3I1FA

Gamma-subunit of the translation initiation factor 2 from s. solfataricus in complex with gpp(ch2)p
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
414
structure length
414
Chain Sequence
AWPKVQPEVNIGVVGHVDHGKTTLVQAITGIWTSKHSEELKRGMTIKLGYAETNIGVCESCKKPEAYVTEPSCKSCGSDDEPKFLRRISFIDAPGHEVLMATMLSGAALMDGAILVVAANEPFPQPQTREHFVALGIIGVKNLIIVQNKVDVVSKEEALSQYRQIKQFTKGTWAENVPIIPVSALHKINIDSLIEGIEEYIKTPYRDLSQKPVMLVIRSFDVNKPGTQFNELKGGVIGGSIIQGLFKVDQEIKVLPGLRVEKQGKVSYEPIFTKISSIRFGDEEFKEAKPGGLVAIGTYLDPSLTKADNLLGSIITLADAEVPVLWNIRIKYNLLERVVGAKEMLKVDPIRAKETLMLSVGSSTTLGIVTSVKKDEIEVELRRPVAVWSNNIRTVISRQIAGRWRMIGWGLVEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 subunit gamma
publication title 5-prime-triphosphate end of mRNA recognizes the second GTP-binding site on the gamma-subunit of the archaeal translation initiation factor 2
rcsb
source organism Sulfolobus solfataricus
molecule tags Translation
total genus 70
structure length 414
sequence length 414
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3i1fA02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 3i1fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3i1fA01
3L0PA 1X8JA 4PC2A 4Q4HB 3WMEA 3QG1A 3IEUA 2W6IA 2Z5FA 4Q00A 1ODFA 4HLUC 2WAYA 5FI0B 3TJZA 4L8GA 3K0FB 4ZI2A 4IDOA 4C3ZA 2ZSDA 1AS2A 2QMEA 2GJ8A 2F9LA 1E32A 1S1MA 3ZZTA 1ZJ6A 3OW2B 2PMKA 3F8TA 3B1WA 2FA9A 1F20A 1BMFD 4A6PA 2W6JA 1IAQA 3RC8A 4OHVA 1W44A 3GLGB 2FU5C 2NO7A 4TT3D 1NG9A 3GEEA 2ZRBA 3QE2A 3FWYA 3LD9A 3W5HA 2XNDA 2QG6A 4FCTA 5JEDA 1Z47A 3PUWA 1FFHA 2GTPA 3KUCA 3CC2B 5CYOA 1N5JA 3WNCA 2XOKA 1A5TA 3H0KA 2DPXA 4BQSA 1WF3A 2V54A 3QEJA 4UNQA 2QE7A 3SFZA 3GPLA 1NRJB 1R0XA 4B3BA 5CM8B 4EPTA 3E70C 2C9OA 2EFDB 2JAQA 3QKTA 4URYR 3ZC3A 1KDOA 3NHAA 1NN0A 1UPTA 2FEMA 3AVQA 1ZD9A 2CJWB 5FL7A 3UPUA 1GAQA 3CMEB 5IHPA 3Q7QA 2AXPA 2P6NA 4JVSB 3K70C 4Q1AA 3GLFB 1HQCA 1JAIA 4JVLA 4C2UA 5AR1A 5TARA 2KE5A 3ETLA 3B85A 2CLSA 2REBA 1G3IA 4G1VA 4L9WA 2BWJA 4C0AC 1JPNA 2IHYA 4PFSA 2WICA 3U60B 1GSIA 1S3GA 1ZIPA 2CHVA 2OBMA 2V7QA 3DHWC 3GFTA 3IO5A 4LHXA 4TLDA 3U7EB 4DB4A 3ZQJA 2MMGA 4NMMA 1DAEA 3LX5A 2ZUBA 1GOTA 2PZEA 3BFKA 2EU8A 5F9FA 1S0UA 1TX4B 3CBQA 3CZPA 4LHZA 1VQMB 5F9HA 3WBJA 2VNKA 1E9BA 1OXXK 1KIMA 5H1YA 3G82C 1V43A 4C0QC 1SXJC 1NVXQ 1XZPA 3VFDA 3UXMA 3EA0A 3WRYC 2OAQ1 1WXQA 3T1TA 2O8DA 4OBEA 5F3WB 1NBMD 1EP3B 1II9A 4BLOA 5KO2A 4I1SA 4A0GA 2AHOA 2E1RA 2C8VA 3GJ6A 3TUIC 4LCBA 1XXHE 4J0QA 2ONJA 3CPJB 1Q3HA 1YU9A 3CH4B 5EE5B 4QGFA 1JI0A 3P27A 4QJ4A 5TB5A 4H1UA 3BK7A 4TQUS 5E7JA 3WBKA 2RKOA 4OKSA 3EPKA 4UXHA 4QG7A 5EXXA 3VR4A 1TQ2A 2V55B 1XDBA 2BMEA 4EPVA 3U44A 1DAGA 4B33A 2ZRAA 3MWLA 2YINC 2OZEA 4YXWA 4OQLA 4GT1A 2F1IA 1NN3A 4BGDA 4U5XA 3QQ5A 1CJMA 4JLNA 4ZDJA 1S72B 4TMZA 1JECA 4QBGB 3U5ZB 2ZYUX 1R0WA 2CCJA 5DI3B 4IOJA 1KKLA 1JPJA 2VA8A 2B7CA 1ZD8A 4OI4A 1OH5A 2EWWA 3K8YA 3QBVA 1EX6A 1BJKA 2XNDD 5G40A 3AB3A 4Q4JB 4KJZA 3CMAB 2YWFA 3GJ7A 3V00A 1W36D 2R65A 5L3RA 2HCJB 1E2KA 1GVNB 1Z06A 2E87A 1NLYA 4WBSA 3A4MA 1K73D 2VP6A 2HF8A 3QKUA 2ZRKA 2VEDA 4PAMA 1DO0A 4GPTA 2XNCA 3AVTA 2BKEA 2FGJA 4DHEA 2VZLA 2RGBA 1J2JA 4N1AA 4B71A 2JLYA 1QHNA 5H8WA 4XOIA 1E0SA 3LO5A 3OZUA 1ZUIA 5TR9A 1Z6YA 5FL7D 3W5IA 4A0RA 5GADl 4NTZA 5J4HA 2TMKA 3H86A 1A2BA 4MRVA 4PO8A 3SN6A 2WJVA 2WZQA 2OESA 2HJVA 1CIPA 4TZ6A 4IXMA 1R5OA 3W2FA 2B7BA 3CR7A 3PUXA 1YRBA 3QXXA 5FFMA 1YR6A 3GP8A 1E9RA 1L4UA 4JLDA 2CVFA 5HCIA 3EC2A 3NWJA 1S3SA 3H4MA 5J40A 1ZNZA 1F2TB 2F3RA 3AF0A 2ZRDA 1T3LA 1C1YA 3KJHA 2V7QD 4LZZA 4KSBA 2YVUA 3RS2A 4EPXA 4BPBA 5K8UA 3A36A 4C0BA 4TMTA 2ZJ8A 4MUAA 1OB2A 4QJ3A 3SNHA 1KRHA 1J70A 2KI5A 3NTUA 4WOPA 4KFSA 1XCPA 3BC1A 5FOSA 3FOZA 1TLLA 3BS4A 5AJWA 1TADA 3SDZA 4ASUD 3VNVA 1VQ5B 1QDEA 5L3QB 3RRNA 2RC5A 5KHOC 3L8ZA 4KSCA 3TNFA 2H92A 3DM5A 4GP6A 2H57A 4JL6A 2O8BB 4ACAA 1M7HA 1KAOA 4DIDA 5HXBA 5IRCD 1FX0B 5H68A 3THYA 1XF9A 1OH8A 3U61B 3CCMB 1S9HA 1E2MA 3I72A 1NMZA 4URWR 4UNPA 1X3SA 3O47A 3G0HA 3BXZA 3GQBA 3B1XA 1SM4A 4UAJA 121PA 4HLQB 2IUUA 2ZJBA 3NBZC 1HT2E 2DETA 1R8QA 2GESA 4ARZB 3VR6A 1G3MA 3BIFA 1DPFA 1XXHA 3CRRA 4BASA 4PO1A 3THXA 1CJTC 4NHOA 2GCNA 2J41A 4ABYA 5JMTA 2VTKA 3CONA 4YXWD 2HYIC 3KXKA 4CF7A 3VAAA 2FDCA 4AKGA 4PQRA 3OAAD 5KYKA 3I5XA 2CMKA 3LLMA 4PC3A 3HWSA 3KJEA 3W8NA 3FE2A 4WXPA 1QHYA 3FKSA 1FRQA 5HCNA 1XTJA 4YMWA 3ZJYA 1KNQA 2ORVA 4PC1A 5EE1A 2REXB 3EIQA 1XJCA 5TV2A 4BZPA 4BWYA 1KI7A 2ZR9A 4BLPA 1QGYA 3WXMA 1KI8A 4DCVA 3KXLA 2FE4A 4LYJA 3QKRB 2ZE5A 3BFXA 4MGZR 4R2IA 2IXGA 1COWD 2ZI9A 2VF7A 5CM9C 4DSUA 4RSGA 2HJGA 2ZAOA 2QM7A 2NTYC 1ESNA 2Q0HA 2WOOA 1IOZA 4KHZA 2A5JA 3CKLA 4W5WA 3OESA 4D4JA 2Z43A 4YMTA 3BAFA 1FTNA 3CPHA 4NE2A 4GFDA 5KPJA 4PXAA 5J5CA 4Q66C 1SGWA 1TQ6A 1XX6A 1NY6A 3BD9A 2W2XA 2NPFA 2J0QA 3SFVA 4AK9A 2Z4SA 4WAUA 4C0SA 4B3CA 3CRQA 1CF4A 1MRSA 2FV8A 3LFUA 4MYCA 4QNMA 2FG5A 1H8HA 1SHZA 4MH0R 4D0NA 4TTRA 4GL2A 1HH4A 3HU2A 1VTKA 4Q4LA 2IYLD 2AD5A 2IEYA 3HP1A 3N5CA 5EE3A 4JL8A 4X8MA 4MGYR 3AVVA 4DLTA 3M4YA 1MO4A 4TYYA 4PHHA 2OV2A 2NO6A 3ASZA 2UZIR 2JLZA 1Z3IX 1T0JB 3THWB 3SQWA 1ZW6A 1T6NA 2AK3A 3UATA 3K0CC 4DUGA 3VQTA 1OFTA 4F92B 2EFGA 4U02A 1JR3E 3BWDD 5KSOA 2ZJYA 3N70A 1G4UR 1UF9A 5AUPB 3KQLA 5KPDA 3FPKA 2XTNA 1F2UA 1R5BA 1QHGA 2OK7A 1UADA 5JZVA 2PX3A 2IX3A 4C7OB 2CHGA 1D5CA 2IYYA 2J0UA 1DVRA 3K0AA 3QI2A 1E4YA 1A2KC 3PIRA 1MABB 1VPLA 4CDGA 1XEWY 3R9WA 3B5JA 5TXGA 2ZRIA 3UIEA 3NEYA 1HA3A 4TLAA 1FUKA 1HQYE 2EFCB 4XVQA 3B1VA 3UKDA 2AK2A 1NIJA 4DLYA 4URUR 2WAXA 4BEJA 4DVGA 4TSFD 4AY2A 1W35A 3R8CA 3GLIE 1WDTA 1DS6A 1RKBA 1G5TA 3CWQA 5IK2A 1LB1B 4G5QA 4A15A 1U0JA 4G5RA 4LBWA 4QHTA 4TQ9A 4YC7A 4OK3A 4BFWA 4Q01A 1N2CE 1QZXA 3AVUA 221PA 2GHIA 1J99A 2PEYA 4ZV4A 2RCNA 3B9QA 2C95A 4BZQA 3OIUA 1N3BA 1TU3A 2QAJA 3FKQA 4G1BA 3PUZA 3ADBA 1ZINA 4DEXA 3M0EA 4NDZA 4PPQA 1BYUA 1CR1A 1SXJD 3LAWA 1E64A 3I62A 2PJRA 4BZXA 3FKSD 1MOZA 1AJEA 3QFSA 3CCSB 4DCTA 1OFHA 4AWXA 2C9CA 4R98A 3CUEF 2QL6A 4CEHA 4M0LA 3IHWA 3I61A 2DY1A 1RYFA 2ZSEA 4TYQA 3SJZA 1E69A 2WKQA 5SZIA 1XD9A 2HCBA 2BF4A 1Q3TA 4Q1FA 4C30A 4A9AA 1OXVA 2BOVA 5FL3A 1Q1BA 2QTFA 4D2IA 3I4LA 1X6VA 4R2HA 4F7DA 2XAUA 1KJZA 3R20A 3EX7C 2QAGA 3DMNA 5CIWA 3PV0A 1SVLA 3OEEA 4Q4AA 1OF1A 5F98A 2RH5A 1YR8A 1IHUA 3HJNA 1OIVA 2C96A 4Q1BA 4NBSA 3U4QA 3LW7A 1FTSA 4HUTA 4US0R 4EJSB 4FIDA 1E62A 4HAYA 2CRVA 2YV5A 1H8HD 1UBGA 1OE0A 4RJLA 4BRWA 3TSWA 4B3FX 3D6TB 1TEVA 1R10A 3BB1A 3FMOB 2ORWA 1M34E 4KO8A 5HPYB 1YI2B 5B30A 1XJ0A 2CNDA 3LNCA 4JBXA 4KYUA 4S35A 1JB1A 1D9XA 5K8TA 3L0IB 3FMPB 4PAOA 1W2HA 3VR1A 3W6NA 2F7SA 1NMYA 5JECA 1KO4A 3WYAA 5C18A 3LDAA 3BH6A 1UJ2A 1Z0IA 5FPYA 1G18A 3BOSA 3TH5A 4DQKA 4CEJB 2QT0A 1W5SA 2QDXA 1GUAA 2D7CA 3QBTA 5DE3A 1KKMA 3EZ9A 4K46A 4A8JA 2BCJQ 4DJTA 1F60A 2ZSFA 3KKMA 1JR3A 4B47A 3AF4A 1P9RA 1IXSB 1VG8A 4JVMA 1ZM7A 1U8ZA 5G41A 2ZVQX 3AF1A 1B2RA 2HT6A 2JCSA 1OXUA 3H84A 4LYFA 1FPMA 5C4MA 3A6PC 3NH6A 1D2NA 4ZCMA 2VH5R 1BKDR 2ZE8A 5D3MB 4XWAA 3HU3A 3W8RA 4XH9B 4HZUA 1AZSC 4TMWA 1E2HA 3DL0A 5JWOA 3RWMB 5EE0A 5JWHA 4LBVA 1W46A 3DMDA 3K0CA 1FP6A 1GG2A 4RFSB 1YJ9B 3V4RA 3Q5DA 2KB0A 1E63A 3SC3A 1YQTA 4EFMA 4IDPA 3FHCB 2QEQA 4B2IA 2X2FA 1RZ3A 2AD1A 2O0HA 1M1KD 1M1YE 3GLIA 2OCPA 4GZLA 2CJWA 5B2ZA 1S96A 4KFUA 4XJXA 3KL4A 5BN5A 2ORIA 1RW4A 2ZPTX 1T8UA 1DARA 4LJ4A 1E3MA 2OFWA 2WKRA 3AP2A 2O0KA 3K0EA 1XTSA 2BV3A 1YITB 3UWKA 1NBME 1QFYA 4B73A 4TMXA 4D26A 2VPPA 3DPUA 3ZD6A 4JT4A 1FDRA 2O8FB 1UMKA 3MLEA 1QG4A 1U94A 4B4DA 2FFAA 3CCLB 3SU8A 1P72A 1HEIA 4CRWB 4EDHA 1N8RD 1NVVQ 4DT1B 4ZI3A 4HAWA 2L0XA 2FSIA 2JJ2A 4OQFA 2RGXA 3EARA 4XIGS 5FR2A 2A5YB 1RRFA 4OHXA 4ZKEA 3ZVNA 3I73A 3LLUA 2QTVB 3EA5A 3FPAA 3LY5A 3U3KA 4BFSA 4P6VF 1DG3A 4Y9RA 2G77B 3CPEA 4PZZA 3R9IA 1W2BB 1ZUHA 4DLUA 4DXAA 1XCMA 1CS4C 1KI6B 3W6PA 4GSYA 3PR1A 3UMFA 1DG1G 1AMOA 2FPLA 5IF9A 1Q12A 5L8VA 1DAIA 2ZE6A 3TSOA 5FPKA 2FJUA 4MITA 4DCSA 3RDPA 2BKUA 3ICEA 4QXAA 1NY5A 1Q57A 1G5RA 5DYIA 3UMSA 4B74A 4B3GA 2EYQA 4KU4A 3SYLA 3B9PA 4IFEA 3KUDA 1GNQA 1WE2A 2J5XA 2PJZA 4NH0A 2YC2C 3ASYA 4Q1DA 4RKEA 4TT3A 2X1VA 3EZ6A 2CLCX 1U0LA 1WP9A 1ZVQA 3FJOA 3X1WA 4DLZA 1NSFA 2E9SA 4KFTA 2A9KA 5JSZB 2F43B 5TVKA 1GNPA 4C0LA 1E4VA 5CIQA 1QHSA 2H1LA 3OEHD 5DHFA 1AA9A 3AQ4A 3TAUA 3DZDA 4TWZA 2C03A 4DLWA 3R7WB 2Q9BA 4IDQA 3VKWA 1Z08A 1F6BA 2O0JA 3BBPA 5G53C 5EJEA 2IT1A 4N0DA 5E7MA 2P0EA 5HKKD 4WZBE 2W2TA 4RD0A 4M9QA 4LV6A 2CCGA 1O3YA 2VO1A 4NCJA 3IIKA 1T8TA 5DYGA 1GL7A 3PQCA 4P0TA 5IDVA 2OG2A 2Z4RA 3KZ1E 1G7SA 1NL3A 3QPVA 2O8CA 3W5VA 3KJIA 3GFOA 2J7KA 1IONA 5FTLA 2RB4A 1T5LA 2HXYA 2LCFA 2QU8A 2OTJB 1GKYA 1XE1A 3NBYC 1ETUA 1XFAA 3KQNA 2KSQA 1R0YA 1AK2A 2ZI3A 4V0LA 4OI0A 6Q21A 1ESMA 4IOKA 2A30A 2HLDA 1JNYA 2V3CC 4HAUA 3BRWD 1NG1A 2VYFA 1OB5A 1KK3A 1P73A 3GEHA 5FOUA 2G3YA 3EPJA 3W2IA 5G3ZA 1CNFA 1CNEA 4Q9KA 4O2RA 3EWAA 1KO5A 5P21A 2R6CA 1Z0JA 4KXFB 3LVBA 3A1WA 1Q22A 5AN9A 4GZMA 3QFRA 1JBKA 3MFYA 5FPTA 1DTSA 3ZGXA 4OL0A 1IY0A 3BH7A 1P62B 5AUNB 2Y8EA 3D31A 1T3HA 3PG5A 3TW4A 1KK2A 1NBMA 2JEOA 1E2DA 2QA5A 4JBYA 3PJRA 3QF4B 2ZRHA 3CX8A 2JJ2D 1PVOA 4D4LA 1KSJA 1XMJA 3WYGA 4MGKR 4PPFA 5JS7A 4HB4A 1QHXA 1OH6A 4DQLA 1WQ1R 3CPWB 1CKEA 1JAHA 1XEXB 3DZ8A 1G6OA 3B82A 3I8XA 1GVHA 1ZNWA 3KKQA 4DWJA 2EYUA 2ONKA 4Z54A 5JEEA 2O8BA 4PHGA 1LF0A 2HEIA 3QPWA 1P2VA 3EXAA 1X1SA 1GILA 5FUXA 2QA4B 1R4AA 4RKFA 1M6NA 4RZXA 4EKDA 4ZGNB 4YDSA 4B3DA 1TTTA 5JCZA 2VP5A 3IHLA 4CT5A 4BFTA 2GEVA 4JZKA 2BMJA 2FF7A 2SHKA 3N2EA 1J9ZA 2Q3FA 4LRWA 4NCIA 2A78A 1I4DD 4C4PA 3RLFA 1KZ7B 1GAWA 2WWGA 2C5LA 4GBMA 2D06A 4JLKA 5GJWC 4GMXA 2V1XA 1GIAA 4ZCIA 2I1VB 1P9WA 2MSDB 4MKGA 4B75A 1EWQA 3VHLB 2B8TA 1VYTA 2VSOA 1XRJA 5F2EA 1Q44A 1SVSA 3ADCA 2QMUA 3QG5A 4OHZA 4BFXA 4DLSA 2BGJA 2GF9A 3LO8A 1NN5A 2D2FA 2QT1A 1Q0UA 4DB2A 1H85A 1OIWA 1XD2B 2AR7A 2ZSAA 2P67A 1OJLA 1DAFA 1X8KA 3LVQE 1GZSA 3Q72A 4JL5A 3RS4A 3LV8A 4M1OA 1N6KA 3CIOA 1H42A 4EJSC 1CR0A 1W0JD 2PLFA 5BW8A 1GO2A 1KYIA 1KNXA 1RE0A 1TAGA 1US8A 2WSSD 3CM0A 3TK1A 1CRPA 1S4QA 5HE8A 1CEEA 1GNRA 2IXEA 2VHJA 2O52A 2P2LA 2XB2A 2BN4A 3U3RA 3CD6B 3HYRA 3OJWA 4QHSA 3B60A 3RSLA 5L3SB 1GRRA 4ZDKA 2EQBA 1JQLB 4KVGA 4HE5A 2Q21A 2ZTSA 5LB4A 1Z0KA 3U6KA 1II8B 1VQ4B 1Z0FA 3CCUB 4B34A 1VQPB 3F5FA 3X1DA 3RRZA 2N46A 3RRYA 2QP4A 1HUQA 3UG6A 2WSMA 3G4SB 3JZMA 4D80A 4EPYA 721PA 1SKYB 2VYQA 1RIFA 1SHKA 1G41A 2HLDD 1GRNA 4TLEA 1NI3A 4WIAA 1OIXA 3IPXA 4D4MA 4DSTA 2BMDA 3MWYW 1Z8FA 1OW3B 4AG5A 1R8SA 1VG9B 1E6CA 1E9SA 4GNKA 3ZYCA 4ASUA 4P4SB 4YHBA 2RGNA 1KSGA 3SJCA 2FPMA 3RHFA 3DM9B 5G3YA 1L7VC 2QM8A 4K1XA 1KY3A 1UEJA 1NVVR 1LY1A 2W2VA 2GJSA 4PZYA 1SVIA 3HR7A 4JSTA 3IDQA 3PENA 2YWGA 5KSYA 3EPHA 1G20E 3FMFA 2QGZA 2CK3D 3QSYA 2PZGA 5DH9A 1W49A 1Z6XA 2NGRA 1FW6A 3IQXA 3AP3A 1XBTA 5EE9A 4UKDA 3FHTA 1SXJE 5JJLA 4BFYA 2AFIE 4EIWA 2PCJA 1V5WA 3IBGA 3S1AB 1DADA 1Q1EA 5LDDC 2XXAA 3ZH9B 4Q1CA 1FZQA 3RANA 5JI2E 1SVMA 2HDNB 5CK4A 2GEUA 4PQFA 2RGDA 4ACBA 1Q20A 1RYHA 2ZRFA 3OAAA 8OHMA 1AGPA 5BYKA 5J4VA 3AVPA 1ZCAA 5C2JB 1QUFA 4CIDA 2DR3A 4HSEA 2Z6VA 3QXHA 1P60A 2HUPA 1UFQA 2RGEA 2QQ0A 4F4IA 4MRSA 4V0MA 1W4RA 1HY3A 2G1KA 3C16C 1KMQA 1N5IA 4DSNA 1COWA 2CL0X 3NHBA 2ZYTX 4PX9A 3RAPR 1QGAA 1U8AA 4HATA 2FNAA 1P4SA 3AUXA 4HLUA 4JT2A 4M53A 4MQBA 4TYPA 1YJWB 2ZR0A 4ZGQB 2NZJA 5GVSA 3DKPA 1RPZA 5DSZA 5JI3E 1G8PA 1IY2A 1E79D 1ZU4A 2ZVPX 5FH9A 1CULC 1XMSA 3LWNA 3MG9A 3SJBA 1BIFA 1YR7A 2I3BA 4XD7D 2GETA 4MRRA 4E09A 4PPGA 3EZ2A 3FGNA 4M1YA 2DFKB 3U3JA 5EP2A 4A92A 4C0KA 3Q7PA 2DWOA 4B44A 4Y0AA 2JLWA 3ES9A 1TMKA 2GEDA 1E0KA 3SZRA 3T34A 1FNNA 3AF3A 4NKRA 3A1UA 4HAXA 4XTRA 4QM7A 3QXSA 4UJ5A 3MJRA 4Q9LA 2AXNA 2JLSA 4LV5B 5FOXA 1W7AA 2G9NA 2FSFA 1YZNA 3N2IA 1KSFX 2QGNA 3W5UA 5GV7A 1NF3A 2W58A 1IJFA 1C4OA 3D8BA 3ZZUA 4AF6A 3QIAA 4XSHA 5CJPA 2IWHA 5CJ2A 2B8WA 4EH1A 1QHHB 4HB0A 1KO8A 4CEIB 1U8YA 3WRXC 1W5TA 4LJ8A 1IY1A 2GAAA 4HLCA 3TBKA 3GMTA 1W1WA 1KMHA 2WJJA 2AN9A 4ZDWA 2WWFA 2UKDA 3HPRA 2DYKA 2J9RA 4EQ6B 1H8EA 1KJWA 2QY9A 2H16A 3K09C 4C9BA 2O8EA 2ZRLA 4HAZA 4TSFA 2VRWA 2KWIA 1KDPA 3NXSA 3MCAA 1S2MA 1GKIA 1A7JA 3ZVMA 4L5BA 1Q86D 4LV8B 2GAOA 4NYIQ 2QROA 2IK8A 1S8FA 4KITB 2P5TB 3C5HA 2YOGA 2XITA 3VX4A 2WIBA 2NO1A 4ILEA 1E96A 2J7PD 4PANA 4DLVA 4GOKA 2ATXA 2IHBA 2WM9B 2EWVA 3LXRA 5CLQA 1TVCA 1VIAA 2D3WA 4M8NE 4LSGA 4U7DA 2OHFA 2WWXA 4TL8A 1G1MA 2GWHA 1G8GA 2G6BA 3GLHE 3QXJA 2WVJA 1SXJA 3I56B 1PLLA 4JLPA 1MT0A 3QOFA 1E0AA 1G5PA 3KTAA 3T1QA 5FOVA 3I32A 4M9XA 4WZAE 2FX3A 4MYHA 1E1RD 4D0GA 4GMDA 1T3SA 2B21A 1JEDA 3VU9A 4JLAA 3D7MA 4NONA 4LX0A 2ZYVX 2AKYA 4ZIRA 4LDJA 5CYPA 4OJQA 3SJAA 1HURA 4I1VA 3V9PA 1DDGA 3FDIA 4KLNA 4F91B 4KVAA 1Q82D 3MRSA 4M2LA 2YOHA 4Q48A 2ODEA 2XZOA 1KTVA 3RS7A 2JJ8A 1JA0A 2ZUCA 4GOXA 4Q18A 4NYJQ 1IN6A 1R5NA 3IGFA 2ZI5A 1OV4A 2B92A 4GI7A 3W5JA 1CR4A 2MMCA 1U0HC 2C77A 1OGIA 4GP7A 2W00A 1KD1D 4DT1A 3O8CA 3AM1A 1TF7A 2ZU0C 5A4JA 3UK6A 3OE7A 2GCOA 3QKSA 5DGXA 4AYXA 1YIJB 4BLRA 2GZAA 2GILA 4LJ9A 1NN1A 2JLXA 3IEVA 1CQXA 2RAPA 1H65A 1VYVA 1W47A 2GF0A 3EAQA 4GRAA 1N6RA 1DDIA 3HU1A 4QGAA 1JQJC 2DWQA 2R2AA 3H2YA 1DAKA 2R6DA 3A1SA 3FHOA 4DDUA 2K5UA 2QBYB 4MUBA 5J4LA 1U2RA 1KSHA 1G64A 3MUFA 5H70A 4ESVA 1YZUA 4LI0A 2D4HA 3GLGE 1VECA 3K1JA 3O8DA 4Z8YA 2FN4A 1G3QA 4B48A 2QP3A 4ZKDA 2N1BA 1M74A 5FBRB 1T4GA 2FMXA 4AURA 3L82B 1QFZA 1LFDB 1OYYA 1Z6AA 3ZIAD 1GP2A 2J45A 2WJHA 1ONBA 5KNCA 3K70D 3KX2A 1LS6A 4TLBA 4MKFA 2VHTA 1P75A 4HUQA 1FRNA 2FFHA 2V6JA 1CTQA 4B6FA 2O8DB 4LC0A 1HV8A 2HMAA 1H8ED 4IOMA 4B43A 4XWOA 1YHNA 3PUYA 1Q7YD 4JS0A 1EP1B 4EFLA 1LV7A 3CCQB 1Z5ZA 3NBFA 4M1KA 1E2LA 4FINA 2EFEB 1UBEA 4C2TA 3E5HA 4OQNA 4Q7KA 5DN6A 3U7FB 4KV9A 1GL9B 1K6MA 2NZ8A 3D3QA 3GLFE 1G8HA 4A0HA 1G7TA 2QTZA 4YAOA 3IO3A 2CBZA 1XP8A 2D62A 5C46F 2IA5A 1Z63A 4FMBB 3ECCA 3MSXA 2IYUA 3ZVLA 3U44B 4LGMA 3CCVB 4WW0A 3X2SA 1OFUX 4PSKA 3GCGA 2CE7A 2IEZA 2OFXA 3BB4A 2I1QA 3L0SA 1XU4A 4HDQB 3QFCA 3AV0B 2JLUA 5EXTA 3T15A 2ZR7A 3AVWA 4QC2A 1Q81D 4MDFA 3RS3A 3JVVA 4M1MA 2BJWA 3GLHA 1LW7A 3K09A 1ZNYA 4FD2A 3QFTA 1TPZA 4P33A 3K9GA 4IJMA 1D2MA 1KDTA 2ZRJA 4M21A 3RC3A 3RWOA 5DIFA 2OK8A 1FMJA 2RHDA 4E03A 3V76A 3G71B 4NCHA 1Z07A 3U6BA 4A2WA 2QPOA 1G6HA 2ZI4A 4R9UC 4PHTA 2QSYA 3KQHA 1RRGA 3KFXA 4DDVA 1NVWQ 1BH2A 3AKYA 4OI1A 2XX3A 2X2EA 1IN4A 3TR0A 5HZKA 5J47A 3LBIA 2IS4A 1X1RA 2FEOA 4TL9A 4B2PA 5J4KA 3T1OA 1BX0A 4MDEA 2QBYA 5THXA 4BRUA 5KDDA 3NDBB 1JJ2B 1HT1E 2GDJA 4JBWA 3I8SA 2FFQA 2HXSA 4Q7MB 1S1CA 4U00A 4EUNA 1IN5A 5JJKA 3OE7D 4MGIR 3T61A 4URVR 1G8YA 2G1JA 1TQ4A 1TQDA 1G291 5LB2A 1SZPA 2CVHA 2J0SA 3IPYA 2KBFA 1VG1A 4L4UA 4PGOA 2OBLA 3TW8B 4G5OA 1P2SA 2JASA 4Q4HA 4QBIA 3LBNA 2PCLA 2QMOA 2OFOA 2ZYWX 3M6AA 5SZHB 1KOFA 2XTZA 1E99A 1YZKA 1A8PA 3AVOA 2ZJ5A 3K0FA 4NYMQ 1XMVA 2OBNA 4Q47A 1XCGB 5CK5A 5KOYA 2ZRGA 4OHWA 3CX7A 3SYKA 1M8PA 2C04A 2O5VA 1DEKA 3A4LA 2VP2A 3ZQ6A 3OEHA 3DO6A 1VQ8B 2PLRA 3I1FA 1KO7A 1Q1ZA 4H9GA 1SVOA 5BN3A 1XD8A 3SYNA 3GLGA 2XB4A 4DLRA 2H5EA 2GK7A 2RGCA 3KKPA 4OK5A 5HKKA 1GITA 2YWHA 2ZQ5A 3NIBA 4E22A 2WOJA 4LJYA 1KJYA 1NKSA 2DFLA 3THYB 4TMVA 2VP4A 2VF8A 3X1ZA 5B58C 3TGPA 1QF9A 1G3UA 1KAGA 2FH5B 2ZJZA 4URZR 1N25A 3G5UA 1A82A 3L2OB 4V0OA 4IDHA 4DBLC 2BVNA 2IL1A 3IUYA 5DN6D 4IEIA 4NU0A 3TLXA 3W3ZB 1XNJA 4D0LB 2ZU6A 5KDOA 4TYWA 4Q03A 2GCPA 1R2QA 4R7ZA 3B1YA 1K5DA 3UG7A 1EG7A 3AGPA 1KI9A 1KDRA 1XXHB 5KSWB 3VR3A 2EIXA 2VSFA 3THXB 1SKQA 1E9CA 4KCGA 1G4AE 1F5NA 3GLFA 3PVSA 3SHWA 1YJNB 1LNZA 3GJ8A 4II7A 3WP0A 2DCUA 1LVGA 1WMSA 4CVNA 3FFBA 1XPUA 4RD2A 5FBVB 4LJ5A 1Q21A 1NP6A 3DOEA 4DDTA 3GEIA 3NDPA 2V8OA 3IIJA 1JR6A 3ND9A 4CW7A 4MKIA 4JJZA 3Q3JB 2XJ9A 5FUYA 4B2LA 2G88A 1Z0AA 4R71A 4QGHA 5FTJA 3OZXA 1BYIA 2VIIA 3C15C 4ZDIA 4IVPA 4RCYA 4P4UA 3QE0A 3GJ5A 2GBLC 3QVUA 1OKKA 2DFTA 4ZPXA 1YZLA 3BGWA 4X8HA 1JXOA 2A5DA 5AK0A 2OT3B 4HDCA 2R8RA 1B23P 4CGZA 5JWRA 5LD2B 2WTUA 4NYJR 4JKIA 2C2HA 1QBKC 3HDTA 1QG0A 1FUUA 4L16A 3B78A 2VHCA 2JA1A 5M04A 4XVUA 4RD6A 1KGDA 1VKJA 1PJRA 1IB0A 3CRW1 3E1SA 3ZBTA 1E1QA 1HE8B 2ASEA 2QPAA 1E2JA 4KI0A 4D4KA 3DVLA 5B57C 2BEJA 4TLCA 5FTNA 2VSXA 4A4DA 5JJIA 5FOTA 4YAFA 2F1HA 3P26A 4A6XA 2V4ZA 5BWMA 2WWIA 2QI9C 1XPOA 3BJIC 3S1AA 4OJKA 2QRZA 4Q9JA 3T5DA 4CZ2A 1E94E 1XEWX 4D81A 3O8RA 1VQOB 4M9ZA 3AVXA 1CXZA 4LY6A 3ZDQA 3TRFA 3ADDA 1PZNA 5L3VA 4TL7A 2G0NA 4LBYA 1C9KA 1E2EA 1F2UB 4ESHA 4JSYA 4W9MC 4G3XA 4A36A 1QVAA 1EXMA 5DI3A 2J0UB 3NEJA 1AIPA 1KO1A 3K0AB 4IW3B 2OEPA 1CP2A 1FNCA 1W0JA 3OIWA 3Q9LA 5EP1A 1PV4A 1P5ZB 2WSSA 4NCKA 4D82A 3WNDA 2OSBA 3OF5A 2BBWA 3SHFA 1CJVC 4Q7LA 1W4BA 4TMKA 2UZ3A 2NQ2C 1NJFA 1FNBA 3VTKA 3X1XA 4Q4JA 4RZUA 4US1R 2GA8A 4Q1EA 4POAA 2BM1A 4FMDF 1QVRA 2P5SA 1E0JA 1P9NA 2RMKA 5JFGA 4AF7A 4KFRA 4LJ6A 1MO3A 2C98A 2OXRA 2FGKA 2GKSA 1X86B 3H1TA 5TMPA 2LWIA 5FUWA 3HPQA 4IKEA 2YJTD 3AH8A 2OTLB 4CT4B 1WRBA 2ZI6A 2KBEA 4HB3A 1OYWA 1I7PA 2ZETA 3B8HA 3DEFA 1XB2A 3EWSA 3OFND 3CX6A 4JJKA 4DKXA 5KSZA 2ZJOA 3LX8A 3TR5A 3QEOA 5FPHA 2GZHA 1TL7C 2A7QA 5GVRA 2F3TA 4WZ6A 2ZRPA 3TUZC 2PIAA 1JA1A 3IQWA 1L2TA 2A2ZA 3CNLA 2C99A 4IRUB 4N3GA 1GRQA 3Q8XB 2IWRA 1QG2A 1TF5A 1E2QA 2BBSA 1F2TA 4CEHB 2OCBA 3KJGA 2QORA 3VHXA 1VMAA 4HEJA 4C0HA 5HTKA 2ANCA 3MHPA 3GJ0A 3QXCA 4AKEA 1AZTA 2GQFA 2V6IA 2WPDD 2XJ4A 5AWFC 2JGNA 2CK3A 4BLSA 1OKKD 3LA6A 2QAGB 2DERA 1KHTA 1CRQA 4Q4AB 3WHKA 1KK1A 1TUIA 1D1NA 2G0TA 5L3QA 2D74A 1EK0A 1L4YA 3U7GA 2GNOA 1GKUB 1WB9A 1TEXA 2ZS7A 5UKDA 4RD4A 1GL6A 1TU4A 1FMLA 1FX0A 1ZAKA 3BFVA 2IYXA 1QVGB 3CNNA 3U4QB 1E1QD 2ERXA 3TKLA 4OI2A 4V0ME 3W90A 2W0MA 4OQXA 3ONWA 2QTLA 3T35A 5EQTA 4ERNA 4OYHA 1FL9A 2QSZA 4XSGA 4ZO4A 3VKGA 1UKVY 2XSZD 4I81A 3RS0A 4ARZA 2RHMA 3P1JA 2FFBA 3CCRB 1W87A 1LF5A 4NCNA 4DLXA 2CE2X 2AWOA 1IJEA 1R0ZA 2JJ1A 2WJGA 1MR3F 4NYMR 4PQYA 4W5JA 2WIAA 2GBLA 3LQQA 1EFTA 2AWNA 4FI3C 4F93B 4PC7A 2F6RA 1EFUA 1IN8A 3WY9A 1TNDA 3QVVA 4A8JB 2J3EA 4YLGA 3M1IA 2IYRA 5E7IA 1E79A 1ZM3A 3CWZA 4UNRA 1P61B 3B1ZA 1SQ5A 1P7CA 2BEKA 4GOJA 4UXIA 4XD7A 1ZYUA 3EG5A 1GWNA 3PEWA 4RFVA 3GJ3A 3VR2A 3QKRA 3JQRA 2R6GA 2F55A 1EFHA 3OIVA 2NG1A 4Z1MA 2YOFA 4DCUA 4HZUB 4FMDB 2DB3A 1OHHD 1M7BA 1YJ5A 2X3UA 3LQRA 4RVCA 2NMVA 1QGZA 5EZ6B 4AG6A 4AKHA 2FZLA 3FYHA 4WVFA 5FTKA 2QPTA 3K0SA 1NSTA 5AJVB 3KQKA 3RNLA 1QH0A 2PBRA 1EGAA 1NJID 3BH0A 3GLIB 3A58B 4A2PA 3W3AA 1N6HA 1XJQA 2IXFA 1ZIOA 3I92A 1PLKA 4JLVA 2DBYA 2G83A 3OIYA 4LHWA 2XEXA 3ZZ0A 1N6NA 2WHXA 5EZ5A 1KC8D 4U9UA 2ZAMA 2J46A 4OQMA 1P2TA 1UBCA 2WBLC 4LPKA 4JLOA 3CB4A 1BX1A 2GVZC 2BHRA 4AC9A 3THWA 1JJ7A 3W34A 1U9IC 2IW3A 3EZ7A 2XNJA 4O3MA 4QM6A 2R62A 1QFJA 1VCOA 1YRAA 4QOSA 5HR5A 3A1TA 2DFNA 5CLLA 1E2GA 2A5FA 3RABA 4BEBA 4C7OA 1XZQA 1VCNA 2FSHA 2F1RA 4G5SA 1YE8A 4PTLA 5JLJA 3CRVA 4Q19A 5KDLA 3WP1B 1E2PA 2CCKA 2MSEB 1AKYA 1MABA 4PC6A 2J7PA 1N6LA 4UQOA 1KZGB 3L0OA 3CO5A 4FN5A 3W6OA 2GJ9A 2OUKA 1AN0A 5TY0A 4RZ2A 1E2IA 3TQFA 2CL7X 2GK6A 4NP6A 3AF2A 2F1JA 2A3RA 1U90A 2V1UA 3BORA 3CC4B 3PXGA 3NG1A 4P32A 4RCZA 1SVWA 4M1SA 1J8YF 1E1RA 2BPOA 2CL6X 3UWOA 3W2GA 1VIYA 1JB9A 4IVRA 2BMFA 2BBOA 4ITRC 4N0EA 5DO9A 3VNUA 5BN4A 2JJ1D 2W6ID 2IUTA 1UDWA 4LYHA 1N0UA 2HYDA 4N3NA 4Q9HA 4MYTA 1AS0A 2VP0A 4K81B 3EIHA 5LD2C 4V0KA 5A5GA 2IYQA 4FCVA 4EPWA 4P4TA 4DIEA 1G17A 1IQPA 1HE1C 2J87A 1PLJA 1JEEA 4Q9IA 5IT5A 3NH9A 5AUQA 3F3YA 1A1VA 2D2EA 5CB8A 3OZVA 2W6JD 5EP4A 4QJ5A 3L8YA 4LK2A 4AYWA 2WMNB 1ANKA 4UXJA 2BCGY 1IXZA 2Z83A 3CZQA 4E5UA 2NIPA 3R9XA 3KQUA 2IYWA 4FMCF 3QPUA 4S2EA 4DC9A 4Z1MD 3ZLJA 1E9DA 2XOKD 4YMSA 1UBFA 5EUMA 2IF2A 2PH1A 3I3SR 2EW1A 3VKHA 1JJVA 1XPRA 2QE7D 3NVAA 2FSGA 3ZD7A 2O8CB 4QFMA 2IC5A 5GJVC 1JXMA 3CRZA 1VHLA 1NKTA 3AUYA 4HB2A 4W7SA 4K8OA 3T1VA 4IDNA 5E3HA 1D2EA 3C5CA 4URXR 1WBDA 2N42A 3TVDA 1NIPA 2C78A 2BSAA 2ECKA 1Z6TA 4FCWA 2GJAA 4X8OA 1RFLA 2CLDX 4EJSA 1RJ9B 1VDZA 1SVKA 3SI7A 4YAUA 1N6OA 1I4LD 3X1YA 3UANA 3ZIAA 5GJCA 3GJXC 3HYTA 3P32A 2WMOB 5BXQC 4Z8XA 2BMWA 3KKNA 4MYUA 1R7RA 3T06B 2JIZA 2ZANA 5K8IA 2R44A 3PEYA 1XTRA 2XZPA 3CC7B 3W9YA 3AGQA 1BO6A 1MV5A 2BBTA 4CEJA 4D25A 2QENA 5CDFE 4Y0VA 4Y7CA 3A8TA 2ERYA 2OLJA 3RYTC 4TYNA 2HT1A 1ELOA 1EWRA 1J8MF 4YALA 4B3XA 1FP7A 3OHMA 4BFVA 2JDIA 1UKEA 2CHQA 5KUTA 2ZXUA 1WCV1 5KNDA 3C8UA 3GJ4A 2Q3MA 2GXUA 1XEFA 1XTQA 2X77A 4LJAA 2GXSA 5AJXA 5D3MA 3UMRA 4LJ7A 3WHLA 4B35A 4IOLA 3KB1A 4V02A 3SE0A 1I2MA 4TL6A 1M90D 1OLOA 4MRNA 1U9IA 2PL3A 3PUVA 3IILA 4IFBA 4TQAA 5B64A 1UEIA 3EW9A 4RFSA 1CJKC 2YWEA 4Q7JB 4A2QA 3U3MA 2B5OA 1UKYA 3GD7A 3C41J 2IS6A 4PSAA 1EX7A 1OT3A 2QAGC 2H7VA 3WYFA 1ZUNB 3SS8A 2QNRA 2ZSBA 1T5IA 3CF0A 3V4FA 5D3QA 2GVDC 1W36B 3F0TA 1G7CA 1G7RA 2Q9CA 4IXNA 1HYQA 1WA5A 4O25A 3C7KA 4JLJA 1IM2A 4UNSA 4TTPA 5DNYB 2R6HA 1VYUA 2RC6A 2QMHA 1GDDA 1ZD1A 4V03A 1OGJA 1ZM2A 1B0UA 1XWIA 3QY0A 2O8FA 4LOAA 1US8B 4G01B 2AKAB 4JKYA 4KLZA 1G9XA 1T9HA 4I4LA 1Y63A 4KODA 2D7DA 1AGRA 4O0MA 2F9MA 3K9HA 5GV8A 1CJUC 1ZP6A 2Z0MA 4FMCB 4QGGA 2AX4A 5JRJA 1MH1A 3B6EA 4XVRA 2C9YA 1UAAA 2HF9A 3P4XA 3IKJA 1RRCA 1EWYA 1LS1A 1N6IA 2NO0A 2WWWA 1CU1A 1A4RA 3TE6A 4B6EA 1Z22A 5SZJA 5EXPA 4LYAA 4YQFA 1KI6A 3MD0A 3CR8A 1FNDA 2Q6TA 1VCMA 2YNMA 1VG0B 2W83A 4A8JC 2OLKA 5FUVA 2OAP1 3PFIA 1XTKA 4OK6A 4A0FA 1ZBDA 2GZDA 2IYTA 3MJHA 4B76A 3HR8A 4LHYA 3FVQA 1D8TA 2IS1A 2AL7A 4AKIA 1ZM4A 3ICQB 2VHQA 2FPKA 5HZHA 4YONB 2H17A 5FI1B 1NDHA 2ODWA 1RRPA 2YYZA 4PO9A 1J90A 1W2GA 4L15A 5J4YA 4AI6A 1K8RA 3L43A 1XMIA 4G5GA 2JIZD 3TIFA 3I5YA 3MWKA 4Y9UA 3I55B 1YR9A 3A37A 2BC9A 2OO7A 5ELXA 2EFHB 1TF2A 4V0NA 1HTWA 3BERA 1W34A 2ZREA 3CF2A 3PEUA 1AS3A 4UJ3A 5JSZA 3FMIA 1FQJA 1QRAA 2WV9A 1ZMXA 2YC4C 2F43A 521PA 2QN6A 1YZGA 3AKEA 2I4IA 4KAXA 1G3RA 1N5KA 4RY2A 4JIMA 4A1FA 3VX3A 4W5HA 4YDHB 3KB2A 2OXCA 3R7WA 4RD1A 2WJYA 3DOFA 2A5GA 3KDSE 2JDID 2JLRA 5CDFA 1EFCA 3B13B 1BOFA 2H8KA 2XXAB 3VO2A 1NJGA 3MAAC 4FWIB 5FR1A 3TAHA 5LBIA 4OHYA 3VR5A 3VO1A 2GXQA 3AVYA 3E20A 2R9VA 1IN7A 1E2FA 2VHUA 4QKQA 4JYCA 621PA 1QX4A 3LRPA 3TUJC 1K8AD 3ADKA 1P2UA 1SKYE 1ZM9A 1WBBA 4DCNA 3Q85A 3P20A 3JZAA 1VQ9B 4PAQA 3LBHA 2GXAA 1MKYA 1ZRHA 2PZFA 2V9PA 1OXTA 3C4JA 4WXRA 3EIEA 3MGCA 2QEXB 3AKDA 5AUOB 2OE2A 3THOA 1QUEA 3ZVRA 3E2IA 5A0FA 1M2OB 2JLQA 4RD3A 4AD8A 4M1TA 3SEAA 5KSPA 1DE0A 1ZU5A 2REOA 3FFAA 4LUCA 1TUEA 3TVTA 4QRHA 5GJBA 1EP2B 4WA7A 1CR2A 3LH5A 5CB6A 3LVRE 5FTMA 3REGA 1P3JA 1W0KA 5JCPA 2XTMA 1OPXA 2J59A 1GM5A 3B7GA 3KKOA 1NMXA 4X8LA 1K5GA 3U3OA 1CLUA 2BDTA 3QF4A 2ZITA 1II0A 1VQLB 4C0JA 3EC1A 4BFUA 4PZLA 2ATVA 2W0SA 2RGAA 1XEXA 3ND8A 2OM2A 1VQKB 3CXCB 3NC1C 1W4AA 4HAVA 2DEUA 3CH5A 1NVUQ 1U98A 2ZRCA 4M4SA 1GAJA 1E98A 2Q3HA 2IYSA 1G8FA 3QENA 2VL7A 2P6RA 1N0VC 3GFPA 1OSNA 2UVQA 3CLVA 1FOEB 4C43A 4I1UA 3K9LA 5EUQB 5JHHB 4I1OA 1N6PA 1G16A 1KMHB 1KI1A 2KJQA 2ZS9A 1GJRA 1DELA 4B32A 5ANRB 2YKGA 3K70B 1KI3A 5BQ5A 4G0NA 3ZS8A 1YZQA 3CCJB 4CYMA 2CNWA 4Q02A 4TN1A 1Z28A 4DUGD 1R6BX 2PEZA 5DHAA 5H5JA 4EFNA 5K8LA 3IBYA 1ZNXA 3ZBUA 1DAMA 2O8EB 3Q5EA 2GRJA 4LWZA 3WMGA 1XD2A 3G6EB 4L9SA 3REFA 4FW9A 4NYIR 1BS1A 1KI4A 2FOLA 2GJKA 3U7HB 2B6HA 4LC1A 4BFZA 1Z29A 3BB3A 3P4YA 2Q9AA 1NLZA 2FWRA 1MRNA 4MKHA 1MO5A 3EZFA 1ZC4A 1QHIA 1D6JA 4F38A 4NL4H 3OFNA 5FOWA 4P31A 3OZWA 4DRZA 4M22A 2ODBA 5AJYA 2JLVA 1YZTA 4QHYA 1BQEA 1T0HB 1CBUA 2VNHA 1G19A 2IYVA 2X8AA 1SXJB 4AIIA 2ZUDA 5L3SA 1G21E 1E9AA 3W2HA 4BLQA 1JALA 5KTYA 4WQMA 4YAWA 1U81A 1II8A 1VQ7B 2OCYC 2VBCA 3KTAB 1OXSC 3NC0C 2XGJA 2ZROA 4LBZA 4H1VA 5IK2D 4MA4A 4RZ3A 1GTVA 3U2QA 1ZC3A 1UDXA 5HE9A 2WJIA 2VLIA 3OJXA 1GFIA 4JLMA 3NBXX 3VU9B 2NPIA 5C4GB 2IS2A 2R6FA 5E95A 2ZM5A 4PPNA 3K9NA 1F3OA 4ZIRB 3BE4A 4EAQA 3DKVA 3K53A 2YHSA 1SULA 5E4FA 3ZS9A 2WPDA 2HV8A 3CF6R 2LKDA 1EFRA 3MWJA 4D6PA 1EESA 1DBSA 4F7WA 5JBQA 2CXXA 5JRZA 4M9SA 3KXIA 1U99A 1FNMA 4PSVA 2NOAA 2VNIA 1I4TD 1NLFA 2PT7A 4P4SA 5EMNA 1AKEA 1DO2A 5FBWB 3RRMA 1W0KD 2CDNA 3SBEA 2PX0A 3JQQA 3TQCA 1PUIA 3CCEB 821PA 2PMDA 3R8FA 4XWKA 3MMPA 2X19A 5C1BA 1VHTA 4US2R 4G1UC 2ANBA 1W48A 3JQPA 2GCOB 3QKSB 4BLTA 3WMFA 3IIMA 3RVBA 2BM0A 4IEEA 3CW2A 3OEED 3PITA 2XSZA 4NZYA 3CNOA 4BE7B 5H59A 3FB4A 4LPSA 5KNBA 1W36C 5SZKB 3RSOA 2RGGA 2PT5A 1VQNB 2JATA 2ZS8A 2XNSA 1YHQB 5DI9A 3C14C 4DEYA 4YMVA 1IBRA 1OH7A 4HI0E 1Q1QA 1KY2A 4JLBA 1YVDA 2ZRNA 5JHGB 3PCRB 1Z2AA 4EPRA 4MRPA 3SOPA 3QUSA 1OFIA 1S9DA 4HYYA 1Z6GA 2ZIAA 2LKCA 1DOAA 1E9EA 5DISB 4Q5IA 4I99A 4BUJA 4DSOA 2WWYA 2QZ4A 3E1YE 4YMUA 3T5GA 1BMFA 1XTIA 1J7KA 2IYZA 3KFVA 1N5LA 3SBDA 1GR1A 5KU1A 4LHVA 3AP1A 4QBFA 2IBMA 1Z2CA 1MO6A 2CNWD 2WKPA 3TSZA 4M1WA 4BECA 4HUQB 4QNRA 4DDWA 1LTQA 1AQYA 2YZ2A 1K9MD 2CEAA 3RS5A 3PEVA 4PR0A 1PUJA 5FBQB 4IHQA 2J1LA 1Z83A 1Y3AA 2ZEJA 2DHRA 2ZI7A 4Q21A 1UM8A 1W4CA 5EP3A 1OHHA 3CRMA 4KBGA 4Z51A 2AFHE 4KBFA 3O8BA 3QF7A 1KK0A 5EXSA 1VQ6B 3T12A 1D9ZA 3EASA 1AM4D 4F4CA 1JR3D 1YKSA 2BJVA 4BPRA 2XZLA 4TTQA 421PA 5BYJA 1AQUA 2P65A 3DDCA 2ZJAA 1KQSB 4E07A 3A4NA 4HE6A 2QQEA 2ZJ2A 3LXXA 2GPJA 4TZ0A 2MSCB 2RGNC 3SR0A 2BIFA 4GDFA 2P6UA 1UKZA 2ODNA 2QP9X 2EVWX 3B2EA 1Z0DA 3J81k 4UNNA 5DLQC 3WNBA 3VMFA 1L8QA 4A82A 1KI2A 1F48A 4ON9A 4PHFA 1O87A 3GLHB 4FWTA 2P3SA 3AKCA 1X8LA 2OILA 4HZIA 4QBHA 4QL3A 4O2LA 1VCIA 2DWPA 2OCAA 2J0VA 2QRNA 2R6AA 2ZRMA 3A1VA 1DAHA 3EPLA 4FK8A 1M7GA 2NO9A 4F4JA 2BGIA 1NNEA 1QHHA 4DZZA 5FPSA 3QJYA 4KYIB 4CEIA 1RJ9A 2H18A 1EFRD 2WWHA 4FXPA 5FA6A 5TDHA 3TMKA 4HDOB 1IXRC 2QTHA 2VNJA 3NKVA 2QUZA 2VP9A 4XTCS 4NPHA 1FQKA 5AJZA 4AYTA 3QNUA 3JVUA 1T91A 5LPNA 1P6XA 4P3YA 3LW8A 2FZ4A 4HLDA 4JMPA 1E2NA 4EQ6A 5CITA 4JYBA 3W2EA 2VQSA 1ZCBA 5FBLB 2IUSA 2IF0A 2ZE7A 1RC8A 3SQXA 5JS8A 3AEZA 1E9FA 4JVNA 1QVFB 4ZCLA 1N0WA 1I2DA 3FTQA 4IVQA 1RVDA
chains in the Genus database with same CATH superfamily
3HZHA 1M8GA 1HG0A 3L0PA 4Q4HB 2X23A 3TRIA 1ECPA 3X43A 3WMEA 1RHMA 1YOBA 2VTDA 3PGA1 2I4NA 4OA8A 4ALJA 3QYAA 4ARBA 4ZI2A 4R54A 4C3ZA 1Z17A 3R4VA 3W9BA 3TIVA 1AS2A 2QMEA 4M8LA 1T6ZA 2DF8A 4ZQGA 3KZCA 3CNEA 4X6XA 4G89A 1ZJ6A 5BSTA 2PMKA 1ENZA 2PQ6A 4UTVA 1NZDA 5A4AA 3NAGA 3C1OA 3M3PA 3SC2B 2W6JA 2BFCA 1BXZA 1EQUA 3BZBA 4YUWA 1YLOA 1W44A 1NVDA 2YWCA 4NICA 1NUTA 1R4MB 3HN6A 4XI9A 3WIOA 3IE1A 4WWVA 1WHTB 2HA4A 2WINI 2WPNA 3LCJA 3GEEA 1DEXA 1KXJA 1WTHD 2XYPA 3FNQA 3ICCA 1T5SA 4PLWA 3ZIDA 4DILA 5IFLA 1Y7PA 4FCTA 4XWTA 4EG3A 3GT0A 5JG7A 1Z47A 4RNCA 2BD0A 1HVXA 5J1SB 1KC1A 1VLOA 3WNQA 5K8CA 1U4OA 2OOKA 3KKZA 2DPXA 4BQSA 4BVJA 2V54A 3WJ2A 4UNQA 3M6MD 2JJQA 4PYNA 4KC0A 4UFNA 1H6AA 3HHEA 4JEMA 4OM8A 2OPBA 3GDGA 5CM8B 4OBXA 1OZFA 4B3BA 3WB0A 4OGKA 1TK2A 4R81A 4J3NA 3SYRA 3U39A 4AZTA 5HX7A 5LL6P 4Y6PA 1NN0A 3RGGA 3V2IA 2GEKA 2ZYIA 2CJWB 1F0PA 5I7RA 4F60A 5A4FS 2GGSA 2M1ZA 4NU6A 3CMEB 2AUMA 4UUNA 4DRXB 5IHPA 2LIVA 3RKRA 3S8EA 4Q1AA 1R0SA 4U3JA 3VSDA 5GAJA 3DTYA 1C3JA 4C2UA 3UNXA 1AUVA 2HMVA 3CG0A 4GYJA 3S8YA 3ETLA 4GLBA 4IAOA 2JIMA 1P17A 1UZMA 2CLSA 1RLOA 1G3IA 3HDGA 4L9WA 2BWJA 3JQFC 5LC1A 2H54A 3WLOA 1K6XA 1UK6A 2CLEB 5HKBA 2UUBB 4OA5A 1ZIXA 2WICA 1GSIA 1S3GA 4LHXA 4TLDA 3BL6A 1FVXA 2I6UA 3IO5A 4WPGA 1TJNA 5F78A 4ZVSA 1USVA 3F2VA 5LNK6 4EY7A 3UAGA 1GOTA 4LOJA 2PZEA 2UZ4A 5IXYA 5LUAA 4ZOBA 2QTNA 4OJYA 2BI8A 5I9TA 4ER6A 4FZJA 4LHZA 3WSWA 4BNVA 1OXBB 5JRDS 1X19A 4AAYA 5BUCA 2R1UA 1U5CA 2NUTB 3WGIA 1KBOA 5TQ0B 5EG5A 1NVXQ 3D7RA 3QVXA 3HKCA 4ZMRA 2M6SA 2GZ3A 2OAQ1 3MK31 1YBHA 5HWSA 3SZ3A 3DNFA 5GQSA 3LG2A 5EI5A 4DC0A 4RW0A 5F3WB 3RY8A 3JXEA 1D7AA 1FE8A 1YIAA 2VZ8A 4NOLA 2Z9BA 2OL4A 1H4QA 3THSA 1UPXA 3IEKA 2H0AA 5L4LA 3GJ6A 4QQKA 4TTIA 3RIMA 4J0QA 3CLRD 2JD2A 3JD0A 3CH4B 4RTKA 3HAGA 5EE5B 5CNIA 1JI0A 3EXG2 3P27A 4L5IA 4QJ4A 5IAKA 3UWPA 3MD9A 3IT3A 5E7JA 5JJIA 4R1PA 4MO9A 1WBJB 4U7FA 4HQNA 2O8NA 4UXHA 3EPKA 1FJXA 5YASA 3UJ6A 3OP1A 1TGYA 3O9MA 5JXJA 3GFBA 1DQNA 4WINA 4WRRA 5T4HA 5C8XA 4GVXA 2ZRAA 3HJTA 2WA2A 4OQLA 4I55B 2F1IA 2JVKA 3OFSA 4HBGA 4IUDS 2W2KB 1PAUA 3SF8B 1KVTA 4PCLA 4YI3A 3E8MA 3C7AA 4FC6A 5NLLA 4YJ2A 1J33A 1LTKA 2JFGA 3DKIA 3R23A 3JASB 1OQAA 1W94A 4IOJA 3A05A 4KR9A 2OPHA 2VA8A 1ABFA 4O0LA 4OI4A 1TQHA 1CB0A 2EWWA 3HA3A 3BZWA 3SHTA 1U7XA 1JSXA 1JR2A 3AB3A 5DF1A 1ST2A 1ZJ5A 3M9WA 5HM8A 3GJ7A 2YWFA 1Z6PA 1JEQA 3OE5A 3ZHVA 2XY4A 2QI9F 2QRPA 3W6UA 4RMGA 2HCJB 1GVNB 2QYHA 4K0RA 1NLYA 4JFAA 3A4MA 4WBSA 2XMRA 2QS9A 1K73D 5T4BA 2VP6A 2PRJA 4LSMA 3AUAA 3QKUA 1E3WA 3PVZA 3MM4A 4GVPA 3T3DA 4TVSA 4YT4A 1ZK0A 4PAMA 1PK9A 2DHCA 5DW3A 5C5IA 2XNCA 1T9AA 2FGJA 2W71A 5GGXA 2RGBA 4N1AA 4NDNE 3T95A 2QVLA 4TXJA 3OZUA 4YO8A 5TR9A 1Z6YA 5FL7D 3W5IA 4GOND 4KOEC 6GPBA 3C1TA 3RSZA 3TQRA 1TO2E 2A1TS 2P2ZA 2UZ0A 3D4BA 3JVIA 4PO8A 1P2BA 2WZQA 1GTG1 1V35A 2DTXA 2OESA 2FMHA 1CIPA 2G5PA 2P2CA 4HKTA 5EMKA 3VA7A 2B7BA 4YTEA 3ZTWA 3IKVA 2JBHA 1LLDA 3UPDA 2XCTB 4Y7DA 1OBVA 3MS4A 1L4UA 1G42A 1Q2XA 4BWGA 1FY2A 5HCIA 3EC2A 1VMIA 3GEBA 3H4MA 2NADA 3I34X 1IZ8A 3PFFA 5KTOA 3THRA 3PFBA 3AF0A 2ZRDA 3OCJA 3WQRA 3GLSA 4D3YA 3KJHA 4M60A 4KSBA 3REQB 5L95A 1DXOA 3WWYA 1QCCA 3R3ZA 2P5YA 3AOGA 1BDJA 2B25A 1BXKA 3ASRA 4MUAA 2GYWA 1OX4A 4BO4A 1QIEA 2KI5A 3NTUA 1KVRA 1RQRA 2XUPA 4WOPA 1XCPA 3BC1A 4N41A 1JSLA 1BKYA 3BS4A 1H3EA 2QU7A 2Z58A 3RBAA 1L1FA 2HSWA 4QNNA 5GZ6A 2XOXA 2MSLA 3W7AA 3H2BA 2VPTA 4AXBA 2WTMA 3KRTA 5BSGA 3RGWS 1KAOA 2FCRA 2J85A 5HXBA 4DIDA 5CB4F 4B09A 3THYA 1P77A 2Q2NA 3HCOA 3JTEA 4ASUD 3I72A 3BGSA 3Q10A 2JGDB 3CNQS 1DDOA 2HDOA 1X3SA 1N5MA 3ASUA 3B1XA 4LVCA 1KVSA 4HF7A 4YRJA 2C61A 3N2ZB 4X85A 1F8YA 2DETA 1HT2E 1R00A 3HJHA 2Q3CA 1VE1A 3MTJA 3VR6A 4KR3A 3LVFO 4KUHA 4D9EA 5CR9A 5AVSA 3GJTA 3CRRA 4KX3A 4FJ2A 5HF8A 3R7LA 4GZ5A 3OKAA 4ZWNA 4TRRA 3SX4A 4KN8A 4U7JA 1USIA 1CUSA 3CONA 5F3RA 2NZXA 3DYVA 1MXHA 3KXKA 5EZSA 3VAAA 4YXWD 1MB0A 1X7XB 5AJTA 3LLMA 1W73A 2OZKA 1CUHA 3PGVA 3FE2A 4U2EA 1O5OA 1QHYA 1DJMA 1MUUA 3FKSA 1U1CA 4FEYA 3E5MA 4M7WA 5CLHA 5I9LA 1N05A 1YKGA 4PC1A 2C1ZA 1W0CA 5EE1A 3ZV4A 4F5WA 3EIQA 5ALHA 1JE0A 1Z37A 2NYUA 4AQDA 4TV8A 3NANA 1R8XA 4RVDA 1QGYA 3WXMA 3L05A 5EHZA 4LYJA 2QVZX 2ZE5A 4MGZR 5JUWA 3FTFA 3RM3A 1COWD 2ZI9A 2VF7A 3I05A 3KWMA 4JX9A 1UFVA 3SZLA 3JZDA 1ZA1A 3T9BA 5IHXA 5D7BA 3LKVA 4DA4A 2NZVG 3QJ5A 2ZIZA 3R3VA 2ZB3A 3SHVA 4FI3F 2WOOA 4FWBA 2QR5A 4EAAA 3MEQA 2RHLA 4KHZA 1UMBB 3A6LA 1RM5A 4D02A 4D4JA 3WIVA 4IWNA 4EVRA 4KLCA 3BAFA 3KM0A 4QU0A 2Q5HA 3SNKA 2YMQA 4GFDA 4PXAA 4C89A 5B1HA 1YB7A 1R64A 1SGWA 3LPMA 3MMZA 1XX6A 2M5SA 1NY6A 4IPTA 2NPFA 2J0QA 4AK9A 4KYTA 3INYA 2CFTA 4C0SA 3CRQA 2BW0A 2Z09A 4GG1A 3LOQA 3LFUA 4P80A 1Z5NA 4QNMA 1Z34A 3MBIA 4GL2A 2JZNA 1VTKA 4MPJA 3T53B 2IYLD 2AD5A 2QRKA 3UAXA 4RX1A 1GUBA 4ZT4A 5JSUA 5JXIA 3Q98A 2UZIR 1Z3IX 1VPWA 3KTDA 1JJAA 2HO5A 3J80A 3THWB 2WA1A 2A9JA 3SQWA 1T6NA 4LVNA 1SC4A 3UATA 4DUGA 3I0NA 4HNSA 3OZTA 1RQGA 1YFZA 3AQIA 4MR9A 4UQPA 3GRYA 2PFGA 5DTQA 3N70A 1G4UR 2DT8A 1UF9A 2D7JA 1UJ5A 3KQLA 1I33A 16PKA 1JXQA 4XPIA 1UADA 3ORSA 1G9SA 2OK7A 4XQ0A 5AI9A 5DWDA 3UM9A 5HVNA 3AFHA 2CHGA 4TMFA 1MX9A 4WLNA 1D5CA 3G9QA 3H9UA 5GOZA 3RSQA 2ZZEA 1JWAB 1DVRA 4KH0A 4Z4HA 1WM1A 4L57A 4N40A 4PN3A 4DYVA 3PQFA 1E43A 1XEWY 3B5JA 4G07A 1HDXA 5TXGA 4IZIA 4YB8A 3TLGB 3O84A 1HA3A 4JJ4A 4TLAA 2V7XA 2AJTA 1N57A 3OC6A 1RTKA 2EFCB 3T1NA 3UKDA 1TEZA 1SH7A 1DC7A 2ZSIA 1KPGA 1X74A 3HACA 3BICA 2V7BA 1SD2A 4NEQA 1ATIA 3K92A 3R8CA 5A62A 1AF4A 1D1SA 1DS6A 1TJ3A 3N53A 3R6WA 5TGZA 4I5IA 3K5PA 5ALLA 1WD5A 5IK2A 2XDAA 4G5QA 4RESA 4A15A 1FLAA 1ODIA 1U0JA 4L3VA 4LBWA 4YC7A 4BFWA 3UQYS 1E1CA 4KQJA 1E1YA 1NVTA 1QZXA 1PX0A 1MA0A 1ZGHA 221PA 2JI6A 3I09A 4E0FA 1NBIA 3MOIA 4O4HB 4Q3CA 1RXIA 3RAFC 2JAOA 5E6UB 2WUFA 1MAWA 2XNKA 3CPSA 5DP2A 2R86A 1MNQA 3D4PA 2C0CA 1NLMA 1SXJD 4IIBA 4Q12A 1WZCA 1D6SA 1LWOA 1PW5A 4BVHA 2ODTX 4EG1A 5HIAA 3I62A 2GTIA 4YRZA 1THZA 1GTL1 1ORWA 4BVAA 1CUVA 4DCTA 1OFHA 1KY4A 3C4VA 3PRYA 4R98A 1UBOS 3VO9A 4L7QA 3PEEA 4ETWA 1L5SA 2FWAA 4TYQA 2AMLA 4WK2B 2PUJA 1YJAA 1ISHA 1IEVA 1U80A 1FSGA 2Q2WA 4F11A 1XD9A 4E4TA 5CA0B 5K0TA 4PTZA 1S3IA 2F00A 3Q8WA 2H4HA 2BF4A 1Q3TA 2HCBA 4OP3A 4Q1FA 4WLFA 4LZJA 1CK4A 3UMJA 3PF8A 3BXPA 4JEHA 2Z08A 5CIWA 4KXWA 5DWVA 5AIBA 4GE3A 4M7PA 4Y6LA 1YDWA 4D9HA 2DR2A 3NWPA 5F98A 2IU4A 2Q3DA 2OCKA 4AUKA 5DK4A 1N2IA 3L5OA 5CX1A 5FLKA 1MJ5A 4FFBA 4Q39A 4PX2A 1GY8A 1HNWB 2CDAA 3M9LA 4GNRA 4OQQA 2I67A 1DV1A 3CLKA 4MJXA 5I4BA 2CRVA 1RCTE 1H8HD 4MYRA 1UBGA 2FW8A 1EBBA 3TSWA 1MOPA 4B3FX 5AFSA 4TWIA 1TEVA 2PZAA 2O05A 3BB1A 3FMOB 4O2BA 4BRSA 1M34E 3FVVA 5JYDA 3ZQUA 4A8TA 2OXFA 4NOMA 1RLJA 1YI2B 2VC2B 3AJDA 4ZXFA 4KYUA 1IUPA 2H65A 1SBIA 3LDHA 3NYWA 1NXTA 3CVOA 3FMPB 3H5RA 5DLEA 4B2YA 1BU5A 4B3HA 1QIJA 1KO4A 4M76B 4OJNA 2PGAA 3I2FA 1W2WB 3ZY3A 3VAZA 2E4UA 3BOSA 5FPYA 3TH5A 4UU1A 3HB1A 1WUKS 3N2KA 3QBTA 5DE3A 1MQ9A 1YIDA 2I6SA 2PN1A 1FNSA 4CHGA 4ROXA 1SOUA 4LZPA 4A8JA 4AJLA 4CL2A 1F60A 2ZSFA 1MC1A 4MV9A 1CQPA 5CJJA 3NT5A 1M2VB 4LGVA 1VI5A 3OA2A 4Q24A 3B3QA 2JCSA 2CXNA 1GKKA 3H84A 2F3SA 1Q2UA 4G2NA 1RD4A 2Z8XA 1FPMA 1IZ0A 3RAJA 1HKUA 1JPVA 2D0DA 4M87A 4OKIA 4UC0A 5FWDA 2HM7A 3W04A 5IBCA 3GJRA 4AG3A 5TGTA 4GX1A 1R3UA 2YZ7A 3DG9A 3I23A 1OU4A 4ALKA 4X7FA 3LX6A 1QFXA 4KGDA 3AUUA 1DLIA 4MVJA 4UEQA 4HZUA 5AVKA 1DEHA 2J08A 2BRUC 1IATA 4GW3A 3RWMB 5JWHA 1OA1A 1NPTO 3EA4A 3K0CA 4ZEOA 1GG2A 3FTCA 2KB0A 1E63A 1IIBA 3FHCB 5KOHB 4IIVA 1R12A 3ZGYA 4B2IA 2X2FA 3FR8A 3HO8A 1YB2A 3IMGA 1X70A 2H4YA 4HUJA 4NV0A 2NTVA 1T34A 2WG0A 2CJWA 3IVGA 3Q6NA 4GZLA 1S96A 2CNLA 4KR0A 4XJXA 1R27A 2WKWA 5BN5A 2VUIB 3QA3E 1DARA 4LJ4A 3W9SA 2OFWA 3QU9A 1E3MA 3R9KA 4QT4A 2UZ1A 2O0KA 1Z9BA 1SUEA 5K01A 3BSSA 1VE7A 2BV3A 4RSHA 1PFVA 1PFWA 3N1UA 3UWKA 4EB6A 3G2IA 4FFLA 3VKUA 3DPUA 3ZD6A 3BC9A 1IVYA 2HK8A 2GCEA 4JT4A 3V1KA 5B3KA 4OQPA 4EG0A 4P9SA 3WX0A 1UMKA 4PLFA 2I2WA 1Q7RA 4B4DA 3NDJA 3OX3A 4FZRA 3FLMA 5HZGA 1S5PA 3B7PA 4JC0A 3OJFA 5K6AC 4L5YA 2RHJA 1N8RD 3UHPA 1NVVQ 3NHJA 3Q9SA 4FUQA 4ZI3A 4HAWA 2I7CA 4XQEA 3U9TA 2FSIA 4CNBA 4JY7A 3OLXA 3D4LA 4NS1A 2QX4A 2YXBA 3QFHA 3TIGA 3ZE6A 5AK4A 5DGTA 3ZVNA 4EA7A 1C7JA 5IVIA 3U3KA 3MCUA 4OFWA 5EJMA 2AOVA 5BSHA 4N76A 4EHNA 3IEXA 4NATA 1RZVA 3BMCB 1CY4A 2GK3A 3PKIA 1W2BB 1BE8A 1ZUHA 3PD7A 5DHQA 1T9GR 4DXAA 1KI6B 2P6OA 5CFRA 3C3AA 3CU5A 3PR1A 4OHUA 1XELA 4YRGA 4KE8A 2QTWB 5ALFA 4PCAA 1NZFA 3A1DA 4TKOB 3EHEA 4DCSA 4LZOA 3RDPA 1P3DA 2M6LA 4UMEA 1F5SA 3D64A 3GGCA 1Q57A 3HHPA 3JYLA 4IIDA 4QXAA 4FDTA 2QJWA 2NWQA 5AJHA 1YR3A 1P4AA 1T2AA 4B74A 2Y1OA 4ARIA 3GBPA 1C0LA 2JKVA 4NNOA 2DH6A 3B9PA 2X8BA 4IFEA 3KUDA 4QTTB 1R9MA 1WE2A 1Z0SA 2ZTMA 1JTFA 4BB6A 4Q1DA 3V4OA 1SXPA 1K7XB 3QLVA 4P0PB 2HCRA 5CFOA 1MX5A 2X1VA 3OQ1A 4MVJM 4O8CA 4QUHA 3ZOZA 1U0LA 3BNWA 1VIMA 1ZVQA 3FJOA 1M34A 3AUSA 3M4ZA 5DHTA 4DCJA 3WL8A 3KWJA 2EC5A 2A9KA 1V2GA 4KFTA 3SF8A 3QX3A 2F43B 1T0UA 3RLIA 1EFAA 4EYEA 3L02A 3BJMA 1VKRA 1CRWG 1EEHA 1SIWA 4QYTA 3BL8A 2H1LA 3OEHD 1L5LA 4D8UA 3FOFC 4TWZA 5EJ5A 1DINA 1SXHA 2XAAA 4HQKA 2PS1A 1NFFA 1WX1A 2XMZA 3SQMA 3R6JA 2NW6A 4YJFA 4Z4UA 3HFJA 3NORA 4L5JA 4OP7A 1YMVA 2AZDA 5G53C 5IYZB 4CETA 2IT1A 4N0DA 5KU7A 4I9FA 4WGGA 2W2MA 5AW2A 3DDNA 5JZ9A 4RD0A 2C7BA 3GZNA 4M9QA 1FDOA 5K3OA 5J43A 1PFUA 4NCJA 4NZ9A 1J2RA 3KQVA 3IIKA 3EFOA 3GH1A 4MQUA 5EWMB 3EIWA 4IEFB 4M46A 3F1KA 3IJRA 3W4KA 2PWBA 4P0TA 4ZAWA 4MW4A 1A4XA 3KZ1E 4JP2A 2X0EA 4MX8A 1KYQA 5BVGA 2OORC 3CZMA 3F6YA 3QPVA 1L8AA 3AIMA 1SUWA 3DAOA 2I29A 1CR6A 2VJNA 1Q0RA 3N0TA 1HLPA 4C5BA 4EEKA 3BJEA 2BSXA 3KNZA 5ALVA 1UK7A 4HWSA 5J1TB 1GKYA 2PX8A 2X1LA 3ONDA 3P0JA 4F06A 1NC1A 4DVJA 1GQRA 1XVUA 1O6CA 1E6UA 3TB4A 1KEUA 4XM1A 2G5CA 4IOKA 1JNYA 1NG1A 1Z7YA 2VUTA 2VYFA 4C6TB 2YXEA 3W8EA 2VWPA 3E61A 1X8XA 1TEHA 1G6Q1 3EGIA 3PQ6A 1QANA 1AVTA 2PLAA 3H1EA 2GKOA 4MEJA 3K9CA 1XRPA 4H35A 3G0BA 4LS3A 1Z0JA 3L7LA 4EVSA 4BMZA 3IEMA 3A1WA 3A1PA 1Q22A 1WCWA 3HADA 4OSOA 4GZMA 3QFRA 1JBKA 4HH3C 2D13A 2J3HA 1BKSB 1DTSA 3HV2A 3NDIA 2M6RA 5FPTA 3WQSB 3KC2A 2OV4A 1UDBA 3MWDA 3SIPA 3REQA 1HDYA 3ZGXA 1RWKA 3KAQA 1EVEA 1LLQA 3F8SA 4IDAA 4NOJA 1EXVA 4PYRA 4F8YA 3H0CA 3QRWA 3AV3A 2DLNA 3QF4B 5EKUA 4BP1A 4DG9A 1SC6A 1C4WA 1QIIA 4D4LA 5B55A 3WICA 2BT4A 1XMJA 3WYGA 4UZUA 5F4OA 4LTDA 4MGKR 5JS7A 1SU6A 2AZXA 3H0EA 2GEJA 3KYBA 4AJKA 3EG9B 2HNKA 1JSZA 1Y3CE 3UGTA 3CPWB 1C3OB 1CKEA 2GHTA 5LXTA 3I8XA 3QU7A 1JYSA 3GN1A 1GVHA 3LT1A 5TF4A 3VVMA 5JEEA 2ONKA 4Z54A 5JY1A 4QVJA 1LF0A 1Y8QA 1ZRSA 1GQOA 1VLLA 3I4FA 3EGCA 2JFXA 1E89A 3KLOA 3EXAA 4V3BA 1R4AA 4RC9A 2A88A 4RKFA 4TXHA 3OPXA 1NDQA 4R16A 2XUQA 1VZ2A 2IH4A 2WE8A 3KR1A 4F4UA 2E1BA 2YL2A 2ZVDA 5AHRA 3CVUA 4YCJA 2V0GA 5EHQA 2GJPA 1JG2A 3G2MA 2PXXA 3S6JA 5TEVA 5JAMA 3RLFA 1I4WA 1PL8A 4JLKA 3ER6A 1VXOA 4PS0A 3ZXSA 1GIAA 3CZ4A 4CV1A 1PR5A 2MSDB 4CLOA 5D8DA 1EWQA 3MT9A 4ZU3A 3GJYA 1JUDA 1SVSA 4RV9A 3ADCA 2QMUA 1RAEA 2J3MA 5FV4A 1Q1GA 3AJAA 2FUCA 4RQUA 3DFZA 1X7XA 3PSAA 2NU9B 3VPHA 3AOEA 1Q0UA 1WLSA 4OBBA 5D5QA 4ZZ1A 1H85A 1OIWA 3VOSA 2HQRA 4Z7OB 1OJLA 3FW1A 1U0BB 5JMOA 2ZR8A 3H75A 4M1OA 4QXRA 3WYNA 4X65B 2JFBA 1A5ZA 1W0JD 2JN9A 1KNXA 3TK1A 4OFBA 4FN4A 1CRPA 4HDAA 2WR8A 1GAXA 2QM0A 3JQCA 5HE8A 3OKCA 2C3OA 1MO2A 4KMSA 1CWUA 1KS9A 2VHJA 2O52A 3K16A 2A4MA 4CI9A 3SR4A 3ZJVA 2XB2A 1XRNA 3Q88A 3KVYA 3OJWA 2A0YA 3TN7A 3K71B 3RSLA 3I6YA 1JW9B 3U13A 5L3SB 5MHTA 3RTCA 4KVGA 4HE5A 3DV0A 4X71A 5EJ4A 1Z0KA 3U6KA 1F17A 3ZWWA 1MT3A 2IKSA 3PA8A 1USWA 4TUYA 3SE7A 3F5FA 2R68A 5B1EA 3X1DA 1NXOA 3IDSA 5ICGA 3AERA 3RRYA 1JLRA 3ILYA 1A9ZA 1HUQA 1K9VF 4I1IA 4E08A 3G4SB 4QOFA 1J0AA 4DCMA 4H6XA 1PTKA 2ZWVA 4I7EA 4J3JA 3KP1A 2ZTVA 1P80A 2ID9A 3QYFA 4FYKA 1SKYB 3FZGA 1RIFA 3GVHA 2HLDD 1NI3A 3WLPA 1OIXA 2AT1A 3IPXA 3V4SA 4DSTA 2FG7C 1QOZA 3GFFA 3MWYW 4NZOA 1OW3B 4V24A 2C0PA 5IVHA 1QU2A 3AW9A 1DCTA 2ARKA 3F6BX 1BCRB 3GHYA 3B9BA 4LQDA 1Q50A 1OAOC 1FFGA 2YS6A 4RK6A 1KSGA 3OH8A 1W5FA 2FPMA 4Z4CA 5G3YA 3FMGA 2BJHA 2CUKA 2QM8A 1NVVR 4KWTA 4ENVA 2IY9A 2W2VA 3GOQA 4NMWA 4PZYA 3HR7A 3N59A 2OWDA 3IDQA 4RMIA 2HRDA 2DHEA 3BYZA 4G5YA 2FEAA 1JKIA 5G0UA 5JNWA 1SBCA 2I65A 4MKRA 5C8DA 2CK3D 4HSGA 3FCXA 1PT9A 2B9VA 4HG2A 5DH9A 1QIFA 1W49A 4HYEA 4KFCA 2JH8A 4KWEA 4R8RA 4RE5A 1XBTA 4D3ZA 2G8NA 3DVAB 3C6XA 2A1IA 1SXJE 4LDQA 3IESA 3I2GA 2IW1A 4QULA 3X2FA 5JO9A 4E4YA 5K45A 4HNTA 3DE6X 5LDDC 1KZ1A 3IBGA 1DADA 1Q1EA 1JZTA 3CLTD 3NS7A 3ZDZB 2DG2A 5JI2E 2Z3VA 4MP6A 2C9ZA 2YCBA 5CK4A 2GEUA 2UVDA 3DMTC 3L7JA 4XB1A 4HFNA 2FWIA 5BWOA 2VPZA 3GEDA 8OHMA 4FHZA 4FJ1A 2OQVA 3OT1B 2JIBA 3SMQA 4RJTA 1I32A 5CCBA 3DE7X 1Y3DE 1ZCAA 3AVPA 2XUOA 3KT8A 3BCSA 3E9YA 2Z9DA 3O9VA 5ALEA 2OENG 4G0WA 1J21A 3DWEX 2JVJA 3H6GA 3Q1KA 2HUPA 3FWHA 2YZKA 4H4CA 4Q3LA 2RGEA 2A4KA 3I6IA 2B94A 3MTDA 3D1JA 5TT1A 1W59A 5J35A 3R6LA 4B1FA 4DUZB 3P96A 1DCFA 3NHSA 3KOWA 3PPWA 2D5BA 5CD1A 2G1KA 3C16C 4HGNA 2PSFA 3DL4A 4JUFA 3W05A 1COWA 3L6RA 2ZYTX 4FOLA 3QW4B 5D01A 4PX9A 4PY2A 3WTBA 3ZHOA 5EIFA 2FNAA 4LJLA 2RE8A 3D9QX 1P4SA 4QT0A 4M53A 2A0XA 1YJWB 2P1RA 2NZJA 4II3A 2ZR0A 2ZWIA 3DKPA 4GICA 3TM5A 3EK2A 4EBFA 1G8PA 1IY2A 3LY8A 3PHGA 1CQWA 2O1WA 3Q87B 3PWSA 3UFXA 3VV2A 3W3AH 3L1IA 3TLJA 4RA9B 4XD7D 4LRQA 3AMVA 3E18A 2VKQA 2G8LA 4MRRA 1U31A 4HGPA 3NB0A 2PBLA 3G0DA 3VPGA 3AL2A 2J3KA 4KKTA 1DU4A 1D2CA 1NI5A 1YE5A 5EP2A 2P30A 3FUUA 4OMCA 1N92A 4A92A 4DEVA 1ZK2A 3VZRA 4B44A 1PEAA 3EEFA 5C9ZA 1TMKA 3H42B 4RIGA 4HAXA 3BDVA 4ZU1X 1VRWA 2FAXA 5FADA 2CF6A 3IUBA 2IQIA 1KJ9A 4O08A 2B2NA 1P33A 3D43A 4E3ZA 4ZT5A 3LUDA 4OXIA 4Q4CA 3NPAA 2AG8A 1JSCA 1YNSA 1UXJA 2QGNA 2XE4A 3CF4A 3D8BA 4M9CA 4XZ3A 3VPBA 4Z0TA 4DMFA 1MW8X 1N4AA 2W11A 1A72A 3ZZUA 5IW8A 1H22A 3LGAA 3I12A 4XSHA 2IWHA 4LXQA 4S05A 4ER0A 1QHHB 3WRXC 2P4EA 4LJ8A 4WGFA 2VA9A 2GAAA 5JZSA 5LU8A 5BURA 1PR0A 3LCUA 3LHIA 1UBHS 4UMDA 3V1UA 3I0MA 2SCUB 4KQ9A 2AI1A 1QIKA 2WHEA 4AO6A 3F73A 4WT7A 2KS6A 1AO3A 4GC9A 1Z5GA 4WKOA 3K6RA 5JAUA 2UKDA 1WZNA 3HPRA 3DZIA 1GYRA 5L40A 1C2YA 1BD4A 3P2OA 5AXAA 1T1EA 1U7OA 2IELA 3GEGA 3OQ6A 1FBTA 4IXTA 3RJ5A 2EZTA 2C7VA 2H16A 3CEAA 3K09C 4CLRA 3ZV6A 1H66A 3KQPA 4ZAVA 1AGYA 1FDTA 1N08A 4MI1A 2VRWA 4OU4A 3A6JA 3A1NA 3MCAA 5DMXA 5IJ0B 1OVMA 4LFCB 2EFYA 2PUDA 2GZRA 3V1MA 2IIQA 1X1AA 3LC7O 4KITB 2P5TB 3ZHRA 2XITA 3G2QA 4XWYA 4ZAFA 2H1OA 1E96A 2J7PD 4PANA 5DCUA 4DLVA 1V1JA 2ATXA 4GOKA 2YZMA 3KELA 2X3YA 3LXRA 1VIAA 4TWBA 4M8NE 4CM6A 2CB9A 2NNLD 1G1MA 1ECBA 2GWHA 2G6BA 3Q6MA 4G36A 3RVSA 4CMEA 1E3QA 1SXJA 4PBTA 3E27A 1PLLA 10MHA 1W75A 1Z4NA 4YJHA 3OZDA 1EM6A 5I9SA 1RVV1 4R1UA 3WRYA 5LJLA 5BWLA 4Z2AA 2VFAA 3T1QA 4BXOB 2Y1FA 5FOVA 4D0SA 1DBWA 2FWBA 2I8AA 3I37X 4MYHA 5FQOA 1ISGA 1OLUB 1RWNA 1VL1A 3PDIB 4PG7A 4INAA 4N47A 1C1HA 2QVGA 2UZAA 3HEAA 3VU9A 4JLAA 3TR6A 4BNJA 2CD9A 4LX0A 4CM9D 4DNTB 3I6MA 4JQOA 2VOEA 1DZIA 3E6AA 4QVAA 2V5AA 3Q3VA 2Y68A 1EGHA 1LTHR 4RTQA 3DT8A 2ASVA 5ESXA 1KWKA 1KEZA 1UBTS 3KSMA 4OJQA 5KZMB 4INPA 3V9PA 4CCYA 1SC9A 1W8DA 3RSFA 3AUFA 2J9FB 4KLNA 1KPHA 4X7RA 5KKAA 1W96A 2A94A 5F52A 5F4MA 4GMFA 4UCQA 1P0MA 3MRSA 2YOHA 2XZOA 2ODEA 3ITDA 1LFAA 1P9OA 2PRIA 1WO8A 2ZUCA 1YZ3A 3K4PA 4GOXA 2HBRA 1IN6A 3LRTA 4JOBA 4NYJQ 1R5NA 5FA8A 3T9AA 4ADSG 1ZXXA 2JFHA 2ZI5A 1OV4A 4ENWA 2V7UA 4J9VA 3KR2A 3IQGX 4RY9A 3W5JA 2QTAA 3D4IA 4Q93A 3PHIA 1YRYE 3O2NA 1BVUA 4UAVA 3FYCA 4XQCA 4DDMA 1EVYA 1V6CA 3O7WA 3FHLA 4TX1A 3PUNA 3D6HA 4LJ9A 4IQGA 4BN4A 3IEVA 5JT1A 1CQXA 1HLDA 2RAPA 1VYVA 1W47A 4BVGA 3EAQA 4IIUA 4AZ0B 1EA5A 2QL5A 1DDIA 2NN3C 3IELA 2HJRA 4D3SA 2DWQA 2QKYA 3KJZA 2R2AA 4FNMA 2FN3A 4JASB 1ZOLA 3KBOA 4BQNA 4AW9A 4DDUA 2XE6A 5J4LA 2QBYB 1E6LA 4U9IS 3NAMA 2CLFB 3OSZA 1KSHA 2BFAA 4C3VA 1G64A 2WFLB 3MW8A 4HQOA 1NZJA 4RMHA 3VSCA 4BN5A 1XRLA 5BPFA 4LI0A 5EGNA 3L07A 3K1JA 4Z8YA 2TMDA 3CPXA 1G3QA 1TRKA 5KHOC 1M6EX 5CNJA 2KPOA 2N1BA 4YH1A 1KA9H 2QY6A 3IP8A 4EENA 1C0IA 2AQKA 3QX7A 3DLCA 5HIIA 3ZIAD 4LCJA 2PGIA 4CIVA 1K8XB 3KX2A 5DNWA 1LS6A 3EIXA 1L5NA 3PIIA 4TLBA 2XDQB 2XGSA 2EX4A 4HUQA 1CTQA 2Q28A 2X0KA 2WP0A 4UUQA 3TLYA 4FT2A 3AY0A 4JNCA 1XMPA 1HV8A 1PWHA 3QVMA 4IOMA 2SKCA 4RA6B 1C3EA 3L01A 4MINA 4JQSA 4XGKA 5IC5A 4HH0A 4CR8A 4XWOA 1EP1B 5IM4A 1LV7A 4MWDA 5A6VA 2I66A 1TD9A 5SICE 1RPJA 2I2DA 2C4KA 4J76A 2EFEB 3PYLA 3GRCA 3U7FB 5DN6A 4RBNA 4KV9A 1K6MA 3QUBA 4MB6A 3H6HA 1BE1A 1G8HA 1UC5B 3JYOA 4CFSA 5L45A 1NW9B 1LW6E 3EEIA 2WM3A 1L7QA 3AR6A 5LIRA 2ABWA 3HBAA 2H1SA 4TRNA 4FMBB 5KNDD 1NV9A 1DEAA 4XCVA 4XJSA 3MSXA 3ZVLA 3R7DA 1MQ8B 1OFUX 3R4CA 4TVBA