5DEFA 3QEGH 1PQZA 2I27N 2RQ8A 1MCSA 4WW2A 2EIDA 1PZ5A 5TE6H 1D5IH 3SDDD 5GZNC 4NNXA 1CT8A 5CZKA 4MJ5B 1QKZL 4RMRA 2EDLA 4Y4FC 4JZNA 4PRIE 2YMXL 2DKUA 1FFQA 3H42L 4R7DB 2JJWA 4MYWB 2BJML 1WGOA 5CD3A 5DEZA 4YHLL 1Y0LA 5TE4L 2YPLD 4ZFOB 5L8JB 2WUCH 3P0YH 4UAOB 4G7VL 3NFSL 4CMMB 3ETBF 3MOBH 1FVCB 3MV9A 4NBZB 4QRPB 3JWNC 4PUBH 3QWRA 3W39A 2BNQA 4O2EB 2I9TA 3K74B 2GK2A 5C70A 5IVXE 2Y07L 5DJ2A 5AEAA 2VLLA 2QKIB 5M94B 4NQSA 2A6KB 1EK3A 3HMWH 3JV4A 4I18C 2OK0L 3LN5B 1CD8A 4OZHA 3L3OB 3JWDH 3WIHH 3FO1A 2WBJC 4U7SA 3KVQA 2BRQA 1RZIB 1P7KB 2BCKA 4HK3N 4W4OC 3FONB 5CS7A 3IJSB 3JV5A 5FYKL 1LO3H 5IVOA 3MRLA 1YNKL 3DRQB 4LSPH 5EUOF 2AJVH 3S4SB 2R23A 4BK4A 1N8ZB 3K4AA 2X4TB 2XT1B 4LLWB 2KL6A 5B38G 1KPUA 3K3QA 4GRWB 2EO1A 5I1JH 1AQDB 3UPRB 3L5XL 4Q0XH 5DWUH 4OCRH 2AEQH 4JHZA 4LCWE 5ID0B 2DRUA 5ENWB 4MJID 3UJTH 3CZJA 1EUUA 1EO7A 1CBVH 4Z7WB 5JDSA 1UH2A 4LNVA 1FZJB 5ADOL 3N9GH 3BMWA 3RA7L 4HJ0C 5HVFB 2B1HH 12E8H 4PJ8C 1K8IA 3BIAX 5C9KA 1S7SA 4JFEB 1FC1A 1HH6B 3N0PB 4LMQE 2V9TA 1HIMH 1YYLH 1GPOH 3FFCA 3L9RB 1VGKB 3LOWA 4KDTC 2MCG1 5IOPA 5SV4A 3LHPH 4YHYB 1IBGH 1FYTE 4UT6L 2VLME 4DVRH 3KJ6H 3MLZH 1T89C 5BMFL 4KJQC 5IHZB 1F58H 3B3IB 4X7SL 5KSBA 4XI5D 5F9WB 4N0UB 5H2BA 4DJMA 4LEXH 3MRCB 4JPIB 1AR1C 3B9KC 3UJIL 5ESAA 5KAQG 4NM4L 3RPIA 2Z8SA 2DQEH 2NLJA 5DGRA 2YPLA 4CVUA 3BRFA 3X3GH 5MEPB 2NY4D 4N68A 5AZEL 1RHHB 2BVPA 2F15A 1RZGB 4PBVC 5JOPE 2XN9B 2DQTL 5TF0A 3L6FB 1HHKA 1JF1A 2WUCL 4JREB 1RU9H 3MRKA 3T65B 2APWA 5GJTH 4ONGL 4PJ5B 1I9JH 1AXTH 1QBML 1UZ6E 3L3DB 3U0PB 3VXME 1U8LB 3NCEB 3FRPA 5E6YA 4LBEA 1KLFA 1U3HD 3A67H 4RNRB 3JTSA 4MQXC 1F4XH 4R7NB 4O5LL 3H0TA 4BH7B 3IU4H 3GO1H 4LVEA 1HE7A 1KN2L 3FN0L 1KF9B 3MLRH 5E8PB 5IFJA 2BSTA 2F54D 4KV5F 4WEUD 2MCPL 4YDIL 4Z7QF 1FVCA 3HAEA 3SKOB 4AZ8A 3T0BA 3Q5OA 5I16A 2BNQB 1RUPH 3THMH 3KR3L 1R6VA 3MGOA 3TBTA 2VDKL 3E8UH 2FJHA 4P5TB 1FG9C 4L9LA 5EUOB 1BQLH 3QIWB 2AXHA 4HDIA 4XP6H 1MFCH 5D7IF 3QIBC 4WWKD 3KPQB 1ZAGA 4OGYH 3NTCH 5A2FA 4XT1C 1UVQB 3S3JA 5HGBA 3D2UD 4GQ9H 4H88H 2KQMA 3NIFF 1HOCB 4M02A 4ODHH 1VEMA 4G43B 3VH8G 3RQ3A 1LQSR 5DGQA 3O6FB 1SMOA 4IOSD 5ECJE 1DQMH 4MMXC 2FATH 3VJ6A 4BZ1L 3I84A 1JI2A 5DHVH 1KJ3H 1FO0L 2AKRB 1VFAA 1P1ZB 4MX7B 1L0XA 2FZ3A 3I50L 2Z8WC 4HXAH 4NCC2 5C08B 3MUGB 4K3HA 4Y19D 3A0OA 5F96L 3S36X 2YWYA 5DR5H 4OUOA 3L3IB 4YHOL 3REWB 3R0MA 4X4YA 4AH2B 3O6MH 1H3VA 5CGYC 5J6GA 43C9A 1UM4H 1XEDA 5DVOA 3BEVA 4N9GB 1E28A 2FJFB 1JGDA 5HYJA 4BZ2L 5J12C 1X7QB 1A5FL 5I1HH 3T2PA 3MRCA 3O2WH 4JPIA 4W6XB 4E9LA 4D94A 4AT6B 5HYIA 4N5EC 5A2KH 3MUY1 3PQYA 4PLKD 4Z0XA 4RGOL 4PGZA 2P5EA 3CDYA 1ZT4A 4KJPC 1F4XL 3NCJL 1OLLA 2VISB 4KROC 2ICCA 1ZHKA 4OB5H 2R2HA 3L7FA 3EW3B 2YA1A 2EXWC 2JE8A 3GJFH 4P9HH 3NACL 3VGDA 3LZFH 3O6LL 1M05B 4LF3B 3BP7A 2DL2A 4ETQB 2VLJA 2E9BA 3T3ME 4X8JA 1Q9LA 3ULVD 4IOIA 3GSNL 1MNUH 4K7PH 5I18L 3P4NA 4HPYL 1LMKA 1RMFH 4JR9L 2ZCHL 2ZNXA 3GB7A 5CHNA 4EIGB 1G7PA 5HHOD 5TQ2L 4HKBA 1JHLL 1K5NA 3BP6B 1A1OA 1W0WA 3CFCL 5GRWA 1Y18B 1JJUA 4U31A 2ZKHH 1AGFB 1ITCA 3CLFL 1IKNC 5D2NE 3F7YA 2CJUH 3BGMB 4M7KL 1I1AA 2D2OA 5DHXB 3LD8C 2CLVA 3PL6D 3QUXD 5F7WC 1FZMB 1WWWX 1ZKAA 2VLMD 3TH3T 4OLXL 5EUOA 3UZEA 2YC1B 2I26N 3B2UC 3SOBH 1HILA 3L5HA 2P8LA 5J1AA 3WYRA 5IM7B 3JWOC 2ATPA 3RWEA 3R06B 3FN9A 2IH1A 1T0PB 2H32A 3FQNA 3FQXA 3W5MA 2NMSA 4EEEA 2JELH 3EDDA 5JIPA 1S8DA 4KH2A 5LGJA 1P7QD 2DWDA 4AENB 2AQ3A 2VDNL 5EN2B 3MV9E 1MHPH 4NKQB 5IFAL 4E5XB 1FORH 1QRNE 1EMTL 1LDSA 2FH8A 1YYML 3HZYA 4AEIL 1EGJA 1IL1A 5GQBA 1MJJA 3LRSA 2DDQH 2NY0C 5DT1H 2OXHA 2PO6C 3V5HA 4M61B 4EQ3A 1LO2H 1T20A 3OZ9L 1UA6L 3ZE2F 5GS1B 3TT1L 3WHXB 1XH3A 1JPTL 1CIUA 5T5FL 3EDFA 5ESVB 2EC9T 2NXYC 4IDJH 3M1BB 1CLOL 1X3DA 4GSDH 2GJ6B 4S0SD 2WM0A 4YX2H 2ICWI 5DJCB 2PTTB 4HIEA 4ZS6D 4XX1G 3ZTNH 5FKAB 4MNQE 3QPXL 3HE6B 1A1MB 1MNUL 3PDOA 4K7PL 5I18H 1XR8A 2APVA 4JQIH 2GTWB 3IDMB 4OCSL 4P3DB 4FMKA 4XMLH 2UZYB 2ARJB 5KVGH 3MC0A 5FCUL 2J6EH 4P5KA 3QFDA 4M93C 4ZXBC 2YD4A 4F15C 1BWMA 3UTSA 1IKNA 3EFFA 1FV1B 5IV2B 1XCTA 4K71C 4UQ2A 1ZGLB 1JFQH 5BOPA 3GMQA 3MV8B 5HDLA 4J3OC 3ARFC 2HKHL 4IRZL 4ZQKB 3H2WA 1RZKH 1NUGA 4XC3L 3VD9A 2A77L 1NAML 4I0CC 1ZOXA 3HZKA 5DMGD 1Q0YL 3CPLB 4MA8L 2GSIB 3VGHA 2FIKA 1MRDH 1OW0C 1QLRA 4OM1L 4JKPL 4JHAL 4HIJA 1JBJA 5HHOE 2A83B 1LO0H 1UCTA 4KAQH 3ARFB 4XWOD 4FXLA 4S1DC 3VGEA 3FN0H 3NCMA 4XPHH 2W59A 1OAKH 3C9NB 2XWJA 1INDL 4Y8DC 4A6YB 4RFOH 4AMKL 3KWWB 5FM5O 1NGQH 5DDHB 4CU6A 3MLVH 3TBYB 5LCVL 1JZ5A 4I77L 3RIFK 5CCKL 1S9VA 3S37H 1R3LB 4C4KT 1BAFH 3EYOA 4RGNC 1FNSL 1DFBL 3R06A 4PRHD 1ZSDA 2O61A 3MLUH 1XR9A 1KSRA 4ZUUB 2GAZB 3CDGA 3ARFD 3T4YB 3MRPA 4P3CL 4UTAL 3GI8H 1OD7A 1U3JA 2CKBH 4KRPC 5DD6A 1HQ4B 3D5OF 4KJYB 2VB5A 1PZ5B 3L5WA 4ZTOH 4UNVA 3OJVC 2R15A 2EC8A 3C6LA 4XVJL 4F7CA 3LKSB 3NTCL 5I8CA 1LP9B 1ZVYA 2ADFH 4NRYA 4F3FA 3MBXL 1UM5H 3VWJA 2PXYA 4BQCA 1JL8A 2JLLA 2AK4B 4OLVL 4PJ9B 5DQJA 4P5MA 2DLFL 3DI3B 3QNXB 4YBQC 3QUYB 4QRRE 1WZMA 2ZNWA 4N8VB 1YN7B 5HVHB 3EDJA 5HD8D 3MLYH 1FNAA 4X98A 1BBJA 3KLDA 1NCCL 2BOBB 4U1JA 1KEGL 5HI4C 4PP1D 4KMTH 2VSCA 4XC3H 3SBWA 1DLFL 4YHNA 1OARH 32C2B 3BKYH 1L7TL 2BSSB 5DQ9A 3IU4L 4YHKL 5DD1H 1YPZA 1QBLH 3N1PC 1PEWA 4JANB 5D2LA 5E6IB 3U2SA 3GUTB 3O6ML 3GMMA 5CP7B 2OTWA 1AIFB 5CWSA 3PWPB 1T4KA 5DK2B 4QHUB 1GGCL 1WVZA 5C3TA 5T1DH 1CGYA 1G1YA 1MWAA 2GTZA 2VXSL 2P24B 1AO7D 3JTSB 1JZ2A 2I60L 2X4TA 5E7FA 1BJMA 2UWEB 2B20A 1J7VR 3D69A 4I3RH 2DDQL 3S98A 3TH4T 5K9JL 2C3XA 2BVUA 3RDTC 3T0EB 3STLB 3MV7B 4C83B 3F12B 4N0YH 2DQIL 1TZHB 2C4XA 3N1GC 5J89A 3DXAE 3HAEB 3SKOA 1NUNB 3TPKA 2EZ0D 5H35B 3Q3GB 4AIOA 1JZ7A 1IM9A 5EA0L 1K4CB 3CC5B 2HTLD 1P84K 1FNGB 2ESVB 3HMXL 4R6UA 4TUJB 3QPQC 3OV6A 1RZJC 1J05A 4WWKA 2EXWD 1KFAH 3DSFL 3WD5L 1IGTB 2HG5B 1YEFH 3UTZB 5BS0E 3IXTB 1CU4H 2IBGA 1FNEB 5ISZE 1NC4B 2OMBA 2EEBA 1KB5B 1QYGH 1T2XA 1JWSA 2W91A 1MREH 3DV4A 3HNVH 3QDJE 3CLFH 1I7RA 5HGAB 4IOFD 3KPPB 3HN3A 3ZLQC 3FTGB 4FXKA 4WFFD 5ALCH 1RK0B 5FOBA 5TE4H 1R5WB 2FLRT 3RWGA 2NW3A 1MF2H 1Q0YH 3L6FA 4R26L 2XACC 3RWDA 1C5BH 4ZUVB 1WTLA 2Z93B 1PYWB 2MSPA 5FGBA 3QNZA 2OZ4A 3PL6C 4NUGH 4K8RH 1SJEA 4F33A 4PRDA 5BCAA 3REWA 2CK2A 5FYKE 3NIFE 1XFPA 1XT5A 2BY1A 2IMNA 4XCNB 4GH7B 1OTSC 5EO9B 3UDWC 1E28B 5HYSA 1VADB 4K7FA 3Q5YA 4JN1H 1G0YR 4OF3A 5JIIA 1JPTH 4PJXA 1G9NC 1SYSB 2DM4A 3QUXB 4G5ZH 4WFHE 1T1XB 3GK8H 5F7MC 1T3FB 4HS6B 3GGWA 4MNQB 2YS4A 3MGOB 3E6HB 1KGCD 3S35H 4OZGF 5MEOA 4ETQA 4ISVA 1JE6A 3I6LD 4IDJL 4G7YH 4X8JB 3RIAK 1GHFL 2J1KA 2MPAH 4YO0A 2VC2L 3RA7H 2HLAA 5I8OH 1NMBH 4WVRA 1WBZB 5E9DD 3LSOB 3MR9B 2ZUWA 5F3HB 3E6FB 4DOHE 3MV7E 1AFVL 4FQ1L 4HKBB 1KTLB 4XCFH 1MEXH 3CD4A 4MQXD 3HNSH 3MGTA 3BPNB 4N8PA 4G8GE 5J7CC 2GCYA 5IW3A 3VDCA 4PY8I 2VXUL 4NO0D 3VG9C 5AWNL 3L1OH 1WFOA 3F58L 3ARVA 3F7YB 4JQVC 1IM3B 3FB5B 4LCUA 4Y5VC 5FB8A 1NCNA 5AYUL 4XPHL 2VLKA 4C54A 3BGFC 1PDKA 1TQCC 2HG5A 3OX8B 4LLAA 5FGCE 4LRIC 5T1KB 5CEXB 2ATPB 4FFYL 3IFPB 1MY7A 4XPAL 4M7JL 1OTTD 5T33L 4PGCA 2BY3A 3VW3H 4JFXA 1MHEA 3DPBA 2CKBA 3MZGB 4LPWA 1O0VA 1S5HB 2Y5TA 5HYJD 1B4JL 3BEWA 4MAYB 5CBAA 4WU7A 3H7BB 1ZT7A 2P5EB 5E00A 3GSWA 3LN9A 1F6AB 3K1DA 3GSNH 3LQZA 5D5MF 3FT4A 4MA7H 5I1KH 4XVUC 3QXDA 4YUEH 2RHEA 1VEOA 5E8OB 2RAMA 4O2CB 1CFVH 5GIRB 2Q8AH 3NFPA 2APFA 2ZOKA 4RX4D 3SGEI 5C2UB 1A3LL 4QNPF 3QDME 5CZXD 2CPCA 1R24B 3TWCH 3BZFA 2V2XA 3MNVB 4OCSH 1MCPH 4PRPD 1U6AL 3KYMA 1GGIL 2YEZA 3AS1A 5CJOH 5C7XH 1DBKL 4F9LC 3TO2A 1RUQL 2EYSB 5B39A 2BRRL 5MEQB 3J7HA 4XZUA 2E7BA 3DVGB 3HNTH 4HKXB 1X5JA 2E5EA 2GITA 2HJLA 2F53E 3MBXH 4GAJH 2AQ1A 3ARGC 3BE1L 4WHDA 1I7TA 2CLVB 2KZ1B 3C6LD 3NA9H 3ALWA 3TH2T 4URTB 5BV7H 3QI9A 1TQBB 2MKWA 2CDGA 2OQJA 2D03H 2R8SL 1BFVH 3T0EE 3V5KA 5HYQA 4X6DB 2F74B 5HYSG 1MI5A 5I1AB 5F7HA 4P23A 5JXED 3CPLA 2NXZC 4TYUA 4GW1A 4NQEA 5C0NC 1A4KA 4I77H 1A7OH 1V05A 1IZKA 1T7VA 4U3HA 5DRXA 1I75A 3L5JA 4PJFE 3QUMB 5CEZL 2AV1A 3BP4A 3WIHL 3D39B 1WAAE 4DWHA 1T1WB 3O3AA 3WFHB 2DQGL 4LSRH 5EC1A 5SX4I 5BQ7B 3UYPA 3ULUH 3ARBB 4WFEE 4FTVB 5GRJL 3GKWL 5B8CA 1Q8MA 3QCVL 2NXZB 4HKJB 5ILTH 1BD2E 3TCLA 4K9EH 1BEYH 2X4SB 4LSQL 5GRUL 2BNUB 2MCPH 4L4VB 3E1F1 2F8OA 4OGAD 1QEWA 5T1KA 1UWGL 5IFHH 4I2XA 4RX4A 4XAKD 3MBEB 4F7MA 1X44A 5CINL 1MCEA 4Y4HC 4ZNEE 2N56A 5GISL 3E8UL 4K94C 5JR1H 1J0IA 1XIWA 3TWCL 4YFEA 4XPBL 5B4MD 2K1MA 1F11A 4GRMB 1VACA 5IB3B 4HC1L 3CH1B 4BKLA 3PGFL 1HWHB 2VDPL 3ILQD 4MMZC 3ZYZA 1ZGLM 4JGUA 2QSTA 3TVMB 4PJHE 2AJZA 4M00A 1CXLA 2YD8A 2F5BL 5C0CB 1CCZA 3S34L 3NFPB 4QWWC 1GZPB 2VL5A 5EU3A 4M8VA 1A2YB 1FLTX 3LKQA 4NFCA 3CUPB 4UMGA 5J1TC 2CMRL 1G7QA 2ED8A 1ZLUK 5C8JB 4ZFZA 3BZFB 5C0AB 3AY4C 1OQXA 5CFHA 3LDBC 5DJAA 4NN6B 2D7NA 1U3HA 4LSUH 2ZSVB 1EUTA 3L3GA 4S1SH 1LP9F 2A74A 3QUKA 2ESVD 2E6JA 3G5XB 4G8FB 3X11A 3SKNA 4ZAKD 3EO9H 4U1IB 1BIIB 2ZOLB 2C3VA 4YAQB 5FO9B 2X09A 1MCOH 1Z6JT 2FWOB 1BQHB 3RZCB 3UO1L 1LK3L 5HPMB 1J8HD 1FFOB 4YHNB 2EYTB 5J6HB 1KT2B 2J8UE 4OV5A 1FDLL 5D70H 2EIZB 3L5XH 1JWUA 1FL6A 1YECH 4IS6A 1UXWB 1YMMA 4BA8A 4NC1C 3EO0A 3L3JA 3QDHA 1P9MC 4H25B 4N0UE 5FYLH 3BKML 4NBXB 4P46D 1JK8B 5FM4A 5K9KB 4QLRA 4MNGA 3UC0H 1IGCH 5KBNC 4MXQD 2DQDH 4XP9L 4JAMB 4OIIH 3PWPA 1H5BA 4U7MA 1DLHA 3E2HB 3TBSA 4HFUH 1UVQA 5HGBB 4G7YL 4XMKH 1MAKA 3O8XB 4PRHB 3BPOB 4JG1L 5E1HB 3IT8D 4QWWD 5C0AD 1Z9SA 1EEYA 3BDYL 2HTLC 5DZNA 4PJCE 1FL5B 2YD6A 5F71A 4LKXB 4ZAKA 4QT5A 4Z76B 2ZJSL 5FECB 1I4FB 4XP6L 5DD6B 3GSVA 3RUGE 2J5LB 2ORBL 3SKUD 2EDFA 2Y7QA 1RJCA 2IADA 4UOW1 5C07A 3GSQB 2Z91B 4O9HL 1ZTXL 2HJKB 1NEZG 4DZBB 5T3XE 2B4CL 5C08A 4LK4A 2J8OA 4PJDF 1NGYA 3DXAB 3ECBA 1AKJD 5E24E 4IBLT 3VXRA 4PUBL 3MJ8B 4EUPB 3ARQA 3VH8A 1NC4A 3RI5K 5C86A 5I71C 5I1LB 2ZCLL 4L4VD 1SJXA 2L0DA 1P6FA 2HT4C 3KPLB 4RGND 2NY1C 1U3HC 4ORGA 4U33A 5EBGA 3U1SL 2RB8A 4G8EA 4XPAH 2HMIC 4QRPE 1PW3A 3AUVA 1UWEH 2VQTA 5BW7A 1AHWA 2O5ZL 1AXSA 1NFDA 5KVEH 4OSUL 3QDMA 4LLUA 3X14B 3KYKH 4DN3L 3PABA 4K3EL 5KZCB 2YUZA 5DQ9B 1B0RA 1MCDA 2R4SH 4KVNH 4UOW0 2PO6A 3MA7A 3C5SA 4LEOB 1H8SA 1WZ1L 3UAJC 2VR5A 5CP7A 4LASH 4TPRL 3TVMD 2X1WL 1XCQA 3HR5A 5EG6C 4OZ4B 2K7PA 4JPKL 4N0FA 4QHUA 5LGKA 4LAQH 1KIRA 1D6EB 4U4BA 1FVEA 2FECI 5GGSY 5SX4H 3OXRB 3G5XA 4G8FA 4M3JA 3SQBA 2R69H 3SDDB 5GGVY 1CGXA 4I13B 4TSAH 3IXAA 2VDRL 3B9KA 1TCRB 4IMLB 4NQDE 1N3NB 2PUQT 4G6KH 1NFDE 4M48L 1IBGL 2EYTA 1IMHC 1MJ8L 2APXA 3U0TA 4QRPA 4RCAA 5F6HJ 5JOPD 1UXWA 2VUYA 3I6KA 2QKIA 5E2VH 5KSAB 1NC2A 3JV4B 2J8UF 2XWBA 4UDTA 1RVFH 3FOLA 5HHME 4XBEL 2GYSA 2NQCA 4U6YA 3HZMA 5ACLA 4BFGA 3KYNA 4ZS7L 1Z0MA 4GAJL 3I6GB 1XF4A 4AG4L 3UTZA 3NZ8A 3RWFA 2P8LB 4PD4J 4YR6A 4G7VH 4HULB 1G9MC 2V5SA 1DQDH 2X9YA 2FIRT 3H9SB 2AAVA 3S4SA 1ZT1A 1F4HA 2Z92B 3MRDB 1FBIL 4XVTL 4RRPG 5D6DA 3P0VH 5DRZB 1F02I 2J7LA 4S1QH 3VFTB 5LXGL 4FXKB 4OKDA 4HIXH 3INUL 4KY1L 1ZHLA 4ENED 3OAUH 5D9SB 1FO0A 3P9LA 4YQXL 1MJJB 5DJXA 2DJUA 3AS2A 1I8MA 2QR0A 1EX0A 3ARUA 5C6WH 2LQRA 2XI9A 2R0KL 4PRID 3DV6A 5DUBA 1OAZH 1NCDL 5FYJU 1QNZH 3ES6B 2CRMA 2PO6D 5GS1A 1WF5A 1S9XA 4BSWA 1FFRA 3S5LA 1MH5A 2XKNB 3U36A 1D6VL 5JHLH 5EIIA 1Q1JL 1YC8A 4YDJB 2PF6A 5J06A 3ULUD 4JJ5B 5DT1L 4PJXB 3O3DB 2YXMA 4KDVA 3REVA 4TUKL 3BUYB 3FQWB 1TDQA 2AABL 4JR9H 4QRSA 3H7BA 1GOHA 1DFBH 3GKZA 3RZWA 1CL7H 2V7NA 4TVPL 4Y4HD 2DWEA 5HSFA 3C5SB 1NSNL 5GIRA 3UTSD 4YJZL 3EJYD 2DQUH 1UENA 3EOBB 4H1LA 4OF8A 1F00I 5IIEA 1MEXL 3U30B 5I15L 4ODWB 4QO1A 2OZ4H 3ZHDA 3EKCA 3HZKB 4N90E 3N1FC 3QDJA 5FIEA 3TA3C 1OAUL 4OQTL 1A9BB 3BXNA 3RVTD 1F42A 3TO2B 4V2CB 1VFBA 4HF5L 2X89A 1QZ1A 1WC7B 2DD8H 4EOWL 5E9DA 3HPJB 4NRXB 1GGUA 1DQLH 1RZ8A 3KNBB 3FO9A 2GK0A 5FK9B 2JIXB 1FYTD 2EDOA 5C0BE 1MHCB 2D0FA 3CVHA 4TQEL 5TGBA 2IBZX 5ESQB 4RZCA 4Y16A 3EOTL 3FT3A 4DGIH 4RDQG 1G0DA 3I75B 4XRCA 5JW5B 5DK0A 5F72S 1NFKA 2VTFA 2CQVA 3MXWH 3DECA 5LXGH 5F7DA 1Q94B 2XQYK 1DE4B 5DURD 4L1HA 2OL3H 1T7YA 3OKLA 4MVBC 1LEIB 3DUUB 2OLDA 4L4TD 3ELAT 4FQHB 4Z5RB 4GW5A 4QTIH 1T7WA 1YEEL 3LPWA 1JNHB 3U4BH 2HRPH 5IGXH 1GIGL 1BVLA 5GRXG 1E27B 3B5GA 3DMMB 4BQBA 2ZG1A 1FIGL 3QO0A 5DS8B 5D7JA 3RAJH 3O3EA 4ODVH 1HKLH 5C9JA 2A9NH 1A1NB 3UBXG 4IRJA 3BOVA 1QQDB 4DN4H 1TJHH 1MFCL 2XN9E 3GI9H 3EOAB 1S7UB 3EIFA 3LN4A 5E8OA 4OT1L 4KJYA 1XGUB 2WUBH 4MCZA 1RZFH 1JHLH 2VR4A 3P4MB 1LP9A 5FF6B 2DYPA 3FFCD 4LDEB 4RWYH 1X5LA 2VABA 3MACH 3WJJC 3CFDA 3O41A 1G9ML 4GRLD 4MHHG 1XGRB 5I1CH 1JNNL 4X6BA 5FYLD 3G6JB 3PGDB 3D85D 4HZLA 4N9GA 2QADB 2CKBL 3OG6B 4JZJA 2XICA 1NGZA 4LHQB 1FE8L 1WWAX 2IG2H 7CGTA 2ADIA 4M3KB 1IFHL 4E41E 4XVJH 4XNQB 1SY6L 3O45B 1ES0B 1V3KA 3ZKNC 3S5LG 4IHOB 4F7PA 4ZODA 1IAIL 1T5XB 2Y72A 1BZQK 4OQTH 4HWUA 1YEHH 4F7TB 2ZP0T 3U30C 5KJRH 4XAWH 2I07B 5A40E 3HB3D 3GMMB 3UX9B 4HQQH 3MMEA 5EU5B 1BOYA 5FHAH 1FYTB 43CAB 5IIEB 2DTML 4XXCC 5C0AA 4IRSD 4M7ZB 3KPNA 2HMID 1S7XB 1NGQL 1H3WM 4KZEH 1KPRA 5FA3B 4M1GL 1MWAB 2GTZB 4LASL 4TPRH 1RUMH 3S97C 4GKNB 4WEBH 4R90L 1U95A 5B8CC 3ZKQD 4JO3L 5JXAH 2LU4A 1XMWA 2FL5A 2O5ZH 5FUCE 2ILLA 4HPOH 2CUMA 3KYKL 3EO1A 1WLHA 4WY7H 1SM3H 3LY6A 4L9DA 2BSRA 4TN9A 4RDQF 4XPGL 2DTSA 2X4RA 3FO9B 1FFOA 4Y1AB 4NIKB 2GJZB 3GJFB 1FL6B 4IS6B 2NY6B 1LD9B 3O11A 4FQQA 1K4CA 3V7MA 1PG7L 3L3JB 5B8CB 5EZJA 2CO7B 1EEZB 2WQ8A 1SY6A 4R7DA 3WSQL 1S78C 4MDJA 3R1GH 4L4VA 1ZV5A 4QF1B 4HMEA 5JTWA 4F7EB 4XMLL 1UACL 2J6EL 4ODBD 3D2UA 1JWSB 2VLKE 5JQHC 5F7YC 2Q87A 3NH7L 4Z78B 4OLVH 1HXYB 3IVKA 1PY4A 3QEGL 3RDTB 1L0YA 3T0EC 3H9SE 3MRNB 4X99A 1YN6A 1ZK9A 4G6ML 4PRPA 2BVYA 3L7EB 5C9JB 2BVOB 1AY1H 5BV7B 1EH9A 3MLYL 1FBIH 4PLJD 1YQ2A 2JCCB 3QJHB 4KK8C 4M4RA 5D2NC 1A47A 1F6LL 4R4BA 3FFDB 3BWAA 1U92A 3OHXB 1MJUH 5I1DB 3BISA 4KGLA 5JDSB 3MRQB 1KJMA 3MLTB 5T1MA 1ROWA 4JFDE 4YH6A 3NA4A 1KTRL 4DKFL 1T20B 3K1KC 5IF0A 2LAGB 2A1WL 4XXDA 4APQC 4ELMB 3V5DA 3TZVA 4TSBH 1W2KT 2E9WA 3UPRA 4NOFA 1NCWL 4JFOA 3MOBL 5EO0B 1ZLVH 5ID1B 1PAMA 1FAKT 3JXAA 4K23L 4XNYH 5ISZD 4R3SA 1BMGA 1MVFA 4PRAA 2VE6A 4LSDA 3OKYA 5HHXL 5IWLC 3CX5K 3PP3H 4XP9H 3SDXA 1AHWB 1LHZA 3BPLB 3DVFA 4LLUB 3DSNA 1HH6A 4GOSA 1NAMB 4NQSB 4OF5A 2EDDA 5FUOH 3WLWC 1IC5H 4HGMA 2YPVH 4HK0B 5E2WL 3EYQD 4G6AC 4I3SH 4X0KA 2H26B 2XTJE 1YUHA 4HMCA 3LEYH 1P7KA 4YO0B 1X4XA 3F7PC 3TJHD 5ESAB 4LBEB 3KPRE 4LVOC 1AO7B 1PD6A 5TFSL 4GLRH 3MV8D 1EEYB 3HPLA 2WNGA 1KPUB 3IXAB 2B0SL 1KCLA 4QRPD 1NGWA 4JCMA 1YEDA 4P4KB 3PGCB 1Z9OA 5DVKA 4OUUB 1TCRA 4AQOA 4HIIA 1HNFA 3DWTA 3QCUH 4FFZH 3KPOA 1NKOA 3MRKB 3W9EB 3OJ2C 1CVSC 2C5DC 4GBXC 4J4PC 5IQ9A 2VLRB 4QXGL 2VH5L 3BHBA 2HYMA 5ALBL 2HJKA 3KPSE 1A3QA 4KRLB 4LU5H 3S7GA 2YBRB 1AD9A 2RBLA 4P4KC 3NFNB 3D0VB 4N5UA 3VRJA 3I6GA 1A3RL 3OX8A 5F9JB 1I9IH 1V7ML 4LLYB 3BUTA 4LPTA 3KGRA 4PJ7B 2VYRE 1FRGH 4RISL 3GSUA 2Q86B 3U9PL 1CI5A 3UTQB 3I3DA 1ZA6B 4G8GD 2E8YA 4WUUB 3JZ7A 4Q97A 4I18A 2VQUA 4JFFA 3BZDA 1CDUA 1QR1B 5BXFA 4NWUH 4DEPC 1OT2A 3IDXL 3I2CH 1P7HL 1XF1A 1S5HA 2Y5TB 4JFHE 2H1PL 2XWTB 5I75B 2B7DT 4ODTL 1U93B 1ZT7B 2DLHA 3OQ3B 4OGZA 4DZ8B 3U4EA 4I0PD 4ZFGH 1J5OH 1FO0B 1HQ4A 3VD5A 5I1DA 5I2IA 5TQ0L 2PNDA 2Y06L 2R0ZH 3P9MA 4XC1H 3V52H 5CBEB 1H0DB 5DMKB 1DCLA 5JXAL 5DJZB 3TFKC 3DUSB 4C56A 2OX5A 1R3HA 1G7MB 3BO8B 3ARBD 3O9WA 1F3JA 5GZOD 1RIUL 4NRZA 3K2UL 2CUIA 3ZYJA 1C16B 3QWRD 4DQOH 5JW4R 4G6JL 4NO5A 3AAZB 3UC0L 4ZNCD 3IJHB 4U1SA 3T8XA 3QEUB 5EO1A 5L2KE 3UTOA 1JGVH 1FL3B 1KC5H 4Z7VE 2YPVL 2I9LB 1CICB 4GJTB 5D7JD 1YPZE 4EIZC 3B2VH 4Y5YA 1EFXB 1B9ZA 4HJJL 3O3DA 2X7LB 3VDAA 3DBXB 5T3XD 3DVGA 5FA4A 4JM2C 4U7KA 2WINB 4EBQL 3D9AL 3K8LA 2GITB 1PSKL 3S4SG 5DRWA 5GISH 1N7MH 2GEEA 2IFFL 4A2MA 3IF1A 1HSAA 4P2CG 2Y25A 1DBJH 3BH9B 3O4LE 1JGDB 1NCCH 1C5CL 4U6HB 4BQ8A 3HE6C 1RD6A 4MAUL 2A9ML 4M6MH 3SJVE 3MO1B 5SWZA 3MXVH 4PV9B 5DQDH 2IH3A 1ZTXH 2A2QT 1EAPA 4M7LL 3BKYL 4YDKL 1YDPA 4U0RC 1MQ8A 1K3ZA 2NY7H 1VGEH 2UWEA 2VDMH 4F58L 3UROR 1XF2B 2NXZD 2P4AB 5GGQH 4AEFA 1PX4A 4JFDD 4IRSC 3GIZL 4WHTB 4WI6A 4QTIL 1RFDH 4WY7L 3QI9C 4OAWA 1P84J 3W2DL 4FS0A 1I8MB 4X4ME 1ONQB 1X5XA 3EYUL 4B5EA 1BF8A 2ZG2A 1AGDA 1OCWH 3JV0A 1RV6X 2HTKD 1J88A 2M1KA 4OD1H 2J88H 2JIXD 3QBTB 5HTSA 3O2WL 5INCA 1T22B 5DD5H 4X4YB 2PYEA 1YEKL 4PJFB 3CCHB 1MAJA 4AEIH 2FLBT 4MD0B 5A2LH 4FRWA 2EDTA 1A1OB 5C0RH 4CGTA 3V2AR 4C59B 2QSQA 4QHMA 3GNMH 4MA1C 3NCJH 4AK1A 2OSLB 1BVLB 2VN4A 3QJFA 5FYJE 5KVDL 1CD9B 4EDWL 5JQ6H 1CR9L 5D1XB 4PPTA 1XZ0A 2C1OB 2QADC 4KMLB 4TULL 5I1IH 4FTVE 5DS8A 5EOTB 3QEQE 1OTSD 5F3BB 4JKWA 1D5IL 1TTGA 4X6DE 4POZD 5GGUA 3CH1A 3PQYB 2VLRE 4FQXD 4NP4L 4Z0XB 2EEDA 5EU7E 3G5YB 5AUMA 4OIBA 3RX5A 1RK1A 5BMFH 4GSDL 4JQVA 2P5WE 1M6OB 4I4WA 2YD5A 1M05A 3CVIH 1J0HA 1S7WA 3T0VA 3QDGB 2FO4B 3UJIH 4UT7H 4D9LH 4L8CA 2IH1B 4NFBA 5TQ2H 4Y4HA 4IOIB 4X7TA 5MERB 1ZWIB 3LS4H 4JRYA 4HD9A 4WRLA 2CDEA 2ATKA 1CDBA 2OS7A 5BV7L 4DKFH 4OJFH 2ITDA 2PYFB 3G6JA 4QYOA 4NWTL 8CGTA 5KSBE 4HX1B 1NMCB 3T0DA 4LIQL 1QSFD 3E3QE 1Y0LB 5DFVC 5C2BH 1NMAH 1NGXA 1LE9B 1M4KA 1JFQL 3VXMD 5E9DB 1I1YA 3R8BB 1LNUB 3P77A 2CR3A 2NNAB 4WTXA 5GSRB 2BNQD 1T5XA 1B2WH 1YJDL 4GG8A 2OJEA 3C8HA 5GS3A 4PLNC 3PIQB 3T0AA 5IWLA 3H3PL 4MNGB 3LPGA 3MMEB 2VXTH 4LOUC 4XB7A 2NYYC 4JY4B 1HI6A 3IKKA 1I1CA 4JB9L 4OFVA 4ONHB 4P9HL 1DSFL 1CXKA 1A14H 3A6OA 5D1QB 5JW4Q 1HKLL 5I19H 2PTTA 4HIEB 2Z31C 3PHOA 1RJYA 3HC3L 4NZTL 3C2AH 2WAHA 4I3SL 3SE3A 3SCMB 2Q8AL 4NHUB 2AJSL 2EXYC 3MR9A 2FIKB 3WSQH 3GMRA 4OCMC 4FFVC 4PJAA 4U1LA 3O0RL 3P2TA 3QWQB 1OGAE 1WEJL 4JFDB 3FQTA 4L8BA 2DKMA 2YN5A 2BSRB 4YFDB 4K3DL 2FGWH 1QRNA 1N6VA 2XY2A 3K2UH 1T6VN 4DKEH 4Z7NF 1WTGT 2FCBA 3O4OC 4PJXF 4NJAL 3P4MA 4P3CH 1T1YB 2XNAB 1SEBB 3T0ED 4JFEA 3D3VB 2GSIA 5SWSE 4G6KL 1YNTA 4M48H 3AU1B 3PQYD 4FQXB 4JKMA 4RA0C 2F54B 1MUJA 4NYLA 2LTQC 1LE5A 4JJHA 2P44B 2P48B 2PW2A 5E2VL 3LB6C 3X3GL 3F58H 5D6DC 2WV3A 2VRAA 3KPLA 5KN5A 3V6FA 1KELL 1RY7B 3HUJA 4UUJA 4OTXH 2PKDA 2XWJB 1O5DT 2CKBB 1YPZF 3O45A 3U7WH 4TSBL 3BIKB 1HHHA 1S7RA 1AXSB 4XVUD 1QPXA 4OLYL 1CDYA 5DEGB 3RVVC 2HP4A 5L88L 4F7TA 5MENE 3TBWB 4WGVB 1BD2D 4O2CA 3V6OE 3EYOB 1N2RB 2YKLH 1FORL 3BQUB 5ICYA 1XF5A 5JNYA 2AJXH 1JYWA 3DI2B 4F3FB 1KN2H 3KPRA 2HFTA 2NX5B 3TBVA 1A8JH 1TENA 3OKEB 3O3UN 3VRLE 1JF6A 2GAZA 2OR7A 4PJ5D 3QNXA 2LU7A 4KJQD 1HNGA 4YHPA 3I2CL 1WFTA 2DIAA 2LV4A 1JPGB 3H9SD 4U1GC 1RJZA 3MRRB 2R4SL 4KVNL 4BH7A 1CFQB 1WCBB 2A6JB 3EFDH 1OHQA 4R3SB 3QFJB 2AK4D 5FYKH 4IMKA 5B39B 4JO1H 5MHSD 1JZ8A 1JTOA 5T5NF 1HH9B 4X5LA 5GZOC 4L4JA 1V3MA 3LEVL 1RMFL 4C57C 2WBKA 5HVWA 4G9FE 3WLBA 4NQCA 3BMVA 1U0QA 1ZLUH 4OGYL 3U2SB 2P5WA 3BN3B 3CGTA 3NH7H 4U6YB 1BZ7A 3NZHL 4HDIB 3GI9L 1JHKL 2CLZA 4GAYB 5GGSB 3ROLA 4OFYD 4S1DD 5IHBA 4X6DA 4U0QB 4ZPTA 5I1AA 3V6ZB 3GM8A 2P24A 2QHRL 4JFED 4GQPH 2D4FA 4YHZL 3O8XD 3GSNB 1IKFH 1W72A 2W9DL 4PIRF 5A43C 1AD0B 3WD5H 5D7LE 5BS0B 2PYEE 4JANA 3IKCB 2IFFH 4P4KD 5D2LB 2AV1B 3BP4B 3QJHA 5EFIB 1IEBA 4KMQA 1AFVH 4LKCA 5EC1B 2OTWB 1MREL 4Y2DD 1T4KB 4XNZC 2LTQB 3V4VH 3WXWL 2DQEL 5KSAD 3EDEA 1KLGB 4XAWL 5GGTH 3G04B 4QHKJ 2IFGA 3RZCD 3BWUC 3DIFA 4TQEH 4O02H 4ZFGL 1J5OL 4RGNB 4CVZA 5IR1A 3MV8E 3VG9B 1YY8A 2DLIA 2EYRB 4NHCL 1AI1L 3TPUB 3PWPD 2B4CC 4G8GB 4XNZB 2QSCL 3HFML 1OTUC 2ZPKH 5T1LB 4CN6A 1FNSH 3MYJA 5E03A 2CIKB 2DQJL 3MBEC 1KTDB 3H7LA 3P4LA 3KPPA 2W92A 1FNHA 4X83A 3NVQA 4R0LB 1CGWA 3I3EA 1IGJA 3QIUB 1MFAH 3FTGA 3WS6C 1D9KB 4NZRH 3BPCA 2ED7A 1S3KH 2AJZB 4YK4B 3OR6A 3DGGB 5DWUL 5INDB 5E99L 3BP7B 4DTGH 1KB5A 4Z7QE 3BKCL 2EDKA 2H8PB 4X0KB 3QB7C 1SVZA 4Z18A 3BO8A 4FMFA 3IAPA 5F7EH 2NY6D 4TRPH 2OBGA 4NJ9H 1GGYA 3ULUE 2V5MA 1AE6L 3IFOB 1C16A 3KHQA 4Y1AD 4X9IA 1KEML 3AAZA 5BVPH 1S9WA 2JJSA 1RZFL 5GRVL 5IG7A 3U9UA 2R9HD 2X89D 4MZ3A 3QFJA 1IC1A 2PCPB 3TF7C 2VH5H 5FO9A 4YEEA 4P3WA 3QWOA 4XVSL 1BQHA 1T04A 3FKUS 4NKDA 4QGTA 1TZHA 3V8OA 1PY9A 1B4RA 3WS6A 1J11A 3MV9B 5SWSB 3VE0A 1JGUL 1BVKB 3CVHB 3PG2A 5I8EA 4IRSB 3OKOB 1T3FA 5C0IB 4RZCB 3DXAD 3EO0B 2P7TA 5L8KB 3MCKA 1WBXA 3OXSA 3QRGL 1WZLA 4LP5A 4KI5D 4YXLH 3P11L 3SY0B 3FAXA 3OL2A 4TNVK 1LEKB 3RVUC 4JDTH 1NMAL 1TTUA 3TA3B 2H41A 2W9EL 2IH3B 4ZOBA 4B53A 2HLAB 3BSZL 3DRQA 1JZ6A 4RFOL 5BS0D 3BGAA 3BJLA 3DETD 4HQQL 1G6VK 5BRZE 5HHVL 4NC2B 3H6JA 1WITA 4DGIL 1QR1A 2FYYB 1NAKH 4LOUD 4DUXA 4HS6A 1VCAA 3D85B 3FB8A 3PWLA 1GYAA 3BP5A 3UMTA 2QQQA 3RKPA 5K9JH 3VFPB 4ONOA 5D7LA 4LCWA 1N64H 2NY3D 2VZVA 3TZVC 3GSQA 1FQ9C 2GUOA 4O4YH 3DURB 3MFGB 3KPTA 5SWQB 2DLGA 3QNZB 3B2UD 5I1JL 2AJUH 2ESVE 1LO5B 2AEIT 3G04A 3L9RA 3QG7H 2H3NB 1WUNT 3JUYA 5F7FA 3WHXA 1KTLA 3THML 2ZUQC 1YY8B 5ESVA 6FABH 3UJTL 1IAKB 2D31B 4HUXB 4MAYC 2FGWL 4ZSOA 4PGDB 3UP1A 4DGVH 1X5ZA 1FLRH 1YA5A 1NGZB 3OJMB 3ARXA 5D6CB 1TVDA 3DMMD 2D7PA 5HVHC 1AH1A 5HBBA 2CIKA 4UIKH 1AKJA 3P40A 2Z35A 2J4WL 3LQAC 2UWEE 3MJ9A 4IEFB 5BVJA 1IGJB 2B2XL 3QIUA 1IGIL 1J1PH 5I0ZA 5FFLA 4K94L 1JPSH 3LS5H 5GSVB 3I02B 4XPBH 3S36L 3MSPA 4OCXL 3FT4B 5F9AC 4HS3B 3QFDB 4KK5D 1OPGL 3K8KA 4LSSL 2BSED 3RGVD 4MA8H 2ZCLH 2LVCA 1D5ZA 5CEYB 3L3KA 3V79C 4KUCD 1JGLL 4QCIB 2HAZA 5SWZB 5DFTA 3L3DA 3U0PA 2ZCKH 4PRIA 2E3VA 1MHEB 5IKCB 5A3IC 4BH8B 1I9RH 4GKNA 3V0VA 1WBZA 2PYFA 5F9WC 3WNOA 4LIQE 1H3XA 4DCQA 2LVEA 3VFNB 4AM0A 4CADB 1UH3A 3MLWH 4JB9H 2ENYA 2A6IA 4PJIE 2BP3A 2EO9A 4H26B 5GJTL 3OR7B 5C0DA 4N1HB 4R97C 3WCYA 1J8KA 2KPNA 2A0LD 1I7ZB 3GBML 1K85A 1I9EA 3NPSC 4XBGA 1QHPA 4X4XB 3GRWA 2A9NL 3C87A 2L7JA 3MCKB 1WZKA 3BDBA 1INQB 3LEVH 3JV6A 1RQ5A 4L4TB 1KIUA 1FC2D 1S9VB 1QFWH 1UZ8A 4HPOL 2ZPKL 5JLZA 2DQIH 4NDMA 1ULVA 3RJDA 2FSEA 5TQ0H 1TIUA 3FB7B 5IB4A 3BIBX 3PHOB 4UTAH 5I9QC 3SHSA 4Y4FD 3D2UB 1IGCL 3H9SA 4QHMB 4BFIA 1SEQH 1BREA 5C0EA 3NPSB 4PV8B 3F7RA 5TPWL 1YYLL 1H5BC 1N0LA 2JJUA 5HHNB 5LQBH 4PRPB 5D5MB 1HZHL 4XMKL 3NABL 1BQLL 1KIQA 1UCBL 1B90A 1T7XA 2AK1H 4PB0H 2V2WA 3WFHA 1ZXQA 4R4BB 2Z31A 4HWZB 5D9SA 1IAII 2CDGB 5DUML 4CL7A 2VOTA 3P73B 1RUKH 3O2VH 4LRNH 5C08D 1MIEH 3MUJA 4I0KA 3C6LB 2W07A 4LHUD 1SMAA 4ZPVA 1R24A 3KPSA 4OLEA 3JTTB 2RCSH 3ZO0A 2AK4A