3I1FA

Gamma-subunit of the translation initiation factor 2 from s. solfataricus in complex with gpp(ch2)p
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 5-prime-triphosphate end of mRNA recognizes the second GTP-binding site on the gamma-subunit of the archaeal translation initiation factor 2
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
molecule keywords Translation initiation factor 2 subunit gamma
total genus 70
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3i1fA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3i1fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i1fA01
2W6ID 1SVOA 3GLFA 4HAZA 3R7WA 1P4SA 3B1ZA 3W5VA 3QKUA 1N5JA 1VQ6B 4EJSC 1CEEA 1E69A 5AJWA 4RZ3A 2VIIA 3QI2A 2W2XA 2QROA 4M9XA 3U3KA 2IYZA 4LY6A 3RAPR 4LHVA 3SN6A 4LBYA 1CJVC 2XOKD 2H16A 3AB3A 2NO7A 1VQ4B 1F5NA 3EAQA 3D3QA 1E64A 2FEOA 1TF5A 2OBLA 5EQTA 2QDXA 4MITA 2XXAB 4X8MA 2ONJA 3LQQA 4K8OA 4P6VF 2NG1A 4IDPA 2VP4A 1FPMA 3KB2A 3CUEF 2WJIA 4HZUB 1TUIA 4C0QC 2ZRCA 2GBLC 2GXQA 2WWGA 3I72A 2KE5A 1N6KA 4BLRA 1IM2A 5HKKD 1WDTA 4ZKEA 1NMZA 4DHEA 4E09A 1L4YA 4LJAA 1KI4A 4M9SA 5BN5A 1WMSA 4PHHA 5LB4A 4GI7A 1SXJB 4NCKA 4Z8YA 5BYKA 4PSKA 4MRVA 2YYZA 3MCAA 2R6DA 2WWXA 1G6OA 3PQCA 2W00A 3E20A 3L8ZA 1ZUIA 1DO2A 2YWHA 2VPPA 5DNYB 1XTKA 3CPEA 1S4QA 4B43A 4GFDA 4TYQA 3W3ZB 5HTKA 2WJYA 3H0KA 2VYFA 1GRRA 1RC8A 1J8MF 4LBZA 3T5GA 5DE3A 3BJIC 1XJ0A 2G6BA 1K73D 4U02A 3ZGXA 1ZUHA 2FJUA 3G0HA 1N0VC 3PUWA 4L5BA 5CK4A 4UNQA 3FJOA 3R8CA 3RS7A 1QVRA 1CXZA 3LVBA 4RZUA 3GLHB 4F4IA 1G3MA 1Q3HA 2BGJA 1N6HA 1SVMA 3VKWA 2WIBA 2J0UA 3E2IA 4IXMA 3VHXA 3C14C 4HZIA 1AIPA 2B7CA 2DWQA 4DLYA 2XOKA 3MRSA 3V4RA 3K0FB 1OH5A 1A2BA 1IN5A 2JLSA 2QZ4A 3ZC3A 3VQTA 1ZM7A 1S1CA 2XSZD 1Z6AA 4JBWA 3UMSA 4B3CA 4PC1A 3VHLB 3T06B 1KJZA 1NKTA 3QXXA 2BN4A 3GJ3A 2EU8A 1IY1A 2QP3A 3MG9A 1M7HA 3UATA 2PT7A 2JJ2D 2JLYA 1FL9A 3ZS9A 4EKDA 4RKFA 1EGAA 1UADA 1DO0A 4A36A 4XOIA 2ZJBA 1E3MA 1KDOA 3L0SA 4HB0A 4KFRA 5JI3E 1HH4A 2CE7A 4F7DA 2GRJA 1QHIA 1Q20A 4PR0A 2RC5A 4G5GA 2IXEA 5JWOA 4BPBA 3KJEA 4EFLA 4W5JA 1FMJA 1II9A 4CEIB 3REFA 1NSFA 4B3XA 1NVUQ 3HR7A 3B1YA 4R71A 2VHCA 4WAUA 4GOXA 3QXHA 4JL6A 1RKBA 4L9WA 1JPNA 2J3EA 2ZUCA 4LWZA 3UANA 1EFCA 3NG1A 3OEHD 1MH1A 5AUOB 1U2RA 3E1YE 1AGPA 4L16A 2REBA 3KKMA 4LBWA 3QENA 4QBFA 1Z6YA 1ONBA 1U8AA 3CF2A 3CZQA 4AYWA 3THYB 3KKOA 2V7QA 3CCQB 1XEFA 2WSMA 1EWRA 4MKIA 1KZ7B 3RC3A 2CCGA 1C1YA 2JDIA 4HB2A 3ZVMA 1P61B 2IL1A 2WICA 3K9LA 4DLXA 2PJZA 5SZHB 1Z6GA 1VECA 4IVPA 4A6XA 2WWYA 1Z0JA 1MR3F 5DH9A 2PMKA 2F55A 2MMGA 3G82C 4FMCB 1E9AA 2MMCA 1E79A 3EZ9A 4DCVA 2X19A 5BN4A 4PC7A 1KQSB 4DLZA 4LRWA 4AWXA 1KO7A 1ZCAA 3GJ0A 4V03A 4BASA 1OXXK 1XD2B 3PR1A 1EFRD 2AHOA 2YWGA 1E2PA 1NG1A 2WVJA 2WAXA 3KKNA 4EFMA 1G7CA 1DADA 4GNKA 3KKPA 1FRNA 4ACAA 4JKIA 4UNSA 2FSHA 4DSTA 1JAHA 2QNRA 3IO3A 4K1XA 3OZXA 1N6IA 1OF1A 1OPXA 1M1KD 3UIEA 3KXLA 1QX4A 1X6VA 2YOGA 4P0TA 4ZGNB 3DO6A 1D9ZA 2CCJA 4PC6A 1FP7A 4BZQA 3WYFA 1YQTA 1COWA 2I1VB 3GLGB 4AY2A 4XJXA 3QPVA 2E1RA 1NKSA 3KQUA 3P20A 3IDQA 2BMDA 1A2KC 2QTHA 4RD4A 3RDPA 1FW6A 3ADBA 2QA4B 1CTQA 1GKUB 5E7JA 4ARZA 621PA 4TYWA 3CCEB 1ZNWA 1XCPA 2PCJA 3T12A 4JLOA 2CHGA 5FPTA 2QMHA 1FNDA 1QGAA 1DG3A 2D62A 2Q9AA 3IUYA 1Q3TA 2J7PA 3CD6B 4B6FA 1A7JA 2B8TA 2DETA 2H8KA 2HYIC 2R6HA 2F1HA 2EQBA 4Q7JB 3WP0A 4NCJA 2ZE7A 4DSUA 5L3VA 1KHTA 5C4MA 2TMKA 1T4GA 2JDID 4UXHA 1U0JA 2X77A 3VO1A 3A8TA 2PEYA 1T5LA 2V7QD 2KWIA 2ZSFA 3DVLA 3LO5A 1GAJA 2F43A 5M04A 5FUXA 1MRNA 3U3RA 3AP1A 1JEDA 2FF7A 2QN6A 2UVQA 3GLIB 1P2VA 1F6BA 4M1YA 1JR3D 1AK2A 3AP2A 3CNOA 5EP3A 2DR3A 1NY6A 3WHKA 4YONB 5EMNA 3U4QA 2FU5C 1ZYUA 4G5SA 5GVRA 1XBTA 4JLDA 3GJXC 1OYWA 1NDHA 3CW2A 1VG1A 1ZP6A 3IIKA 4Q7LA 4TTRA 3ZDQA 1VQ8B 2QMOA 2VA8A 3EARA 4LDJA 1I4LD 2JJ1A 1TAGA 1SVKA 2VP2A 4WZ6A 1Q81D 3NXSA 4WIAA 4IDOA 2N46A 2O0KA 3GLFB 3QFSA 4RZ2A 2WOOA 4QHTA 1SXJE 4KFTA 2F43B 4TT3D 5GJVC 4OJQA 1ZRHA 1F2UA 3AKDA 4QNMA 3QFTA 3UG7A 1KJYA 3WNDA 1VHTA 1UBEA 4Q4HA 5BYJA 1Z6TA 3LWNA 3W6NA 1VQNB 1YZTA 2Z4RA 2VSXA 4P3YA 1G8YA 4G0NA 4OI2A 3KQHA 4IVQA 1FZQA 4EH1A 1GNQA 5DISB 4YAUA 2GJSA 5AWFC 4JJZA 2BSAA 1JB1A 4C9BA 5D3QA 2ZI9A 2CHVA 1KTVA 4HDOB 4Q9KA 1J9ZA 4DXAA 3FVQA 3K70B 1YR9A 2ZR9A 1E4YA 2V6IA 3PVSA 1T0HB 4BEBA 1RRCA 3AUXA 3CC4B 1LV7A 2W2VA 4HAXA 3SE0A 3ND8A 2PIAA 1QFJA 1F2UB 3O8BA 4B4DA 2BKUA 1UAAA 4WXRA 1QDEA 3RRYA 2OE2A 1GKIA 3BD9A 5G41A 4ERNA 1AMOA 1E2LA 1W2HA 3RS3A 2WIAA 2YJTD 4G01B 4TSFD 4OHVA 3T1QA 1W4CA 1PVOA 3CLVA 3TJZA 5H59A 1P5ZB 2GXUA 2D2EA 2GVZC 1XEXA 4C2UA 3CNLA 2BEKA 5FPYA 4EQ6A 1G4AE 2NO1A 4EPRA 3PEYA 3KTAB 4CYMA 2PT5A 1FDRA 3ZS8A 4D4MA 3VR2A 2VF7A 3Q8XB 4QGGA 3U7EB 5JSZB 2ANCA 1YR8A 1RRPA 2O0HA 4PQRA 2PJRA 4W7SA 2J1LA 1CJUC 4CVNA 1P72A 2ZPTX 3AVVA 1XCGB 1JQLB 1W48A 3VX3A 3ZVLA 3EPHA 4FMDF 4B48A 3JQRA 2ZI7A 2DWPA 1G9XA 3RRZA 2D3WA 2OILA 5GADl 4CEHB 1EFUA 3ES9A 3OIVA 3BWDD 5DHAA 1QGZA 4F93B 4LHZA 3I8XA 2LWIA 1XEWY 2VRWA 2GAOA 4OHXA 1R2QA 2EFEB 3TUJC 3KQNA 3EZ7A 4PX9A 1ANKA 2WWWA 2GEVA 4AYTA 5JLJA 2ZIAA 3W2EA 2ZJOA 2HCJB 1HYQA 3KTAA 4DDWA 3GP8A 4IW3B 4AURA 3KZ1E 6Q21A 4N1AA 3SBEA 3FHOA 4DLUA 1E1RD 1FNNA 1LTQA 1OIWA 2J9RA 1KMHA 3FE2A 4FI3C 4CEJB 3AF3A 1ZJ6A 1OIVA 1E9EA 1QHGA 1SZPA 5HCNA 1E1QD 5G53C 4R2IA 3PUVA 1W47A 1WCV1 2WJJA 1N6RA 4HE5A 1GM5A 4KBGA 4IHQA 1P2UA 4IOLA 2PX3A 2ZE5A 2FPKA 4G1BA 3ZQJA 3TLXA 1OKKD 3A37A 1W34A 1Z0AA 2VNJA 4MH0R 2OBMA 3NDBB 4HDCA 4HATA 4Q7MB 4XIGS 3W5JA 2NO9A 1RFLA 3K70D 1OFIA 3QPWA 1KK2A 1E2EA 1E6CA 1ELOA 3A1SA 3EZ2A 4JMPA 1UDWA 1NY5A 1KC8D 1U99A 1XFAA 4OL0A 1M2OB 1LF0A 4GP6A 1U94A 5FPHA 2FSIA 4CRWB 3LVQE 2F9LA 3Q5DA 4TSFA 2RC6A 2WM9B 3I5XA 3X1WA 1YITB 4D25A 3G4SB 4HAUA 2REOA 2PMDA 2LKDA 1NG9A 4BLQA 1FMLA 2NQ2C 2R44A 4MRNA 1VCMA 3UMFA 1K5GA 4F38A 2AD1A 3NDPA 3QKRB 3AVWA 4QHYA 4IXNA 3CO5A 1F60A 1SQ5A 3QIAA 2VP0A 1B23P 1GL6A 1IBRA 2NGRA 1NN0A 1S9DA 4TMXA 1U81A 4EJSA 2DFNA 1VTKA 1DAKA 5LBIA 5P21A 1KRHA 1QHSA 2QGZA 1C9KA 2ODEA 2IYLD 3BH0A 1I2DA 2ANBA 2ZS8A 2NZJA 2P5SA 4Q18A 1W46A 2R6CA 4IEIA 1VDZA 3QEOA 4TMVA 5JHHB 2XZLA 1FUKA 4N3NA 3W9YA 3GPLA 4Q21A 2VL7A 3IILA 1IHUA 1A82A 2CE2X 5FI1B 1RRGA 2F3RA 2CHQA 1QFZA 2HLDD 4XD7A 2QG6A 3N70A 3A4LA 4KI0A 2GJ8A 4US2R 3PIRA 2KB0A 4LX0A 3NVAA 1XE1A 4YDHB 1QH0A 2J5XA 4BQSA 1ZIPA 4PPGA 3MJRA 2BBWA 2O8BB 3CMEB 1E9RA 2CJWA 2HJGA 1CS4C 2WZQA 3LV8A 3AGQA 2IEYA 4PZYA 2OFOA 1XRJA 1GNPA 2ZRNA 3OJWA 2ZITA 4DQLA 1N8RD 1SULA 4BPRA 1MT0A 4QGHA 3AF4A 4ZDIA 4Q02A 4PSVA 2IYWA 3CCVB 2O8CA 2G0TA 1KZGB 1TF2A 3EIHA 3ONWA 4KFSA 4JLNA 4TLBA 3GLIA 5KDOA 4V0ME 2JLQA 2RCNA 3T35A 1JEEA 5HZKA 3VAAA 2OXRA 4PHFA 4XWAA 1AJEA 4YQFA 3SU8A 3CCSB 3ZBTA 3AVUA 3NBYC 4PO1A 4YMTA 3E70C 5JBQA 3FMFA 2OTJB 3AEZA 5FOWA 4JVMA 2OLJA 1YHNA 3TUZC 5JJKA 2IYTA 1NL3A 4GPTA 2EW1A 821PA 3QQ5A 1QUEA 2XTMA 4C7OA 1R0ZA 4ZCIA 2QMEA 3RABA 1EXMA 5AR1A 4C0JA 3B1VA 3N5CA 3GEIA 2FZLA 1MKYA 1NJFA 1VG9B 4PO9A 1DG1G 1A1VA 1VG8A 1N0WA 2JLZA 3K0CC 4TTQA 2IF0A 2G77B 2LKCA 4U00A 2CEAA 4C0HA 2IA5A 3BIFA 3ZBUA 3QOFA 4OK5A 2V4ZA 2ZM5A 4KVGA 2A5YB 3TR5A 1NN3A 2XITA 4ASUD 1FRQA 4U9UA 3CCLB 4OI4A 2D7CA 2Q3FA 2ZETA 3NKVA 1CRPA 2H57A 4CEHA 1YJ9B 1AS3A 1MOZA 1V43A 3N2EA 4M1OA 3O47A 4DC9A 5JEDA 5KHOC 4DT1B 2QEXB 2HMAA 1PZNA 3LLMA 1OB5A 5D3MA 2OUKA 2C8VA 3QXCA 1IJEA 1KKLA 3NC0C 4E07A 2BMWA 1A5TA 4NCNA 2OAQ1 3H84A 1JAIA 1JJ7A 2GEDA 1QGYA 3LRPA 3ZIAA 4LJ5A 1XTSA 2OFWA 4I99A 2OHFA 2F1IA 2YWEA 2XEXA 1TQDA 3TIFA 3KJGA 3V4FA 3MLEA 1WRBA 3W34A 4DVGA 5K8TA 1T3LA 3DHWC 1KY3A 1CU1A 2ZROA 4MGZR 4TMKA 1OIXA 5HPYB 2J87A 2DERA 2QPTA 4LHWA 3VR6A 3CF0A 2ORWA 3KB1A 4GMDA 1XP8A 2QP4A 1P3JA 1IN8A 2Z5FA 5FTKA 3X1DA 5HR5A 4HB3A 3DKVA 1OFHA 2D4HA 2REXB 3VO2A 1EWYA 1EG7A 3VR1A 2P0EA 2R65A 3TSOA 5GJBA 3EIEA 2QPOA 1CULC 1W4BA 4QM6A 2RMKA 4EAQA 4KXFB 1L7VC 3FDIA 2DFKB 1IXZA 3OAAD 2ZTSA 2C98A 2KBFA 1Z8FA 5EP4A 2BKEA 2IWRA 2WJVA 1TPZA 2BF4A 1XTJA 2QAGC 4URZR 1KSHA 1TQ2A 4LYJA 1MABB 4MUAA 2HUPA 3L82B 2OEPA 3IQWA 1K6MA 3WBKA 3QBTA 2GF9A 5FL7A 4E22A 3BFKA 1ZM4A 1Z0DA 2ECKA 4IOKA 5CYPA 3ZYCA 4X8HA 5KSYA 5B2ZA 2ZRDA 2GWHA 2YC2C 4UNRA 1RW4A 4JLKA 1J70A 4IDNA 4YC7A 1N5LA 1QG0A 3KXIA 2J0SA 3MFYA 4QBGB 1OH6A 5FOSA 4TLEA 3CCRB 1T8UA 1JA0A 2OBNA 3ZVRA 1LW7A 5HXBA 1GL9B 1Q86D 2QENA 4TZ6A 4XSHA 4TL8A 4CEJA 1KI2A 1SXJA 2V1XA 3FPAA 2F1RA 3G5UA 3RSOA 1D2MA 1KDRA 1E62A 1Z2AA 5DI9A 3SJBA 2IEZA 3CBQA 4GL2A 2BDTA 2ODWA 3QEJA 2O8DB 1AQYA 1QBKC 5LB2A 3L43A 5CIQA 4JVLA 4E03A 4G5OA 3OZWA 1IONA 2D06A 3LAWA 3CRRA 4NYMQ 2X2EA 5CLQA 3CXCB 3LH5A 4QXAA 2CLDX 2GILA 2ZYVX 1YRBA 1GVHA 2GZDA 3BS4A 4JLBA 3LDAA 5DIFA 3TH5A 1EESA 2QRZA 4PHGA 4DT1A 1LB1B 1FFHA 1X3SA 4JKYA 2LCFA 1LF5A 2ODNA 3QY0A 3QVVA 1NP6A 1SKYB 1AGRA 3KUDA 1XWIA 1OGJA 4ILEA 2FGKA 2ZRBA 2W6JA 4A2WA 4CF7A 1CQXA 1QUFA 2WHXA 3CZPA 4DLRA 4QKQA 4AI6A 3T34A 2GXSA 4I1UA 721PA 2VQSA 5GJCA 3JZAA 1H85A 2ORVA 4M1KA 4B74A 3RSLA 5ELXA 3QJYA 3LBNA 4TL6A 1WXQA 3QKSA 3UMRA 4MGKR 1XD2A 2V54A 3ZZUA 4URYR 4GBMA 5TVKA 4YXWD 1UFQA 1H8ED 3LXXA 4EPWA 4CGZA 4I1VA 4O2LA 5IDVA 3THWA 5FR2A 4LJYA 4MKFA 4TN1A 3I32A 3LLUA 5FI0B 4BUJA 5FUYA 4D4JA 3B13B 2GZAA 3C7KA 3MHPA 3HU3A 2A5FA 1ZNXA 2FE4A 2FH5B 3DOEA 1S2MA 3EIQA 4KV9A 3HU1A 4S35A 4LYHA 3NHBA 2IS4A 4UXJA 2IS1A 4BE7B 5AK0A 3QVUA 2OFXA 2RHMA 5JCZA 4OI1A 2JLUA 1NN5A 3MAAC 2XNJA 4RD0A 3GLFE 2XB2A 3AVOA 1CF4A 1G8PA 4HLUA 2JEOA 1X8KA 2V9PA 1N6NA 4TQ9A 3PUYA 1E63A 3R8FA 3W5UA 2Q6TA 4C0KA 2HV8A 5LD2C 5JRZA 2WKQA 1BMFA 1LFDB 1WBDA 1DBSA 1AS0A 2ZRGA 2N42A 4Q9IA 3WMEA 2QEQA 1UEIA 1G20E 1XCMA 3JQQA 2J0QA 4LI0A 3PEWA 2SHKA 2XTNA 1Z83A 1EX7A 2OSBA 1S9HA 2ZYTX 1HUQA 4OI0A 1EP1B 5DN6D 2CVHA 2R6AA 3C15C 4Q9JA 1P9WA 3MWYW 3DM9B 3WMFA 1IAQA 2PZGA 3KX2A 3OFNA 3SZRA 1UJ2A 2RGDA 3T5DA 3K53A 3SYLA 2P6NA 3CRMA 2XGJA 3NH6A 3B9PA 4CZ2A 2I4IA 2JLXA 3OJXA 4JJKA 4E5UA 2VNHA 5LD2B 5EE1A 3NH9A 4WBSA 5FL7D 4DBLC 2IX3A 3ZD7A 3VR5A 4FIDA 4YAFA 1SKQA 1IN6A 1G291 1KI9A 1G5TA 1PLKA 2BIFA 4MGIR 5AJVB 3IIJA 4B75A 2ZRHA 1SVSA 4G3XA 4C2TA 1ZU5A 4MA4A 1ZBDA 5UKDA 1VQMB 1XZPA 1KD1D 5CJ2A 1UBGA 4LZZA 2HJVA 5AJXA 5EE3A 4Q66C 2IWHA 3QNUA 4NYJQ 1VQPB 2HXSA 2QM8A 3ZH9B 1W1WA 1XPUA 4ZI3A 3VU9B 3A4NA 3T1VA 1X1RA 3EC2A 1NLFA 2GEUA 1UEJA 3A1UA 1P62B 3QG5A 4KBFA 4NPHA 4RVCA 4JSYA 4W9MC 2ZI3A 1E0SA 3B7GA 4KCGA 1Y3AA 1Z28A 2ZUDA 3CWZA 4MYCA 3T1OA 4TL7A 2W0MA 4B2PA 3B5JA 3W2GA 1D2EA 1NJGA 1OXTA 1KNXA 3A58B 3IPYA 4JZKA 1JR3A 4URVR 3Q5EA 4F91B 1GJRA 121PA 4PZZA 2YNMA 3K0FA 5C46F 3F5FA 4AIIA 5BN3A 2VYQA 1G8FA 1FNCA 2W83A 4RD2A 5AN9A 3F0TA 1GP2A 3MSXA 1G18A 1ESNA 1GR1A 2BJVA 3B9QA 1KO4A 2J41A 4UNPA 3THWB 4IJMA 4YDSA 1RYFA 2XNSA 2QA5A 3W5IA 2PZFA 4ZKDA 4XTCS 1DELA 1BJKA 2FGJA 2CL7X 2ZR0A 2XTZA 3RC8A 1RZ3A 2PH1A 3B6EA 3AV0B 2DBYA 1D1NA 1OW3B 4AF6A 1SM4A 3VNUA 3EA5A 3OE7A 1RRFA 3Q85A 1HTWA 1P6XA 1E94E 1X1SA 2ERXA 3HJNA 2FFHA 3CKLA 4Q00A 4X8OA 4LHYA 3WRXC 3CCJB 3G6EB 3BAFA 3FTQA 1CR2A 1ZNYA 4CDGA 4MDEA 4QJ4A 1NNEA 4IDHA 1GNRA 1GO2A 1WB9A 1W7AA 2A30A 4BRUA 1US8B 1A4RA 3LW8A 1LVGA 4LPSA 2G3YA 2FFBA 1XD9A 4JLPA 4BFSA 5JJIA 1NN1A 2VO1A 1P9RA 2CJWB 2ZSBA 4TLCA 4TLAA 3IO5A 3RNLA 2ZJYA 2XAUA 2KI5A 1KSFX 4GT1A 1IN7A 2EFCB 4LJ8A 3I8SA 3TBKA 4URXR 4AC9A 1JJVA 5KDDA 3ZVNA 2ATXA 1Z2CA 4NCHA 2QUZA 3MJHA 3ZZ0A 1KI8A 5EE5B 4BLSA 2FOLA 3PFIA 3NBXX 1U0HC 4LOAA 4D0GA 1LS6A 2Y8EA 5JMTA 4XWOA 2IUTA 2BWJA 1H8EA 3HWSA 4P4TA 4EDHA 3ADKA 4EPVA 2QBYB 4Q4HB 2AKYA 3HP1A 5F9HA 2PCLA 2MSEB 5GV8A 3FKSA 3GLHE 1SVWA 2GCNA 3RS5A 5L3SB 5FFMA 1JXOA 1QG2A 1H8HD 4DWJA 3EX7C 2FDCA 4JL8A 4ESHA 2ZE8A 4D82A 3VX4A 1P7CA 2F9MA 1M6NA 3I3SR 4EJSB 3TVTA 2IYRA 3AVQA 3NEJA 5AUPB 1M1YE 1U9IA 5L3RA 5JFGA 3AKCA 1G4UR 4I1SA 4Q7KA 3BRWD 4M2LA 3TKLA 2Q21A 4LC1A 4ESVA 2JGNA 1JR3E 1ZW6A 2DPXA 2RAPA 5JZVA 1XX6A 1KSGA 4CEIA 3IQXA 3BFXA 1HE8B 3TRFA 2IUSA 2ZRMA 4KVAA 1KKMA 3SHWA 1VQLB 2OCPA 2IS6A 1IOZA 3FPKA 2QY9A 1DDIA 2KJQA 5J5CA 2E87A 1MO3A 4RD6A 3UWKA 4WQMA 1G19A 1IN4A 2IYQA 1MABA 1Z63A 1ZVQA 4IFEA 4KLNA 3KJIA 4TQAA 1NMYA 5JI2E 1AM4D 2YINC 3AUYA 4HDQB 2HCBA 2DY1A 4D0NA 1CR0A 4YMSA 1E2HA 1X86B 3IBYA 1CKEA 3THYA 2OLKA 1Z5ZA 4MUBA 2VNKA 2QTVB 3OW2B 3ND9A 3ZJYA 1BO6A 1ZD1A 3D8BA 4LC0A 4G1VA 1MV5A 3R9IA 1KK3A 5JSZA 3OEED 1R8SA 5EXSA 3WYAA 3ICQB 2PEZA 1I7PA 4HLCA 4A1FA 3CRQA 2EYQA 3I5YA 1NF3A 5H68A 2NOAA 3VFDA 1UKEA 4BECA 5IK2D 2VHUA 3LQRA 1TNDA 1KYIA 3CIOA 3EZ6A 2GQFA 5TY0A 1W36D 1SHZA 1GDDA 1FQJA 4A2QA 4M9ZA 3X1XA 4GRAA 1US8A 4FWTA 1Q44A 5KUTA 1XMJA 2NO0A 1W0JD 1Q0UA 4LCBA 3OAAA 5FPKA 5KNBA 2G1KA 3B82A 1TMKA 2V8OA 2WKRA 4V0OA 5J40A 1VQ9B 2JJ1D 1YU9A 4RY2A 4PPFA 3GEHA 1K8AD 5EJEA 3PEVA 2JIZA 2C2HA 5IF9A 3JQPA 3SJCA 3CONA 4OHWA 1RVDA 5CM9C 1NLZA 1VQOB 4MGYR 4QG7A 1E9FA 2PLFA 3VKHA 2WOJA 4G1UC 4NU0A 1FP6A 1G3UA 2NPFA 1Z0FA 5LPNA 4BFZA 3QF7A 1JI0A 2UZ3A 5B58C 3A1TA 1ETUA 2JLWA 2RGNA 2OTLB 1DAGA 2ZRLA 2QT0A 2ZANA 3U6BA 1OKKA 4AK9A 1ZD9A 4BFTA 2NIPA 1HE1C 1L8QA 4RKEA 2WSSA 4K46A 1T6NA 1A8PA 1Z29A 1EP3B 4ARZB 1OJLA 2EFDB 3EWSA 3IEVA 1ZM2A 1DE0A 4IDQA 3U4QB 1E1QA 1S0UA 2DCUA 1Q1EA 4A0GA 1EX6A 2J0VA 1WF3A 2YC4C 1E2GA 2FZ4A 2VZLA 2PZEA 2AWNA 3DOFA 2C04A 1DEKA 1D2NA 1KMQA 2Z6VA 3FYHA 4UJ3A 2EYUA 3WBJA 4MYHA 3KQLA 4FK8A 4MYTA 1HT1E 2QAGB 2OM2A 3C4JA 1T8TA 4N3GA 3VNVA 2H18A 1Z06A 1YHQB 4KSCA 4Z1MA 3EA0A 1ZCBA 4K81B 5EZ5A 1Q21A 1II0A 1QVFB 3I56B 3CR7A 4B32A 4DDTA 1JXMA 1EFHA 5CDFE 2QQ0A 4ZGQB 4CIDA 1TQ4A 3GJ5A 3CPWB 1M34E 1OFTA 4BFYA 1OH7A 1CJMA 1KI1A 4Y0AA 2WBLC 4NHOA 3OIUA 2WAYA 5E4FA 1BIFA 4B34A 3I61A 1N6OA 2QAJA 2W6IA 3BORA 2VHJA 1XB2A 1QHYA 4Q1BA 3GEEA 5F9FA 4JYBA 4D6PA 2BOVA 1KDPA 1R10A 4YALA 1O3YA 1BX0A 5KSWB 1E2NA 4KSBA 4QBHA 1GOTA 1X8JA 3B1XA 4V02A 4A8JA 4DSNA 4YMVA 3I62A 2FMXA 4D4KA 2GF0A 3U7GA 1OYYA 4OK6A 1XF9A 3HYRA 4M1MA 5DHFA 2ZU6A 1QF9A 2HT6A 3SFVA 4XSGA 2FSFA 3B2EA 4YAOA 3DDCA 1NVWQ 2RGEA 5KPJA 2Q0HA 4BZPA 4RFSB 3WNBA 5L3QB 3FMOB 1Q1ZA 2R2AA 3AVYA 2GJKA 4B6EA 4Q19A 1GZSA 4B3DA 5FTMA 1OHHD 5SZJA 1G5RA 2BBSA 3I55B 3Q9LA 3SJAA 1IXRC 3VR3A 1T3SA 2YOFA 3C41J 3K8YA 4L4UA 4I81A 5EXTA 1E32A 1GG2A 1OSNA 4LJ9A 4JLVA 1XEXB 4TZ0A 3AF0A 3I73A 1DARA 3FWYA 3W5HA 4URUR 2ZREA 3ADCA 1DAMA 4ZV4A 5H5JA 2GBLA 2HDNB 4KO8A 3DZDA 4B3GA 1XXHB 1TVCA 2N1BA 2R6GA 2AKAB 1U8YA 1KO8A 2BBTA 2VP9A 2J59A 3CPHA 2J0UB 3EWAA 2EIXA 1N6LA 2G88A 4PZLA 4ZPXA 1CNFA 3BGWA 3GMTA 2ZAMA 4PC3A 4DZZA 2DFTA 2XNCA 4D80A 1MO5A 4DIEA 4JVNA 4P32A 4AD8A 4JBXA 2HLDA 4KYIB 4NP6A 4IVRA 2YWFA 4XD7D 1E98A 3TR0A 5BW8A 1G3QA 5TXGA 1MO6A 2A5GA 4FMDB 4DLSA 5FH9A 3F3YA 3REGA 1BS1A 1O87A 4HZUA 5FOVA 4OK3A 1E2MA 2RGAA 4HLUC 1W36C 2ZSDA 5DO9A 3MMPA 3KFVA 4EPXA 1BYUA 2FPMA 2GA8A 3ASYA 2QAGA 1NRJB 1W5TA 1YZQA 1XXHA 2VTKA 2BMEA 2W2TA 1KI7A 3CC7B 1LNZA 1LY1A 2GJAA 2WMOB 3BB1A 2GPJA 2JCSA 1G3IA 1VCOA 1E2QA 5IT5A 1SKYE 5KYKA 2B21A 3BB4A 2A5DA 1WBBA 4CT5A 1E96A 3U44B 1W4RA 3TNFA 3U3OA 2BV3A 2YOHA 4JYCA 2ZJZA 3RHFA 1SHKA 2AXNA 3H1TA 1Z6XA 3SQXA 3CCUB 2NMVA 5FA6A 2RH5A 4B2IA 4Y9UA 2EVWX 2MSCB 1VIAA 4B44A 1NBMD 3H2YA 3KUCA 4P33A 4QNRA 4ZCMA 1G8GA 4GOJA 1NBMA 2GKSA 4M22A 2ZRPA 1II8B 2QT1A 2IF2A 4EIWA 1B2RA 2I3BA 2BC9A 5CLLA 2J7PD 1RPZA 4GP7A 4BLTA 2ZRAA 3K1JA 4QOSA 3U7FB 2A5JA 2IXFA 5FOTA 2OESA 3GJ8A 1Q7YD 3B8HA 4BFXA 4F4CA 4Q03A 1W44A 4BFUA 3FHCB 4FCWA 4FCVA 3CX6A 2QSZA 1WQ1R 1DDGA 2J7KA 1DAIA 1W2GA 4YMUA 4A4DA 5KNCA 3O8CA 2WKPA 4RCZA 3Q3JB 1R0YA 5F3WB 1F48A 3THXA 2DEUA 1E9DA 5DYGA 2P65A 1EP2B 1Z0KA 1HY3A 4JSTA 2YKGA 4C0BA 4XH9B 3E1SA 3OIWA 4ASUA 3EASA 2ONKA 2RGGA 4LV5B 1N0UA 2WPDA 5J47A 3KFXA 4W5WA 4A92A 2O8FA 2IT1A 2W0SA 1R0WA 2EWWA 3T15A 2BM1A 1PLJA 1GFIA 2CCKA 3UXMA 1YI2B 1QRAA 1G7TA 4PAMA 1HT2E 4OKSA 4BLOA 3TUIC 1WP9A 2RGXA 1VPLA 4Q48A 3SS8A 3LD9A 3LXRA 4BGDA 4R9UC 4PO8A 2GNOA 3W8RA 2B7BA 3GJ7A 2ZJ8A 4Q4AA 1E79D 1S1MA 4RCYA 3PCRB 2CK3D 2ZVPX 5TB5A 1YZNA 3BH6A 5CB8A 4LPKA 1XMSA 2OCAA 2MSDB 2IUUA 1EFTA 3TW4A 4GZLA 1BOFA 1OV4A 5F98A 5J4YA 1YJWB 2ODBA 1T5IA 1W0KA 5BXQC 2VNIA 1YKSA 3PENA 1YZGA 2ZRKA 3JZMA 4P4SA 2RGNC 4ON9A 4CW7A 2QQEA 4PQYA 1XPRA 5KPDA 4KODA 2IC5A 2O5VA 1IJFA 3C5HA 2O8FB 3T1TA 3L0PA 4JLJA 1JB9A 1Q57A 4D4LA 3CMAB 2P3SA 2QPAA 4NTZA 1CBUA 1Y63A 2FEMA 2PX0A 3V9PA 2R6FA 3K09A 4ZCLA 4Q5IA 1GAWA 4OQFA 3IIMA 3OEHA 4NYMR 3D7MA 4B2LA 3DMDA 2WTUA 5H8WA 5KSPA 2DB3A 3SJZA 2XNDA 3N2IA 1R5NA 4UNNA 4HUQA 3RS2A 4B33A 2YHSA 3FHTA 3U61B 1TX4B 5A0FA 4F4JA 1CLUA 5EXPA 4TMTA 2ZUBA 3TAUA 3F8TA 5E7MA 1QZXA 2QP9X 4NMMA 2IBMA 3A4MA 3RWOA 3SOPA 1D5CA 1XPOA 1T9HA 4C0SA 4F7WA 4B71A 3QXJA 2GTPA 1YRAA 3ZQ6A 2O52A 4ABYA 4EFNA 2ASEA 1IQPA 3HPQA 5A5GA 4MQBA 1FTSA 1CR4A 4ACBA 3GD7A 2RHDA 1RE0A 4AG6A 2AFIE 5A4JA 4HE6A 5AJYA 2HEIA 4LYAA 2H17A 3TGPA 3KJHA 2WMNB 4OQMA 5C4GB 4QGFA 1VKJA 3M4YA 2ZS9A 1KDTA 2W58A 5AUNB 3O8RA 4CT4B 2GDJA 3DZ8A 3SFZA 2GCOB 3GJ4A 4URWR 3Q7PA 1AN0A 5AUQA 3M0EA 1VQ5B 1Q1QA 2I1QA 1HEIA 3CX7A 4LBVA 1XNJA 1N25A 1P9NA 3HPRA 4NYJR 5SZIA 2GK7A 5FBQB 1OT3A 3OHMA 5E3HA 1HQCA 2QE7A 2CBZA 2ZR7A 2ZRIA 3FMPB 3AKYA 4FXPA 4Z8XA 1KIMA 1TU4A 3L2OB 4OQNA 2KSQA 1GVNB 3ZZTA 5HE8A 4C30A 3QBVA 2EFGA 1QFYA 1NLYA 3K0AA 1E2IA 5DGXA 2OXCA 2AD5A 1E0KA 3IHWA 3RRMA 3VR4A 1K8RA 1TADA 3B78A 3VTKA 3V76A 1BMFD 4D26A 3U7HB 1CJTC 1XMVA 3WP1B 1SVIA 1HV8A 3P32A 3FMIA 2FFQA 3LBHA 3Q7QA 4IOJA 3Q72A 4TLDA 3MWKA 4RFVA 2ZJ5A 2GVDC 3WHLA 1ZMXA 2Q3HA 2AX4A 1KAGA 1RJ9A 1VYVA 2IXGA 1G64A 5H1YA 2HXYA 3ASZA 4RD3A 2DYKA 2VHQA 3TSWA 4FMCF 3P4XA 2VSFA 4DQKA 3CWQA 4G5QA 2ZYWX 3K0AB 4A8JB 2JIZD 3KDSE 3WXMA 4HSEA 1H8HA 3QE0A 4M53A 3BC1A 2X1VA 1RIFA 4Q4JB 4Q1CA 4US0R 2CNWA 2IYUA 1E0JA 3LA6A 1QHHB 4P31A 1MRSA 2GJ9A 3QKSB 2YVUA 4JL5A 1BKDR 5FTNA 5HE9A 3RWMB 3THOA 5CK5A 4D0LB 4KITB 1VG0B 1COWD 3R9XA 2XZPA 3QXSA 1VIYA 3IBGA 1K9MD 421PA 4RJLA 4Q1FA 4B35A 3AKEA 4WVFA 1AKYA 1NIJA 4MRPA 2GAAA 1J7KA 3OEEA 4Y7CA 4V0MA 5CYOA 3SYKA 5B57C 3GLIE 4AG5A 3W3AA 3RYTC 3H86A 1BH2A 4IOMA 1KI3A 3LO8A 1JR6A 5H70A 1II8A 4B3BA 3LBIA 1R8QA 2ZI4A 1Z47A 2C9CA 1DAEA 4W5HA 3MWLA 3NBFA 3GLGA 2FX3A 1PUJA 4Q4JA 4EPTA 5JRJA 3BERA 5C18A 4OQLA 3W90A 1NVVR 2CK3A 5FBRB 1QVAA 3CR8A 1U9IC 2QMUA 1FNMA 2IYYA 4Z54A 2GESA 1GITA 1J8YF 2BVNA 3CX8A 2G1JA 2R8RA 2VSOA 1U8ZA 2G83A 2BM0A 5TV2A 2ZU0C 4US1R 1F20A 3OE7D 2NO6A 3GFTA 2O8EA 4B47A 1TQ6A 1SXJD 4LJ4A 5ANRB 4LJ7A 5CM8B 4PQFA 1E0AA 2OZEA 4GOKA 3QFCA 1KK1A 1KO5A 4DDUA 3BOSA 1N3BA 3C16C 1ZNZA 3CB4A 3TMKA 3CCMB 1Q82D 4NYIQ 4UQOA 1KOFA 2R9VA 4B3FX 1KY2A 2WSSD 3K9HA 3R7WB 2ZI5A 1NIPA 2JATA 3EXAA 4TMZA 3IKJA 4PXAA 2BGIA 5FUWA 5G3ZA 5SZKB 4A2PA 4C0AC 5TDHA 4G5RA 3AF2A 1R5OA 4GZMA 4ZI2A 3BB3A 4DJTA 2FV8A 2VF8A 3UK6A 1DAFA 4A8JC 2BPOA 1W36B 1DS6A 1G8HA 4JBYA 1W87A 1TLLA 3L0OA 2CDNA 1NJID 4TYPA 1TEXA 1XTQA 2PBRA 4EPYA 3WNCA 1B0UA 1FX0B 1M7BA 1R0XA 1R6BX 4HB4A 2JASA 2KBEA 4JLAA 4QHSA 4GDFA 1ZM3A 3AQ4A 4U5XA 4L8GA 3QFRA 5EE9A 4D2IA 2AL7A 5F2EA 1UDXA 2W6JD 2OAP1 5EXXA 2OK8A 2ZVQX 4A9AA 3THXB 2JLVA 1WE2A 2AN9A 3VKGA 3GLGE 4DCUA 5LDDC 1T91A 4QFMA 3LX5A 4C0LA 2JJ2A 4UJ5A 4LJ6A 1DPFA 3NEYA 4LGMA 4BLPA 3BH7A 4KAXA 1F2TB 2VP6A 2XB4A 4UAJA 4NKRA 5IK2A 5J4KA 2VBCA 1KAOA 1QHHA 2BMFA 2FFAA 2JAQA 3X1YA 1GSIA 2Q9CA 2E9SA 2V3CC 4AYXA 1TTTA 2WWFA 4TT3A 4NCIA 2WJHA 1JNYA 2PLRA 4DUGA 8OHMA 2BEJA 3ZLJA 1VCIA 3A36A 5HCIA 4HEJA 1J90A 1KJWA 1R5BA 3M6AA 1YZLA 221PA 1W49A 5JHGB 2CL6X 4RZXA 5DYIA 4LYFA 3SDZA 4BFWA 3W8NA 2UZIR 4PHTA 2NPIA 4JLMA 3IGFA 2V55B 5TR9A 1JECA 1RYHA 1S3GA 5TARA 3TVDA 5CITA 5E95A 4DIDA 1UBFA 2CXXA 3LY5A 1S8FA 2RB4A 3CNNA 1ZC3A 1N6PA 3CM0A 4NYIR 3DEFA 3NC1C 1I2MA 5C2JB 4A15A 4DUGD 3FGNA 3IEUA 4KLZA 4O2RA 2QE7D 3V00A 5G3YA 4OBEA 2IHYA 3WMGA 2HF8A 4KU4A 5JWHA 2GCPA 2ZI6A 4V0NA 3WYGA 2GCOA 3EPJA 1U98A 5IHPA 1G16A 4A0FA 5HZHA 2A3RA 4V0KA 4BWYA 1N2CE 2HYDA 5FL3A 4WA7A 1DVRA 4OQXA 3DM5A 2VHTA 1OB2A 4NL4H 4JS0A 2IW3A 2OV2A 4II7A 4Q1EA 5JECA 3NHAA 4LV8B 2H1LA 1SVLA 5B64A 1E2KA 2A7QA 1K5DA 1E2DA 3CF6R 4OHZA 3AVPA 4PPQA 3U5ZB 4C7OB 1DTSA 1R4AA 1AQUA 1OGIA 4BEJA 3HYTA 2X2FA 3I1FA 5DLQC 1E9SA 5FUVA 4HAVA 1BQEA 1XXHE 1W5SA 4M1TA 2AFHE 2BCGY 2J46A 4O0MA 3HU2A 4EUNA 4NDZA 4QM7A 1CP2A 3QKTA 4DSOA 1EK0A 1KO1A 2C03A 4C4PA 3LVRE 5FR1A 2DFLA 3FFAA 4DCTA 1TEVA 4HI0E 2O8EB 2GHIA 1GRQA 1T0JB 2BBOA 4BZXA 2AR7A 1TUEA 1IY0A 1R7RA 3U6KA 3IPXA 4M21A 3RLFA 5CIWA 2H92A 5KO2A 4PFSA 3CC2B 3OZUA 3EPLA 3NWJA 1IXSB 2Q3MA 4TL9A 1TF7A 5D3MB 4DEYA 5DN6A 2X3UA 3PG5A 3SR0A 2BCJQ 5FTLA 1DOAA 1KMHB 1AS2A 3LNCA 3MD0A 4O25A 1KK0A 5FTJA 3D31A 1UKYA 1S96A 3C8UA 3U60B 4QJ3A 2ZXUA 2YZ2A 3CPJB 4WOPA 3QSYA 4JVSB 3FFBA 4QL3A 3KXKA 1M90D 4Q47A 1Z07A 1XEWX 1JALA 2G9NA 2FNAA 3J81k 2Z43A 4L15A 5L3SA 3EW9A 3RVBA 2XXAA 4Y0VA 4YLGA 2QTLA 3EG5A 4TYNA 2XJ9A 2C77A 5DI3B 4KHZA 4AF7A 4R2HA 4DCNA 1XJCA 4HLQB 2JJ8A 3U3MA 3CRVA 1Q22A 1Q1BA 4HLDA 4A6PA 3AM1A 3L8YA 3QE2A 4PC2A 2B5OA 1Z3IX 3WRYC 4WZAE 2R62A 2QRNA 3GQBA 3K0CA 4MDFA 4FMBB 5B30A 1C4OA 3QUSA 4MKHA 3PXGA 2X8AA 4HUTA 5TMPA 1D6JA 4TMWA 1GAQA 2OO7A 1G7RA 3OIYA 4FCTA 3FOZA 3SEAA 5EZ6B 2QBYA 1GKYA 1GTVA 1D8TA 1GWNA 4C3ZA 2H7VA 3FKSD 3QKRA 4OJKA 1OLOA 4AKIA 3QPUA 4UKDA 1ESMA 4DRZA 3TAHA 2BJWA 5JS7A 1ZINA 3RANA 2VLIA 1H65A 1M74A 4HYYA 2PL3A 3ECCA 4Q01A 2NZ8A 3RRNA 2V1UA 3CH5A 4A0RA 1OE0A 5K8IA 2A2ZA 1CRQA 2OK7A 4R98A 1BYIA 2GETA 3UPUA 5K8LA 4WZBE 1W4AA 1G3RA 1U0LA 5DSZA 2WV9A 1JJ2B 5CDFA 4H1VA 4PTLA 1GL7A 3O8DA 4A0HA 4AKEA 2C9OA 2QGNA 2C78A 5GJWC 4KJZA 4Q9HA 4JT2A 3W6OA 2QU8A 2ZYUX 4A82A 4C43A 2EFHB 3PEUA 1UBCA 4PGOA 4F92B 2CRVA 2F3TA 2QL6A 2O8DA 3OFND 1NMXA 1YR6A 3ZIAD 4Z1MD 1VYTA 5JS8A 4TYYA 1DAHA 4XWKA 1P2SA 2AWOA 2P6UA 3BFVA 4KFUA 4N0EA 4QRHA 2P2LA 4LSGA 4AKHA 1VQKB 4U7DA 1UMKA 1T3HA 2C9YA 2IHBA 3PITA 3AF1A 2D2FA 4XVUA 1GUAA 1P60A 3HR8A 4NE2A 5EP2A 3UG6A 3LW7A 4BFVA 4IKEA 1VYUA 2P67A 2FPLA 2O8CB 3FB4A 3GFOA 1N5KA 1XU4A 2QM7A 4IEEA 4XVRA 3SI7A 3OZVA 1NBME 4TTPA 1KSJA 1P75A 1CIPA 4Q1AA 4H9GA 2Z83A 4Z51A 5FOUA 1J99A 1OXUA 3DL0A 3TW8B 2XX3A 3BXZA 3C5CA 2ZJAA 4R7ZA 4GSYA 2HT1A 5AJZA 1Z08A 3TQFA 1RJ9B 5KSOA 2O8BA 3SNHA 5K8UA 1FUUA 3UKDA 3DPUA 1XTRA 2P5TB 1VQ7B 1FTNA 1CNEA 2UKDA 4Q1DA 1CJKC 1GIAA 5EUQB 3MGCA 2IYVA 3GFPA 2D74A 1MO4A 3QF4B 3ZD6A 4YXWA 1XD8A 1V5WA 2IYSA 2QORA 2ZRJA 2DHRA 1W0JA 1W2BB 2OG2A 3P4YA 4PAOA 2XNDD 5CJPA 4IRUB 4ITRC 2C96A 3CRW1 1CR1A 4MRSA 3K70C 2AK2A 2J45A 4JT4A 1G21E 4DLWA 2IYXA 2DWOA 3U44A 5IRCD 4I1OA 1JA1A 1YJNB 1XJQA 3K9NA 4Q4AB 1VHLA 4YHBA 4PPNA 1FX0A 4LHXA 3EPKA 3AVXA 2CVFA 2IS2A 1GILA 3B60A 4LUCA 5E7IA 4MRRA 3ADDA 4M0LA 3S1AA 4EQ6B 1Z22A 1YJ5A 2CLCX 2OCYC 4L9SA 1FNBA 4QGAA 3U3JA 4B73A 1E1RA 2VP5A 5GVSA 5KU1A 2GXAA 1EFRA 3AGPA 1W35A 1ZD8A 3NBZC 1G41A 1Z0IA 2B6HA 1UKZA 2WJGA 1NI3A 3H4MA 3R20A 4KYUA 2IK8A 2QTZA 1YVDA 1ODFA 4GMXA 1PUIA 4QBIA 3M1IA 2F7SA 3KKQA 1WA5A 1EWQA 3DMNA 2L0XA 4WXPA 4DLVA 1S72B 2Z4SA 4MKGA 2FG5A 3AP3A 4Q4LA 1KNQA 5JEEA 2A9KA 2WWHA 4NONA 2VH5R 1I4TD 4LV6A 2CL0X 1XZQA 3NIBA 1ZU4A 2V6JA 1QG4A 2ZSAA 3BE4A 3PJRA 1E2FA 5J4HA 4HUQB 3PV0A 1NSTA 5G40A 2WPDD 3W6PA 2YV5A 1AZSC 3MWJA 2G0NA 3B85A 3X1ZA 1E9BA 4ZIRB 3W2HA 1ZUNB 1XMIA 4QJ5A 4X8LA 2EWVA 3VU9A 3TQCA 1JBKA 2NTYC 2ZJ2A 4NZYA 4DEXA 4DLTA 3GLHA 3P27A 2P6RA 1H42A 4XVQA 1YR7A 1YIJB 4PAQA 1E9CA 4POAA 3LFUA 1UKVY 1G1MA 3K0EA 2ZE6A 2CNDA 5KDLA 2OCBA 5EUMA 5FBLB 1ZAKA 1BX1A 1E2JA 1X8LA 4P4UA 3SYNA 3SQWA 3SC3A 1NVXQ 2CNWD 2RGCA 2VEDA 3DKPA 1OH8A 3KL4A 1ZC4A 4M8NE 4DCSA 1OFUX 4M1SA 3R9WA 2ATVA 2FA9A 3ICEA 1L2TA 1SGWA 5J4VA 2Q9BA 5JWRA 3ETLA 4D81A 5KTYA 3FKQA 3W2IA 1LS1A 2AK3A 4OYHA 1QHXA 4P4SB 3CH4B 3L0IB 4HAWA 4LK2A 4RSGA 2JLRA 1AKEA 2CMKA 2HF9A 4FW9A 2XJ4A 4H1UA 4IFBA 5GV7A 5FBVB 5HKKA 1AA9A 3A1WA 4M9QA 1N5IA 2XSZA 3U2QA 1U90A 1J2JA 2CLSA 1G5PA 1F2TA 4NBSA 1IB0A 2RGBA 2ZS7A 3I4LA 4TWZA 5C1BA 4YAWA 5L8VA 1GRNA 4DB2A 5JCPA 3P1JA 4WW0A 4OHYA 3TE6A 1JPJA 4B76A 1HQYE 5J4LA 2C95A 4RFSA 3NTUA 4FWIB 1PLLA 2QI9C 3I92A 1KI6B 1M7GA 4V0LA 3G71B 5KSZA 1HURA 5KNDA 3JVVA 4Y9RA 2BMJA 3JVUA 4HAYA 1G6HA 1E99A 5DI3A 2F6RA 3VMFA 1XDBA 3HDTA 3OESA 2K5UA 5EE0A 4DB4A 2XZOA 2RKOA 2A78A 2OT3B 4XTRA 2ORIA 2ZSEA 3SBDA 1JQJC 1QHNA 1AZTA 1YZKA 4RD1A 3A6PC 2ZAOA 4NH0A 1TU3A 1E4VA 3GJ6A 4ZO4A 3EC1A 1HA3A 2JA1A 4UXIA 2C99A 4M1WA 4Q9LA 1M8PA 4BRWA 4I4LA 1P2TA 1FOEB 1IY2A 2F1JA 2O0JA 3LX8A 4FN5A 1UM8A 3T61A 3BBPA 1L4UA 2ZQ5A 1KGDA 3E5HA 2FWRA 3QG1A 1KI6A 1F3OA 5EP1A 4O3MA 3TK1A 4YMWA 4AKGA 3W2FA 1SXJC 2Z0MA 3UWOA 4FD2A 3WY9A 2C5LA 3X2SA 2H5EA 5FBWB 2FSGA 4ZIRA 3MUFA 2AXPA 5CB6A 3PUXA 2ERYA 3P26A 3K9GA 1G17A 3GCGA 4PSAA 4PANA 5THXA 2ZEJA 2ZRFA 4N0DA 1PV4A 4DDVA 5FPSA 1QVGB 4ZDJA 1TL7C 1NVVQ 1VCNA 2B8WA 1Q12A 1OHHA 2GZHA 1YZUA 3D6TB 4J0QA 1UPTA 3BK7A 2B92A 4ZDKA 5KOYA 1OXSC 1P73A 3AVTA 5L3QA 5FOXA 5BWMA 3OF5A 1ZM9A 1YE8A 4MYUA 1I4DD 1G7SA 2QSYA 3AH8A 4DKXA 1FQKA 2QTFA 1S3SA 1XTIA 4ZDWA 1D9XA 3RS0A 3KQKA 3SHFA 1VMAA 2FN4A 3A1VA 3IHLA 2BHRA 1W0KD 5BQ5A 5JJLA 4TQUS 2GK6A 3PUZA 3S1AB 3CRZA 1ZIOA 3K09C 521PA 4S2EA 3K0SA 1OXVA 3TSZA 2D7DA 3QF4A 2WWIA 4JIMA 1PJRA 1UF9A 3EZFA 4FINA 3B1WA 4M4SA 3RS4A 4QC2A
chains in the Genus database with same CATH superfamily
3M70A 4L8LA 3H04A 5I9BA 3R7WA 4X1YA 3W5VA 3QKUA 1RPNA 1URPA 3DQQA 3S40A 1I14A 3JYPA 1JDTA 5LYJB 1CEEA 2BFFB 3QTTA 1W8DA 1E69A 3G7UA 2YH2A 4WKCA 1XCBA 3PNYA 4RZ3A 2VIIA 3A3PA 3B70A 3O75A 3K1AB 2W2XA 4FE4A 3O90A 4MUJA 1GQFA 2IYZA 3AUTA 3SN6A 2A35A 2GARA 1UR5A 1E5QA 3U3KA 5HUQA 4JI8B 2FZWA 1BDMA 2WT8A 4HF7A 5FWXA 1DRUA 1YIOA 2NZUG 1D1SA 1L4LA 1QMGA 2AG6A 1WUKS 5B7GA 1X77A 1E8DA 3R40A 1A7KA 2Y4NA 2OBLA 1RC0A 2A4KA 1SY7A 2X3FA 5EIAA 2C5HA 4R2LA 5DKFA 5F5NA 2NG1A 3O7MA 5A88A 2P7IA 3TLZA 3UGTA 1TUIA 4MQLA 2GBLC 3WK9A 2WWGA 1Y3DE 4LTNA 4YROA 4W1RA 4ZKEA 1NMZA 2VJYA 3ABRB 3FHJA 3BCSA 4IMIB 1WMSA 1JKFA 5LB4A 1S8NA 1VJCA 4ZMBA 3CRNA 1MX3A 4BVHA 3KQPA 5BYKA 1Z74A 2NYAA 3EVZA 1VA4A 3MCAA 3RYFB 4PAWA 1L5LA 3PQCA 1JIVA 2W00A 4X61A 2H1FA 4EA9A 3UXEA 1GGEA 3UH0A 4A1OA 1ZJYA 2JBAB 4IGIA 1X1QA 3V8PA 1XTKA 2PPLA 3CPEA 4X6XA 1ZIDA 4Z86A 3D3KA 4YJ2B 4TYQA 3D8HA 4OSOA 3PC7A 4GVPA 2WJYA 4X00A 1A9SA 3QYJA 4N0PA 1I2AA 2D8MA 5ES4B 2NV0A 1GTRA 2GO7A 3QWIA 4YWJA 3ER6A 3ZU6A 1P1BA 2D1RA 3LY7A 1E59A 3G0IA 3KB8A 2FJUA 2C3PA 2KVOA 2RHHA 3FUWA 5K3AA 4M8KA 1XAJA 3PUWA 2HJRA 4BKMA 3VZSA 2O8VA 3GF4A 4RZUA 5A62A 3COWA 1H66A 3NUQA 3DBVO 1O57A 3LG2A 1Q5PA 1N1EA 1Q3HA 2W8BA 4ZVOA 4AU1A 4UMVA 3E2IA 4UVHA 4JT8A 4H27A 5KKNB 1TC1A 3C14C 4HZIA 4JQZA 4AXXA 4EG6A 4DK1A 1GUFA 4RMJA 1XAIA 1ZXXA 3ZD8A 1IN5A 1ENOA 3R24A 3VQTA 1ZM7A 4Q16A 4B3CA 1Z6AA 3VHLB 2G09A 4G37A 3HYCA 4KPUB 2I34A 1T4CB 1MHPA 2PO7A 3HVJA 5AHKA 4QGSA 4ZT4A 3QXXA 4JOCA 4ZOLF 2EU8A 4ZZ3A 5AVSA 2XWJI 5JALA 5E9WA 3WMRA 2R0QC 2ZT8A 5IP5A 4FGWA 2PT7A 4ZREA 3EF3A 5A3SA 3UATA 3VZBA 4JA0A 3WE7A 1U65A 3SSOA 4RKFA 1TVMA 1ENZA 1UADA 1RDFA 4C6SA 2GHQA 4HYTA 4L3WA 5HX7A 1UBHS 5JWOA 2GRJA 3ZVKA 1V7QA 2YQ5A 3KJEA 1II9A 5LQUA 4DRXA 3REFA 2BE9A 3DEYX 3HR7A 3UWSA 3E7FA 4R71A 2NACA 2V4UA 3CCCA 5GMOA 4P1VA 1ISSA 3GRVA 1STOA 2VTBB 5J9FA 4ALJA 4L9WA 2AMYA 4D9CA 3HYSA 2IYPA 1VRCA 4XIFA 3A7EA 1WOYA 2ZQYA 3UANA 1EFCA 4IIVA 1X80A 4QYIB 2JD2A 4ZQIA 3BXOA 1U2RA 4HL6A 2REBA 3VR2D 3PFNA 4MIOA 1WW8A 1A9PA 3P52A 4N6NA 5E38A 1XKQA 4PFKA 3RS8A 1U8AA 3CF2A 2EKDA 4LMBA 2YWRA 4BJ3A 1EX1A 2J5KA 2YV2A 3B9BA 3KKOA 3THYB 1XEFA 5KNLA 1ORIA 1EWRA 3VYVA 1QTIA 2CCGA 5MHTA 1XRLA 3HO8A 4HB2A 4OM8A 3EDCA 3K9LA 2I8AA 2PMEA 1JU4A 2YQZA 3JATB 4KIWA 1KARA 4P93A 3OPQA 1PT9A 3UHFA 5ARDA 3H9BA 4TRNA 3G82C 3E35A 1W94A 3DUFB 3HGTA 4BO2A 2HLPA 5AHRA 1BDIA 1WMEA 2H4WA 1N8TA 2JBAA 4M9CA 2QLMA 5BN4A 1JTVA 2X86A 3TZEA 4LRWA 1RTTA 1A5BB 3FG9A 3HCPA 4AWXA 1KO7A 4BVJA 4E33A 3R0QA 3WISA 1OXXK 2EGUA 2XWQA 5F77A 1O5IA 4MMXB 1RYZA 3PRKE 1MFPA 3QWAA 5LQSA 1G7CA 3K6SA 5DU2A 2XCIA 2XIJA 3KT6A 4UNSA 4JKIA 3ZYZA 4D9GA 5CX1A 3T4EA 1PQPA 1F4VA 2FEKA 2QNRA 1NATA 3RAFC 3OZXA 4RADA 2IW1A 1IQ0A 1M8JA 4B82A 5ADVA 1M1KD 2QN7A 3E8XA 4JUFA 1QX4A 3KPVA 4Y1EA 4KN6A 4DS3A 3KKEA 5KYVA 1OBVA 2Y1DA 1NQAO 1V8OA 3PKJA 1Y4UA 3DO6A 3G2HA 4PYJA 1BPLA 1D9ZA 5KYYB 3A14A 4H7HA 5B1YA 4ZYZA 5F4OA 1FP7A 3DW1X 3LOPA 4MMZB 2AI1A 2K7FA 4W5OA 1EGQA 3R23A 5E4TA 2LCIA 3P71T 3ZWQA 4D9HA 4AY2A 3QPVA 3JTMA 1ONSA 1XVLA 4G9EA 1BOOA 2B8EA 5E3IA 3TRIA 3ANXA 3HWWA 4Q34A 3RDPA 1Y1PA 2AN3A 3ADBA 2BP7B 2I4OA 5E7JA 4TYWA 2VT3A 4HEQA 4NABA 2HMYB 1XCPA 1HKHA 2PCJA 1MN6A 2QR5A 3O2JA 4LRXA 2ZT7A 4O1MA 3GRZA 3LCUA 1U6JA 4ODIA 5FEUA 4IZ6A 1EFPA 4DSZA 4R83A 2Q9AA 1HZZA 2J7PA 2Q4DA 4DNTB 3ETCA 3CD6B 2BFDA 2NVUA 4B6FA 4KPEC 4H4EA 4Y1RB 3RARA 1HLPA 1H1LB 2R6HA 2ABWA 3WP0A 3G6WA 4Z9FA 3A8IA 1VSUA 2ZE7A 3LT1A 1KHTA 1VJ0A 5C4MA 1I36A 1T4GA 2JDID 3CMMA 4YGXB 3PFBA 3OY2A 1OZGA 2V7QD 2ZSFA 3DYVA 1TM2A 2H4ZA 4MVWA 5TNXA 4B8ZA 5M04A 5FUXA 2R1VB 3IP7A 3OZBA 2C4WA 4PGAA 1XHLA 4P3IA 2VPWA 4WCVA 3GLIB 3HKCA 4AQYB 1N1MA 1TVKA 4RHYA 3GD5A 3Q6IA 1UJ5A 1X80B 4B4KA 4DKJA 2GTHA 3MVEA 1U8CB 3DVAA 1X38A 4QC2A 1H93A 2OQRA 2PS3A 3AP2A 4MVJP 5F12A 3ZBPA 4KQXA 3GZTB 5A9RA 5AKJA 1PKVA 4G36A 3STYA 2OBRA 3HJBA 2FU5C 4WXYB 3TX6A 1PT6A 2Q4EA 4A3SA 2XADA 3GJXC 4TTRA 4Q7LA 1VQ8B 2VA8A 4AX8A 4ZV7A 4RMNA 1HO3A 4FFBB 4FSDA 1V96A 2HCTA 2IKSA 2XPCA 1CRLA 1E58A 5ALLA 3ZN2A 1ZH0A 3CSDA 1VL6A 5EPOA 2B69A 5KTPA 1KTIA 2G40A 9MHTA 4RZ2A 1WETA 2WOOA 4BLWA 4QHTA 1SXJE 2F43B 4GF5A 3IV6A 4OKIA 5GY7A 4NJEB 1L7XA 2O0LA 3AKDA 5HZAA 1F9AA 3UAYA 3C6MA 3UHJA 1CC1S 1KJYA 5JIBA 1MIHA 5BV2P 4FBLA 3R3YA 3TCNA 4BAGA 2ZBQA 3IEXA 3LWNA 3HEBA 3RC9A 3DLIA 5AM3A 2Z4RA 2VSXA 3SJUA 3R0IA 2GA9A 4P3YA 4OI2A 3RS9A 2XYVA 1Y0BA 4YAGA 1FZQA 1NQXA 2Z9BA 3H5TA 5DISB 4GP9A 3V4VB 2KPOA 1PJ3A 2I33A 1JB1A 2M2IA 1V16B 2NNLD 4V1CB 2WUVA 1J9ZA 5KJEA 4DXAA 1PZGA 1AB5A 4OBBA 2PE3A 3E53A 2OHJA 2ACKA 1U2TA 4CTMA 2NP6A 3PVSA 2NSLA 4ALLA 1T0HB 4XLAA 2FCRA 4KXLA 1RRCA 3AUXA 1OTYA 2BELA 3EVNA 5JI2E 2CLOB 1UODA 1MJGM 3G5MA 1CF2O 1OYVA 2W2KA 3ND8A 5JARA 3O1JC 3FPCA 5KOHA 5EZQA 4BTEA 3D2AA 2BKUA 5IJXA 3S8YA 3FNBA 1QDEA 3Q9SA 4H7IA 1GGVA 1U2DA 5JD5A 1HE3A 4FT4A 3R7AA 1WBJB 2P27A 2XDAA 2WG1A 3D2BA 3PUHA 4E13A 2GLTA 4ERNA 5KKAA 3WO0A 2C2WA 2AW3A 2OO3A 3DAHA 1THZA 2ZBPA 1OBFO 4RSHA 1W4CA 3D6MA 2BM9A 3BICA 2HMWA 2IJGX 1X13A 1U80A 4UM9B 5I45A 2BFDB 1CUYA 1ECFA 5FPYA 2NVUB 4EQ6A 4C2UA 1DO8A 1VJSA 2NO1A 1SUBA 2ECQA 3KTAB 4NU6A 2I6QA 2IUFA 3ZS8A 2PMBA 1PL0A 3M5PA 1ODIA 2CFTA 2GF2A 3VR2A 1HSOA 1SD2A 4QGGA 4R6WA 5IKOA 3TOXA 1D2AA 1YR8A 2O0HA 4IDFA 3UMBA 2GK4A 1F0NA 3GZNA 3M82A 4UHBA 2ZPTX 4U2GA 4Z4IA 3TI7A 1U5AA 4RV5A 1JQLB 1IBKB 4MPPA 3EPHA 4HS9A 3JQRA 2ZBVA 1H05A 1YS6A 1EQ2A 1GQQA 2K2QB 2OP1A 3PFKA 3ROMA 4CLRA 5F2NA 2BZGA 2OILA 1FYVA 3GK3A 4YN3A 3WK7A 3CIFA 5TT0A 3UPDA 3BIJA 5JAZA 1D5WA 5ALXA 5H0IA 5BSTA 1ZEMA 1LSSA 2CFSA 3IMGA 1PG5A 1AY0A 1L5RA 2EFEB 2VDJA 3I42A 3CUYA 4IDBA 1PS9A 2O2JA 1THTA 1WLSA 4JC8A 1NX6A 4PSCA 2ZJOA 3COYA 3ON5A 4Z4HA 1OFVA 4ALMA 4JJAA 1I3NA 1V9LA 3EFBA 2LBPA 3F6SA 4UZFA 2A9PA 4M7OA 4PLFA 3X1JA 2LZ0A 4IJ5A 6Q21A 2ZPUA 3JATA 3B1JA 4DLUA 1LTQA 1MA3A 2XTJA 1J2RA 1ZJ6A 3IAFA 1E9EA 1QHGA 4S1VA 1TE2A 3ROEA 2RBGA 1NOKA 1SELA 1MAVA 4RM2A 4R2IA 5E1OA 1W47A 3WC4A 1D4OA 3H6KA 4HE5A 1M2NA 2HHJA 3D4LA 4B3SB 4IHQA 1V9CA 4IOLA 2W2OA 2GYUA 4J1TC 3Q0TA 2FPKA 4G1BA 2CVPA 4R8LA 5D87A 4D9KA 1W34A 2QR3A 2WTAA 1ABFA 4B3MB 3A4VA 4HATA 4Q7MB 3VPGA 3IVRA 4HX9A 1DQNA 3PLAE 5AYVA 3C4VA 1E6CA 1ELOA 1NY5A 1LH0A 2X9GA 4IKOA 1NJ2A 4OJNA 2BE7A 1QKIA 2W5UA 3FWNA 4KKVA 4OL0A 3O3MB 4TOIA 3QVSA 1L7AA 2WHYA 1C8KA 2F9LA 1Y7HA 2O2IA 4RHXA 3V9AA 5L53A 4LA4A 2RC6A 2WM9B 2P6MA 3A1CA 2EZ8A 4ATNA 4D25A 3HJFA 3G4SB 1YCHA 4WL0A 2PQMA 2PMDA 1PJLA 1NG9A 2Y2UA 1T0PA 4DDMA 1Q7GA 5G0UA 2NQ2C 2YNMD 3MF4A 1B4DA 4R9RA 4CHTA 1OZ0A 4XUEA 1JHOA 2UYCA 5ITZB 2J0EA 4F38A 4G7WA 2AD1A 4P3OA 4JUCA 2O8NA 3QKRB 4QHYA 5HILA 2AG1A 3A2MA 3ETHA 3CO5A 1SQ5A 2QT9A 4BQIA 5CVCA 1GL6A 1VHWA 3GFVA 3WGHA 1G98A 4Z0NA 3TQHA 3BD8A 1L7NA 4TS4A 1EUDA 1JZQA 2JGKA 5C80A 1TW3A 2VJMB 3I6MA 2AIRA 4KC0A 1QHSA 2AZTA 1C9KA 1DKLA 2ODEA 2W2PA 4MWCA 3GNQA 2ZW9A 4RLFA 3ZU5A 4Q18A 1W46A 4HXFB 1J09A 2R6CA 4N03A 1EZ4A 1C1XA 1Z5PA 1YI8A 1FF9A 4EI9A 3LUJA 3T3GA 1FUKA 4N3NA 2HY7A 4FFMA 4LMAA 4O2BB 3I83A 3RYCB 4Q21A 1MORA 1HDGO 3QGMA 2YHBA 1IHUA 5E0OA 5IARA 5EVCA 2AZMA 4AMUA 1J06A 2XRZA 2R11A 1QFZA 1ARZA 1FCJA 1YIDA 2DTXA 2HLDD 2J6CA 2C3OA 3A9UA 3OCCA 4WZAB 4YJGA 4CMIB 2DXIA 2J3DA 5CG1A 1Q6ZA 2KB0A 1ULBA 2O2ZA 4LX0A 5A5EA 3NVAA 4NYMR 1T9GR 1T1IA 3IEKA 2J5XA 2LDXA 4GX2A 4OJYA 4BQSA 5AI4A 1V3VA 1L7QA 1PYGA 4QUBA 3MJRA 2BBWA 1GQOA 3NOVA 4TWBA 2HLHA 4HXEB 3KSDO 2O8BB 4O33A 3ZCUA 4MUKA 4RPLA 2RH8A 4UUBA 2HX1A 4KN8A 4PZYA 1OZAA 4G07A 1GNPA 2ZRNA 5BUZA 3OJWA 1L5YA 3SD7A 2LIPA 1MBZA 2XDWA 2V0CA 4TM8A 2PUVA 4DY6A 3NS7A 3L02A 4QGHA 5JAQA 4Q02A 2W4IA 4BNUA 1WXHA 3BD6A 1Z7BA 2WJZB 5I9TA 4IHKA 3EIHA 2F59A 4U2KA 4KFSA 4OJTA 2GAFA 3N2YA 4NBNA 4XPZA 5F3DA 5ULLA 1FFCA 2C7RA 4LF9B 2GBGA 2O5EA 2JLQA 2POCA 3WRWA 1JG2A 4ZVSA 1Q91A 2W48A 4FCCA 3UEOA 4UQLA 3KL9A 4ER0A 5IM4A 4AS1A 3CCSB 3T1HB 3MWDA 4KYVA 3PIDA 4WOBA 3NBUA 4PO1A 3H5WA 4QRDA 4WOKA 4WN3A 4EB6A 4N39A 4BOYA 5JBQA 3FMFA 1NC3A 4KQ6A 2WK1A 3Q3EA 1CX9B 1OBCA 1VBMA 3AEZA 3KEGA 1NPTO 2FW1A 4FNOA 1V16A 4UTXA 2H1SA 3IJ5A 4R2XA 5JJKA 2IYTA 1GTSA 3QELA 2FPPA 4X7MA 2XTMA 1RBMA 4C7OA 3LDUA 3HXPA 2PTGA 4ZCIA 2P3LA 3DXFA 1ODKA 1Y0YA 2HA7A 2JFVA 3I34X 3IBFA 3NORA 3RABA 4AWAA 4F4FA 1JSXA 1TMGE 3SM9A 1GPMA 2HEGA 1C9DB 2PZJA 3IODA 3KFLA 3N5CA 4MVJM 4RQTA 2ES4A 2CSXA 1UOOA 4PO9A 3OLCX 1KFKB 1T9DA 2WE8A 1YI0A 3NHPA 3P9CA 1F51E 2JFZA 3K0CC 5CFQA 5KQRA 3RTBA 4WDQA 3FB1A 1BCRA 1ACMA 1RXIA 3R7BA 2CVQA 3I5MA 3LP8A 4C0HA 4HNSA 2VNSA 4TKOB 2RHWA 2FPIB 2IA5A 3AKZA 5G1OA 3QOFA 2VTDA 3CR3C 2V4ZA 4MDYA 2CKDA 4P34A 5ECDA 2A5YB 2YJNA 2O1WA 4AMGA 4C6HA 4ASUD 1CDZA 4BXOB 1V6SA 1XZFA 4I7EA 1RBZA 2N75A 2YMPA 3NM5A 4S12A 4XUGB 3HA5A 1AS3A 1V43A 1Y33E 3CFYA 3N2EA 4FS3A 3GI1A 3WQRA 4BKPA 2LIVA 2PH5A 2DQKA 1PZNA 3LUFA 4RDKA 4XN3A 3KXPA 3EH1A 3VPXA 5D3MA 4ZOLB 4LOJA 1KKLA 3PNBA 4MWBA 2PU7A 4E07A 4O2BA 2WYHA 2OAQ1 3H84A 1JJ7A 4L02A 4BJHB 1QGYA 1TOAA 3BMXA 3LRPA 4YRSA 1EFVB 1LCIA 3EY4A 2OFWA 2X2PA 2QHXA 4DREA 2F1IA 2P69A 2YWEA 4YDQA 4HS4A 5ALKA 1KR5A 1TQDA 4OAQA 3DOUA 3KQWA 3MLEA 3W34A 1FDOA 3TNDA 3DHWC 4W7HA 1SFRA 2AJ8A 2ZIZA 3I52A 3HUDA 3I2FA 3FGZA 5HS4A 2VHEA 2Q6KA 3Q3IA 4KWTA 3ZWAA 2J3QA 2X4DA 2J87A 2QPTA 1DT5A 4YI3A 2ORWA 2C0CA 1TJNA 3DP9A 1P0CA 5FHRA 2WD7A 1O95A 4UTPA 3L7OA 2FKAA 1IN8A 3HHPA 2X0DA 2CDBA 3X1DA 5HR5A 2WP0A 4HB3A 1TEZA 3Q8WA 1BA3A 3DKVA 4GHWA 3TLCA 4DPKA 1EG7A 1UBTS 3ZY5A 4NNJA 1DCTA 2PL1A 3O8QB 3NHLA 2C4VA 4QYSA 1VFPA 1KEEA 2B98A 2XUGA 1L6IA 1PX0A 3S4YA 4MI1A 4BO0A 1ZD2P 1HDYA 3DHNA 3R74A 1ZOIA 2H0RA 3ZX5A 2VHZA 5BXYA 1ZVKA 1F7UA 3PFGA 4TPKA 4Z4CA 1B74A 2CMHA 4ZAGA 3RUEA 4OA5A 4TWIA 1TPZA 2M9MA 2BF4A 4HADA 2OL4A 2QAGC 3S44A 3E23A 3TZHA 3PT5A 4WGGA 2P2DA 5AVQA 3R5FA 3VNSA 3CUKA 4F5EA 3ETNA 3L82B 2OEPA 2PRIA 1K6MA 4KOAA 4Z9YA 2QLTA 4E22A 3N28A 1ZM4A 1Z0DA 5CYPA 2ACVA 4X8HA 1OX4A 4X1KB 1KQGA 5B2ZA 2DUUA 3BCDA 2D1SA 2YC2C 1M1NB 2H9YA 2JBHA 3FDZB 2JD0A 1K8QA 1XF1A 1I6KA 4ZYUA 5EJ5A 2VAPA 2WFMA 3QM1A 4J94A 4B7ZA 2HK9A 3IJRA 3L7YA 4OF4A 2C61A 5L40A 2N1MA 3N7UA 1JA0A 2OBNA 4YIKA 1LW7A 2PRSA 5K6RA 4DEVA 4J7CA 1VJ1A 2H5JA 3ABZA 4N5NA 3F71A 2V1XA 3FPAA 1PJTA 2ZBGA 4ZRMA 4ZT7A 3SEZA 3DDOA 2XLCA 1OI7A 1Z2AA 4ZHQF 3P2OA 3IPCA 5B36A 2NZYA 3NOXA 3P5SA 4WKOA 5IHXA 2VJQA 9ATCA 3TGWA 2VJLA 2BDTA 2OVBA 1NW5A 2EJCA 3WLFA 5AH0A 1QQ5A 3QEJA 2I9KA 2VQ6A 4TV8F 2CXTA 5KQSA 3JYOA 1N33B 2ZJFA 1YRQA 4ZC8A 5AXBA 3CPSA 1P6QA 1R4ZA 3ELDA 1DZ3A 3F6BX 4RFLA 3TPZA 4CUKA 5CFRA 4NSNA 2X2EA 4GIBA 3CXCB 3LH5A 4QXAA 4CKEA 4G8DA 2PGAA 4HOYA 2ZYVX 4JLBA 2MINA 4MPRA 5DIFA 3TH5A 4BMVA 3WNZA 2QJTA 1Z4NA 3ET4A 1LB1B 1YBFA 2PX6A 4G0XA 4PCUA 1X3SA 3EUAA 2H4FA 5EI5A 1JE0A 2X8WA 3PGA1 3QY0A 3WK5A 1R0BA 3QVVA 1IZ9A 2UVDA 4BNXA 3FR7A 1NLUA 4KWCA 1F6WA 3A6HA 3VI4B 1VKRA 3OCUA 2VK8A 4WZTA 3IQFA 3V32A 1XA4A 1XWIA 4LGCA 1C9JA 2Q5FA 1GZ7A 3DC7A 1E5LA 4G09A 2KQUA 1B6RA 2IZ6A 4OFXA 1CQXA 1QUFA 2WHXA 3DBRA 3EIUA 3G0BA 4K9OA 4DDKA 4DLRA 5CH3A 1HNWB 3EWIA 2GXSA 3OG9A 721PA 3DSRA 3KJFA 4IZOA 4AUEA 3QHAA 4IIHA 3W4JA 5FV4A 5JNRA 5FWXB 3QJYA 1C50A 4RTSA 5ELXA 3EDMA 1KS2A 1KVUA 2YMQA 3NRCA 1XD2A 1FLVA 1TLTA 2V54A 4IUBS 4URYR 2PPVA 1O54A 4XD2A 3K32A 5DLEA 1H8ED 2QTTA 5TVKA 3EZGA 2GUGA 1MC8A 3LXXA 4EPWA 4I1VA 4O2LA 4CGZA 5J2UF 1TO2E 2O19A 3DEIA 3M2TA 4OGWA 5LXTF 2X8JB 3I32A 5FI0B 4EB0A 1TCAA 2A5FA 1M2OA 1XWWA 2VDRB 4UCQA 4BUZA 2OGWA 1TIPA 1NYTA 3DOEA 5JTTA 3CGWA 2CLKB 3EIQA 2RFLA 5HMLA 5TPWA 4LCJA 4UPDA 4MZXA 1SK8A 1YX2A 2A14A 3CEPB 3M5WA 3QVUA 5AK0A 2RE8A 2RHMA 2Q3JA 1A77A 3QY9A 1NQTA 4XKVA 4J0GA 2XY4A 5LUBA 2HHHB 2ZCVA 2I6FA 1G8PA 2DWUA 3VTZA 4RAQA 3OICA 1RAEA 2P9TA 1YCGA 4B3HA 4XYLA 3PUYA 1E63A 4QPDA 3NNNA 3R8FA 3W5UA 1C81A 2Q6TA 3DV2A 4C0KA 2HV8A 1I4WA 3ZKWB 1KPGA 4XUDA 2HA6A 3EGVA 1WBDA 1PRYA 2RHJA 3F96A 3EK2A 2QEQA 4Q9IA 3W3AH 1Z2NX 3JQQA 4BQEA 5CUQA 2J0QA 4PNEA 1ZH8A 3PRHA 1JKIA 4MCIA 1HUQA 1UJCA 3TYXA 4GU5A 3H4VA 3IUMA 4DR6B 2Q27A 3ASVA 3D4PA 3NEPX 4QLBA 2OCDA 3GLSA 3RVPA 3SK0A 1H2RS 3MWYW 3TZQA 3MQ2A 3OFNA 3T5DA 1JG1A 4JGGA 2XGJA 3F7MA 5IAEA 1C1HA 2HIAA 2PYZA 2Z04A 1V11A 4ENVA 1T0BA 4RULA 3WWYA 1AXRA 5LUAA 2JLXA 3NAGA 2D6FA 2Q07A 3U5TA 3VZRA 2CKMA 5JOQA 2QRUA 4NPAA 4O1HA 4Y6RA 1NR7A 5A4AA 1SO8A 1U7HA 2QLLA 1WHTB 4KPUA 3IIJA 4P86A 3M83A 1CJBA 1YU6A 4G3XA 2C2ZA 3UJ9A 4C2TA 2JI4A 3VJMA 1XZPA 2IWHA 5CJ2A 2UV8A 3ZE0B 2HJVA 2Z4TA 4CLHA 4NFYA 2NUAB 1AKVA 2AG5A 4WINA 4YJFA 3ZH9B 1XPUA 1W1WA 1M76A 1WF6A 1Y7PA 1OVGA 4MYSA 1KC3A 1X1RA 4GE3A 1KP9A 4JY7A 5L7WA 3P9RA 1NLFA 2J67A 5DT2A 4TVOA 1OR8A 1C1DB 3WGOA 4JSYA 4BNIA 2B34A 4EYEA 2HIHA 4EVSA 1NMSA 1UQRA 3P9IA 2P4EA 3ZHVA 4P7BA 1C41A 1U8FO 1Z28A 4RMIA 3OEWA 1Y5NA 1QYRA 3T3OA 2QD2A 5TRDA 3B5JA 4FDLA 1XVVA 3W2GA 4EATA 2RB5A 4UOZA 1L4NA 5I4BA 4F91B 2IHTA 2PJDA 3ENNA 2TS1A 2QYOA 3DZKA 4NV3A 3HADA 4M0CA 4OLJA 5KX5B 3IT3A 1HYHA 3FTDA 5BN3A 1DIGA 2W83A 4YIHA 2XBMA 1IM5A 4DC1A 1OFUA 1SOVA 2Z08A 4MLCA 3JXEA 5BSVA 3AI3A 4R3NA 1L3IA 2J41A 1UK6A 4XRGA 4YRZA 4IJMA 3ZV6A 1YBMA 4Y6SA 2OLEA 3N8KA 1O6GA 3HB5X 4PZCA 3UW3A 4I1PA 4MA0A 1KFEB 2FGJA 1BJKA 3AERA 4IJ6A 4DF3A 2CL7X 2FN7A 3DJFA 5C7IO 3CJRA 1IULA 1ATIA 1H0HA 3CNBA 3B6EA 4DCOA 4F6RA 3JASB 4HH0A 3RC8A 4HH4A 5CCDA 1HDRA 1D1NA 1OW3B 2Z30A 3ESRA 4Z4WA 3EC7A 3KQVA 1RRFA 4QULA 5EUQB 3BMNA 3Q9NA 3HJNA 1U2GC 3WWDA 5JO0A 4X8OA 4RL4A 1EK2A 3I04M 1KPIA 4D9JA 1FY2A 4PIVA 4ZYYA 4UUPA 4ZA2A 3WB1A 3MILA 1ZNYA 1SKAA 3QU2A 4L4ZA 5EOVA 4XNFA 1JMVA 2ZUUA 3M4NA 4IDHA 4N3AA 2P2YA 4V2UA 1UXHA 3F6YA 4WDRA 5ALGA 2PSFA 1L8LA 2W4QA 4I4NA 4JELA 2JKVA 4LSWA 4D42A 2A30A 1US8B 4XXHA 2Z95A 3LW8A 1LVGA 3RU9A 2X58A 2CLHB 3PUJA 4F84A 2FFBA 2Q1UA 1WCXA 3Q6MA 2P30A 3CH7A 4Y9TA 3L84A 3RIHA 3RW9A 1NN1A 4BFSA 2VBTA 2CZCA 4OXIA 2AVNA 1JHPA 3D9QX 5JU6A 3IO5A 2XD9A 2KI5A 4RTRA 1Y9AA 4UMEA 1VB5A 3ASPA 3PZBA 1NVBA 1G5IA 5KDDA 3ZVNA 1R15A 4GL4A 5BNTA 2VPTA 4G8BA 4NCHA 3PFFA 4KFCA 2QUZA 1PR2A 4BLSA 1BHO1 1ZD5A 2FOLA 2DPHA 5HIAA 3UMVA 2IUTA 1H5QA 4DJAA 2BWJA 3EHDA 4Q12A 3KJZA 5GM2A 2R8XA 4G41A 2CBXA 2BKLA 5A6SB 4KR6A 1ISRA 4Q4HB 4K2HA 3HP1A 4L8YA 3GLHE 3WTCA 1T25A 1G5QA 4NQZA 3EXG1 5JMOA 2NTEA 2MSLA 3MJ4A 2IGTA 2IDZA 4MR7A 4MV8A 3T9AA 5K0BA 5L3SB 1OD6A 4DWJA 1HRDA 5D7BA 2EEZA 5IWCA 2PA0A 2F9MA 3BC9A 3EDOA 2V6FA 1VLHA 4YO8A 2IYRA 5DP2A 1YDFA 3AVQA 3WRVA 4DR4B 1I0LA 1XNQB 1U9IA 3C6YA 3PC4A 1P1RA 4LZOA 1UP4A 4NOKA 5I8WA 4D8XA 5JFGA 3K1YA 3SZGA 4I1SA 4Q7KA 2HC9A 1CF9A 1EXVA 2QL7A 3AEUB 2FMIA 3VH1A 3LT4A 5C7YA 3CVYA 1ZW6A 2DPXA 4LISA 3KHTA 3L1VA 4PEVA 2C2MA 2HRZA 5BN5B 1KSGA 3C1UA 2X0EA 4A8HA 5DP1A 1SUCA 1ZGJA 2R8ZA 1KE2A 4LFAB 2IUSA 2O2YA 1UEXC 2GN2A 4XLZA 3HGMA 5ERXA 4MEBA 1G1AA 3GCDA 3CUWA 4ZZIA 1IOZA 1O6CA 2P0AA 2QD5A 4LGVA 4RD6A 5IYZA 5K45A 4WQMA 1TK2A 2I4RA 3FLAA 4PZEA 1NRIA 1X7XB 1VL5A 1TLFA 4PX2A 4PYQA 1ZVQA 2WYIA 5BWNA 2HOQA 2PSHA 2ZIGA 4L2IA 4RU1A 4BV2A 2DY1A 4D0NA 4YMSA 1K92A 1E2HA 1VMDA 1I9CA 3GAFA 3GEGA 1CKEA 4ZI5A 3THYA 4UTNA 1MZVA 2C7PA 3OW2B 1J0CA 2QSUA 1EDEA 2NVOA 2SICE 5E9AA 5IUJC 5AW6A 1XALA 3UFBA 4G1VA 4CM8A 2FRDC 4BVEA 3GQBB 5JADA 4RV9A 1I7PA 4XN0A 4P8RA 3GZJA 1YGPA 4AS3A 3V8QA 5D1NA 3TIGA 2A9QA 2B4RO 5JS6A 4MR9A 1UOEA 4KQCA 1IK6A 1E3EA 5CTAA 3VFDA 4BECA 1PG2A 5LSAA 2V0GA 3ZIDA 4AFNA 3LQRA 5C51B 1SK9A 1TNDA 4PM4A 2YHAA 3LGAA 3EZ6A 4QD3A 5TY0A 1BCSB 4OL9A 4ZI7F 5EWLA 1WOSA 1BWSA 1U6KA 3HB7A 5LP6F 1US8A 4KQEA 4FWTA 1Q44A 2EF1A 4HPXB 4JQYA 3GYBA 5FNVF 4BMCA 2VBIA 3V2UA 2FRXA 2FMTA 1Q0UA 2Z2XA 1HT3A 4LCBA 1ZJWA 1DX6A 2G1KA 3B82A 3DBOB 1UIRA 3OJEA 4PGHA 3ZZMA 4EZBA 2V8OA 2WKRA 3CF4G 4V0OA 3CJQA 3R76A 1U7PA 4I2VA 4BYGA 2JJ1D 1YU9A 5H83A 1R8JA 2ZJ1A 1RXUA 3KR1A 4TSKA 5M2QA 5H82A 2C2BA 4F2WA 3BN3A 3SJCA 1XYVA 4L72A 1RVDA 2ZL7A 3MS2A 1VQOB 2YIMA 1I6MA 4MGYR 4WCDA 2Z5GA 3MIIA 3AIIA 1E9FA 4GRIA 3C8MA 4QG7A 4YRFA 2IYFA 1GNLA 5JTUA 4MCJA 2GOYA 5THKA 4DR5B 3TDKA 1BU5A 3AESA 3CLKA 3CP2A 2LE0A 4MUIA 1FVHA 3P8ZA 4RK7A 2OYSA 2V03A 2WF5A 4QSHA 4INZA 3NASA 3QF7A 4BFZA 1HFJA 4DNFA 1AF7A 2ZRQA 4EHLA 2WAAA 3RSGA 2D2IA 3VX4A 5B7NA 1FJGB 4RVSA 5J1SB 1CEYA 3PNKA 3PK0A 2YZGA 1OKKA 1FFGA 2WSSA 3BZUA 2RGYA 4EAAA 2MT9A 1T6NA 1A8PA 1EJ6A 2HSGA 2PG3A 4K46A 1JEJA 3O1LA 3RFUA 1ZM2A 1UBSB 1U3VA 2WJAA 1MQAA 2IVZA 1E1QA 1Q1EA 2DCUA 4J07A 1R3UA 1KYXA 3AG5A 1WF3A 1EXDA 1DI0A 1E2GA 2JFXA 1HEUA 2VZLA 3FYHA 3KJNA 1ODSA 2C1EA 2ZG6A 1K7SN 3L6BA 5BMVF 2C2YA 1J2TA 5D85A 4UVEA 4MYHA 2YRFA 1P2BA 4XYGA 4FK8A 1KOLA 2X5XA 1SD5A 3C4JA 5KTOA 4BCDA 1APBA