3I1FA

Gamma-subunit of the translation initiation factor 2 from s. solfataricus in complex with gpp(ch2)p
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title 5-prime-triphosphate end of mRNA recognizes the second GTP-binding site on the gamma-subunit of the archaeal translation initiation factor 2
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 70
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3i1fA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3i1fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i1fA01
4B43A 1U9IC 5HCNA 1ZP6A 3DKPA 1TF7A 3T34A 3L0IB 1UAAA 4WZBE 1IXRC 2F3RA 4P31A 4ZDJA 3VR2A 1RRFA 1NLFA 5DN6A 4A0HA 2FOLA 2J59A 1F48A 3C15C 2WJJA 4NBSA 2QMOA 2VH5R 1ELOA 3CD6B 1FRNA 1DTSA 1ZM7A 3L0SA 4KXFB 2XNDA 2DFLA 5JCZA 2FGJA 4GRAA 2OEPA 5EXXA 1I4TD 3X1YA 1GNRA 4URVR 2QBYA 3Q5DA 3BS4A 1QVAA 3FYHA 3CMEB 2ORWA 1D9ZA 4OI0A 3TKLA 1XTKA 5FTLA 1C4OA 4PQFA 3UG6A 2RGBA 4TZ0A 3KQHA 4NZYA 2QRNA 1K5DA 3A58B 2AWOA 4BFXA 3LBNA 2A78A 2EU8A 1AQYA 4PPNA 1GVNB 1MO5A 2GTPA 2N1BA 2VRWA 4B73A 1U8YA 2A3RA 4URWR 2HMAA 4A8JA 1DG1G 2HDNB 4C3ZA 3GMTA 1PJRA 1Z8FA 3Q7QA 2HYDA 1F60A 3AV0B 3HR8A 4JT2A 3X1DA 4A4DA 4UNRA 4UJ3A 4DUGD 4CEHB 4PQYA 3M6AA 4JL5A 3RRZA 4YMUA 2A5DA 1Y3AA 4RZ2A 4YDSA 3SBEA 3NEYA 3I5YA 5L8VA 1E2DA 1P9NA 1Q86D 4KSBA 4PSKA 2GPJA 5EUMA 2ZJZA 3F3YA 1LS1A 3IBYA 1LB1B 5JSZA 5SZIA 1UDXA 2G1KA 3BJIC 4KFTA 2GETA 3TW4A 1IN4A 3CCSB 1A2BA 2QP9X 4HZUA 1W46A 4L16A 1KO4A 4MH0R 3GLFE 5H1YA 3IO5A 4CDGA 2XOKA 1CR1A 3N70A 2OK8A 1KI1A 4OI2A 4ITRC 3LX5A 3ND9A 1O3YA 4QBFA 1SHZA 4IVQA 4BRWA 4I1VA 1XXHB 5CK4A 2G83A 4FMDF 5GJWC 2IXFA 1J2JA 4F7WA 4ILEA 4LRWA 1OE0A 2ZROA 5TR9A 4UNNA 3A1UA 521PA 3GLGB 2JJ1D 3DPUA 1CULC 3GFOA 3A8TA 3QXJA 4ON9A 5CITA 4W5WA 3W8RA 3CXCB 2ZJBA 3QXXA 2XNCA 2QTHA 2KSQA 3FWYA 2C95A 1N6PA 1T3SA 4R7ZA 2XXAA 1ZU4A 3MG9A 1OB5A 5JRZA 1IJFA 2R44A 1Q3TA 3GLIB 4Q02A 2C9OA 4A36A 1QHSA 5CDFA 4C4PA 2BV3A 2FU5C 1IN7A 1E2MA 3D8BA 1VCMA 2JLWA 3OZWA 1FP7A 2ERYA 2VNIA 2YYZA 3LRPA 4JLMA 3R9XA 2ZETA 4CIDA 1CR0A 4JVMA 3MD0A 2KB0A 1R7RA 4OHXA 1BIFA 3UXMA 5FPHA 4ZCMA 1QF9A 2FNAA 2W58A 1P6XA 3KKQA 4W5JA 3EZ2A 3LV8A 4RD2A 3TUZC 4MGZR 1SXJD 4K81B 1GITA 4B48A 2IYYA 4Z54A 4AYWA 4C0HA 1VQ9B 1KMQA 2IS4A 2JEOA 4IOKA 3IQWA 1KTVA 3K0FA 2WVJA 3PUXA 2PLFA 3WBJA 4DLVA 1NIPA 1P9WA 5H8WA 1E9FA 1W48A 1R5NA 5J4HA 1CR2A 5CYPA 3ZQ6A 4Y7CA 2GCOA 3SBDA 4JLAA 1CF4A 2ZRMA 2HEIA 1OPXA 4QNMA 2ZRIA 2IUUA 3AVXA 2IYUA 1KMHA 1ZVQA 3FFAA 1BJKA 3P32A 4ARZB 3AUYA 5JEEA 3I3SR 2WWYA 2P6UA 4JLJA 1UBCA 4PZLA 1KGDA 4GOKA 1Z28A 1JBKA 1SM4A 3WMGA 1XTJA 2E9SA 1QBKC 2PCJA 4DDUA 2QT0A 4C30A 3ZQJA 4HAXA 3NBXX 4DDTA 5LD2C 3KQLA 5L3VA 2C8VA 1WMSA 1CKEA 2KWIA 1DAEA 1JQLB 4HAYA 3C8UA 3R9IA 4CT5A 3VQTA 3WYAA 5HZHA 4LYHA 1ZD9A 4FMCF 4PHFA 4UKDA 1TX4B 3RS7A 5GJBA 5FOSA 4DSNA 1E2PA 4TYPA 2BSAA 2H17A 1G3MA 2UZIR 3EIQA 3AKEA 4B44A 3JVVA 3NEJA 3QPWA 4KLNA 3RRYA 3SE0A 2ONKA 2QEQA 3R8CA 3UANA 2ZEJA 3IPYA 4AURA 3NDPA 3S1AB 4YAWA 2RGAA 1KY3A 2G88A 4V0ME 5G41A 4NONA 1ZAKA 3KXIA 3VO1A 2AXNA 4KCGA 4LJ4A 1GRQA 4BLRA 2ZE5A 2QPTA 4QG7A 3PVSA 1G6OA 2KBEA 3LD9A 4X8MA 4BGDA 4MYHA 2ZM5A 4PPQA 1E98A 1Q1BA 1KHTA 2DHRA 3CNOA 3LVRE 4KJZA 1E2EA 4EH1A 2G1JA 4CEJB 1VHTA 1FPMA 2C04A 2ZXUA 2JLQA 2CDNA 1G7SA 1FRQA 1XEXB 1W36B 4WIAA 3OE7A 3EARA 3OEED 3K1JA 4LY6A 1WRBA 4I1OA 2IEYA 4QM6A 5JHGB 1MRNA 2O0HA 4XWAA 4CEHA 3QXSA 1OW3B 4RD4A 1BYIA 4US1R 3ZLJA 3CPHA 4X8OA 3T1VA 5KNCA 3SS8A 3G82C 2GZHA 1N6IA 1P5ZB 1Z5ZA 2H7VA 2ZVPX 3PV0A 5EP3A 4Q1FA 1CLUA 5C4MA 5F9FA 5F9HA 1ZBDA 4DSTA 1X8JA 1XE1A 3QKRB 1KSHA 4C7OB 5KUTA 2HV8A 3DHWC 5HE9A 1PVOA 2ZI6A 2QP4A 4WVFA 2PH1A 2GBLC 2SHKA 4LJ6A 4NCIA 1KC8D 4AKGA 1QHNA 2DFKB 3IIJA 1M34E 4TYYA 4RCYA 1II8B 4BRUA 4R2IA 3UK6A 2OSBA 1XMIA 1VQOB 1N6KA 4FMDB 1G20E 3QJYA 3Q72A 2WPDD 3HPRA 2AD5A 2RHMA 3ECCA 3PUVA 2PJZA 3C14C 1E2KA 1XXHA 4F91B 4TQ9A 1B23P 1DVRA 2H92A 3MHPA 4PAQA 4PAOA 3ICQB 1YE8A 3GLGA 3NBYC 1RRCA 2ONJA 3GFTA 4I1SA 1AIPA 1Q1QA 2CK3D 2ZAMA 1IN6A 2WSSA 4D25A 1G291 1E9BA 4LBWA 3FB4A 4Y0AA 2LKCA 3OEHA 3RS0A 1RYHA 3KJIA 3GLIA 2ZYVX 1II0A 4L15A 1DOAA 1HYQA 2O5VA 3LQRA 5FTJA 4BECA 5DN6D 4B3FX 1A1VA 2RGNA 2V6JA 3BC1A 2D62A 1F20A 4OHVA 1DE0A 3A1TA 4Y9UA 1KO7A 3OZXA 1OT3A 2QDXA 2OTLB 3I73A 4BPBA 3T1TA 4OKSA 1E4YA 1Z08A 3E20A 1N2CE 5JLJA 1FTNA 1KI7A 121PA 1Q81D 3KX2A 3PEYA 3CC4B 2N42A 4NYIR 3PEWA 2ZI7A 1R10A 4GI7A 4DLSA 1X3SA 3SYLA 4Q7JB 2BMFA 2UVQA 2DFNA 1Q0UA 5BYJA 1E63A 1G64A 4LJ5A 3M1IA 2GAAA 2BJWA 1NJID 3CR7A 3ICEA 1TF5A 2OCPA 2QTZA 3WNDA 3DMDA 1S9DA 1SVMA 3R9WA 1E0SA 4V0KA 5G53C 1GR1A 4P6VF 1XNJA 4YMSA 3CCLB 3L0PA 2GXQA 2D2FA 3E1SA 3QKSB 2VSFA 3CC7B 1GAJA 2EW1A 3OAAA 3Q7PA 2AWNA 5CIWA 3Q85A 4B3DA 1G6HA 5SZJA 2VHQA 2PEYA 3PIRA 4ARZA 1TMKA 2JASA 3AVVA 1U94A 4QHSA 2X8AA 5IHPA 421PA 3TLXA 1XWIA 4G5OA 1X1SA 1DAFA 2DWPA 3U7EB 2EFCB 3JQQA 2W2TA 4LJYA 3ZJYA 3WP1B 1E4VA 2OXCA 3TR5A 1JR3E 4BLTA 3B7GA 4URUR 1Z47A 1E9EA 1XCGB 4RFSB 3TJZA 4L5BA 2VNKA 3GEEA 1Z0DA 1G3RA 4FMCB 3QE0A 1HA3A 3O8BA 1TUEA 2REOA 3MJRA 4D4MA 2ZSAA 1I4LD 2ZQ5A 1KO1A 3KFVA 4RCZA 1JAIA 3KKNA 1Q22A 1JNYA 1NRJB 3LW8A 4UNSA 1E0KA 2HLDA 1XJ0A 3ZS8A 2ATXA 1B0UA 2YWGA 4Q00A 2CCKA 2I1VB 2IYRA 2GK6A 621PA 4LDJA 1R2QA 5KSZA 4NU0A 3AVTA 4JYCA 4NHOA 3EASA 3S1AA 4PC2A 1OJLA 2WJGA 3OZVA 4O2RA 1KAOA 1WXQA 2J0VA 1OH8A 1G8HA 1QVGB 1KDTA 4MYTA 3TIFA 1NLYA 4RKEA 4O0MA 3TUJC 4DIDA 1E9SA 3QBVA 4X8LA 3QNUA 2A7QA 2ZI4A 2B5OA 2IXEA 4DSOA 2JGNA 1LF0A 3N2IA 4Q47A 5J4KA 3R8FA 2G0TA 2KJQA 4CEJA 1XD8A 4DSUA 2YC2C 2QZ4A 1N6OA 3RVBA 4NYIQ 5JJKA 5AN9A 1XEXA 1R0XA 2HXSA 2JDIA 2LCFA 1MABB 3TSZA 2ZYWX 3GJ6A 4HAUA 1JJ2B 1OKKA 4WA7A 1S3GA 5LB4A 1JB1A 3IEUA 4P32A 5AR1A 5KPJA 1W35A 3Q9LA 4JSTA 5EP4A 1XZPA 3K9NA 3U3RA 4OJQA 2ZJYA 1BYUA 2CLSA 1FW6A 2P2LA 3QKRA 4C7OA 1UDWA 1NN0A 1OFIA 2WSMA 3E2IA 5EZ6B 1Z29A 1Z6AA 4UQOA 5JI2E 4M1WA 4TYWA 1JQJC 3VR4A 1NJGA 5JHHB 1II9A 1RIFA 2X19A 3CR8A 4HUTA 1OSNA 2R8RA 3NWJA 3QPVA 4AF6A 1H8EA 3QPUA 2GESA 1KO8A 2C99A 2CRVA 1AM4D 5E7MA 1II8A 5D3QA 1JB9A 1ZIOA 2PX0A 3KDSE 5KDDA 3LLMA 3I61A 5KHOC 2IW3A 8OHMA 2OXRA 4BLOA 1NVUQ 4JBWA 5EE9A 1GRNA 4P3YA 2NO0A 4CGZA 3TQCA 2Q3MA 1XX6A 2CLDX 1KI2A 1TQ4A 3KZ1E 3KB2A 3K9HA 2EFHB 4EPXA 1ZYUA 4HE5A 2QNRA 3ZZ0A 2CHVA 5AJYA 5FUYA 2BMDA 4Y9RA 4PX9A 3AKCA 1TU4A 1IBRA 3FE2A 4EIWA 2ZITA 2WJYA 2RGEA 3BRWD 2RC6A 1W2BB 4XJXA 3CCJB 1GG2A 2ZUCA 3PR1A 4HDQB 1AGRA 3OIUA 2WTUA 2B6HA 4O3MA 2ZS9A 4A15A 3SQWA 1KZ7B 4MKFA 3WNBA 1U8AA 3NDBB 1TF2A 4WOPA 1GOTA 4G0NA 1CJVC 1P9RA 2CE2X 2ZRFA 5H68A 2XJ4A 1KRHA 4FXPA 1KDOA 2PMKA 3ZIAD 3BOSA 4PZZA 2PT7A 4H1UA 3X1ZA 3P27A 1FFHA 1DDGA 2C9YA 1UEIA 2VSOA 3ONWA 2J7PA 2QE7A 4G3XA 1ZM4A 4LC1A 3THWB 1G4AE 5CDFE 1E79A 4M21A 1XEFA 1VQ5B 2FSHA 3ASYA 4AF7A 5D3MB 2ZUDA 1N5JA 4DLTA 2Q9AA 1XU4A 2GA8A 2Q9CA 4QJ4A 1COWA 2ORVA 5C4GB 4D0GA 2GXSA 4A1FA 2ZS7A 2FZ4A 1IXSB 1SXJC 3OE7D 2VNJA 4L4UA 1S1MA 1E64A 1GNQA 2QGZA 3CX8A 3L2OB 1F3OA 3QKSA 1CR4A 2OBMA 4OHWA 2K5UA 1N6HA 3IIMA 2BVNA 5FR1A 3ZBUA 1M90D 2DB3A 1KDRA 2QSZA 2QTFA 3SNHA 2JLZA 3LBIA 4TMZA 2FGKA 1XCPA 2R6AA 2AL7A 2ZAOA 3CNNA 4PR0A 4US0R 5K8UA 1VQKB 3CM0A 3W6NA 1EP3B 1KI4A 5G3ZA 1G8PA 4YONB 4JL6A 2DWQA 1U81A 3AB3A 2RCNA 3D7MA 4Q7LA 3TE6A 821PA 1US8B 4TZ6A 4Q1CA 3EA0A 2GJ9A 1QDEA 3SDZA 1XD2B 4RFSA 3DM5A 4B32A 2F1IA 1XB2A 2IA5A 3T1QA 5DYIA 5FBLB 1Z06A 1ZD1A 3A4NA 4JBXA 4JKIA 3ZVLA 2NMVA 1ZC4A 5KPDA 4DEXA 2FSIA 1NMXA 3DDCA 2QMUA 5FPTA 4XVUA 1E99A 1D2EA 1ZU5A 1SVLA 2IBMA 3I72A 5DHFA 5GJVC 1CNFA 5HE8A 4WXRA 4TSFA 2JJ2A 4HB4A 3WRYC 4FCWA 4GOJA 1FQJA 2NZJA 3JVUA 1GVHA 4E03A 3BH7A 3FFBA 2WWFA 3ZZTA 1NY6A 3KFXA 4W7SA 2DCUA 1OLOA 5EE3A 2IC5A 4EFNA 1QG2A 4EJSB 3OEHD 4NH0A 2OCYC 3GQBA 4KBFA 2QQEA 3VKHA 2IXGA 3OFNA 1OXXK 1OXVA 2RGDA 4PO9A 4YXWD 1QVFB 4IHQA 1KK1A 1YU9A 2VIIA 2ZSDA 4LV6A 1MABA 4WZ6A 1XTIA 4LHVA 1JJVA 4NTZA 1BX0A 5E7JA 2V1UA 1LY1A 1J7KA 4MYUA 1UF9A 2QEXB 4BASA 1JR6A 2P65A 3QQ5A 3RYTC 2KBFA 2QTVB 1S96A 3GJXC 3K70B 2FV8A 1KOFA 2H5EA 1CNEA 1T91A 3OHMA 4M1YA 1FNDA 1DELA 2QORA 5AJXA 5GVSA 3OIWA 3IGFA 3UMSA 4QM7A 4C0AC 3RANA 5K8IA 2EIXA 4MUAA 3HU2A 1GO2A 1KJZA 2WWXA 4NYJQ 2GJAA 3BD9A 3CWZA 4EUNA 4QKQA 2XTMA 2ZRAA 3EPJA 1YIJB 2ODNA 3TSWA 4OQNA 4YQFA 3B78A 2WMOB 3BWDD 3OAAD 1SVSA 2IYLD 2QROA 4MRNA 4AG5A 4ASUA 4BFTA 4LBZA 2JIZD 4IDOA 5HCIA 1P7CA 1EWYA 2GF9A 4TMTA 1HH4A 4K46A 3KB1A 2FSFA 3F8TA 3REFA 2WJIA 4DCUA 4IRUB 2OE2A 5J40A 4YAOA 4TN1A 2P5SA 4NMMA 4CRWB 3FHTA 3WXMA 4BFYA 1S2MA 1U9IA 2ZIAA 5FR2A 1W5TA 3K9GA 3CRQA 2P3SA 3VU9B 2FFAA 1XXHE 4DB2A 4IDPA 1FMJA 1L2TA 4B3XA 5FL3A 3BIFA 3GLGE 3HR7A 2GKSA 4IEIA 2YKGA 1M1YE 3KXKA 1T5IA 3T5DA 4PZYA 4G5GA 2JLSA 4PAMA 1F2UB 4TTQA 2V8OA 2A5GA 4GL2A 5J4VA 4Q4AB 1T0HB 1DAMA 4XWKA 4U9UA 3GLIE 1ODFA 2Q9BA 3RS2A 2IT1A 2NIPA 2W00A 3SI7A 3THWA 1S9HA 1M7BA 4LYAA 3TRFA 1NL3A 2BMJA 4HI0E 3C7KA 2JLRA 4LV8B 5D3MA 1OIWA 5DHAA 4DC9A 4KFSA 5IT5A 1KKLA 1SULA 1TUIA 3OIVA 4XSHA 1U2RA 2IYVA 2MSDB 3BK7A 3D3QA 1F2TB 4LCBA 2O8CB 5JEDA 5KNBA 1OH7A 4OYHA 3VKGA 4RZXA 4BFUA 1FNBA 1U0LA 5JFGA 1W36D 4IJMA 4LHWA 2E1RA 2NPFA 2JDID 4QXAA 4L9SA 3KQUA 2YWHA 4R2HA 3U61B 3OJWA 2NZ8A 3M4YA 5FTNA 2BGJA 3LW7A 2XX3A 2VP0A 4ZCIA 2B8TA 3U6BA 4H9GA 1ZW6A 2XB2A 4A8JC 1Z0KA 5F3WB 3M0EA 4OK5A 3T06B 3QFRA 4GOXA 1W49A 2WJVA 4PFSA 1FQKA 1MH1A 4PC7A 1JAHA 2ZRLA 1A2KC 1NG9A 4F4CA 4KAXA 3HYRA 3B1WA 4HSEA 3TR0A 1US8A 5G40A 5IK2A 3EPLA 2J0SA 2ZRKA 5TY0A 1YHQB 1DADA 2OK7A 3SJCA 5BN3A 1XD2A 2Z83A 2W2XA 3CX6A 3GJ5A 4U00A 1A82A 4CW7A 3WBKA 4XOIA 1VIYA 3QF4B 3PG5A 2ODBA 2V6IA 3HJNA 1G7CA 3RWMB 2GVZC 2ZRPA 4HLCA 4LHZA 1DARA 1LFDB 4NCHA 4UNQA 1P75A 1ZNWA 3W5JA 1CJTC 3CUEF 1EWQA 3AF0A 5JI3E 3CRMA 1T3LA 5J47A 4RJLA 4B2PA 3KL4A 2WKPA 2J0UB 4QJ3A 3TAUA 1AZTA 4G1VA 4LPKA 2GF0A 4TTRA 4I4LA 1XPOA 3I92A 1P73A 4QFMA 4PQRA 5KO2A 2AHOA 4LHXA 2D74A 2QUZA 3AF1A 3EX7C 4F7DA 1BX1A 1Z6TA 4EJSA 1JI0A 4YHBA 4IDQA 3U3KA 4PTLA 4N0DA 1FZQA 3TK1A 1VKJA 1OHHD 3FTQA 3VFDA 3VNVA 4AKHA 3MRSA 2ANBA 5EZ5A 4XH9B 1GJRA 4XWOA 4NP6A 1NSFA 1R0YA 1K6MA 5FH9A 1PV4A 4M1OA 1TEXA 2QE7D 1I4DD 1ESNA 4ACAA 2ZRCA 1E79D 1Q21A 1R5OA 4B2IA 1NVXQ 1P2VA 4LV5B 2J0QA 3IPXA 4OI1A 2G77B 4Q7KA 4ZKDA 2QMEA 3EAQA 3P20A 2BBTA 4DVGA 2UKDA 1COWD 2R9VA 4B6EA 2QL6A 1IN5A 1DPFA 2A9KA 4CEIB 1XPRA 4POAA 1ZCBA 4CVNA 4IDNA 2ZE6A 2PT5A 3H0KA 3QG5A 5HTKA 1VIAA 5GJCA 1K73D 2IYZA 5FUVA 3AVUA 1VQLB 1QHHB 1W44A 1NKSA 4H1VA 2IUTA 2QM7A 3QBTA 2UZ3A 2ZRGA 1HE1C 2ZJAA 4BFWA 2NTYC 3CF0A 2VEDA 4FIDA 4FMBB 3U5ZB 1KYIA 4Z8YA 3H2YA 5CM8B 1C9KA 3LY5A 2RHDA 1M7HA 5FL7D 1G21E 1Z2AA 2V1XA 3ADDA 2GXUA 5HR5A 1N0VC 1JJ7A 3AVWA 2WAYA 3VU9A 1EX7A 3EXAA 1N0UA 3PEVA 4WXPA 3CW2A 2D3WA 4YAUA 1QG4A 1J8MF 1Z6GA 2WZQA 3H4MA 3QXCA 2YOGA 4QGFA 1LS6A 2RGGA 5TDHA 3RAPR 3ZGXA 4US2R 1ESMA 3QVUA 3OJXA 4JLNA 2HT1A 2PZFA 3RNLA 1KK2A 1UEJA 4R71A 1F2UA 4QBGB 5EE0A 4M9QA 2DY1A 1HQCA 2JJ2D 4LYFA 4Q4AA 3IO3A 1AZSC 1G5PA 5J4YA 1XTSA 2YV5A 3QVVA 2IYXA 1D8TA 3JQRA 3C4JA 4JZKA 3RRNA 5FOXA 4XVQA 2GJ8A 1JEEA 1NVVR 1VTKA 2VP4A 5B57C 4B3GA 3C5HA 2OO7A 2JAQA 1R8SA 1F2TA 4D6PA 4A82A 2O8CA 5HZKA 3FMFA 4ACBA 1WBDA 1QUFA 5TARA 4M1MA 2F1HA 3LO8A 1ONBA 4OJKA 4HLUA 2BKEA 1YI2B 3TNFA 3THYA 3AKDA 3NH6A 3NKVA 4MRRA 1CEEA 4GZLA 1E3MA 1Q1EA 2ODEA 3ZYCA 4HZIA 1RJ9B 4TYNA 3TW8B 5KDOA 4Z1MA 1E0JA 1VQPB 1YR6A 1OXTA 1U90A 3A36A 1MOZA 4EPYA 1XJCA 4DB4A 3VNUA 1X1RA 3W34A 4Q9KA 4F92B 4GFDA 1A7JA 1TU3A 1YZGA 3WHKA 3AF4A 4AYXA 4ZDKA 5HXBA 1AMOA 4HE6A 5H70A 4TMVA 3CF2A 3KKOA 4I1UA 1KO5A 3BAFA 4A2QA 1W2GA 2ZR7A 4JMPA 1DAKA 4G1UC 4DHEA 1R8QA 2OAP1 1VG8A 3QY0A 4PC3A 1VG9B 1JR3D 5TB5A 1NJFA 2H8KA 4A2WA 3K8YA 3QF4A 1FNCA 3W5HA 5E4FA 2ZPTX 5FUWA 4QC2A 3EZ6A 2J87A 1BO6A 1JALA 3BFKA 1PLKA 1SVKA 3GEHA 2BCGY 3B1XA 1E1RD 2IUSA 1E69A 2PZEA 5DO9A 5JJIA 1KQSB 1CP2A 2CL7X 5CYOA 2E87A 4KU4A 4ASUD 5KSOA 4CZ2A 4JSYA 3QSYA 2VA8A 1P2TA 2PLRA 2J0UA 4DWJA 4Q03A 5AWFC 4BZPA 1GZSA 5IF9A 2JJ8A 2QP3A 3GJ8A 2A30A 2X3UA 4WW0A 3ZDQA 1L8QA 5HPYB 2IF2A 5FOVA 1SKYB 3T61A 5DE3A 3KUDA 5FA6A 1LNZA 2ZJ5A 5EXTA 2GCPA 2O8EB 4PO1A 4CYMA 4DT1A 3GFPA 1MO6A 1YZKA 4EFLA 4L9WA 1T3HA 4DLUA 3ZIAA 1Z2CA 4ZPXA 4TQUS 3U7GA 4Q21A 3HP1A 1KSGA 3RSOA 2V3CC 1J70A 3W3AA 1G1MA 2XNDD 5AK0A 2OFXA 1T6NA 3BB3A 1DEKA 1N3BA 1WF3A 2CCJA 2OAQ1 2PEZA 2I3BA 3BORA 4Q7MB 4NCJA 1JECA 3W8NA 4DQLA 4D4JA 2F3TA 1NVVQ 2BBWA 3AGPA 1E9RA 1CS4C 2OM2A 1BMFA 4M4SA 1VQNB 4BFSA 2J9RA 4RKFA 3SJAA 4DLRA 5M04A 4LSGA 2B7CA 2AD1A 3H84A 2RGNC 3QEOA 1HTWA 2PBRA 4JLDA 3RS3A 2HCJB 2YWEA 5KSWB 2XZOA 4JBYA 5J5CA 3QEJA 1J90A 1KI8A 2VLIA 4LJAA 5JZVA 3A1SA 1D2MA 3QFTA 1XMSA 1KY2A 4N1AA 5DGXA 4NYMR 4CEIA 3MCAA 4F4JA 1VQ6B 3THXB 2AN9A 2IL1A 2FPLA 5CLQA 3AF3A 1K5GA 2ZANA 3FMPB 2ZJOA 3X1WA 4I81A 3L43A 4TL9A 4ZCLA 4KYIB 5G3YA 4QGAA 3U7FB 4B76A 5TXGA 1SVIA 4JVNA 3ZS9A 1UBGA 3UATA 2AK3A 4EPTA 1QHHA 5HKKA 2ZJ8A 2XZLA 1UKEA 5AJVB 3MJHA 1NMYA 4AKEA 5FPYA 4YC7A 3GJ4A 5A5GA 2C5LA 3H86A 4XTCS 4C43A 3CX7A 1Q12A 4HYYA 5IK2D 5JRJA 4LWZA 4C0JA 2B21A 1XTRA 4GP7A 3W6PA 2XOKD 2AX4A 1NNEA 1XCMA 5KTYA 5DI9A 5AUOB 2X2EA 3MLEA 1P62B 3WMEA 4E09A 2IYSA 2IWRA 2QN6A 1W47A 5DYGA 1HV8A 1SGWA 2GNOA 2ZRDA 1P61B 1Q20A 4UJ5A 2CNDA 2ANCA 1GL9B 3PUYA 2PJRA 5DIFA 4DDWA 3NTUA 2QM8A 4RFVA 2QAGB 2XNJA 1HUQA 1L4UA 3PENA 2X1VA 3IDQA 4TMXA 3R20A 1OH6A 4MKGA 4FN5A 3QOFA 2YOFA 1BKDR 4C0BA 3ETLA 3ZH9B 1T0JB 1E32A 1FUUA 3BH0A 4G5RA 5C1BA 3QIAA 1WB9A 3RDPA 1HY3A 1ZJ6A 4PC1A 2WOJA 4C0LA 5JWRA 2BN4A 4U7DA 3QFSA 4DQKA 1UKYA 2YVUA 3QUSA 1IAQA 1KK3A 3ADKA 2Q6TA 3LQQA 3NHAA 5CB6A 3OF5A 4DZZA 3PJRA 1AKEA 1VECA 3MWLA 3V4RA 2Z43A 4MUBA 1N5KA 1E2NA 2HF9A 4PHGA 1AA9A 3QFCA 3IKJA 1OH5A 2BBOA 3D6TB 1KI6B 1P4SA 1HT1E 1WBBA 1RJ9A 1W36C 2JLVA 4N3GA 3GCGA 3VR1A 5E95A 1BQEA 2OCBA 3FKQA 4OHZA 3VX4A 3K70D 4NYMQ 1A8PA 2OT3B 3A6PC 4B6FA 2Z6VA 1UMKA 2XNSA 1H42A 3TQFA 5FPKA 3K09A 3GPLA 2ZI5A 1DG3A 2DETA 2FH5B 1UFQA 4DXAA 4NCKA 3C41J 1BOFA 2CVHA 5EXPA 5FBVB 1Z0JA 2MSCB 2EFEB 5CJ2A 2P5TB 1OYWA 1P2SA 2YJTD 3LWNA 1DDIA 4D0LB 2HT6A 3KUCA 1JEDA 2V54A 2NQ2C 4Q5IA 1CU1A 3CCEB 2F55A 5F98A 3EG5A 1HQYE 4HB2A 4BLSA 1EK0A 3B5JA 1LTQA 4FCVA 4P0TA 4D26A 1NP6A 1XEWY 2AK2A 3LLUA 3O8DA 2ZI9A 1AS3A 4TLDA 3ZVRA 3B2EA 2C78A 3DEFA 5H5JA 1RE0A 4M9XA 3FHCB 3GEIA 1OIXA 4KITB 4RZ3A 2O8EA 4DIEA 3G71B 2QT1A 3O47A 1QHXA 1NN5A 4UNPA 4RD3A 2O52A 3L8ZA 1GAQA 2R62A 1AGPA 3A4MA 1ZM9A 2F1JA 1GRRA 2DWOA 2O0JA 4PC6A 2GWHA 3CRZA 4JT4A 4M9ZA 2G6BA 4D82A 4AWXA 3W2EA 4AKIA 3CCRB 2IX3A 3O8RA 5EMNA 3IIKA 2F43B 4LJ7A 2OHFA 3DO6A 3DM9B 1W4CA 3LDAA 3LFUA 4Q1AA 1GP2A 1IONA 1MR3F 2QSYA 3JZMA 3L0OA 1KAGA 1M6NA 3BXZA 1QFYA 2EYQA 1RW4A 3K0CA 3QXHA 2GDJA 3ZBTA 2BM0A 4IKEA 2FA9A 1XRJA 5TV2A 3FHOA 1X8KA 5LDDC 3U44B 5E3HA 4MGIR 1EP1B 2VO1A 3X2SA 3CZQA 3SFZA 3GJ0A 3X1XA 1NKTA 3HDTA 2DERA 3AP2A 3ZD7A 3DZ8A 2WIAA 4QRHA 2FFBA 5L3SB 2BJVA 4ZI3A 2A2ZA 1DBSA 4AYTA 1SXJA 2CVFA 2D7CA 2QENA 3I8XA 3TH5A 3THXA 2CCGA 1QFJA 1LVGA 3KKMA 3SJBA 4IW3B 4OL0A 2Y8EA 1WDTA 2CNWA 1ZM3A 5FFMA 2JATA 2RKOA 3U6KA 1YHNA 1S3SA 2BWJA 3FDIA 4QOSA 1QHGA 4NDZA 4Z1MD 2W6IA 1MO4A 5EJEA 1TVCA 2Q3FA 1TEVA 4QHTA 1N6LA 2BGIA 5BWMA 1YZNA 1NI3A 1G3QA 4RD0A 1D5CA 3NG1A 4UXJA 1OYYA 4TYQA 3DKVA 3V76A 2PIAA 4BPRA 3FJOA 2RAPA 2WHXA 3MGCA 4M1KA 2AFHE 2OESA 1UKZA 1NLZA 4AK9A 2O0KA 1X6VA 1ZINA 2O8FB 3ASZA 2WBLC 4TWZA 3AUXA 3IHWA 3W2FA 3SOPA 3FKSA 3NIBA 2Z4RA 3JQPA 1U8ZA 1GIAA 4C2UA 4KI0A 2ZU0C 3B1YA 1RPZA 2W6JA 4QBIA 3W3ZB 3NXSA 3QG1A 4S2EA 1GKYA 3W2HA 4OI4A 1Z63A 3SYKA 1IJEA 2QAGA 1XP8A 4MRVA 2R6GA 2BPOA 2ZSBA 3THOA 1ETUA 1W4AA 2GEUA 1NBMA 2R6HA 2WSSD 1IN8A 5P21A 2RH5A 1TNDA 3WP0A 3LO5A 1OFUX 2BDTA 4IOLA 4LK2A 4QJ5A 4MQBA 3TGPA 1SKQA 2XJ9A 3CO5A 1F6BA 2NOAA 1ZD8A 2GJKA 5C2JB 5A0FA 2VHCA 3BB1A 4EQ6B 3ZZUA 4GMXA 1IQPA 4QGGA 2VYQA 1Q44A 1HT2E 2Q21A 3R7WB 4B2LA 3NBFA 3W9YA 3IHLA 1NIJA 3PQCA 4BUJA 3CLVA 4LBYA 1XF9A 5FOWA 1YVDA 1MRSA 4HDOB 5AJZA 1T8TA 2XAUA 3B85A 5FBQB 4O2LA 4CT4B 1CQXA 3E70C 4QGHA 2FPKA 4C0SA 2BKUA 3A1VA 1BMFD 1KI6A 4S35A 1E1QA 5JJLA 3EPKA 4KYUA 3TMKA 4ERNA 2H1LA 4JLPA 3AH8A 3B13B 2VL7A 3OEEA 5E7IA 5BXQC 1AS2A 2V55B 2DBYA 4E5UA 4ZV4A 2C9CA 2NO6A 5GV7A 4URYR 4JLBA 3MWJA 4V02A 2VP2A 3RWOA 1EG7A 1DS6A 4RZUA 1E9CA 3VKWA 1GFIA 3EZFA 5CM9C 4EKDA 1WE2A 2XEXA 1EWRA 3K0AB 1KD1D 2DR3A 4IXNA 1B2RA 3CCVB 1FTSA 1YZLA 4F93B 2C77A 3H1TA 1QFZA 3A4LA 5EXSA 3CKLA 4ZGNB 4BEBA 4FINA 5L3RA 2WWGA 3AQ4A 1HEIA 2QG6A 1Q57A 2P6NA 2D2EA 4FWTA 1H85A 3ADBA 2OBNA 5HKKD 2FFQA 1FUKA 1E2GA 3N5CA 4WAUA 1AN0A 2YHSA 3I8SA 1Z83A 3VTKA 3QI2A 1W5SA 1VCNA 2ZYUX 5LD2B 5LPNA 2I4IA 4RSGA 4UXIA 2I1QA 4DLYA 2PCLA 2ZR9A 1FL9A 3VR6A 2CEAA 2AFIE 2EWWA 3B8HA 4B75A 5B64A 4GDFA 1TL7C 4M2LA 4HLQB 1DO0A 4ZGQB 1GWNA 2HLDD 2HUPA 2GHIA 3CRW1 2IYWA 1FNNA 1T5LA 3TVDA 5L3QB 2VYFA 3SZRA 1QX4A 2PL3A 3VAAA 2IYTA 3AEZA 2F1RA 1OXUA 4IXMA 4DKXA 1W0KA 3KQKA 3B60A 2YWFA 2IEZA 2F43A 3PFIA 1ZIPA 1G9XA 4QL3A 5B2ZA 4ZDIA 1W2HA 4K1XA 1E6CA 4PO8A 4DLZA 1KDPA 5GVRA 1IXZA 1KNQA 2OV2A 3LBHA 3NHBA 4JLVA 4V0LA 2DFTA 1IB0A 3EA5A 3CBQA 4MGKR 5KSPA 4EAQA 4BQSA 1T9HA 3GP8A 3U44A 1W34A 3RHFA 3PCRB 2TMKA 4ABYA 2ORIA 1W1WA 1Q7YD 3PITA 4MDFA 3I1FA 1K8RA 3IQXA 1OIVA 2BHRA 3LVBA 3AP3A 4LGMA 5L3SA 2EWVA 4OBEA 3THYB 1OKKD 3CRVA 1O87A 3RSLA 4KODA 3CH5A 1G17A 3IUYA 1XD9A 2DEUA 2WWHA 2HCBA 1WP9A 3MWKA 1VCIA 4IEEA 2GRJA 2LKDA 2P67A 1FP6A 1G3IA 1YJ5A 1VHLA 3GJ7A 4A0FA 3ZD6A 2C2HA 3IILA 4Q1BA 4AG6A 2R6DA 1D9XA 4LJ8A 1YJWB 2OFOA 3TUIC 4G5SA 1Z3IX 3EWSA 1CJKC 2J41A 2A5YB 5FOTA 1RYFA 5CIQA 1H8ED 5EP1A 2H18A 4P4UA 3RS5A 2VP5A 2BC9A 4KHZA 2BBSA 3G4SB 1DAHA 1JXMA 4YMWA 2O8FA 1CTQA 3CB4A 2FE4A 2ODWA 2ZE7A 2ZRBA 1H8HA 3GJ3A 3HYTA 3BGWA 2ECKA 1N6RA 4TT3A 3PXGA 1H65A 1CRQA 4NCNA 3FVQA 2AXPA 3A1WA 3A37A 3EZ7A 4PHTA 4URXR 2ZVQX 1OB2A 1SHKA 4IDHA 3KTAB 3WNCA 1WA5A 3KJEA 4XSGA 2IWHA 2JCSA 1S0UA 1EXMA 1EESA 3KQNA 1E0AA 4C9BA 1WQ1R 5ANRB 5K8LA 3W2GA 1QRAA 1W0JA 4EPVA 5BN5A 4GSYA 2J45A 4NE2A 5JCPA 2OLKA 4BLQA 4BEJA 3DOFA 2XTZA 1GDDA 4DT1B 4AIIA 4Q1EA 1A5TA 4BE7B 1PLLA 2VQSA 4DDVA 3BFXA 4EQ6A 1DO2A 4KFUA 1AKYA 1I2DA 1QZXA 2L0XA 4Q9JA 5FBWB 4M53A 1SZPA 2QA5A 1GL7A 4U5XA 3TSOA 3R7WA 4FW9A 1N5LA 2GCNA 4TMKA 1XBTA 4EJSC 4PXAA 1NN1A 2QY9A 1NY5A 3MSXA 2J7KA 2C03A 2GEDA 1VG0B 4RD6A 2J7PD 2Q0HA 2O8BB 1M7GA 4B4DA 4WQMA 4Z51A 1CIPA 2J46A 1XJQA 4Q01A 4K8OA 3DZDA 3KJGA 2B8WA 4ESHA 4KSCA 3CH4B 1QG0A 1IM2A 2F6RA 3SHFA 3AM1A 4KVAA 2FMXA 4PGOA 4II7A 2OG2A 1VQ7B 3HU3A 3TVTA 2ZR0A 1E2FA 5FL7A 4AD8A 1T4GA 1CJMA 1CXZA 1P3JA 2ZJ2A 4Q4HB 1E2LA 1FMLA 2GK7A 2YC4C 4PPFA 4HATA 5DLQC 4OQXA 4HLDA 2H57A 2V7QA 2IYQA 3T15A 3K70C 3K0AA 1QHYA 4B35A 1VQMB 3I5XA 4G1BA 1GSIA 1SVWA 2BMEA 4LC0A 3W90A 5H59A 1LV7A 2NO1A 1YITB 4QNRA 4TL7A 4YLGA 2R6FA 5FPSA 4EFMA 4UAJA 3K0SA 1G19A 1QHIA 1RRPA 2CNWD 2D06A 1Z6XA 5JECA 3ZVNA 3K53A 3KKPA 1PLJA 3LX8A 1UBFA 2NO7A 3TAHA 2RB4A 1FOEB 1EP2B 2W6ID 3GD7A 2VHUA 3SU8A 3GLFB 2EFDB 5GADl 2QGNA 2B92A 4M22A 3EW9A 4AI6A 3W5VA 1ZUNB 2PZGA 3CF6R 3T35A 3CC2B 2A5FA 1M2OB 4C0QC 5JS7A 1SVOA 4AC9A 1W4BA 4HAZA 4BZQA 4HUQB 4Y0VA 2BEKA 2FDCA 4ZDWA 1EFUA 2OUKA 3I56B 1XEWX 3VHLB 2X2FA 1BH2A 1IHUA 2VBCA 2ZYTX 3FKSD 1D6JA 4A92A 5L3QA 2NO9A 2ZRNA 1U98A 1OXSC 3DMNA 4TSFD 1J99A 2W6JD 1SKYE 4XD7A 5DNYB 1XZQA 5JWOA 1WCV1 2H16A 1ZNZA 5J4LA 4LYJA 4RY2A 3FGNA 1FNMA 4NKRA 1NBMD 3UPUA 3DVLA 3U7HB 1UBEA 4O25A 2MMGA 3BH6A 2HYIC 2F7SA 3UKDA 2O8DB 3OFND 1ZNXA 4HDCA 4IOMA 4M1TA 2LWIA 6Q21A 2VPPA 2W2VA 1TQDA 2GAOA 4LX0A 4J0QA 3CPWB 5SZKB 2W83A 4YALA 3I4LA 3SQXA 1JPJA 2CHGA 5TMPA 3C16C 1D2NA 3B6EA 2B7BA 2JLYA 3WYFA 2OILA 4DJTA 2WMNB 1P72A 1YR7A 1YZUA 4M9SA 4B3CA 3P4YA 4JVSB 1OV4A 3LXRA 1UADA 1GKIA 1L7VC 1E9DA 1NN3A 3G6EB 1IY2A 5FBRB 4Q66C 1E1QD 2W0MA 4LOAA 2ZRJA 4MRPA 4XVRA 4CF7A 3CCUB 4HLUC 2X77A 4TQAA 1SXJE 2QPOA 5JMTA 4Q9HA 3J81k 1VG1A 4C2TA 1G8YA 1OGJA 1QUEA 2J5XA 1AS0A 4A6XA 2FEMA 4KVGA 2BEJA 3MFYA 2F9MA 1EFHA 2GBLA 2GQFA 2VF7A 5THXA 2WM9B 1XDBA 1GUAA 3UG7A 4D2IA 4GPTA 3UMFA 2AKYA 3KXLA 4V0NA 2RC5A 1YZQA 3CNLA 1KSJA 1T8UA 2QAJA 4A6PA 4IVPA 1TQ6A 2FWRA 1FDRA 3ND8A 3UMRA 1VQ8B 5IRCD 1ZUHA 4UXHA 2EYUA 2RGXA 3HWSA 3AKYA 3VHXA 3W6OA 3KTAA 5B58C 4JLOA 1EFRA 3OIYA 2JLXA 4NL4H 4ZIRB 1J9ZA 2ZSFA 3SFVA 1G16A 3AVQA 3ES9A 3B9QA 1GNPA 1AJEA 3NH9A 2CL0X 3GLHE 4TLBA 2OZEA 3RS4A 3ADCA 1OFTA 3B9PA 3E5HA 5B30A 2WJHA 1Z0FA 3KJHA 4JYBA 1F5NA 4Q9LA 4JIMA 1G18A 4LHYA 3T1OA 3K9LA 2XTNA 1E62A 1MKYA 4GMDA 2CBZA 1NBME 2BF4A 4WZAE 1VQ4B 1W0KD 2FZLA 2QQ0A 3FMOB 2EVWX 1V43A 1IY1A 1NF3A 3P1JA 2O8BA 4YXWA 1Z07A 2ZE8A 3U3MA 4TTPA 1GAWA 4LJ9A 5KYKA 5JWHA 2WWWA 3AVOA 4FK8A 2VP6A 4PSAA 2ZU6A 4PSVA 1BS1A 4KFRA 4P33A 2WV9A 3NBZC 4YMVA 1YJ9B 1VYUA 4DCSA 1W4RA 3U4QB 4MITA 1VYTA 2RGCA 5DH9A 3PEUA 4EPWA 2P6RA 3CZPA 2XITA 2DPXA 4D4KA 1GILA 4GP6A 3Q3JB 1Z22A 2OFWA 4Q4HA 2WIBA 4E22A 1SXJB 5DI3B 4QBHA 1Q82D 5EE5B 5AUNB 1X86B 1LW7A 3EIHA 1E2QA 1R0WA 2CHQA 3L82B 5EP2A 4V03A 4B33A 1E96A 4P4SB 1JXOA 4FD2A 1D1NA 5C46F 1LF5A 2GXAA 3LNCA 5JS8A 1QGYA 2BM1A 3C5CA 3EC1A 3DOEA 4MDEA 4E07A 1KNXA 4NPHA 2CL6X 2XSZA 3IBGA 4DEYA 3HU1A 1CBUA 2D7DA 2NG1A 1MV5A 2ZREA 1CRPA 3SJZA 1CJUC 1TAGA 3AVYA 1ANKA 2OLJA 4M8NE 2QA4B 2NGRA 1UJ2A 1FX0B 4FCTA 2GILA 3RC8A 3GLFA 3VR3A 4R9UC 1P60A 5AUQA 3SR0A 5BQ5A 3UWOA 3W5IA 4B34A 3U60B 3QKUA 2Z5FA 3NVAA 3QE2A 2ZSEA 4LPSA 4RVCA 2G9NA 1PUIA 3EPHA 2WOOA 2JIZA 4TL8A 2XGJA 1GM5A 5KSYA 1E94E 1E2HA 4HUQA 4JLKA 2FF7A 4EPRA 1R6BX 3GLHB 1U0JA 4TT3D 3WMFA 1H8HD 2CMKA 2CE7A 2FJUA 1JPNA 3W2IA 4XTRA 4MGYR 3CPJB 4I99A 2IS1A 2WWIA 4JJKA 1MT0A 4OQFA 1OFHA 2BOVA 1YZTA 3EZ9A 5CJPA 1I7PA 221PA 1J8YF 1QH0A 3RABA 4BWYA 1NSTA 4OHYA 5CB8A 3REGA 1P2UA 1M74A 1W0JD 4A0RA 1OF1A 1IOZA 4JL8A 1QGAA 2ZUBA 1TQ2A 4C0KA 4OK3A 5AJWA 4IOJA 2IF0A 3V4FA 2O8DA 1ZC3A 2C98A 1L4YA 1RZ3A 4YDHB 1VDZA 3FOZA 3JZAA 4OQLA 1R5BA 2CXXA 2J1LA 1R4AA 5EQTA 1VCOA 3EC2A 4HB0A 4IFBA 3CRRA 1A4RA 4Q19A 3RC3A 2FEOA 5KNDA 1Q1ZA 4B47A 3SEAA 1YKSA 1KJWA 1ZCAA 5UKDA 3V00A 1HURA 3CWQA 4DBLC 2MSEB 2PX3A 2QI9C 3AGQA 1ZMXA 2G0NA 1XTQA 1V5WA 2BCJQ 1TADA 2REXB 2JLUA 4M0LA 4IVRA 4YAFA 1ZNYA 2FG5A 4DUGA 2Z0MA 5C18A 3SHWA 1Q3HA 4DCVA 3CCMB 2CJWB 3CPEA 2ZS8A 1G5TA 4V0OA 4BLPA 4M1SA 1RC8A 1M1KD 3BE4A 1KI3A 1NG1A 2Z4SA 5GV8A 2V7QD 2WICA 3I62A 4D81A 2VZLA 2W0SA 2OBLA 4U02A 3G0HA 3K09C 3FPAA 2QRZA 1S8FA 3D31A 3L8YA 2G3YA 3FPKA 3MWYW 1PZNA 2AKAB 3BFVA 5KDLA 4DLXA 4B3BA 1W7AA 2OTJB 1PUJA 5JBQA 4N3NA 3CIOA 3Q5EA 4ZIRA 4MA4A 4W9MC 4AY2A 4B74A 1OGIA 5IDVA 4Q4JB 4R98A 3CONA 4XIGS 4LBVA 1I2MA 2J3EA 2IHBA 4BFVA 4LI0A 1KK0A 3I32A 5EUQB 3OW2B 4B71A 5K8TA 3CCQB 1N6NA 2JJ1A 2REBA 1N8RD 2YINC 4ZI2A 1G3UA 4MKHA 3LVQE 1Z0IA 4HEJA 1EFCA 3DL0A 1ZRHA 4W5HA 1M8PA 4FI3C 5DISB 4A2PA 4EDHA 1RRGA 1G8GA 1QVRA 2HXYA 4V0MA 5ELXA 1U0HC 4XD7D 4JKYA 1EFTA 3AF2A 721PA 2YNMA 1TLLA 1XMVA 2OCAA 1ZUIA 1JA0A 1G5RA 1YJNB 3F5FA 5FTMA 3TBKA 1OHHA 4DLWA 5DSZA 3T5GA 2WKQA 5BN4A 4BZXA 5LB2A 4ZO4A 4G5QA 5TVKA 3QF7A 1NVWQ 2RMKA 2BIFA 2QBYB 2IHYA 3U4QA 3WY9A 1ZM2A 1S1CA 2HJVA 2Q3HA 3HPQA 1UM8A 1VMAA 2HF8A 2PMDA 3AP1A 4TLCA 3SYNA 1E9AA 2ZI3A 3K0CC 4JVLA 5BYKA 5DI3A 5FTKA 4KO8A 3F0TA 1C1YA 2IS2A 1KI9A 4P4SA 3UWKA 2IS6A 1TTTA 2VHTA 5CK5A 2F9LA 3U3OA 4MRSA 4MKIA 1EX6A 4URZR 1TPZA 3VR5A 2YOHA 4A8JB 5FOUA 3BB4A 3WRXC 1X8LA 3QENA 2VNHA 1RFLA 2FSGA 2DYKA 1YR8A 1YQTA 1RKBA 4PHHA 2VP9A 4KLZA 2GZDA 2YZ2A 4GNKA 1FX0A 1G7RA 3B1VA 1E2JA 4DCTA 4Q18A 4LUCA 1Y63A 2GVDC 1Z0AA 2QPAA 4A9AA 4NYJR 2VF8A 3Q8XB 3MUFA 3VX3A 3ZVMA 3LH5A 2XB4A 1Z6YA 2WAXA 1VPLA 2FPMA 2VHJA 4TLAA 5JSZB 5BW8A 3GLHA 3U2QA 4HB3A 4MYCA 4TLEA 4GBMA 2VTKA 3BBPA 3LAWA 1K9MD 1NMZA 4HZUB 2ERXA 1XFAA 1UKVY 4OQMA 3K0EA 4WBSA 5CLLA 3WHLA 1NDHA 4A0GA 5KU1A 4P4TA 1N0WA 1XPUA 1G7TA 2HJGA 1EFRD 3NC1C 3MMPA 3OZUA 3MAAC 2KE5A 4PANA 1YRBA 2QU8A 1DAIA 3VMFA 4F38A 1HE8B 1R0ZA 3IEVA 2KI5A 3OESA 5SZHB 5LBIA 3B1ZA 1GTVA 4ZKEA 3B82A 1W87A 3LA6A 4Q48A 2QAGC 2VSXA 1K8AD 1MO3A 2GJSA 2ZTSA 3NC0C 1VYVA 3RLFA 3E1YE 2IK8A 1N5IA 5EE1A 2XXAB 2EFGA 1UPTA 4G01B 2NPIA 1QGZA 1AQUA 4RD1A 3EIEA 1EGAA 1KSFX 4KBGA 4JJZA 2C96A 3LXXA 1YR9A 2CLCX 2QMHA 1SQ5A 2R65A 3QKTA 1AK2A 4KV9A 4LZZA 4ESVA 5FI0B 2JA1A 1IY0A 1XMJA 2GZAA 2R2AA 3PUWA 3PUZA 4N0EA 2EQBA 4OK6A 4GT1A 2D4HA 4Q4LA 3SN6A 3SC3A 4D4LA 3U3JA 4YMTA 1U99A 3BERA 5FI1B 3WYGA 4Q9IA 2CJWA 2WKRA 4TL6A 2FN4A 3T12A 3FMIA 4Q1DA 3P4XA 3P26A 1GL6A 2A5JA 3G5UA 1KKMA 2AR7A 3W5UA 2ZRHA 2ATVA 3VO2A 3CMAB 2V9PA 4IFEA 4DRZA 1RVDA 1E2IA 4F4IA 1DAGA 2V4ZA 4TMWA 1KJYA 1G4UR 4HAVA 4PPGA 4Z8XA 3K0FB 4FWIB 5F2EA 2QTLA 1G41A 4JS0A 3EWAA 2GEVA 3UIEA 2XSZD 2GCOB 1N25A 2R6CA 3RRMA 1S4QA 4D80A 4L8GA 5KOYA 1JR3A 2BMWA 5AUPB 1KMHB 4DCNA 2WPDA 3I55B 3N2EA 4HAWA 4Q4JA 2MMCA 3ZC3A 2P0EA 3AVPA 4BFZA 5FUXA 3O8CA 2ASEA 1YRAA 1E1RA 1G8FA 5A4JA 1KIMA 4X8HA 2FX3A 3V9PA 4GZMA 1KZGB 4D0NA 1GKUB 4QHYA 1S72B 2FFHA 2XZPA 1JA1A 2CK3A 2N46A
chains in the Genus database with same CATH superfamily
2PX2A 2VYND 2FRDC 3HB0A 4G0QA 4IIXA 1P3DA 1VDMA 2R6JA 4Q16A 4RVGA 1BVRA 3ZG6A 4D6YA 2CL5A 2WU1A 4NZZA 3SQOA 3FOEC 1SWWA 4NS1A 3T34A 1B76A 1PBTA 2WLTA 2OP0A 5JPIA 1ENYA 3I9FA 5G02A 2HQ1A 5GONB 1P7WA 1V1RB 4IGFA 4A0HA 3UAOA 1LWOA 1KOLA 3KBOA 5L40A 5J2TA 3C15C 5BXYA 2WJJA 4GYWA 5CVDA 3JATA 3L0SA 3TI9A 1UJMA 1EUQA 1SXHA 2XNDA 1XAIA 2DFLA 2HA3A 3CLTC 4PVDA 2XCSB 5EZSA 3WLLA 4GRAA 1I4TD 5F12A 1ISRA 2QR2A 4R16A 3MS7A 1AOXA 3FYUB 2NU7A 4F04A 2ORWA 3B12A 3KSMA 1P7ZA 2OGTA 3WHIA 3VVBA 3EXIB 3KPUA 3DMTC 1S01A 1XTKA 3H2IA 3RD5A 1CZHA 3TKLA 3FUUA 4AMBA 3K8QA 5LLTA 4TZ0A 3KQHA 2AEJA 4MW6A 4Y2JA 3A58B 1XQWA 1THGA 1ZN7A 2DC1A 1A5BB 1Y3IA 1AQYA 4PPNA 5FQNA 1XZJA 4BJ1A 3OLWA 4XLZA 2VRWA 2GTPA 4FYYA 4B73A 3GSIA 2VP3A 1L5ZA 3DLHA 1J7JA 1ABFA 5JO9A 3R7DA 2HDNB 5BSTA 3EGIA 4CCYB 4C3ZA 3GMTA 1JXQA 3OCWA 1YB6A 2HYDA 4C2BA 1F60A 1UWKA 1UXKA 3AV0B 3HR8A 4GI5A 3X1DA 4CEHB 3B2QA 2LDXA 4EFDA 3JD4A 2C5GA 2OHVA 3C3JA 3O84A 4QXOA 5DLDA 4RZ2A 3SD7A 4Y2TA 3GBPA 1AZLA 3HNRA 2FJ0A 3NEYA 5IAKA 4HXEB 1MQ9A 4FONA 1I7QB 5AK3A 3HE3A 2JCVA 3I5YA 1JG6A 2FKAA 1Q86D 2BEWA 2JGDB 2QTGA 3VYUB 5B7QA 4PSKA 4XOUA 2GPJA 4IXTA 1USUA 5EUMA 1BGVA 1LS1A 3F3YA 1E9VA 2IHNA 5BSVA 3BQ9A 1M0SA 5EKTA 5JSZA 3CCFA 5SZIA 2G1KA 2VJDA 4R3WA 1OCEA 2XADA 3RIMA 2GETA 1NP3A 4DNTB 3CCSB 1MB2A 2JI7A 2ZT8A 1J0EA 2QP9X 3I34X 3REQB 1W46A 2P5YA 1YF3A 4MTLA 5ALZA 1E7MA 1VE9A 2FQWA 2HRZA 3IO5A 3N70A 3QUTA 2IH2A 1C2YA 2H0AA 4QPCA 1J2YA 3HFRA 5FV7A 2HHCA 1ML3A 1R8JA 2X5KO 3LX5A 4IQ4A 4CQMA 2ZULA 1YK1A 4P93A 1ODJA 1ZUWA 4IF6A 2OO5A 1VLOA 1BFDA 2IEBA 1V8BA 2VFAA 1F1JA 2YQ5A 1C4WA 4KGDA 4X91A 5BT8A 3KCNA 4I1VA 3W9BA 1PNQA 2G83A 5DW3A 3CPSA 3L1HA 5ADUS 1L4EA 4MRMA 1MZVA 4XXHA 3F5QA 4LRWA 2IJGX 1QLHA 3ETEA 5TR9A 4LW8A 3GGGA 2GN6A 4YCCA 3PDHA 1M1YB 3DPUA 3JWHA 1V3UA 2COEA 5LQUA 4MWEA 1A8QA 3W8RA 1SN7A 4DG9A 4YRKA 1LLDA 2XNCA 1IZZA 1VHWA 2KSQA 2QTHA 1T3SA 2X85A 3EGVA 4HHEA 1Q7BA 5G2OA 4B6GA 1E4OA 1TM5E 2AMFA 2YFYA 4UATA 4GKKB 4FJ2A 1TM1E 4XB6B 3VPGA 3FF4A 1ZU4A 4ECAA 2XXAA 1JA9A 5JRZA 3N7TA 2R44A 1E0DA 3KCQA 4TXHA 2DTXA 5CX4A 2V5UA 1A9OA 3GLIB 1WM1A 4Q02A 2VDJA 2DPMA 1KFJB 3CW8X 2BV3A 5IS2A 2E49A 1IN7A 5HMLA 3LTEA 1A9XA 4NS4A 4J76A 3D8BA 2BH2A 2JLWA 1XUOA 3OZWA 2VNIA 4MLCA 4O4JB 3AZOA 3LRPA 3V2HA 1MOPA 3A3YA 4BYMA 4EP1A 1AKRA 2BHSA 3TBFA 2CV0A 4L6AA 3W5SA 3K2EA 1ZN9A 3A1EA 1U2PA 4TUYB 1X9GA 3UXMA 1IM8A 1QF9A 3DEIA 4OFWA 4WMLA 4B3MB 1Y0BA 2FW6A 2M6RA 3D54D 3EZ2A 3M34A 5IDWA 2FZVA 1RC0A 5KX5A 2X0RA 3NBKA 4MGZR 1SXJD 1L9KA 3V34A 5A6SA 4B48A 1YA6A 2ZQYA 2P3MA 3MILA 4KQWA 4C0HA 3HWWA 1CZKA 1C41A 2P40A 3CG4A 1EGMB 2XYQA 3K0FA 2W6NA 2ZCVA 1VXOA 3TPCA 4DLVA 4ZALA 2H29A 4ZVQA 1NIPA 4QOJA 3FCUB 1MN6A 2A1UB 1G5FA 2YMMA 3NBMA 1W88A 5CYPA 5LA6A 4OPMA 4KX3A 3WNQA 3TG8A 2Y1LA 1BXZA 1HBJA 1KOJA 4JLAA 3RFTA 4KO2S 1OPXA 2B1RA 3ITDA 3KELA 3WGKA 5FUMA 1SQFA 1VGQA 3EGXB 3H9CA 1J0DA 2IYUA 1ZVQA 3FFAA 4L4SA 5CXXA 2QKYA 1FJ2A 4Y2SA 1ORTA 3HM2A 2WWYA 4X3OA 3TGWA 1W9XA 1Q0QA 4DV4B 1ZJ4A 4REMA 4JLJA 1C9DB 1UBCA 3CVWA 2DYIA 1JEJA 1YFKA 1Z28A 3AETA 4ITUA 3RW9A 1SM4A 2NUAA 4BN0A 5F76A 2GPSA 2QT0A 2F3SA 1E2UA 1BVYF 3EDQA 2WILA 4P3PA 1N75A 1MX9A 2ZBEA 1IQRA 3GARA 3NBXX 3BRWA 4PZEA 4XPIB 5HOEA 2OCDA 2IOFK 3TZLA 4MEJA 4CT5A 3C8UA 4LWQA 4XE5A 5F77A 5U9CA 4YRRA 3K35A 2PR2A 5D01A 4C7KA 4YP9A 1JDTA 1RM0A 1ZD9A 3RS7A 4JWTA 1K7XB 1ECGA 2COKA 3NDJA 3OPVA 4P54A 5DV9A 4AKSA 5LLSA 2B2NA 3KPWA 6LDHA 5L95A 1C50A 1XFOA 3MWDA 1TOAA 4Y9TA 5AOVA 4IUDS 4B44A 3RRYA 5EJGA 4OHMA 2WAAA 2HTEA 3R8CA 4CL2A 2JFHA 3MBKA 3NDPA 5DX1A 3KVYA 1D4OA 3WGHA 4YAWA 4QRIA 2RGAA 1CYDA 4FFVA 4WNAA 5BO5A 4IIDA 4ZMSA 2HWKA 2FPXA 1JDPA 2MINA 1X42A 3IPLA 4V0ME 1ZAKA 4K6KA 3SG0A 1KH2A 3ZK8A 4CFSA 2A0UA 5L9AA 1SXPA 4KIJA 4BLRA 4I36A 4HRXA 2QPTA 4OIMA 3UUFA 3PVSA 1T6BY 2I2DA 5KOIA 2H2FA 3FOFC 4MYHA 4L27A 3V42A 1AF4A 1PEAA 1Q1BA 1TO2E 2GYWA 2ZM5A 1KHTA 3CNOA 3LVRE 2RARA 3TW0A 5KNCH 2Q8PA 4EH1A 2G1JA 4QPJC 3SP1A 1FPMA 1YAJA 2IDKA 2JLQA 2CDNA 1G7SA 2O7QA 1XEXB 3EISA 4KLAA 1T5TA 5BUSA 3OEED 1MOSA 4LE0A 1EFVA 1WRBA 1EM6A 2JAHA 3U13A 4DNOA 3ANNA 4RD4A 1KEUA 1V26A 1DI0A 3SS8A 3A1PA 1N6IA 3I52A 3R5SA 4YO8A 1Z62A 4EKGA 5JY1A 1BHSA 4Q1FA 4B7UA 1N2GA 1ULSA 4I4NA 4UUBA 4I4CA 5F9HA 1ZBDA 4DSTA 1X8JA 4QDKA 4IHJB 2QTMA 5HF9A 4NAUA 3RU2A 3QKRB 5HCNA 3WYNA 4C7OB 3OWHA 4L9AA 5KUTA 1F0KA 3T56B 1H1LB 3GRYA 4CN9A 4FMPA 4X44A 4GKJB 4CQLB 4UC0A 4MLZA 2ZI6A 2R48A 3QLJA 5AKHA 4RLZA 3C3KA 3QV1A 1TZCA 3M8KA 4WVFA 1BFKA 3ROQA 4UOZA 3OIFA 2H1WA 5K8JB 5JTUA 4UULA 4INJA 1J0XO 2PBZA 5IYZF 4YCJA 1KC1A 3KLMX 4X95A 1X7XB 4GAEA 4BRUA 1PFUA 1SB9A 2JJYA 3G2OA 4MAMA 4M7PA 3UK6A 1XMIA 1XDDA 2F67A 3STYA 3DS8A 2QTNA 2VOJA 1G20E 2CHFA 2RKWA 1GGVA 3OX1A 4FMDB 2WPDD 4IWNA 2AD5A 3OC0A 3HSYA 3TOSA 3IEXA 3ZXIA 1FMFA 4XDZA 3DDWA 2JH9A 3D4PA 4BGVA 4V1CI 1M6VB 1TJYA 1B23P 1ZK0A 2AJCA 3GU3A 3OPYI 1MJHA 3DP9A 2MCFA 2M6LA 4YRNA 4JFRA 1Y9JA 1YE8A 2GI4A 3H5TA 3QRWA 3GLGA 3WOVA 3NBYC 3HJRA 5B3KA 3NVMB 4C2AA 1E5TA 4O4HB 4TV9A 3S7ZA 1Y1QA 5LJLA 4EY8A 3BGVA 3Q3IA 1PZEA 1ENPA 3ONVA 4D25A 3AI3A 3M6UA 1JHPA 3GIDA 3GDOA 1EVKA 3BFJA 3NRBA 1YLOA 3B7PA 4CKZA 1GCUA 1ZVKA 2BM9A 2WK1A 2IH4A 2Z2KA 4TSKA 2APJA 2O5VA 5E2BA 4B4UA 3UJBA 3AEUA 4MW0A 2V6JA 5C8XA 2BFPA 1F20A 1B43A 5DCUA 2EL7A 3F67A 2D59A 3OZXA 3KC2A 4EX7A 1EQAA 3WIVA 2OTLB 3ZXUB 1ZFNA 4OKSA 1MT3A 1G2QA 5TPZA 1N2CE 4QBKA 1G42A 2V7TA 1KI7A 4II3A 3KX2A 1VJGA 1GTSA 3NU1A 1NE2A 2ZI7A 1GAEO 3KR1A 4MEBA 4TTJA 1BROA 4EW1A 4P0PB 1NW6A 5TNXA 4Q7JB 2I3GA 5ERYA 3HO1A 1VZ3A 4XWWA 4PRKA 4MVJG 1UJ4A 5BYJA 1UD2A 1XQ6A 3ZY3A 4COOA 2I2BA 3CR7A 5EINA 4ZGWA 4BXOA 1AKUA 1DFGA 4DARA 3CTPA 3DMDA 1ORRA 1RMYA 1ML4A 5EJ5A 2O2YA 3BXXA 4CT4B 1NBHA 3Q15C 1QP8A 2NYRA 1GR1A 1N36B 1YFJA 2ZTHA 3S8EA 3CCLB 1T5SA 3V4SA 1SBQA 3L0PA 1MW9X 2GXQA 2JJQA 1AN9A 1MIHA 4BJ3A 3QKSB 2I78A 2VSFA 4LJSA 3CC7B 3C3BA 3O1JC 3SSOA 1DKPA 1N5DA 3QBJA 3NBQA 5CIWA 3B3QA 1JEAA 3I0MA 1O97C 3KHSA 1Y7LA 1IEQA 2PEYA 1UL1X 2VHQA 2WJPA 1TMKA 1XGKA 2Y9PB 3IAM6 2VAPA 3QBEA 3P0HA 2XDYA 3JRXA 1PQ4A 3OD5A 5DHQA 3T99A 1I3KA 3HY3A 4QHSA 2QX4A 3H9JA 4OY3A 2IHVA 2PIDA 2AG0A 4M8IA 2W2TA 1SCAA 3WR5A 1WXFA 3WP1B 1C1DB 2EEZA 1GA1A 4G0OA 4NARA 5AHRA 2OXCA 3LPAA 2EEPA 3RVNA 3DFMA 2VQFB 4X6UA 2AQKA 3FPCA 1N77A 1A5ZA 3QYJA 4MR8B 4ZAZA 2VNKA 1Z4OA 2SBTA 1PR6A 4NIMA 2PX6A 3SXJA 3AI1A 3W7AA 1HA3A 1I3LA 3HVHA 3MJRA 5EMLA 2FFRA 1XDSA 2ZZGA 2WU3A 4GR4A 5B58T 5LQSA 3RG8A 3T7EA 3K72B 1NI4A 1UZAA 3PNMA 4F8JA 3RTDA 1PIWA 3AI7A 1DZ3A 3LXMA 3RT7A 2XY4A 4LRTB 1GPNA 2CCKA 2Z8ZA 4UBKA 5C80A 2FMIA 621PA 5KSZA 3CVXA 2FKNA 5ARCA 4DKJA 3AVTA 2JGAA 4YRTA 5EIFA 1DBPA 1M2FA 1V7ZA 3GXBA 3KS9A 3COSA 4S3MA 3S1AA 3PD1A 2QLTA 1A96A 4ZOQI 2H11A 1O94A 2WJGA 4F5ZA 5K0EA 2XUJA 1PYDA 1G8HA 4HH1A 4MYTA 4YUAA 1I51A 1QDUA 3B6JA 3TUJC 4DIDA 1E9SA 3QBVA 3WFIA 1CDDA 3EBOA 3PPXA 3QNUA 4UEQA 3H6HA 4D8VA 3LKZA 2DLCX 4G6IA 3JARB 3KLOA 4YRFA 3ASQA 4RDJA 2NTEA 1FFEA 1LF0A 3N2IA 3O2NA 4Q47A 5HEKA 4NFHA 2Q6IA 1FVHA 1VIDA 2QZ4A 3KSAC 3WKBA 5AN9A 2N9UA 3OMWA 1R0XA 4FHZA 1EJ0A 1PJQA 2CD7A 2HXSA 1MV8A 1Q19A 1TD9A 5A3VA 3TL2A 3VOSA 1GPH1 1P77A 3FBTA 4MUMA 3UHFA 1BQ3A 2XE6A 3CEPB 1OKKA 3DHNA 3FA2A 1D6NA 4PBRA 3G6WA 1OBOA 5HKLA 3SC4A 5BW4A 1M2WA 5BWBA 1JB1A 4HS4A 4HP8A 4D0SA 4DCJA 1YB2A 2QL5A 5KPJA 1W35A 4TN5A 5J1SB 4EATA 3HA5A 3PF8A 1YBAA 5E3JA 4DR1B 5EP4A 2VJMB 4RPGA 1XZPA 3FNFA 5A3RA 4UEJA 3RHZA 4X00A 1NQTA 2W4QA 1VPTA 2H2WA 4YREA 2JFBA 1UDWA 1C3OB 1CZNA 1OFIA 4C7VA 5JI2E 5AHKA 4UQOA 1QP0A 3FTCA 4WKPA 4ZEWA 1AGXA 1U65A 1XQYA 4V1CB 1II9A 2X19A 3M4NA 5HGJA 1Y8ZA 3OPYB 3BCFA 4ZRDA 3QPUA 4HK4A 2GESA 1XAGA 2C99A 1U1IA 5E7MA 1AM4D 3SMQA 4E46A 4L57A 3M2PA 3UBTA 1BWSA 1EDOA 3C3WA 3D4BA 5TVGA 1TTPB 3LLMA 1KYTA 2J09A 2ZL6A 3H65A 4GLOA 1A72A 3R6KA 4HDRB 5KJCA 5B2EA 1IZ0A 1WZIA 2X58A 2YMPA 3JWPA 2JKYA 5CBKA 2AX3A 3K92A 4CKWA 5EE9A 2NO0A 4P3YA 1EK2A 3C5VA 3KAKA 3TQCA 2C0PA 2G07A 1B00A 1MORA 4G84A 4BDTA 4CLRB 4CM3A 2V4UA 4ME6A 5JC1A 3MINA 5AVSA 4HE5A 4AZTA 2V59A 3ZZ0A 2JKZA 2PL1A 3UH1A 1U9CA 4XNFA 5ERGB 3WOHA 4EHLA 4LOKA 2HRBA 3NETA 4PX9A 3AKCA 2QLBA 3IVRA 2FPPB 4PXYA 3KT8A 2D0DA 3MTDA 1P1KA 4RK5A 3DT8A 3IOCA 4TWJA 3DSRA 4YJKA 4XJXA 1GG2A 3BWVA 3WRVA 4JK3A 4D92A 3H5NA 1G0OA 2B6HA 4OGFA 4A15A 3SQWA 1KZ7B 1S4MA 3MB8A 3ECSA 4QWWA 3NDBB 4IHAA 3QELA 4N7RA 1RYEA 4WASA 4WOPA 2WKSA 2H3HA 4L22A 2Y77A 4BV8A 4G0MA 4J9UE 1DTWA 1BA2A 2VSQA 3E5MA 1P1RA 4PFKA 4FXPA 4DRYA 2ZBFA 3OW7A 1LX7A 4XYMA 4J03A 2VZ9A 6NULA 4OXXA 2Y6VA 1QV7A 3MC1A 3FH0A 5ALLA 2I5PO 1V8ZA 5KYVA 4G3XA 1QRRA 1ZM4A 1OA1A 4LC1A 4KSYA 3THWB 3W0LB 3WL3A 2VH1A 3IVXA 4YASA 2HI0A 1VQ5B 2PQ2A 4I50B 2FSHA 5D3MB 4AF7A 5BOVA 1HKUA 2LCIA 3KWFA 5I9LA 2VQDA 3IVCA 5F2NA 1OX6A 4DLTA 1AXRA 2INGX 2JI8A 3OICA 1XU4A 4D41A 5LQMA 2H06A 2Q9CA 4QJ4A 1GKKA 4G8DA 4HGOA 5E6RB 1JSZA 3B38A 4D0GA 3OJ0A 4PXSA 1FP1D 1VJSA 1R6AA 5IJAA 4WINA 3OE7D 4B17A 2VNJA 3X44A 2A0XA 2QGZA 3FZGA 3GAZA 3L2OB 2QNBA 3U37A 3ZV6A 3E8XA 2EX0A 2OAGA 1N6HA 2H8GA 3IIMA 2P77A 5FR1A 2NTJA 1RHRA 1U7UA 2R60A 3QPDA 2DB3A 2QD3A 4BQOA 5H3LA 2WE8A 2QTFA 1BU8A 3VVMA 1PWXA 1WQ3A 3DXYA 4DJJA 4BNDB 6CHYA 4JB3A 4IJKA 1XCPA 5EWMB 5IKMA 2Q3EA 3DT9A 4WUVA 3PFBA 3KSRA 1PR0A 4KNVA 1EP3B 4LVCA 3W6NA 3IRUA 2RBGA 3SXPA 2IITA 1RXEA 2W2MA 1U81A 3D7MA 4OSPA 3KK0A 2W8ZA 1Y5RA 3RBZA 1GQFA 1LI4A 2MSLA 1OYOA 3T7JA 1SOUA 2IUFA 2FN9A 2MOKA 4D3ZA 1HTBA 4BBAA 4L5IA 3RSGA 5KW9A 4M36A 3UFBA 1SEPA 1M8GA 3L6UA 3V80A 3WDLA 2NMVA 2YY5A 3LDFA 1YJQA 3IP3A 4W9NC 2XXJA 4B5LA 5FPTA 4XVUA 2NZYA 3FPLA 1E99A 4JOSA 3WB1A 2HU8A 3O4IA 5DHFA 4MWSA 3TDNA 4EUSA 4HB4A 1MB0A 3WRYC 3GC6A 1HNWB 3E03A 2EBFX 4GOJA 4BDSA 1NNUA 3QEAZ 5LNK6 3LGAA 4D9NA 2AB0A 4E03A 2Z9BA 4ENQA 1A77A 3QPCA 4RX1A 5EUCA 1CHNA 1KVUA 1QVVA 1PV2A 2Q4RA 3IV7A 1IFXA 1QAMA 1T8SA 3GUHA 3P45A 5FLYA 4EFNA 2CF4A 2C2YA 2BM8A 1IQUA 2XGMA 3OEHD 2E5LB 1ECFA 2QQEA 3OFNA 3USCS 2RGDA 1OXVA 2A57A 3FCXA 4YXWD 2JAPA 1QVFB 3UK1A 3DWGA 3ANMA 5LMCA 1WCWA 1T1IA 1T4CA 4E1AA 1YU9A 2FMUA 1UP7A 2VIIA 3LSYA 1XZAA 3HXQA 1MABA 1QORA 1RADA 4C05A 3QE4A 4PYIA 1OI3A 2GEBA 4N5MA 4NTZA 4B2YA 9ABPA 3IR5A 2K6GA 5DVZA 4XIJA 3AHDA 4YUZA 4TXNA 2FWBA 1EJ6A 1JR6A 1P9LA 3L0BA 4V38A 3E81A 5FIUA 2DOKA 4Z4ZA 1FXWA 2OC4A 1W29A 1T91A 2XWQA 3BY1A 1DELA 5MHTA 5GVSA 3IGFA 2WM8A 1X87A 3UMSA 4D42A 4QM7A 2GN2A 2X86A 5GPBA 1A8SA 2Y0BA 5IYZA 1KAQA 4NBWA 3FXAA 3U0BA 4DOMA 4QPPA 1ZW1A 4IUYA 5F4BA 2HWWA 3GZNA 1GN8A 2BKVA 3AEQB 2G1AA 1ZR2A 3ILXA 4GSKA 3WFJA 1WMFA 1VSBA 2IXTA 2EDCA 2OBTA 4JT8A 4OQNA 2WMOB 3A9WA 3OAAD 4JR0A 4L4RA 3O8NA 1VL0A 4NOMA 5HBRA 1IY9A 1X7ZB 5FH9A 5CA0B 4ZO7A 5ETJA 4BC1A 2QROA 1I94B 1CPYA 2BFAA 4AG5A 5A89A 2C0CA 3SC6A 2JIZD 5A3JA 2A8YA 4UQLA 1CY8A 1P7CA 1GLNA 1NQVA 1EWYA 1RQRA 1QIFA 4MIEA 4LF6B 4WLNA 3PFCA 2VWHA 4IPTA 4ND1A 3BZBA 3EGWA 1TM2A 3G1UA 4DCUA 3KJNA 4IRUB 5J40A 3PHBE 1PHRA 2MYPA 4S1WA 1JHMA 1S2MA 3NP7A 5FR2A 4QUIA 1VFPA 3CRQA 1XCOA 1L8XA 1RC1A 2QTRA 4M9RA 1WR8A 1J2UA 4IDPA 4B84A 1L2TA 2XMDA 4B4OA 3UKOA 1ECBA 4ADSG 3NHJA 4M6WB 5JXWA 3ONFA 2PS3A 1DBVO 4UBNA 1Z2EA 3HR7A 3IAXA 2YKGA 1NMEA 1T5IA 5DEIA 5DTRA 3MSCA 4PAMA 5AKEA 3R8XA 3ZD8A 2QVCA 4KQFA 2OB1A 3EQ7A 4TTQA 2V8OA 1GFWA 3W79A 5DM70 5J9FA 1Y4AE 2MU1A 4XX1A 3R9KA 1X38A 1NXPA 3FUWA 4KAFA 4XWKA 2WIDA 2RSLA 1BW9B 4WJKB 4HWSA 4XFKA 1M7BA 3IDFA 3DDHA 1NL3A 3ETCA 4LYAA 4ZVLA 3TRFA 5L53A 3THXB 4HI0E 5CT9A 3N8IA 1Y4ZA 4LV8B 1M8KA 1QWOA 1VL1A 4DC9A 5IT5A 2O19A 1SULA 2FX2A 3OIVA 4JITA 3RTBA 5EJ7A 2MSDB 5EHQA 5LU8A 2ET6A 4GI2A 3DD1A 3HZHA 3STVA 2RJNA 1E8NA 3NX4A 5CT5A 3UUEA 1KQFA 4HF7A 2O8CB 4UVIA 3PNBA 4RZXA 2AXQA 3D2AA 4D45A 2REQA 2QI9F 2BSXA 2E1RA 2NPFA 1OU0A 1SIWA 1ZN2A 3HEBA 5AM2A 4YV0A 3D9QX 4R2HA 5IC5A 2WVHA 3U61B 4YCNA 2OZLA 2BGJA 3LW7A 1TCAA 2GRUA 1DXYA 1EQUA 1PG0A 3GH1A 4MMZB 1FSGA 3IMKA 2GTIA 3CLRC 2B8TA 4H9GA 1GTG1 3GPCA 3DQPA 1MZPA 3NTVA 4CIVA 3QVKA 1ULAA 1Z0KA 3MTEA 2QXTA 4JQSA 3QFRA 4GOXA 4DA7A 4JI4B 1N8SA 4PC7A 1JAHA 2V7EA 2ZRLA 4BBPA 4DNFA 4FE4A 4M87A 2NLOA 3HYRA 1KBZA 3LQ2A 4KK4A 2ZRKA 3ZK7A 4CBVA 4EB0A 3MQFA 3R77A 4ZU1X 2J0SA 2VQ6A 2C42A 4OJMX 1VE5A 1ZSVA 4FYPA 1CW2B 2Z83A 2W2XA 3CX6A 4IO1A 4U00A 5D7BA 2GBIA 5EZYB 3VHQA 3GFFA 4IKOA 4FDUA 3IUBA 1PR4A 3IESA 5JH7F 1A9TA 4D79A 2V6IA 4P3IA 5JSHA 3ND5A 4ND8A 5JNSA 3P2EA 1JU4A 4LHZA 1BE1A 3DV2A 1PYGA 1Q7GA 2C9ZA 3R40A 1ZO8A 3SC2B 2CZCA 3G5TA 3H2ZA 3H0EA 5A4DA 5JVDA 1HRDA 1XO1A 2WKPA 3PXUA 5ECYA 4QJ3A 1YR1A 2C58A 2Z6AA 1KH1A 3CTAA 1K98A 2FR0A 2OO5C 4I4LA 1FJHA 4X1IA 4GSLA 3D4IA 1XTZA 5JMPA 1ADJA 2QUZA 3LP5A 2WINI 3GA5A 4XA8A 5JNUA 1JI0A 1X80A 2YICA 3ZDXB 1BE8A 2E4XA 3PQ4A 3ZJ4A 1IHPA 2KS6A 2VZ0A 2OYRA 2HMSA 2XZDA 3TK1A 1FTYA 1VKJA 1OLSB 1OHHD 3FPBA 3VFDA 1EXDA 1JHZA 3PWSA 4WY2A 5LQDA 4U5QA 1EFPB 1Y9DA 3S29A 1SB8A 1O5OA 4G4SO 4BQPA 4CKEA 4D56A 1NZDA 4OMDA 2VBUA 1CUXA 3OETA 4GHWA 3FW1A 2NYUA 4L74A 1GPKA 3U48A 3WLTA 3INNA 4JJIA 2X9NA 3JR3A 1BJTA 4MUIA 1TYEB 2IYAA 3OPXA 1TVEA 3MS2A 2ISQA 4KXWA 5J59A 3RVJA 3L1JA 4M86A 3WIBA 4C7BA 4CMIA 4LY3A 1Q21A 4DTIA 1ZOOA 3MT8A 5BQOA 1YQQA 1B26A 1QK5A 2PE3A 3UMBA 2PUCA 4BCBA 2OPBA 4W5QA 1PWZA 2DPLA 4PFJA 4EW2A 2BBTA 3VR5D 1E1YA 2ACEA 3PC2A 1COWD 2R9VA 2UUOA 5IUJC 3KKZA 2QL6A 4B6EA 1BN6A 2OHOA 4WEOA 4KQHA 4ZEMA 4CEIB 1UPBA 1FDWA 4BC0A 3AY3A 1OXBB 2OM6A 5FNZA 2I4OA 4I8IA 3H0KA 1EX1A 3QG5A 3E7FA 2WYHA 3R7AA 1K73D 1QGUB 1NUTA 1USWA 1YDFA 1IVYA 4Y6RA 1QHHB 4C4ZA 4DDKA 3EPLA 3EZXA 2I76A 2A1TS 1K88A 2A88A 1DIGA 1P2BA 3MJEA 3S8YA 2QZ9A 4K6FA 4CMEA 2XI4A 4P7FA 4BFWA 1JE1A 4A16A 5FX2A 4HDNB 4FIDA 3D6JA 4G4SP 4JSRA 4DM3A 1K97A 4FXUA 4RGQA 4BIMA 3U5ZB 2VI5A 1DT3A 3EXEA 1HDIA 1YR3A 5FL7D 1DX4A 4P5EA 1G21E 5F1OA 1C8VB 1UDAA 3NHKA 3N6XA 5HQTA 2WAYA 3PGLA 4C0WA 3IAHA 3GFGA 4NOKA 1GU0A 3JQAB 1JKIA 4LVUA 3WQQA 2J3DA 3CW2A 4YAUA 1A04A 1K6IA 4FGWA 3H4MA 4J0HA 3QXCA 4O2AF 4MIOA 3OQ1A 2YOGA 5IBRA 3D5EA 1W96A 3I9V6 3RAPR 3TPZA 4US2R 1ESMA 4JOCA 4WE3A 3K71B 2HT1A 3RNLA 1KK2A 4WA8A 2DR0A 5JD4A 3BTVA 3M6MD 4FR0A 5JYDA 1H0HA 3M1LA 4IUCS 4MUHA 3EIOA 4Q4AA 2Q45A 3IO3A 4PLGA 1AZSC 2HRDA 3TLKA 1G5PA 1SA0B 2JANA 5HFJA 2YV5A 3V1LA 3E2MA 5FWDA 3NOQA 3RRNA 2WVGA 3TDKA 5BSHA 1QFSA 3MOIA 1SCJA 4OH1A 3RIXA 3CYFA 1JEEA 4U2EA 1N2XA 4A8TA 5B57C 3C5HA 1FSSA 2OO7A 3NZEA 4OYYA 2Z04A 5TS3A 1LCIA 1CB0A 1WABA 3LDHA 4A82A 1WTHD 5HZKA 2EJUA 2YY7A 3DOIA 3OG9A 1SKAA 3ORQA 5TARA 4DVJA 1XRPA 2G9ZA 2PO5A 3AESB 4M1MA 4X7EA 4U63A 3TD6A 3LO8A 1M2JA 2FVYA 4OJKA 3DL7A 3FN4A 5JASA 3UJNA 1DCFA 3THYA 3QMPA 3TTTA 2AIRA 5ES3A 2JVIA 5A04A 2HJ9A 3DZHA 4XPZA 4BMNA 4GZLA 2ID8A 1Q1EA 3HXKA 2IRWA 4HZIA 1RJ9B 1MU0A 1M0TA 1RPNA 5ITVA 4LE2A 1RBQA 3H3FA 3H4TA 1WB5A 2EJBA 2WU4A 1YR6A 3PLRA 1S8OA 2VVTA 2XVAA 2BP7A 1T9ZA 2UYYA 1JL3A 3LUFA 3N58A 4F92B 2FUG6 1TU3A 1JFSA 4ZDKA 2QX6A 3LC7O 4AYXA 4JDPA 3I1YA 3Q88A 5H70A 1IUNA 3KKOA 4I1UA 2QD1A 1UBTS 3RROA 4J3FA 4A8PA 3ZDZB 2ZR7A 1S2OA 4HT3B 5KYTA 3TOCA 3BXHA 1DAKA 4MO2A 3PEEA 3DP7A 2OAP1 3WTCA 3LIPA 3P9YA 2IZ0A 3JX9A 1JR3D 1SD5A 3H5LA 4JX8A 4R9NA 1NJFA 3O4FA 3K8YA 3FDJA 5CLFA 4QC2A 3JQBA 4PW0A 2W2KA 5C32A 2Q4EA 3KUKA 3JPYA 1USGA 2PZEA 1XTTA 3P5SA 1T9CA 5E1MA 3DTYA 3H9UA 4KU4A 5KSOA 2Q5CA 2PGLA 1UK9A 3A05A 4JSYA 3DCJA 1U7DA 1ZCFA 4NJMB 2J0UA 3C7DB 3U40A 1JFTA 4KWHA 2JJ8A 3HV0A 2X3UA 1NBWB 3ANYB 4PTYA 1JLSA 5FOVA 5AOCA 3KYCA 2ZJ5A 3ZK9A 2Q2OA 3UWSA 3D0RA 2GDZA 8ADHA 1VBMA 4DNRB 1GPWB 2I6XA 2BTEA 2PT6A 1YD7A 3Q3EA 2PUBA 4D8UA 5I6DA 1JDSA 1MG5A 5DWVA 5K4HA 3PGMA 1KJIA 3KE8A 4DLUA 3C0KA 1EI9A 3TM5A 4TQUS 1Z25A 4Q21A 2ZOSA 4RS3A 3RSOA 1J70A 1E7RA 1G1MA 2XNDD 4HTFB 3TOZA 3SICE 4WOCA 1DEKA 1N3BA 3F78A 5AVXA 3BORA 5C8VA 2I3BA 1QTNA 2JBAA 1CVIA 3V6LA 4EYOA 4ENVA 5HW0A 3FNBA 1TFRA 2CYAA 4NCJA 2O2XA 4EG3A 3DXFA 4I1PA 2BBWA 3AIIA 1E9RA 1L5YA 4UDXX 1NFFA 2FSUA 3IAEA 1T4DA 4L50A 4NC9A 4YJHB 4DLRA 5I9IA 5M04A 4RZHA 3H84A 2HSEA 1OX4A 5EHIA 5GINE 1UWLA 2NU9A 2QSJA 3WDMA 4EQZA 2UYQA 4WY5A 3CXUA 2HCJB 3C3XA 4JBYA 2R4QA 1J90A 1KI8A 2VLIA 2PNJA 2J5KA 5SY4A 4QT4A 1BVUA 3Q6QA 3A1SA 1CLEA 4M8LA 3DZBA 2IZZA 1ZEMA 3DE6X 4LOJA 4XKVA 3BAZA 3HO8A 4FZRA 4B7ZA 1L5HA 4NDAA 4AO6A 4ZT2A 4F4JA 1VQ6B 4MA0A 2AN9A 1CD5A 1V37A 2IL1A 3UZUA 1K5GA 3H87A 3ZD9A 3FMPB 1IC6A 2X8LA 4EGQA 1G4HA 1GTZA 1L5MA 4I81A 3L43A 4TL9A 3BMCA 3R41A 2NT3A 2Q5QA 4KYIB 3VO8A 4CL0A 4F1KA 2F17A 4JVNA 3FUVA 1UBGA 3LL7A 5BNWA 1QB7A 4QLOA 2ZJ8A 1J8FA 1CYEA 3L9XA 2WHQA 4ZT4A 3CE6A 1XL1A 3GJ4A 1ZLYA 3SF8A 2OWEA 1HWYA