3I0LA

Crystal structure of gtb c80s/c196s/c209s + da + udp-gal
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
278
structure length
272
Chain Sequence
MVYPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGDVSMRRMEMISDFSERRFLSEVDYLVSVDVDMEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABO glycosyltransferase
publication title Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 272
sequence length 278
ec nomenclature ec 2.4.1.37: Fucosylgalactoside 3-alpha-galactosyltransferase.
pdb deposition date 2009-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 3i0lA00
4FCEA 2PGYA 5J49A 3U2XA 1FWYA 2JCLA 1NQIB 1ZJPA 3KIAA 5L6SA 1R81A 4KC4A 3HL3A 2WVKA 1GWWA 1HM9A 1ON6A 3CU0A 5C4EA 1HM8A 3SX7A 2O1FA 1ZJ1A 1PZYB 1FOAA 3V0PA 4AAWA 5CQPA 4C2SA 2XWLA 1R7VA 2X60A 4R7PA 4Y7TA 4ECMA 1TVYA 1VZUA 1YP3A 3SX3A 1FR8A 2Z86A 2AGDA 1NWGB 2BO7A 1O0RA 1OMXA 2P73A 3RSBA 5AJOA 3V90A 5C8RA 4FRAA 4B4BA 3QVBA 4JD0A 4FRDA 1FR9A 2WAWA 3V0OA 3SXGA 5FU0A 4J18A 1WT2A 1ZJ3A 3BRKX 2AH9A 2VS5A 4KRVA 3R2WA 3USRA 5EJ1A 1KWSA 3ZGFA 1FRWA 1G97A 1ZCVA 2VFZA 1VPAA 2RJ5A 4YS8A 1GX4A 4FQWA 3Q4SA 1G0RA 1EYRA 3OH0A 2D0JA 2D7IA 5C49A 5EJZA 5C3AA 1H4EA 3OH4A 1W57A 4EEOA 1FZWA 1H5SD 4NAKA 1H5RA 1O7QA 1HJLA 5CQNX 2YQJA 4EE3A 1LZJA 4ZDQA 5L6VA 2OI5A 5CMIA 1NF5B 1YP4A 1QGSA 2YC5A 3ZLLA 4Y64A 1JV1A 2Y4MA 3I0JA 4M28A 3OKRA 4D11A 3N9WA 2RJ1A 2V0LA 1QWJA 1LL2A 2QH5A 1VZXA 4Y9XA 1R80A 4Y62A 2JCOA 5EIYA 1VGWA 1MP3A 1H7HA 3PKPA 5JQQA 4D11C 5C4FA 4CJCA 3I0FA 1G2VA 3T7NA 4CJBA 4G3SA 1JVGA 1MC3A 1TW5A 1VGZA 2FYAA 2UX8A 1H5SB 4LW3A 4B5BA 2AM3A 2FY7A 3SX8A 3SXEA 3SXBA 1QG8A 2NXVA 1FGXA 2YCMA 1ON8A 4GBPA 1ZI5A 3OH2A 1WSZA 1R7XA 2YC3A 1FXOA 3I0LA 1JVDA 2Y7AA 2P72A 1G95A 2RIZA 2W0WA 2X5ZA 2AESA 5CMJA 1W55A 1IINA 4FCUA 1ZI1A 1MP4A 4ASYA 1FXJA 3ST8A 1FG5N 1R7TA 4EEAA 1G9RA 2WVLA 3OGZA 2I5KA 4AYLA 3I0HA 2AECA 1ZI4A 1TZFA 2PX7A 2A8UA 5C4CA 2Y4JA 3GUEA 1EZIA 2RITA 3DUVA 4FRMA 3U0XA 1ZIZA 5CMHA 3CKVA 3U2TA 1OMZA 3DJ4A 2ICXA 4HO9A 4Y7GA 3V8YA 5FUHA 1NKHB 2VSHA 4NANA 3T7MA 2ZU7A 1ZJOA 2APCA 3NGWA 2VXLA 4FRHA 5C1GA 3V8ZA 1GX0A 2FFUA 3Q80A 1E5KA 1H5TB 2V0JA 4L41C 1WT1A 2XMEA 1WT0A 1ZDFA 4HO6A 3CKOA 3FOQA 4D48A 4LW6A 1SS9A 1V82A 2GGOA 4KQLA 3E25A 3K8DA 2VD4A 3ZF8A 3I0DA 4FRLA 2JCJA 3OC9A 4M4KA 1JV3A 2RJ0A 5IFYA 1LL0A 2RIYA 3I0IX 2RIXA 4E1KA 2QKXA 4IRPA 4KPZA 3E26A 3U2VA 2E8BA 2BO4A 1FO9A 3I0EA 3ZGGA 4AYJA 5DDTA 2JCKA 3T7OA 1JYKA 2Q4JA 4DE7A 1MP5A 3EE5A 5FV9A 4FRQA 3Q7UA 3U2UA 3IOJA 1NHEB 3I0GA 2Y6PA 2OI6A 4AC3A 2AM4A 2AE7A 2MZBA 2W0VA 5CMGX 3JTJA 4MYBA 4KT7A 3D98A 4BMAA 2RJ6A 1I52A 2YQHA 1H7TA 1VH1A 3O3PA 4NAIA 2V0IA 5DDVA 5C36A 5BXCA 2PA4A 2FYBA 2YQSA 5I1FA 3FWWA 4B2XA 4B42A 4HOCA 4M2AA 1ZDGA 3D8VA 2O1HA 1GQ9A 1V84A 3I0KA 3IOHA 2FYDB 5CQMX 1K4VA 1O7OA 5C4BA 2O1GA 4B3UA 4Y63A 3F1YA 3V0QA 2D7RA 1ZJ2A 1HV9A 4HO5A 2FYCB 4FRPA 2YESA 4KPXA 3V0MA 4HG6A 1H7LA 3POLA 1H7FA 3R3IA 4P02A 1H5RB 1ZJ0A 1TW1A 2A8WA 1XZ6A 4KC2A 4XWIA 3V91A 4EE4A 1HM0A 1H7QA 1IIMA 4P00A 2VXMA 3SXCA 2BO8A 4B4MA 3U0YA 2RJ9A 4FREA 1VICA 4DDZA 3LW6A 1V83A 1H7EA 1LL3A 3SX5A 4EVWA 1G23A 2XWMA 3OH1A 1H4CA 1HJJA 1GA8A 1W77A 2ICYA 1OQMB 2VSIA 4MNDA 1G3LA 3RMVA 1FO8A 3BCVA 4G3QA 3TZTA 4DECA 2V0HA 4Y7UA 5C48A 4Y6UA 1ZCUA 3I0CA 2WEEA 4HO4A 2ZU9A 1R7YA 4EEGA 1H3MA 4CVHA 2DPWA 1VZTA 4EE5A 2XWNA 4BQHA 1G1LA 5C38A 2QGIA 3CKNA 1QGQA 1VGUA 2RJ4A 1Z90A 4B2WA 2GGQA 2OEFA 4D0TA 5IDSA 2V0KA 1GWVA 2I7BA 3V0NA 4M2BA 5C1LA 2VS3A 3V0LA 4HO3A 3RMWA 2YQCA 5FU8A 3SPTA 5C3BA 5CQOA 1YROB 4KC1A 2RJ8A 1VH3A 1H5SA 1G93A 4D0ZA 4JISA 3PKQA 5CMFX 3ZLKA 2BO6A 3D5NA 5CQLX 2E3DA 3CGXA 3K8EA 2CU2A 4G87A 1H4DA 1ZHJA 1H5SC 3TQDA 1ZI3A 3JUKA 2WVMA 4ARWA 3OH3A 2OEGA 4HCQA 4Y7VA 2OI7A 4EEMA 5C3DA 4K6RA 2ZU8A 1WT3A 5FYEA 1VM8A 5AJPA 3OAMA 5AJNA 5C4DA 3SXAA 2WGZA 1YP2A 3F1CA 4ASJA 2VS4A 5IDTA 2Y4KA 4G3PA 1PZTA 1ZCTA 2WE9A 1S4NA 1LZ0A 4UEGA 3DK5A 1WVCA 3SXDA 2XMHA 5C47A 4FROA 1S4PA 5C1HA 1NMMB 5HS2A 1R7UA 1G8OA 2P6WA 4KNRA 4FRBA 2X5SA 3USQA 2PGVA 1R82A 4HO2A 2X65A 2FFVA 4KNXA 1H7GA 1FGGA 3CKJA 5FTSA 4Y7FA 2Z87A 1JYLA 1LZIA 2I5EA 4B4GA 4NALA 4Y6NA 4HO0A 1GQCA 1VGTA 4CJ8A 1XHBA 2Y4LA 1INIA 3CKQA 2AM5A 3U2WA 1LVWA 1ZCYA 3JUJA 1LZ7A 4HO8A 1INJA 1O23B 3PNNA 3IOIA 1S4OA 4IRQA 5FTVA 1H5TA 4KXOA 2RJ7A
chains in the Genus database with same CATH superfamily
4FCEA 2PGYA 5J49A 3U2XA 1FWYA 2JCLA 1NQIB 1ZJPA 3KIAA 5L6SA 1R81A 4KC4A 3HL3A 2WVKA 1GWWA 1HM9A 1ON6A 3CU0A 5C4EA 1HM8A 2J0AA 3SX7A 2O1FA 1ZJ1A 1PZYB 1FOAA 3V0PA 4AAWA 5CQPA 4C2SA 2XWLA 1R7VA 2X60A 4R7PA 4Y7TA 4ECMA 1TVYA 1VZUA 1YP3A 3SX3A 1FR8A 2Z86A 2AGDA 1NWGB 2BO7A 1O0RA 1OMXA 2P73A 3RSBA 5AJOA 3V90A 5C8RA 4FRAA 4B4BA 3QVBA 4JD0A 4FRDA 1FR9A 2WAWA 3V0OA 3SXGA 5FU0A 4J18A 1WT2A 1ZJ3A 3BRKX 2AH9A 2VS5A 4KRVA 3R2WA 3USRA 5EJ1A 1KWSA 3ZGFA 1FRWA 1G97A 1ZCVA 2VFZA 1VPAA 2RJ5A 4YS8A 1GX4A 4FQWA 3Q4SA 1G0RA 1EYRA 3OH0A 2D0JA 2D7IA 5C49A 5EJZA 5C3AA 1H4EA 3OH4A 1W57A 4EEOA 1FZWA 1H5SD 4NAKA 4Q7CA 1H5RA 1O7QA 1HJLA 5CQNX 2YQJA 4EE3A 1LZJA 4ZDQA 5L6VA 2OI5A 5CMIA 1NF5B 1YP4A 1QGSA 2YC5A 3ZLLA 4Y64A 1JV1A 2Y4MA 3I0JA 4M28A 3OKRA 4D11A 3N9WA 2RJ1A 2V0LA 1QWJA 1LL2A 2QH5A 1VZXA 4Y9XA 1R80A 4Y62A 2JCOA 5EIYA 1VGWA 1MP3A 1H7HA 3PKPA 5JQQA 4D11C 5C4FA 4CJCA 3I0FA 1G2VA 3T7NA 4CJBA 4G3SA 1JVGA 1MC3A 1TW5A 1VGZA 2FYAA 2UX8A 1H5SB 4LW3A 4B5BA 2AM3A 2FY7A 3SX8A 3SXEA 4FIYA 3SXBA 1QG8A 2NXVA 1FGXA 2YCMA 1ON8A 4GBPA 1ZI5A 3OH2A 1WSZA 1R7XA 2YC3A 1FXOA 3I0LA 1JVDA 2Y7AA 2P72A 1G95A 2RIZA 2W0WA 2X5ZA 2AESA 5CMJA 1W55A 1IINA 4FCUA 1ZI1A 1MP4A 4ASYA 1FXJA 3ST8A 1FG5N 1R7TA 4EEAA 1G9RA 2WVLA 3OGZA 2I5KA 4AYLA 3I0HA 5D92A 2AECA 1ZI4A 1TZFA 2PX7A 2A8UA 2J0BA 5C4CA 2Y4JA 3GUEA 1EZIA 2RITA 3DUVA 4FRMA 4O6MA 1ZIZA 3U0XA 5CMHA 3CKVA 3U2TA 1OMZA 3DJ4A 2ICXA 4HO9A 4Y7GA 3V8YA 5FUHA 1NKHB 2VSHA 4NANA 3T7MA 2ZU7A 1ZJOA 2APCA 3NGWA 2VXLA 4FRHA 5C1GA 3V8ZA 1GX0A 2FFUA 3Q80A 1E5KA 1H5TB 2V0JA 4L41C 1WT1A 2XMEA 1WT0A 1ZDFA 4HO6A 3CKOA 3FOQA 4D48A 4LW6A 1SS9A 1V82A 2GGOA 4KQLA 3E25A 3K8DA 2VD4A 3ZF8A 3I0DA 4FRLA 2JCJA 3OC9A 4M4KA 1JV3A 2RJ0A 5IFYA 1LL0A 2RIYA 3I0IX 2RIXA 4E1KA 2QKXA 4IRPA 4KPZA 3E26A 3U2VA 2E8BA 2BO4A 1FO9A 3I0EA 3ZGGA 4AYJA 5DDTA 2JCKA 3T7OA 1JYKA 2Q4JA 4DE7A 1MP5A 3EE5A 5FV9A 4FRQA 3Q7UA 3U2UA 3IOJA 1NHEB 2C0NA 3I0GA 2Y6PA 2OI6A 4AC3A 2AM4A 2AE7A 2MZBA 2W0VA 5CMGX 3JTJA 4MYBA 4KT7A 3D98A 4BMAA 2RJ6A 1I52A 2YQHA 1H7TA 1VH1A 3O3PA 4NAIA 2V0IA 5DDVA 5C36A 5BXCA 2PA4A 2FYBA 2YQSA 5I1FA 3FWWA 4B2XA 4B42A 4HOCA 4M2AA 1ZDGA 3D8VA 2O1HA 1GQ9A 1V84A 3I0KA 3IOHA 2FYDB 5CQMX 1K4VA 1O7OA 5C4BA 2O1GA 4B3UA 4Y63A 3F1YA 3V0QA 2D7RA 1ZJ2A 1HV9A 4HO5A 2FYCB 4FRPA 2YESA 4KPXA 3V0MA 4HG6A 1H7LA 3POLA 1H7FA 3R3IA 4P02A 1H5RB 1ZJ0A 1TW1A 2A8WA 1XZ6A 4KC2A 4XWIA 3V91A 4EE4A 1HM0A 1H7QA 1IIMA 4P00A 2VXMA 3SXCA 2BO8A 4B4MA 3U0YA 2RJ9A 4FREA 1VICA 4DDZA 3LW6A 1V83A 1H7EA 1LL3A 3SX5A 4FIXA 4EVWA 1G23A 2XWMA 3OH1A 1H4CA 1HJJA 1GA8A 5D91A 1W77A 2ICYA 1OQMB 2VSIA 4MNDA 1G3LA 3RMVA 2VK9A 1FO8A 3BCVA 4G3QA 3TZTA 4DECA 2V0HA 4Y7UA 5C48A 4Y6UA 1ZCUA 3I0CA 2WEEA 4HO4A 2ZU9A 1R7YA 4EEGA 1H3MA 4CVHA 2DPWA 1VZTA 4EE5A 2XWNA 4BQHA 1G1LA 5C38A 2QGIA 3CKNA 1QGQA 1VGUA 2RJ4A 1Z90A 4B2WA 2GGQA 2OEFA 4D0TA 5IDSA 2V0KA 1GWVA 2I7BA 3V0NA 4M2BA 5C1LA 2VS3A 3V0LA 4HO3A 3RMWA 2YQCA 5FU8A 3SPTA 5C3BA 5CQOA 1YROB 4KC1A 2RJ8A 1VH3A 1H5SA 1G93A 4D0ZA 4JISA 3PKQA 5CMFX 3ZLKA 4MIXA 2BO6A 3D5NA 5CQLX 2E3DA 3CGXA 3K8EA 2CU2A 4G87A 1H4DA 1ZHJA 1H5SC 3TQDA 1ZI3A 3JUKA 2WVMA 4ARWA 3OH3A 2OEGA 4HCQA 4Y7VA 2OI7A 4EEMA 5C3DA 4K6RA 2ZU8A 1WT3A 5FYEA 1VM8A 5AJPA 3OAMA 5AJNA 5C4DA 3SXAA 2WGZA 1YP2A 3F1CA 4ASJA 2VS4A 5IDTA 2Y4KA 4G3PA 1PZTA 1ZCTA 2WE9A 1S4NA 1LZ0A 4UEGA 3DK5A 1WVCA 3SXDA 2XMHA 5C47A 4FROA 1S4PA 5C1HA 1NMMB 5HS2A 1R7UA 1G8OA 2P6WA 4KNRA 4FRBA 2X5SA 3USQA 2PGVA 1R82A 4HO2A 2X65A 2FFVA 4KNXA 1H7GA 1FGGA 3CKJA 5FTSA 4Y7FA 2Z87A 1JYLA 1LZIA 2I5EA 4B4GA 4NALA 4Y6NA 4HO0A 1GQCA 1VGTA 4CJ8A 1XHBA 2Y4LA 1INIA 3CKQA 2AM5A 3U2WA 1LVWA 1ZCYA 3JUJA 1LZ7A 4HO8A 1INJA 1O23B 3PNNA 3IOIA 1S4OA 4IRQA 5FTVA 1H5TA 4KXOA 4O6NA 2RJ7A
chains in the Genus database with same CATH topology
4FCEA 2PGYA 5J49A 3U2XA 1FWYA 2JCLA 1NQIB 1ZJPA 3KIAA 5L6SA 1R81A 4KC4A 3HL3A 2WVKA 1GWWA 1HM9A 1ON6A 3CU0A 5C4EA 1HM8A 2J0AA 3SX7A 2O1FA 1ZJ1A 1PZYB 1FOAA 3V0PA 4AAWA 5CQPA 4C2SA 2XWLA 1R7VA 2X60A 4R7PA 4Y7TA 4ECMA 1TVYA 1VZUA 1YP3A 3SX3A 1FR8A 2Z86A 2AGDA 1NWGB 2BO7A 1O0RA 1OMXA 2P73A 3RSBA 5AJOA 3V90A 5C8RA 4FRAA 4B4BA 3QVBA 4JD0A 4FRDA 1FR9A 2WAWA 3V0OA 3SXGA 5FU0A 4J18A 1WT2A 1ZJ3A 3BRKX 2AH9A 2VS5A 4KRVA 3R2WA 3USRA 5EJ1A 1KWSA 3ZGFA 1FRWA 1G97A 1ZCVA 2VFZA 1VPAA 2RJ5A 4YS8A 1GX4A 4FQWA 3Q4SA 1G0RA 1EYRA 3OH0A 2D0JA 2D7IA 5C49A 5EJZA 5C3AA 1H4EA 3OH4A 1W57A 4EEOA 1FZWA 1H5SD 4NAKA 4Q7CA 1H5RA 1O7QA 1HJLA 5CQNX 2YQJA 4EE3A 1LZJA 4ZDQA 5L6VA 2OI5A 5CMIA 1NF5B 1YP4A 1QGSA 2YC5A 3ZLLA 4Y64A 1JV1A 2Y4MA 3I0JA 4M28A 3OKRA 4D11A 3N9WA 2RJ1A 2V0LA 1QWJA 1LL2A 2QH5A 1VZXA 4Y9XA 1R80A 4Y62A 2JCOA 5EIYA 1VGWA 1MP3A 1H7HA 3PKPA 5JQQA 4D11C 5C4FA 4CJCA 3I0FA 1G2VA 3T7NA 4CJBA 4G3SA 1JVGA 1MC3A 1TW5A 1VGZA 2FYAA 2UX8A 1H5SB 4LW3A 4B5BA 2AM3A 2FY7A 3SX8A 3SXEA 4FIYA 3SXBA 1QG8A 2NXVA 1FGXA 2YCMA 1ON8A 4GBPA 1ZI5A 3OH2A 1WSZA 1R7XA 2YC3A 1FXOA 3I0LA 1JVDA 2Y7AA 2P72A 1G95A 2RIZA 2W0WA 2X5ZA 2AESA 5CMJA 1W55A 1IINA 4FCUA 1ZI1A 1MP4A 4ASYA 1FXJA 3ST8A 1FG5N 1R7TA 4EEAA 1G9RA 2WVLA 3OGZA 2I5KA 4AYLA 3I0HA 5D92A 2AECA 1ZI4A 1TZFA 2PX7A 2A8UA 2J0BA 5C4CA 2Y4JA 3GUEA 1EZIA 2RITA 3DUVA 4FRMA 4O6MA 1ZIZA 3U0XA 5CMHA 3CKVA 3U2TA 1OMZA 3DJ4A 2ICXA 4HO9A 4Y7GA 3V8YA 5FUHA 1NKHB 2VSHA 4NANA 3T7MA 2ZU7A 1ZJOA 2APCA 3NGWA 2VXLA 4FRHA 5C1GA 3V8ZA 1GX0A 2FFUA 3Q80A 1E5KA 1H5TB 2V0JA 4L41C 1WT1A 2XMEA 1WT0A 1ZDFA 4HO6A 3CKOA 3FOQA 4D48A 4LW6A 1SS9A 1V82A 2GGOA 4KQLA 3E25A 3K8DA 2VD4A 3ZF8A 3I0DA 4FRLA 2JCJA 3OC9A 4M4KA 1JV3A 2RJ0A 5IFYA 1LL0A 2RIYA 3I0IX 2RIXA 4E1KA 2QKXA 4IRPA 4KPZA 3E26A 3U2VA 2E8BA 2BO4A 1FO9A 3I0EA 3ZGGA 4AYJA 5DDTA 2JCKA 3T7OA 1JYKA 2Q4JA 4DE7A 1MP5A 3EE5A 5FV9A 4FRQA 3Q7UA 3U2UA 3IOJA 1NHEB 2C0NA 3I0GA 2Y6PA 2OI6A 4AC3A 2AM4A 2AE7A 2MZBA 2W0VA 5CMGX 3JTJA 4MYBA 4KT7A 3D98A 4BMAA 2RJ6A 1I52A 2YQHA 1H7TA 1VH1A 3O3PA 4NAIA 2V0IA 5DDVA 5C36A 5BXCA 2PA4A 2FYBA 2YQSA 5I1FA 3FWWA 4B2XA 4B42A 4HOCA 4M2AA 1ZDGA 3D8VA 2O1HA 1GQ9A 1V84A 3I0KA 3IOHA 2FYDB 5CQMX 1K4VA 1O7OA 5C4BA 2O1GA 4B3UA 4Y63A 3F1YA 3V0QA 2D7RA 1ZJ2A 1HV9A 4HO5A 2FYCB 4FRPA 2YESA 4KPXA 3V0MA 4HG6A 1H7LA 3POLA 1H7FA 3R3IA 4P02A 1H5RB 1ZJ0A 1TW1A 2A8WA 1XZ6A 4KC2A 4XWIA 3V91A 4EE4A 1HM0A 1H7QA 1IIMA 4P00A 2VXMA 3SXCA 2BO8A 4B4MA 3U0YA 2RJ9A 4FREA 1VICA 4DDZA 3LW6A 1V83A 1H7EA 1LL3A 3SX5A 4FIXA 4EVWA 1G23A 2XWMA 3OH1A 1H4CA 1HJJA 1GA8A 5D91A 1W77A 2ICYA 1OQMB 2VSIA 4MNDA 1G3LA 3RMVA 2VK9A 1FO8A 3BCVA 4G3QA 3TZTA 4DECA 2V0HA 4Y7UA 5C48A 4Y6UA 1ZCUA 3I0CA 2WEEA 4HO4A 2ZU9A 1R7YA 4EEGA 1H3MA 4CVHA 2DPWA 1VZTA 4EE5A 2XWNA 4BQHA 1G1LA 5C38A 2QGIA 3CKNA 1QGQA 1VGUA 2RJ4A 1Z90A 4B2WA 2GGQA 2OEFA 4D0TA 5IDSA 2V0KA 1GWVA 2I7BA 3V0NA 4M2BA 5C1LA 2VS3A 3V0LA 4HO3A 3RMWA 2YQCA 5FU8A 3SPTA 5C3BA 5CQOA 1YROB 4KC1A 2RJ8A 1VH3A 1H5SA 1G93A 4D0ZA 4JISA 3PKQA 5CMFX 3ZLKA 4MIXA 2BO6A 3D5NA 5CQLX 2E3DA 3CGXA 3K8EA 2CU2A 4G87A 1H4DA 1ZHJA 1H5SC 3TQDA 1ZI3A 3JUKA 2WVMA 4ARWA 3OH3A 2OEGA 4HCQA 4Y7VA 2OI7A 4EEMA 5C3DA 4K6RA 2ZU8A 1WT3A 5FYEA 1VM8A 5AJPA 3OAMA 5AJNA 5C4DA 3SXAA 2WGZA 1YP2A 3F1CA 4ASJA 2VS4A 5IDTA 2Y4KA 4G3PA 1PZTA 1ZCTA 2WE9A 1S4NA 1LZ0A 4UEGA 3DK5A 1WVCA 3SXDA 2XMHA 5C47A 4FROA 1S4PA 5C1HA 1NMMB 5HS2A 1R7UA 1G8OA 2P6WA 4KNRA 4FRBA 2X5SA 3USQA 2PGVA 1R82A 4HO2A 2X65A 2FFVA 4KNXA 1H7GA 1FGGA 3CKJA 5FTSA 4Y7FA 2Z87A 1JYLA 1LZIA 2I5EA 4B4GA 4NALA 4Y6NA 4HO0A 1GQCA 1VGTA 4CJ8A 1XHBA 2Y4LA 1INIA 3CKQA 2AM5A 3U2WA 1LVWA 1ZCYA 3JUJA 1LZ7A 4HO8A 1INJA 1O23B 3PNNA 3IOIA 1S4OA 4IRQA 5FTVA 1H5TA 4KXOA 4O6NA 2RJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FCE A;  2PGY A;  5J49 A;  3U2X A;  1FWY A;  2JCL A;  1NQI B;  1ZJP A;  3KIA A;  5L6S A;  1R81 A;  4KC4 A;  3HL3 A;  2WVK A;  1GWW A;  1HM9 A;  1ON6 A;  3CU0 A;  5C4E A;  1HM8 A;  3SX7 A;  2O1F A;  1ZJ1 A;  1PZY B;  1FOA A;  3V0P A;  4AAW A;  5CQP A;  4C2S A;  2XWL A;  1R7V A;  2X60 A;  4R7P A;  4Y7T A;  4ECM A;  1TVY A;  1VZU A;  1YP3 A;  3SX3 A;  1FR8 A;  2Z86 A;  2AGD A;  1NWG B;  2BO7 A;  1O0R A;  1OMX A;  2P73 A;  3RSB A;  5AJO A;  3V90 A;  5C8R A;  4FRA A;  4B4B A;  3QVB A;  4JD0 A;  4FRD A;  1FR9 A;  2WAW A;  3V0O A;  3SXG A;  5FU0 A;  4J18 A;  1WT2 A;  1ZJ3 A;  3BRK X;  2AH9 A;  2VS5 A;  4KRV A;  3R2W A;  3USR A;  5EJ1 A;  1KWS A;  3ZGF A;  1FRW A;  1G97 A;  1ZCV A;  2VFZ A;  1VPA A;  2RJ5 A;  4YS8 A;  1GX4 A;  4FQW A;  3Q4S A;  1G0R A;  1EYR A;  3OH0 A;  2D0J A;  2D7I A;  5C49 A;  5EJZ A;  5C3A A;  1H4E A;  3OH4 A;  1W57 A;  4EEO A;  1FZW A;  1H5S D;  4NAK A;  1H5R A;  1O7Q A;  1HJL A;  5CQN X;  2YQJ A;  4EE3 A;  1LZJ A;  4ZDQ A;  5L6V A;  2OI5 A;  5CMI A;  1NF5 B;  1YP4 A;  1QGS A;  2YC5 A;  3ZLL A;  4Y64 A;  1JV1 A;  2Y4M A;  3I0J A;  4M28 A;  3OKR A;  4D11 A;  3N9W A;  2RJ1 A;  2V0L A;  1QWJ A;  1LL2 A;  2QH5 A;  1VZX A;  4Y9X A;  1R80 A;  4Y62 A;  2JCO A;  5EIY A;  1VGW A;  1MP3 A;  1H7H A;  3PKP A;  5JQQ A;  4D11 C;  5C4F A;  4CJC A;  3I0F A;  1G2V A;  3T7N A;  4CJB A;  4G3S A;  1JVG A;  1MC3 A;  1TW5 A;  1VGZ A;  2FYA A;  2UX8 A;  1H5S B;  4LW3 A;  4B5B A;  2AM3 A;  2FY7 A;  3SX8 A;  3SXE A;  3SXB A;  1QG8 A;  2NXV A;  1FGX A;  2YCM A;  1ON8 A;  4GBP A;  1ZI5 A;  3OH2 A;  1WSZ A;  1R7X A;  2YC3 A;  1FXO A;  3I0L A;  1JVD A;  2Y7A A;  2P72 A;  1G95 A;  2RIZ A;  2W0W A;  2X5Z A;  2AES A;  5CMJ A;  1W55 A;  1IIN A;  4FCU A;  1ZI1 A;  1MP4 A;  4ASY A;  1FXJ A;  3ST8 A;  1FG5 N;  1R7T A;  4EEA A;  1G9R A;  2WVL A;  3OGZ A;  2I5K A;  4AYL A;  3I0H A;  2AEC A;  1ZI4 A;  1TZF A;  2PX7 A;  2A8U A;  5C4C A;  2Y4J A;  3GUE A;  1EZI A;  2RIT A;  3DUV A;  4FRM A;  3U0X A;  1ZIZ A;  5CMH A;  3CKV A;  3U2T A;  1OMZ A;  3DJ4 A;  2ICX A;  4HO9 A;  4Y7G A;  3V8Y A;  5FUH A;  1NKH B;  2VSH A;  4NAN A;  3T7M A;  2ZU7 A;  1ZJO A;  2APC A;  3NGW A;  2VXL A;  4FRH A;  5C1G A;  3V8Z A;  1GX0 A;  2FFU A;  3Q80 A;  1E5K A;  1H5T B;  2V0J A;  4L41 C;  1WT1 A;  2XME A;  1WT0 A;  1ZDF A;  4HO6 A;  3CKO A;  3FOQ A;  4D48 A;  4LW6 A;  1SS9 A;  1V82 A;  2GGO A;  4KQL A;  3E25 A;  3K8D A;  2VD4 A;  3ZF8 A;  3I0D A;  4FRL A;  2JCJ A;  3OC9 A;  4M4K A;  1JV3 A;  2RJ0 A;  5IFY A;  1LL0 A;  2RIY A;  3I0I X;  2RIX A;  4E1K A;  2QKX A;  4IRP A;  4KPZ A;  3E26 A;  3U2V A;  2E8B A;  2BO4 A;  1FO9 A;  3I0E A;  3ZGG A;  4AYJ A;  5DDT A;  2JCK A;  3T7O A;  1JYK A;  2Q4J A;  4DE7 A;  1MP5 A;  3EE5 A;  5FV9 A;  4FRQ A;  3Q7U A;  3U2U A;  3IOJ A;  1NHE B;  3I0G A;  2Y6P A;  2OI6 A;  4AC3 A;  2AM4 A;  2AE7 A;  2MZB A;  2W0V A;  5CMG X;  3JTJ A;  4MYB A;  4KT7 A;  3D98 A;  4BMA A;  2RJ6 A;  1I52 A;  2YQH A;  1H7T A;  1VH1 A;  3O3P A;  4NAI A;  2V0I A;  5DDV A;  5C36 A;  5BXC A;  2PA4 A;  2FYB A;  2YQS A;  5I1F A;  3FWW A;  4B2X A;  4B42 A;  4HOC A;  4M2A A;  1ZDG A;  3D8V A;  2O1H A;  1GQ9 A;  1V84 A;  3I0K A;  3IOH A;  2FYD B;  5CQM X;  1K4V A;  1O7O A;  5C4B A;  2O1G A;  4B3U A;  4Y63 A;  3F1Y A;  3V0Q A;  2D7R A;  1ZJ2 A;  1HV9 A;  4HO5 A;  2FYC B;  4FRP A;  2YES A;  4KPX A;  3V0M A;  4HG6 A;  1H7L A;  3POL A;  1H7F A;  3R3I A;  4P02 A;  1H5R B;  1ZJ0 A;  1TW1 A;  2A8W A;  1XZ6 A;  4KC2 A;  4XWI A;  3V91 A;  4EE4 A;  1HM0 A;  1H7Q A;  1IIM A;  4P00 A;  2VXM A;  3SXC A;  2BO8 A;  4B4M A;  3U0Y A;  2RJ9 A;  4FRE A;  1VIC A;  4DDZ A;  3LW6 A;  1V83 A;  1H7E A;  1LL3 A;  3SX5 A;  4EVW A;  1G23 A;  2XWM A;  3OH1 A;  1H4C A;  1HJJ A;  1GA8 A;  1W77 A;  2ICY A;  1OQM B;  2VSI A;  4MND A;  1G3L A;  3RMV A;  1FO8 A;  3BCV A;  4G3Q A;  3TZT A;  4DEC A;  2V0H A;  4Y7U A;  5C48 A;  4Y6U A;  1ZCU A;  3I0C A;  2WEE A;  4HO4 A;  2ZU9 A;  1R7Y A;  4EEG A;  1H3M A;  4CVH A;  2DPW A;  1VZT A;  4EE5 A;  2XWN A;  4BQH A;  1G1L A;  5C38 A;  2QGI A;  3CKN A;  1QGQ A;  1VGU A;  2RJ4 A;  1Z90 A;  4B2W A;  2GGQ A;  2OEF A;  4D0T A;  5IDS A;  2V0K A;  1GWV A;  2I7B A;  3V0N A;  4M2B A;  5C1L A;  2VS3 A;  3V0L A;  4HO3 A;  3RMW A;  2YQC A;  5FU8 A;  3SPT A;  5C3B A;  5CQO A;  1YRO B;  4KC1 A;  2RJ8 A;  1VH3 A;  1H5S A;  1G93 A;  4D0Z A;  4JIS A;  3PKQ A;  5CMF X;  3ZLK A;  2BO6 A;  3D5N A;  5CQL X;  2E3D A;  3CGX A;  3K8E A;  2CU2 A;  4G87 A;  1H4D A;  1ZHJ A;  1H5S C;  3TQD A;  1ZI3 A;  3JUK A;  2WVM A;  4ARW A;  3OH3 A;  2OEG A;  4HCQ A;  4Y7V A;  2OI7 A;  4EEM A;  5C3D A;  4K6R A;  2ZU8 A;  1WT3 A;  5FYE A;  1VM8 A;  5AJP A;  3OAM A;  5AJN A;  5C4D A;  3SXA A;  2WGZ A;  1YP2 A;  3F1C A;  4ASJ A;  2VS4 A;  5IDT A;  2Y4K A;  4G3P A;  1PZT A;  1ZCT A;  2WE9 A;  1S4N A;  1LZ0 A;  4UEG A;  3DK5 A;  1WVC A;  3SXD A;  2XMH A;  5C47 A;  4FRO A;  1S4P A;  5C1H A;  1NMM B;  5HS2 A;  1R7U A;  1G8O A;  2P6W A;  4KNR A;  4FRB A;  2X5S A;  3USQ A;  2PGV A;  1R82 A;  4HO2 A;  2X65 A;  2FFV A;  4KNX A;  1H7G A;  1FGG A;  3CKJ A;  5FTS A;  4Y7F A;  2Z87 A;  1JYL A;  1LZI A;  2I5E A;  4B4G A;  4NAL A;  4Y6N A;  4HO0 A;  1GQC A;  1VGT A;  4CJ8 A;  1XHB A;  2Y4L A;  1INI A;  3CKQ A;  2AM5 A;  3U2W A;  1LVW A;  1ZCY A;  3JUJ A;  1LZ7 A;  4HO8 A;  1INJ A;  1O23 B;  3PNN A;  3IOI A;  1S4O A;  4IRQ A;  5FTV A;  1H5T A;  4KXO A;  2RJ7 A; 
#chains in the Genus database with same CATH topology
 4FCE A;  2PGY A;  5J49 A;  3U2X A;  1FWY A;  2JCL A;  1NQI B;  1ZJP A;  3KIA A;  5L6S A;  1R81 A;  4KC4 A;  3HL3 A;  2WVK A;  1GWW A;  1HM9 A;  1ON6 A;  3CU0 A;  5C4E A;  1HM8 A;  2J0A A;  3SX7 A;  2O1F A;  1ZJ1 A;  1PZY B;  1FOA A;  3V0P A;  4AAW A;  5CQP A;  4C2S A;  2XWL A;  1R7V A;  2X60 A;  4R7P A;  4Y7T A;  4ECM A;  1TVY A;  1VZU A;  1YP3 A;  3SX3 A;  1FR8 A;  2Z86 A;  2AGD A;  1NWG B;  2BO7 A;  1O0R A;  1OMX A;  2P73 A;  3RSB A;  5AJO A;  3V90 A;  5C8R A;  4FRA A;  4B4B A;  3QVB A;  4JD0 A;  4FRD A;  1FR9 A;  2WAW A;  3V0O A;  3SXG A;  5FU0 A;  4J18 A;  1WT2 A;  1ZJ3 A;  3BRK X;  2AH9 A;  2VS5 A;  4KRV A;  3R2W A;  3USR A;  5EJ1 A;  1KWS A;  3ZGF A;  1FRW A;  1G97 A;  1ZCV A;  2VFZ A;  1VPA A;  2RJ5 A;  4YS8 A;  1GX4 A;  4FQW A;  3Q4S A;  1G0R A;  1EYR A;  3OH0 A;  2D0J A;  2D7I A;  5C49 A;  5EJZ A;  5C3A A;  1H4E A;  3OH4 A;  1W57 A;  4EEO A;  1FZW A;  1H5S D;  4NAK A;  4Q7C A;  1H5R A;  1O7Q A;  1HJL A;  5CQN X;  2YQJ A;  4EE3 A;  1LZJ A;  4ZDQ A;  5L6V A;  2OI5 A;  5CMI A;  1NF5 B;  1YP4 A;  1QGS A;  2YC5 A;  3ZLL A;  4Y64 A;  1JV1 A;  2Y4M A;  3I0J A;  4M28 A;  3OKR A;  4D11 A;  3N9W A;  2RJ1 A;  2V0L A;  1QWJ A;  1LL2 A;  2QH5 A;  1VZX A;  4Y9X A;  1R80 A;  4Y62 A;  2JCO A;  5EIY A;  1VGW A;  1MP3 A;  1H7H A;  3PKP A;  5JQQ A;  4D11 C;  5C4F A;  4CJC A;  3I0F A;  1G2V A;  3T7N A;  4CJB A;  4G3S A;  1JVG A;  1MC3 A;  1TW5 A;  1VGZ A;  2FYA A;  2UX8 A;  1H5S B;  4LW3 A;  4B5B A;  2AM3 A;  2FY7 A;  3SX8 A;  3SXE A;  4FIY A;  3SXB A;  1QG8 A;  2NXV A;  1FGX A;  2YCM A;  1ON8 A;  4GBP A;  1ZI5 A;  3OH2 A;  1WSZ A;  1R7X A;  2YC3 A;  1FXO A;  3I0L A;  1JVD A;  2Y7A A;  2P72 A;  1G95 A;  2RIZ A;  2W0W A;  2X5Z A;  2AES A;  5CMJ A;  1W55 A;  1IIN A;  4FCU A;  1ZI1 A;  1MP4 A;  4ASY A;  1FXJ A;  3ST8 A;  1FG5 N;  1R7T A;  4EEA A;  1G9R A;  2WVL A;  3OGZ A;  2I5K A;  4AYL A;  3I0H A;  5D92 A;  2AEC A;  1ZI4 A;  1TZF A;  2PX7 A;  2A8U A;  2J0B A;  5C4C A;  2Y4J A;  3GUE A;  1EZI A;  2RIT A;  3DUV A;  4FRM A;  4O6M A;  1ZIZ A;  3U0X A;  5CMH A;  3CKV A;  3U2T A;  1OMZ A;  3DJ4 A;  2ICX A;  4HO9 A;  4Y7G A;  3V8Y A;  5FUH A;  1NKH B;  2VSH A;  4NAN A;  3T7M A;  2ZU7 A;  1ZJO A;  2APC A;  3NGW A;  2VXL A;  4FRH A;  5C1G A;  3V8Z A;  1GX0 A;  2FFU A;  3Q80 A;  1E5K A;  1H5T B;  2V0J A;  4L41 C;  1WT1 A;  2XME A;  1WT0 A;  1ZDF A;  4HO6 A;  3CKO A;  3FOQ A;  4D48 A;  4LW6 A;  1SS9 A;  1V82 A;  2GGO A;  4KQL A;  3E25 A;  3K8D A;  2VD4 A;  3ZF8 A;  3I0D A;  4FRL A;  2JCJ A;  3OC9 A;  4M4K A;  1JV3 A;  2RJ0 A;  5IFY A;  1LL0 A;  2RIY A;  3I0I X;  2RIX A;  4E1K A;  2QKX A;  4IRP A;  4KPZ A;  3E26 A;  3U2V A;  2E8B A;  2BO4 A;  1FO9 A;  3I0E A;  3ZGG A;  4AYJ A;  5DDT A;  2JCK A;  3T7O A;  1JYK A;  2Q4J A;  4DE7 A;  1MP5 A;  3EE5 A;  5FV9 A;  4FRQ A;  3Q7U A;  3U2U A;  3IOJ A;  1NHE B;  2C0N A;  3I0G A;  2Y6P A;  2OI6 A;  4AC3 A;  2AM4 A;  2AE7 A;  2MZB A;  2W0V A;  5CMG X;  3JTJ A;  4MYB A;  4KT7 A;  3D98 A;  4BMA A;  2RJ6 A;  1I52 A;  2YQH A;  1H7T A;  1VH1 A;  3O3P A;  4NAI A;  2V0I A;  5DDV A;  5C36 A;  5BXC A;  2PA4 A;  2FYB A;  2YQS A;  5I1F A;  3FWW A;  4B2X A;  4B42 A;  4HOC A;  4M2A A;  1ZDG A;  3D8V A;  2O1H A;  1GQ9 A;  1V84 A;  3I0K A;  3IOH A;  2FYD B;  5CQM X;  1K4V A;  1O7O A;  5C4B A;  2O1G A;  4B3U A;  4Y63 A;  3F1Y A;  3V0Q A;  2D7R A;  1ZJ2 A;  1HV9 A;  4HO5 A;  2FYC B;  4FRP A;  2YES A;  4KPX A;  3V0M A;  4HG6 A;  1H7L A;  3POL A;  1H7F A;  3R3I A;  4P02 A;  1H5R B;  1ZJ0 A;  1TW1 A;  2A8W A;  1XZ6 A;  4KC2 A;  4XWI A;  3V91 A;  4EE4 A;  1HM0 A;  1H7Q A;  1IIM A;  4P00 A;  2VXM A;  3SXC A;  2BO8 A;  4B4M A;  3U0Y A;  2RJ9 A;  4FRE A;  1VIC A;  4DDZ A;  3LW6 A;  1V83 A;  1H7E A;  1LL3 A;  3SX5 A;  4FIX A;  4EVW A;  1G23 A;  2XWM A;  3OH1 A;  1H4C A;  1HJJ A;  1GA8 A;  5D91 A;  1W77 A;  2ICY A;  1OQM B;  2VSI A;  4MND A;  1G3L A;  3RMV A;  2VK9 A;  1FO8 A;  3BCV A;  4G3Q A;  3TZT A;  4DEC A;  2V0H A;  4Y7U A;  5C48 A;  4Y6U A;  1ZCU A;  3I0C A;  2WEE A;  4HO4 A;  2ZU9 A;  1R7Y A;  4EEG A;  1H3M A;  4CVH A;  2DPW A;  1VZT A;  4EE5 A;  2XWN A;  4BQH A;  1G1L A;  5C38 A;  2QGI A;  3CKN A;  1QGQ A;  1VGU A;  2RJ4 A;  1Z90 A;  4B2W A;  2GGQ A;  2OEF A;  4D0T A;  5IDS A;  2V0K A;  1GWV A;  2I7B A;  3V0N A;  4M2B A;  5C1L A;  2VS3 A;  3V0L A;  4HO3 A;  3RMW A;  2YQC A;  5FU8 A;  3SPT A;  5C3B A;  5CQO A;  1YRO B;  4KC1 A;  2RJ8 A;  1VH3 A;  1H5S A;  1G93 A;  4D0Z A;  4JIS A;  3PKQ A;  5CMF X;  3ZLK A;  4MIX A;  2BO6 A;  3D5N A;  5CQL X;  2E3D A;  3CGX A;  3K8E A;  2CU2 A;  4G87 A;  1H4D A;  1ZHJ A;  1H5S C;  3TQD A;  1ZI3 A;  3JUK A;  2WVM A;  4ARW A;  3OH3 A;  2OEG A;  4HCQ A;  4Y7V A;  2OI7 A;  4EEM A;  5C3D A;  4K6R A;  2ZU8 A;  1WT3 A;  5FYE A;  1VM8 A;  5AJP A;  3OAM A;  5AJN A;  5C4D A;  3SXA A;  2WGZ A;  1YP2 A;  3F1C A;  4ASJ A;  2VS4 A;  5IDT A;  2Y4K A;  4G3P A;  1PZT A;  1ZCT A;  2WE9 A;  1S4N A;  1LZ0 A;  4UEG A;  3DK5 A;  1WVC A;  3SXD A;  2XMH A;  5C47 A;  4FRO A;  1S4P A;  5C1H A;  1NMM B;  5HS2 A;  1R7U A;  1G8O A;  2P6W A;  4KNR A;  4FRB A;  2X5S A;  3USQ A;  2PGV A;  1R82 A;  4HO2 A;  2X65 A;  2FFV A;  4KNX A;  1H7G A;  1FGG A;  3CKJ A;  5FTS A;  4Y7F A;  2Z87 A;  1JYL A;  1LZI A;  2I5E A;  4B4G A;  4NAL A;  4Y6N A;  4HO0 A;  1GQC A;  1VGT A;  4CJ8 A;  1XHB A;  2Y4L A;  1INI A;  3CKQ A;  2AM5 A;  3U2W A;  1LVW A;  1ZCY A;  3JUJ A;  1LZ7 A;  4HO8 A;  1INJ A;  1O23 B;  3PNN A;  3IOI A;  1S4O A;  4IRQ A;  5FTV A;  1H5T A;  4KXO A;  4O6N A;  2RJ7 A; 
#chains in the Genus database with same CATH homology
 4FCE A;  2PGY A;  5J49 A;  3U2X A;  1FWY A;  2JCL A;  1NQI B;  1ZJP A;  3KIA A;  5L6S A;  1R81 A;  4KC4 A;  3HL3 A;  2WVK A;  1GWW A;  1HM9 A;  1ON6 A;  3CU0 A;  5C4E A;  1HM8 A;  2J0A A;  3SX7 A;  2O1F A;  1ZJ1 A;  1PZY B;  1FOA A;  3V0P A;  4AAW A;  5CQP A;  4C2S A;  2XWL A;  1R7V A;  2X60 A;  4R7P A;  4Y7T A;  4ECM A;  1TVY A;  1VZU A;  1YP3 A;  3SX3 A;  1FR8 A;  2Z86 A;  2AGD A;  1NWG B;  2BO7 A;  1O0R A;  1OMX A;  2P73 A;  3RSB A;  5AJO A;  3V90 A;  5C8R A;  4FRA A;  4B4B A;  3QVB A;  4JD0 A;  4FRD A;  1FR9 A;  2WAW A;  3V0O A;  3SXG A;  5FU0 A;  4J18 A;  1WT2 A;  1ZJ3 A;  3BRK X;  2AH9 A;  2VS5 A;  4KRV A;  3R2W A;  3USR A;  5EJ1 A;  1KWS A;  3ZGF A;  1FRW A;  1G97 A;  1ZCV A;  2VFZ A;  1VPA A;  2RJ5 A;  4YS8 A;  1GX4 A;  4FQW A;  3Q4S A;  1G0R A;  1EYR A;  3OH0 A;  2D0J A;  2D7I A;  5C49 A;  5EJZ A;  5C3A A;  1H4E A;  3OH4 A;  1W57 A;  4EEO A;  1FZW A;  1H5S D;  4NAK A;  4Q7C A;  1H5R A;  1O7Q A;  1HJL A;  5CQN X;  2YQJ A;  4EE3 A;  1LZJ A;  4ZDQ A;  5L6V A;  2OI5 A;  5CMI A;  1NF5 B;  1YP4 A;  1QGS A;  2YC5 A;  3ZLL A;  4Y64 A;  1JV1 A;  2Y4M A;  3I0J A;  4M28 A;  3OKR A;  4D11 A;  3N9W A;  2RJ1 A;  2V0L A;  1QWJ A;  1LL2 A;  2QH5 A;  1VZX A;  4Y9X A;  1R80 A;  4Y62 A;  2JCO A;  5EIY A;  1VGW A;  1MP3 A;  1H7H A;  3PKP A;  5JQQ A;  4D11 C;  5C4F A;  4CJC A;  3I0F A;  1G2V A;  3T7N A;  4CJB A;  4G3S A;  1JVG A;  1MC3 A;  1TW5 A;  1VGZ A;  2FYA A;  2UX8 A;  1H5S B;  4LW3 A;  4B5B A;  2AM3 A;  2FY7 A;  3SX8 A;  3SXE A;  4FIY A;  3SXB A;  1QG8 A;  2NXV A;  1FGX A;  2YCM A;  1ON8 A;  4GBP A;  1ZI5 A;  3OH2 A;  1WSZ A;  1R7X A;  2YC3 A;  1FXO A;  3I0L A;  1JVD A;  2Y7A A;  2P72 A;  1G95 A;  2RIZ A;  2W0W A;  2X5Z A;  2AES A;  5CMJ A;  1W55 A;  1IIN A;  4FCU A;  1ZI1 A;  1MP4 A;  4ASY A;  1FXJ A;  3ST8 A;  1FG5 N;  1R7T A;  4EEA A;  1G9R A;  2WVL A;  3OGZ A;  2I5K A;  4AYL A;  3I0H A;  5D92 A;  2AEC A;  1ZI4 A;  1TZF A;  2PX7 A;  2A8U A;  2J0B A;  5C4C A;  2Y4J A;  3GUE A;  1EZI A;  2RIT A;  3DUV A;  4FRM A;  4O6M A;  1ZIZ A;  3U0X A;  5CMH A;  3CKV A;  3U2T A;  1OMZ A;  3DJ4 A;  2ICX A;  4HO9 A;  4Y7G A;  3V8Y A;  5FUH A;  1NKH B;  2VSH A;  4NAN A;  3T7M A;  2ZU7 A;  1ZJO A;  2APC A;  3NGW A;  2VXL A;  4FRH A;  5C1G A;  3V8Z A;  1GX0 A;  2FFU A;  3Q80 A;  1E5K A;  1H5T B;  2V0J A;  4L41 C;  1WT1 A;  2XME A;  1WT0 A;  1ZDF A;  4HO6 A;  3CKO A;  3FOQ A;  4D48 A;  4LW6 A;  1SS9 A;  1V82 A;  2GGO A;  4KQL A;  3E25 A;  3K8D A;  2VD4 A;  3ZF8 A;  3I0D A;  4FRL A;  2JCJ A;  3OC9 A;  4M4K A;  1JV3 A;  2RJ0 A;  5IFY A;  1LL0 A;  2RIY A;  3I0I X;  2RIX A;  4E1K A;  2QKX A;  4IRP A;  4KPZ A;  3E26 A;  3U2V A;  2E8B A;  2BO4 A;  1FO9 A;  3I0E A;  3ZGG A;  4AYJ A;  5DDT A;  2JCK A;  3T7O A;  1JYK A;  2Q4J A;  4DE7 A;  1MP5 A;  3EE5 A;  5FV9 A;  4FRQ A;  3Q7U A;  3U2U A;  3IOJ A;  1NHE B;  2C0N A;  3I0G A;  2Y6P A;  2OI6 A;  4AC3 A;  2AM4 A;  2AE7 A;  2MZB A;  2W0V A;  5CMG X;  3JTJ A;  4MYB A;  4KT7 A;  3D98 A;  4BMA A;  2RJ6 A;  1I52 A;  2YQH A;  1H7T A;  1VH1 A;  3O3P A;  4NAI A;  2V0I A;  5DDV A;  5C36 A;  5BXC A;  2PA4 A;  2FYB A;  2YQS A;  5I1F A;  3FWW A;  4B2X A;  4B42 A;  4HOC A;  4M2A A;  1ZDG A;  3D8V A;  2O1H A;  1GQ9 A;  1V84 A;  3I0K A;  3IOH A;  2FYD B;  5CQM X;  1K4V A;  1O7O A;  5C4B A;  2O1G A;  4B3U A;  4Y63 A;  3F1Y A;  3V0Q A;  2D7R A;  1ZJ2 A;  1HV9 A;  4HO5 A;  2FYC B;  4FRP A;  2YES A;  4KPX A;  3V0M A;  4HG6 A;  1H7L A;  3POL A;  1H7F A;  3R3I A;  4P02 A;  1H5R B;  1ZJ0 A;  1TW1 A;  2A8W A;  1XZ6 A;  4KC2 A;  4XWI A;  3V91 A;  4EE4 A;  1HM0 A;  1H7Q A;  1IIM A;  4P00 A;  2VXM A;  3SXC A;  2BO8 A;  4B4M A;  3U0Y A;  2RJ9 A;  4FRE A;  1VIC A;  4DDZ A;  3LW6 A;  1V83 A;  1H7E A;  1LL3 A;  3SX5 A;  4FIX A;  4EVW A;  1G23 A;  2XWM A;  3OH1 A;  1H4C A;  1HJJ A;  1GA8 A;  5D91 A;  1W77 A;  2ICY A;  1OQM B;  2VSI A;  4MND A;  1G3L A;  3RMV A;  2VK9 A;  1FO8 A;  3BCV A;  4G3Q A;  3TZT A;  4DEC A;  2V0H A;  4Y7U A;  5C48 A;  4Y6U A;  1ZCU A;  3I0C A;  2WEE A;  4HO4 A;  2ZU9 A;  1R7Y A;  4EEG A;  1H3M A;  4CVH A;  2DPW A;  1VZT A;  4EE5 A;  2XWN A;  4BQH A;  1G1L A;  5C38 A;  2QGI A;  3CKN A;  1QGQ A;  1VGU A;  2RJ4 A;  1Z90 A;  4B2W A;  2GGQ A;  2OEF A;  4D0T A;  5IDS A;  2V0K A;  1GWV A;  2I7B A;  3V0N A;  4M2B A;  5C1L A;  2VS3 A;  3V0L A;  4HO3 A;  3RMW A;  2YQC A;  5FU8 A;  3SPT A;  5C3B A;  5CQO A;  1YRO B;  4KC1 A;  2RJ8 A;  1VH3 A;  1H5S A;  1G93 A;  4D0Z A;  4JIS A;  3PKQ A;  5CMF X;  3ZLK A;  4MIX A;  2BO6 A;  3D5N A;  5CQL X;  2E3D A;  3CGX A;  3K8E A;  2CU2 A;  4G87 A;  1H4D A;  1ZHJ A;  1H5S C;  3TQD A;  1ZI3 A;  3JUK A;  2WVM A;  4ARW A;  3OH3 A;  2OEG A;  4HCQ A;  4Y7V A;  2OI7 A;  4EEM A;  5C3D A;  4K6R A;  2ZU8 A;  1WT3 A;  5FYE A;  1VM8 A;  5AJP A;  3OAM A;  5AJN A;  5C4D A;  3SXA A;  2WGZ A;  1YP2 A;  3F1C A;  4ASJ A;  2VS4 A;  5IDT A;  2Y4K A;  4G3P A;  1PZT A;  1ZCT A;  2WE9 A;  1S4N A;  1LZ0 A;  4UEG A;  3DK5 A;  1WVC A;  3SXD A;  2XMH A;  5C47 A;  4FRO A;  1S4P A;  5C1H A;  1NMM B;  5HS2 A;  1R7U A;  1G8O A;  2P6W A;  4KNR A;  4FRB A;  2X5S A;  3USQ A;  2PGV A;  1R82 A;  4HO2 A;  2X65 A;  2FFV A;  4KNX A;  1H7G A;  1FGG A;  3CKJ A;  5FTS A;  4Y7F A;  2Z87 A;  1JYL A;  1LZI A;  2I5E A;  4B4G A;  4NAL A;  4Y6N A;  4HO0 A;  1GQC A;  1VGT A;  4CJ8 A;  1XHB A;  2Y4L A;  1INI A;  3CKQ A;  2AM5 A;  3U2W A;  1LVW A;  1ZCY A;  3JUJ A;  1LZ7 A;  4HO8 A;  1INJ A;  1O23 B;  3PNN A;  3IOI A;  1S4O A;  4IRQ A;  5FTV A;  1H5T A;  4KXO A;  4O6N A;  2RJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...