3I2AA

Crystal structure of a chimeric trypsin inhibitor protein sti(l)-wci(s)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
180
structure length
180
Chain Sequence
b'GSHMDDDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSPYRIRFIPRGSLVALGFANPPSCAASPWWTVVDSPQGPAVKLSQQKLPEKDILVFKFEKVSHSNIHVYKLLYCQHDEEDVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin inhibitor 3
publication title Identification of a novel set of scaffolding residues that are instrumental for the inhibitory property of Kunitz (STI) inhibitors.
pubmed doi rcsb
source organism Psophocarpus tetragonolobus
molecule tags Hydrolase inhibitor
total genus 30
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3i2aA00
1YF8B 4GAIA 1T4QA 4I4OA 1Q04A 4L4IA 4QC4A 3VEQA 2E4MA 3CA0A 3R4SA 5FNXA 1FMMS 3JUTA 3WO4A 3FGMA 3ZXDA 5BP5A 3Q7XA 1BFFA 3BB2A 1G9CA 3LLPA 1GGPB 1KNMA 3ILAA 2VU9A 1M2TB 1D0HA 3Q7WA 3BAHA 1DJSB 3ZXGA 2KKIA 4A7ZA 5DSSB 1IRAX 3IIRA 2VSEA 2ERMA 4XFUA 2LIQA 3HN1A 2BEBA 4H04A 4I4UA 4LO2C 3BAVA 4EFRA 2VXTI 1S0BA 2DRYA 4GOYA 5G00A 2WBCA 3W9TA 1QQLA 4QD2C 2GZBA 4J23B 1F31A 2J3PA 1E0OA 3OJVA 5EG6C 4JAWA 2RSTA 3CA3A 1S0GA 1V6VA 3ZC8A 3CRGA 3PHZA 1IOBA 1JQZA 1PUMB 3CA1A 3FUOA 3VSZA 3VT2A 4G6MA 3AZWA 3O4CA 2NYYA 1V6UA 1BLDA 3NBEA 4GOVA 2E4MC 4Z8SB 1Z2VA 1HCEA 2AAIB 4I3NA 2K43A 3WMUA 2FFVA 5D63A 4QO3A 4ZOTA 4OUJA 1JT4A 4GP0A 3SNVA 2P39A 4I96A 1TP0A 1M16A 5JMCA 5FNWA 4QALA 4I4YA 2ZQOA 4J2SA 2IWTB 4I4VA 4LO1A 3VT0A 3BX1C 1K5VA 5I1BA 1CVSA 1XG6A 1FN0A 3BADA 4I6IA 3R4UA 5GAQA 3K1XA 3NBCA 4CJMA 4IQPA 1FWUA 3H6RB 1BFGA 3BA5A 3FJHA 4YOLA 2RG9B 4USPA 1CE7B 3HMYA 6I1BA 2L5XA 1L2HA 2DREA 4IZEA 2P23A 4OWLA 1Z0HA 1HCDA 4OEEA 4D8HA 4Z9WB 1XYFA 2K4AB 3AKHA 1AVAC 3RSJA 4FGFA 4JQ0A 1WBAA 3AH2A 4G6JA 3HOMA 1DFCA 3FFZA 5EHAA 4IZXA 3FJEA 4HR6C 4XFSA 1TTUA 4USOA 1DFQA 2VUAA 1FQ9A 2NM1A 2Y9XE 3MPPG 4X38A 3CA5A 5DUYA 1ISXA 5BQUA 1FGAA 1W3GA 3O44A 2NZ9A 3FJ8A 1MC9A 2R9KB 4QKSA 2QYIB 4I4PA 3WA1A 4I2SA 1DZCA 4XKIA 4DENA 1MD6A 4GP3A 1FMZA 3UJ0A 3BAQA 2BFHA 4LO1C 3KMVA 3O4AA 4HJJA 4JKQA 5FZUA 3RMXA 2NTDA 3A23A 3N7JA 4I4SA 2UUSA 4OEFA 3AH1A 2AQZA 3AJ5A 3P6JA 3VUOA 1G9DA 1N4KA 3AZVA 2FFUA 3RTIB 1EPWA 4ISRA 3D7WB 3QYDA 3O4OA 1YYNA 4HA2A 1JLXA 3NBDA 3BTAA 3AKFA 2K8RA 1HWNB 3CAHA 3S8KA 1AXMA 2NVHA 2VXRA 3H6QA 3WO2A 1SR4C 3A21A 4LO3A 1V6WA 1I1BA 1BLAA 3N0KA 1ISYA 4LO0C 3RTJB 1K5UA 2MLLB 1HWOB 5BQUC 2XOAA 3F62B 4F34A 5E24E 2VSAA 4LO8B 1DZDA 3A07A 4I7IA 4OEGA 3O5WB 3B9UA 3PUBA 3FJFA 3OJ2A 2KI4A 3NBNA 3MALA 3OGGA 1YXWA 1FV3A 4J2YA 2RQ9A 4F83A 2F2FA 1DLLA 4P0JA 1DQOA 4ENDA 3WINA 4H9WA 1PUUB 4Q91A 2WRYA 2HW9A 3AKIA 3O3QA 4J2KA 3H6RA 3I2XA 4G1RA 3RMYA 4GAFA 4PC4A 3ZC9A 4KEIA 2Q3NB 4IONA 5HPZA 1NZKA 3AH4A 2D22A 3O4DA 4ZFYB 5BVPI 4I1EA 4EFQA 4ZFWB 3AJ6A 2FDBM 41BIA 1XZZA 4I4RA 1IRPA 1ISVA 1SZ6B 2ZQNA 2FO1A 4DEPA 3HALA 3O4BA 4LO3C 5FZYA 1G9AA 1ISZA 3I2AA 4AN6A 2D7RA 2M49A 1R8NA 3T8SA 2D23A 3P6IA 3BRGC 3BAUA 1S0EA 3OJMA 1HKNA 4OWKA 4X39A 1S0DA 4IY9A 5F8YA 3BAGA 1TWMA 1A8DA 2D1ZA 1UPSA 2ZR1B 4TLPA 2HWMA 1SR4A 3OGFA 5BXPA 3VT1A 3FJIA 3WO3A 3TC2A 1DIWA 3HBWA 4DCKC 3N7MA 1EV2A 2F2FC 4G9NA 4AN7B 4LO0A 4EKXB 2D43A 3WINC 2D24A 1JY0A 2Z48A 4I1BA 1JT7A 5DZUA 4P6AA 3CRIA 2DRZA 2LIEA 4QBVA 3V0AA 2D44A 3PMEA 4D0ZA 1QXMA 2YUGA 1BASA 1BFCA 1VCLA 1YTOA 4G9MA 1AF9A 1JT5A 3BRDA 2AFGA 1HWPB 1XHBA 1TWEA 5F8SA 4ZLBB 1W3FA 2FGFA 1P63A 3IM7A 2HWAA 3PG0A 4JRAA 1JTCA 1IHKA 3N7KA 4EB2B 3BAOA 1JT3A 2HZ9A 1ONKB 1I1EA 3V0AB 1IT0A 3E8LC 4II0A 3VSFA 3LTQA 4KEJA 5B2HA 4R6UB 4X3AA 1G82A 3V0BA 4I37A 4KBBA 4LO7B 4Q9PA 3FJDA 4JP0A 2MC2A 3O49A 1ABRB 2ESUA 2BEAA 2I1BA 2IHOA 3QR5A 1S0CA 1FV2A 3Q7YA 5DVHA 1ISWA 4Q9GA 3CA4A 4P0LA 3IAGC 1HIBA 4KC3A 1T9FA 3BA4A 3V0BB 4QKRA 3P53A 5BOWA 1YBIA 4IYBA 3H6SE 2ET2A 1BARA 3EF2A 3OBTA 4X37A 1II4A 3BRFA 1RY7A 4EEEB 5F8WA 3BA7A 1W3AA 4JKXB 3UD8A 1NUNA 3F1RA 2Y9WC 3FJKA 1EVTA 2QN4A 5BXTA 4OW4A 2VLCA 1ILR1 1FWVA 3UD7A 3C9ZA 1PC8B 1RZOB 4J2XA 4ZFUB 4KEKA 4LO7C 1EYLA 4ISQA 3CU1B 3I29B 5JLVA 2Y9FA 31BIA 3WMVA 4ZBVB 1JLYA 5FZZA 4FVVA 1BA7A 3NJ5A 3S8JA 1OQLB 1RMLA 7I1BA 3CA6A 1IILA 1ITBA 4ZA3B 1J0SA 4IY8A 2GO2A 3CQAA 3CRHA 21BIA 1AVUA 4EFPA 3FJJA 5BP5C 1G9BA 1HWMB 1WD4A 4ZGRB 4QBCA 4D0TA 4WBCA 2DS0A 4OWJA 3AKGA 1IJTA 2Z49A 3OBRA 3FJBA 3FJ9A 1Z4SA 1WD3A 1S0LA 1RG8A 3A22A 1PWAA 2X2TA 3ZX7A 3IM6A 2KLLA 1DQGA 2F8XC 3N7LA 1V6XA 4I8MA 2KI6B 3FJAA 1WBCA 3HSMA 5EC5A 1Q03A 2MIBA 4I4XA 1PZZA 5D61A 5D62A 8I1BA 3UDAA 4A7YA 2KH2A 3FJCA 4LO2A 1TFMB 5BXSA 2D7IA 4XFTA 2NP0A 4JPZA 3POKA 1R8OA 2D20A 5F90A 4IHZA 2Y9GA 2AXMA 3IM5A 4L4HA 4A7KA 1QQKA 3VWCA 4I4QA 1AVWB 1Q1UA 3FUQA 1AFCA 3V79C 1TOOA 2Q9XA 9ILBA 4P0KA 3JRRA 4ZKTB 1TIEA 5BXRA 4I0YA 4QD2B 1S0FA 3UJ4A 1AVXB 2X2SA 3UD9A 1BFBA
chains in the Genus database with same CATH superfamily
1YF8B 4GAIA 1T4QA 4I4OA 1Q04A 4L4IA 4QC4A 3VEQA 2E4MA 3CA0A 3R4SA 5FNXA 1FMMS 3JUTA 3WO4A 3FGMA 3ZXDA 5BP5A 3Q7XA 1BFFA 3BB2A 1G9CA 3LLPA 1GGPB 1KNMA 3ILAA 2VU9A 1M2TB 1D0HA 3Q7WA 3BAHA 1DJSB 3ZXGA 2KKIA 4A7ZA 5DSSB 1IRAX 3IIRA 2VSEA 2ERMA 4XFUA 2LIQA 3HN1A 2BEBA 4H04A 4I4UA 4LO2C 3BAVA 4EFRA 2VXTI 1S0BA 2DRYA 4GOYA 5G00A 2WBCA 3W9TA 1QQLA 4QD2C 2GZBA 4J23B 1F31A 2J3PA 1E0OA 3OJVA 5EG6C 4JAWA 2RSTA 3CA3A 1S0GA 1V6VA 4MZHA 3ZC8A 3CRGA 3PHZA 1IOBA 1JQZA 1PUMB 3CA1A 3FUOA 3VSZA 3VT2A 4G6MA 3AZWA 3O4CA 2NYYA 1V6UA 1BLDA 3NBEA 4GOVA 2E4MC 4Z8SB 4UY4A 1Z2VA 1HCEA 2AAIB 4I3NA 2K43A 3WMUA 2FFVA 5D63A 4QO3A 4ZOTA 4OUJA 1JT4A 4GP0A 3SNVA 2P39A 4I96A 1TP0A 1M16A 5JMCA 5FNWA 4QALA 4I4YA 2ZQOA 4J2SA 2IWTB 4I4VA 4LO1A 3VT0A 3BX1C 1K5VA 5I1BA 1CVSA 1XG6A 4MZGB 1FN0A 3BADA 4I6IA 3R4UA 5GAQA 3K1XA 3NBCA 4CJMA 4IQPA 1FWUA 3H6RB 1BFGA 3BA5A 3FJHA 4YOLA 2RG9B 4USPA 1CE7B 3HMYA 6I1BA 2L5XA 1L2HA 2DREA 4IZEA 2P23A 4OWLA 1Z0HA 1HCDA 4OEEA 4D8HA 4Z9WB 1XYFA 2K4AB 3AKHA 1AVAC 3RSJA 4FGFA 4JQ0A 1WBAA 3AH2A 4G6JA 3HOMA 1DFCA 3FFZA 5EHAA 4IZXA 3FJEA 4HR6C 4XFSA 1TTUA 4USOA 1DFQA 2VUAA 1FQ9A 2NM1A 2Y9XE 3MPPG 4X38A 3CA5A 5DUYA 1ISXA 5BQUA 1FGAA 1W3GA 3O44A 2NZ9A 3FJ8A 1MC9A 2R9KB 4QKSA 2QYIB 4I4PA 3WA1A 4I2SA 1DZCA 4XKIA 4DENA 1MD6A 4GP3A 1FMZA 3UJ0A 3BAQA 2BFHA 4LO1C 3KMVA 3O4AA 4HJJA 4JKQA 5FZUA 3RMXA 2NTDA 3A23A 3N7JA 4I4SA 2UUSA 4OEFA 3AH1A 2AQZA 3AJ5A 3P6JA 3VUOA 1G9DA 1N4KA 3AZVA 2FFUA 3RTIB 1EPWA 4ISRA 3D7WB 3QYDA 3O4OA 1YYNA 4HA2A 1JLXA 3NBDA 3BTAA 3AKFA 2K8RA 1HWNB 3CAHA 3S8KA 1AXMA 2NVHA 2VXRA 3H6QA 3WO2A 1SR4C 3A21A 4LO3A 1V6WA 1I1BA 1BLAA 3N0KA 1ISYA 4LO0C 3RTJB 1K5UA 2MLLB 1HWOB 5BQUC 2XOAA 3F62B 4F34A 5E24E 2VSAA 4LO8B 1DZDA 3A07A 4I7IA 4OEGA 3O5WB 3B9UA 3PUBA 3FJFA 3OJ2A 2KI4A 3NBNA 3MALA 3OGGA 1YXWA 1FV3A 4J2YA 2RQ9A 4F83A 2F2FA 1DLLA 4P0JA 1DQOA 4ENDA 3WINA 4H9WA 1PUUB 4Q91A 2WRYA 2HW9A 3AKIA 3O3QA 4J2KA 3H6RA 3I2XA 4G1RA 3RMYA 4GAFA 4PC4A 3ZC9A 4KEIA 2Q3NB 4IONA 5HPZA 1NZKA 3AH4A 2D22A 3O4DA 4ZFYB 5BVPI 4I1EA 4EFQA 4ZFWB 3AJ6A 2FDBM 41BIA 1XZZA 4I4RA 1IRPA 1ISVA 1SZ6B 2ZQNA 2FO1A 4DEPA 3HALA 3O4BA 4LO3C 5FZYA 1G9AA 1ISZA 3I2AA 4AN6A 2D7RA 2M49A 1R8NA 3T8SA 2D23A 3P6IA 3BRGC 3BAUA 1S0EA 3OJMA 1HKNA 4OWKA 4X39A 1S0DA 4IY9A 5F8YA 3BAGA 1TWMA 1A8DA 2D1ZA 1UPSA 2ZR1B 4TLPA 2HWMA 1SR4A 3OGFA 5BXPA 3VT1A 3FJIA 3WO3A 3TC2A 1DIWA 3HBWA 4DCKC 3N7MA 1EV2A 2F2FC 4G9NA 4AN7B 4LO0A 4EKXB 2D43A 3WINC 2D24A 1JY0A 2Z48A 4I1BA 1JT7A 5DZUA 4P6AA 3CRIA 2DRZA 2LIEA 4QBVA 3V0AA 2D44A 3PMEA 4D0ZA 1QXMA 2YUGA 1BASA 1BFCA 1VCLA 1YTOA 4G9MA 1AF9A 1JT5A 3BRDA 2AFGA 1HWPB 1XHBA 1TWEA 5F8SA 4ZLBB 1W3FA 4MZFB 2FGFA 1P63A 3IM7A 2HWAA 3PG0A 4JRAA 1JTCA 1IHKA 3N7KA 4EB2B 3BAOA 1JT3A 2HZ9A 4H75A 1ONKB 1I1EA 3V0AB 1IT0A 3E8LC 4II0A 3VSFA 3LTQA 4KEJA 5B2HA 4R6UB 4X3AA 1G82A 3V0BA 4I37A 4KBBA 4LO7B 4Q9PA 3FJDA 4JP0A 2MC2A 3O49A 1ABRB 2ESUA 2BEAA 2I1BA 2IHOA 3QR5A 1S0CA 1FV2A 3Q7YA 5DVHA 1ISWA 4Q9GA 3CA4A 4P0LA 3IAGC 1HIBA 4KC3A 1T9FA 3BA4A 3V0BB 4QKRA 3P53A 5BOWA 1YBIA 4IYBA 3H6SE 2ET2A 1BARA 3EF2A 3OBTA 4X37A 1II4A 3BRFA 1RY7A 4EEEB 5F8WA 3BA7A 1W3AA 4JKXB 3UD8A 1NUNA 3F1RA 2Y9WC 2NS2A 3FJKA 1EVTA 2QN4A 5BXTA 4OW4A 2VLCA 1ILR1 1FWVA 3UD7A 3C9ZA 1PC8B 1RZOB 4J2XA 4ZFUB 4KEKA 4LO7C 1EYLA 4ISQA 3CU1B 3I29B 5JLVA 2Y9FA 31BIA 3WMVA 4ZBVB 1JLYA 5FZZA 4FVVA 1BA7A 3NJ5A 3S8JA 1OQLB 1RMLA 7I1BA 3CA6A 1IILA 1ITBA 4ZA3B 1J0SA 4IY8A 2GO2A 3CQAA 3CRHA 21BIA 1AVUA 4EFPA 3FJJA 5BP5C 1G9BA 1HWMB 1WD4A 4ZGRB 4QBCA 4D0TA 4WBCA 2DS0A 4OWJA 3AKGA 1IJTA 2Z49A 3OBRA 3FJBA 3FJ9A 1Z4SA 1WD3A 1S0LA 1RG8A 3A22A 1PWAA 2X2TA 3ZX7A 3IM6A 2KLLA 1DQGA 2F8XC 3N7LA 1V6XA 4I8MA 2KI6B 3FJAA 1WBCA 3HSMA 5EC5A 1Q03A 2MIBA 4I4XA 1PZZA 5D61A 5D62A 8I1BA 3UDAA 4A7YA 2KH2A 3FJCA 4LO2A 1TFMB 5BXSA 2D7IA 4XFTA 2NP0A 4JPZA 3POKA 1R8OA 2D20A 5F90A 4IHZA 2Y9GA 2AXMA 3IM5A 4L4HA 4A7KA 1QQKA 3VWCA 4I4QA 1AVWB 1Q1UA 3FUQA 1AFCA 3V79C 1TOOA 2Q9XA 9ILBA 4P0KA 3JRRA 4ZKTB 1TIEA 5BXRA 4I0YA 4QD2B 1S0FA 3UJ4A 1AVXB 2X2SA 3UD9A 1BFBA
chains in the Genus database with same CATH topology
1YF8B 4GAIA 1T4QA 4I4OA 1Q04A 4L4IA 4QC4A 3VEQA 2E4MA 3CA0A 3R4SA 5FNXA 1FMMS 3JUTA 3WO4A 3FGMA 3ZXDA 5BP5A 3Q7XA 1BFFA 3BB2A 1G9CA 3LLPA 1GGPB 1KNMA 3ILAA 2VU9A 1M2TB 1D0HA 3Q7WA 3BAHA 1DJSB 3ZXGA 2KKIA 4A7ZA 5DSSB 1IRAX 3IIRA 2VSEA 2ERMA 4XFUA 2LIQA 3HN1A 2BEBA 4H04A 4I4UA 4LO2C 3BAVA 4EFRA 2VXTI 1S0BA 2DRYA 4GOYA 5G00A 2WBCA 3W9TA 1QQLA 4QD2C 2GZBA 4J23B 1F31A 2J3PA 1E0OA 3OJVA 5EG6C 4JAWA 2RSTA 3CA3A 1S0GA 1V6VA 4MZHA 3ZC8A 3CRGA 3PHZA 1IOBA 1JQZA 1PUMB 3CA1A 3FUOA 3VSZA 3VT2A 4G6MA 3AZWA 3O4CA 2NYYA 1V6UA 1BLDA 3NBEA 4GOVA 2E4MC 4Z8SB 4UY4A 1Z2VA 1HCEA 2AAIB 4I3NA 2K43A 3WMUA 2FFVA 5D63A 4QO3A 4ZOTA 4OUJA 1JT4A 4GP0A 3SNVA 2P39A 4I96A 1TP0A 1M16A 5JMCA 5FNWA 4QALA 4I4YA 2ZQOA 4J2SA 2IWTB 4I4VA 4LO1A 3VT0A 3BX1C 1K5VA 5I1BA 1CVSA 1XG6A 4MZGB 1FN0A 3BADA 4I6IA 3R4UA 5GAQA 3K1XA 3NBCA 4CJMA 4IQPA 1FWUA 3H6RB 1BFGA 3BA5A 3FJHA 4YOLA 2RG9B 4USPA 1CE7B 3HMYA 6I1BA 2L5XA 1L2HA 2DREA 4IZEA 2P23A 4OWLA 1Z0HA 1HCDA 4OEEA 4D8HA 4Z9WB 1XYFA 2K4AB 3AKHA 1AVAC 3RSJA 4FGFA 4JQ0A 1WBAA 3AH2A 4G6JA 3HOMA 1DFCA 3FFZA 5EHAA 4IZXA 3FJEA 4HR6C 4XFSA 1TTUA 4USOA 1DFQA 2VUAA 1FQ9A 2NM1A 2Y9XE 3MPPG 4X38A 3CA5A 5DUYA 1ISXA 5BQUA 1FGAA 1W3GA 3O44A 2NZ9A 3FJ8A 1MC9A 2R9KB 4QKSA 2QYIB 4I4PA 3WA1A 4I2SA 1DZCA 4XKIA 4DENA 1MD6A 4GP3A 1FMZA 3UJ0A 3BAQA 2BFHA 4LO1C 3KMVA 3O4AA 4HJJA 4JKQA 5FZUA 3RMXA 2NTDA 3A23A 3N7JA 4I4SA 2UUSA 4OEFA 3AH1A 2AQZA 3AJ5A 3P6JA 3VUOA 1G9DA 1N4KA 3AZVA 2FFUA 3RTIB 1EPWA 4ISRA 3D7WB 3QYDA 3O4OA 1YYNA 4HA2A 1JLXA 3NBDA 3BTAA 3AKFA 2K8RA 1HWNB 3CAHA 3S8KA 1AXMA 2NVHA 2VXRA 3H6QA 3WO2A 1SR4C 3A21A 4LO3A 1V6WA 1I1BA 1BLAA 3N0KA 1ISYA 4LO0C 3RTJB 1K5UA 2MLLB 1HWOB 5BQUC 2XOAA 3F62B 4F34A 5E24E 2VSAA 4LO8B 1DZDA 3A07A 4I7IA 4OEGA 3O5WB 3B9UA 3PUBA 3FJFA 3OJ2A 2KI4A 3NBNA 3MALA 3OGGA 1YXWA 1FV3A 4J2YA 2RQ9A 4F83A 2F2FA 1DLLA 4P0JA 1DQOA 4ENDA 3WINA 4H9WA 1PUUB 4Q91A 2WRYA 2HW9A 3AKIA 3O3QA 4J2KA 3H6RA 3I2XA 4G1RA 3RMYA 4GAFA 4PC4A 3ZC9A 4KEIA 2Q3NB 4IONA 5HPZA 1NZKA 3AH4A 2D22A 3O4DA 4ZFYB 5BVPI 4I1EA 4EFQA 4ZFWB 3AJ6A 2FDBM 41BIA 1XZZA 4I4RA 1IRPA 1ISVA 1SZ6B 2ZQNA 2FO1A 4DEPA 3HALA 3O4BA 4LO3C 5FZYA 1G9AA 1ISZA 3I2AA 4AN6A 2D7RA 2M49A 1R8NA 3T8SA 2D23A 3P6IA 3BRGC 3BAUA 1S0EA 3OJMA 1HKNA 4OWKA 4X39A 1S0DA 4IY9A 5F8YA 3BAGA 1TWMA 1A8DA 2D1ZA 1UPSA 2ZR1B 4TLPA 2HWMA 1SR4A 3OGFA 5BXPA 3VT1A 3FJIA 3WO3A 3TC2A 1DIWA 3HBWA 4DCKC 3N7MA 1EV2A 2F2FC 4G9NA 4AN7B 4LO0A 4EKXB 2D43A 3WINC 2D24A 1JY0A 2Z48A 4I1BA 1JT7A 5DZUA 4P6AA 3CRIA 2DRZA 2LIEA 4QBVA 3V0AA 2D44A 3PMEA 4D0ZA 1QXMA 2YUGA 1BASA 1BFCA 1VCLA 1YTOA 4G9MA 1AF9A 1JT5A 3BRDA 2AFGA 1HWPB 1XHBA 1TWEA 5F8SA 4ZLBB 1W3FA 4MZFB 2FGFA 1P63A 3IM7A 2HWAA 3PG0A 4JRAA 1JTCA 1IHKA 3N7KA 4EB2B 3BAOA 1JT3A 2HZ9A 4H75A 1ONKB 1I1EA 3V0AB 1IT0A 3E8LC 4II0A 3VSFA 3LTQA 4KEJA 5B2HA 4R6UB 4X3AA 1G82A 3V0BA 4I37A 4KBBA 4LO7B 4Q9PA 3FJDA 4JP0A 2MC2A 3O49A 1ABRB 2ESUA 2BEAA 2I1BA 2IHOA 3QR5A 1S0CA 1FV2A 3Q7YA 5DVHA 1ISWA 4Q9GA 3CA4A 4P0LA 3IAGC 1HIBA 4KC3A 1T9FA 3BA4A 3V0BB 4QKRA 3P53A 5BOWA 1YBIA 4IYBA 3H6SE 2ET2A 1BARA 3EF2A 3OBTA 4X37A 1II4A 3BRFA 1RY7A 4EEEB 5F8WA 3BA7A 1W3AA 4JKXB 3UD8A 1NUNA 3F1RA 2Y9WC 2NS2A 3FJKA 1EVTA 2QN4A 5BXTA 4OW4A 2VLCA 1ILR1 1FWVA 3UD7A 3C9ZA 1PC8B 1RZOB 4J2XA 4ZFUB 4KEKA 4LO7C 1EYLA 4ISQA 3CU1B 3I29B 5JLVA 2Y9FA 31BIA 3WMVA 4ZBVB 1JLYA 5FZZA 4FVVA 1BA7A 3NJ5A 3S8JA 1OQLB 1RMLA 7I1BA 3CA6A 1IILA 1ITBA 4ZA3B 1J0SA 4IY8A 2GO2A 3CQAA 3CRHA 21BIA 1AVUA 4EFPA 3FJJA 5BP5C 1G9BA 1HWMB 1WD4A 4ZGRB 4QBCA 4D0TA 4WBCA 2DS0A 4OWJA 3AKGA 1IJTA 2Z49A 3OBRA 3FJBA 3FJ9A 1Z4SA 1WD3A 1S0LA 1RG8A 3A22A 1PWAA 2X2TA 3ZX7A 3IM6A 2KLLA 1DQGA 2F8XC 3N7LA 1V6XA 4I8MA 2KI6B 3FJAA 1WBCA 3HSMA 5EC5A 1Q03A 2MIBA 4I4XA 1PZZA 5D61A 5D62A 8I1BA 3UDAA 4A7YA 2KH2A 3FJCA 4LO2A 1TFMB 5BXSA 2D7IA 4XFTA 2NP0A 4JPZA 3POKA 1R8OA 2D20A 5F90A 4IHZA 2Y9GA 2AXMA 3IM5A 4L4HA 4A7KA 1QQKA 3VWCA 4I4QA 1AVWB 1Q1UA 3FUQA 1AFCA 3V79C 1TOOA 2Q9XA 9ILBA 4P0KA 3JRRA 4ZKTB 1TIEA 5BXRA 4I0YA 4QD2B 1S0FA 3UJ4A 1AVXB 2X2SA 3UD9A 1BFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YF8 B;  4GAI A;  1T4Q A;  4I4O A;  1Q04 A;  4L4I A;  4QC4 A;  3VEQ A;  2E4M A;  3CA0 A;  3R4S A;  5FNX A;  1FMM S;  3JUT A;  3WO4 A;  3FGM A;  3ZXD A;  5BP5 A;  3Q7X A;  1BFF A;  3BB2 A;  1G9C A;  3LLP A;  1GGP B;  1KNM A;  3ILA A;  2VU9 A;  1M2T B;  1D0H A;  3Q7W A;  3BAH A;  1DJS B;  3ZXG A;  2KKI A;  4A7Z A;  5DSS B;  1IRA X;  3IIR A;  2VSE A;  2ERM A;  4XFU A;  2LIQ A;  3HN1 A;  2BEB A;  4H04 A;  4I4U A;  4LO2 C;  3BAV A;  4EFR A;  2VXT I;  1S0B A;  2DRY A;  4GOY A;  5G00 A;  2WBC A;  3W9T A;  1QQL A;  4QD2 C;  2GZB A;  4J23 B;  1F31 A;  2J3P A;  1E0O A;  3OJV A;  5EG6 C;  4JAW A;  2RST A;  3CA3 A;  1S0G A;  1V6V A;  3ZC8 A;  3CRG A;  3PHZ A;  1IOB A;  1JQZ A;  1PUM B;  3CA1 A;  3FUO A;  3VSZ A;  3VT2 A;  4G6M A;  3AZW A;  3O4C A;  2NYY A;  1V6U A;  1BLD A;  3NBE A;  4GOV A;  2E4M C;  4Z8S B;  1Z2V A;  1HCE A;  2AAI B;  4I3N A;  2K43 A;  3WMU A;  2FFV A;  5D63 A;  4QO3 A;  4ZOT A;  4OUJ A;  1JT4 A;  4GP0 A;  3SNV A;  2P39 A;  4I96 A;  1TP0 A;  1M16 A;  5JMC A;  5FNW A;  4QAL A;  4I4Y A;  2ZQO A;  4J2S A;  2IWT B;  4I4V A;  4LO1 A;  3VT0 A;  3BX1 C;  1K5V A;  5I1B A;  1CVS A;  1XG6 A;  1FN0 A;  3BAD A;  4I6I A;  3R4U A;  5GAQ A;  3K1X A;  3NBC A;  4CJM A;  4IQP A;  1FWU A;  3H6R B;  1BFG A;  3BA5 A;  3FJH A;  4YOL A;  2RG9 B;  4USP A;  1CE7 B;  3HMY A;  6I1B A;  2L5X A;  1L2H A;  2DRE A;  4IZE A;  2P23 A;  4OWL A;  1Z0H A;  1HCD A;  4OEE A;  4D8H A;  4Z9W B;  1XYF A;  2K4A B;  3AKH A;  1AVA C;  3RSJ A;  4FGF A;  4JQ0 A;  1WBA A;  3AH2 A;  4G6J A;  3HOM A;  1DFC A;  3FFZ A;  5EHA A;  4IZX A;  3FJE A;  4HR6 C;  4XFS A;  1TTU A;  4USO A;  1DFQ A;  2VUA A;  1FQ9 A;  2NM1 A;  2Y9X E;  3MPP G;  4X38 A;  3CA5 A;  5DUY A;  1ISX A;  5BQU A;  1FGA A;  1W3G A;  3O44 A;  2NZ9 A;  3FJ8 A;  1MC9 A;  2R9K B;  4QKS A;  2QYI B;  4I4P A;  3WA1 A;  4I2S A;  1DZC A;  4XKI A;  4DEN A;  1MD6 A;  4GP3 A;  1FMZ A;  3UJ0 A;  3BAQ A;  2BFH A;  4LO1 C;  3KMV A;  3O4A A;  4HJJ A;  4JKQ A;  5FZU A;  3RMX A;  2NTD A;  3A23 A;  3N7J A;  4I4S A;  2UUS A;  4OEF A;  3AH1 A;  2AQZ A;  3AJ5 A;  3P6J A;  3VUO A;  1G9D A;  1N4K A;  3AZV A;  2FFU A;  3RTI B;  1EPW A;  4ISR A;  3D7W B;  3QYD A;  3O4O A;  1YYN A;  4HA2 A;  1JLX A;  3NBD A;  3BTA A;  3AKF A;  2K8R A;  1HWN B;  3CAH A;  3S8K A;  1AXM A;  2NVH A;  2VXR A;  3H6Q A;  3WO2 A;  1SR4 C;  3A21 A;  4LO3 A;  1V6W A;  1I1B A;  1BLA A;  3N0K A;  1ISY A;  4LO0 C;  3RTJ B;  1K5U A;  2MLL B;  1HWO B;  5BQU C;  2XOA A;  3F62 B;  4F34 A;  5E24 E;  2VSA A;  4LO8 B;  1DZD A;  3A07 A;  4I7I A;  4OEG A;  3O5W B;  3B9U A;  3PUB A;  3FJF A;  3OJ2 A;  2KI4 A;  3NBN A;  3MAL A;  3OGG A;  1YXW A;  1FV3 A;  4J2Y A;  2RQ9 A;  4F83 A;  2F2F A;  1DLL A;  4P0J A;  1DQO A;  4END A;  3WIN A;  4H9W A;  1PUU B;  4Q91 A;  2WRY A;  2HW9 A;  3AKI A;  3O3Q A;  4J2K A;  3H6R A;  3I2X A;  4G1R A;  3RMY A;  4GAF A;  4PC4 A;  3ZC9 A;  4KEI A;  2Q3N B;  4ION A;  5HPZ A;  1NZK A;  3AH4 A;  2D22 A;  3O4D A;  4ZFY B;  5BVP I;  4I1E A;  4EFQ A;  4ZFW B;  3AJ6 A;  2FDB M;  41BI A;  1XZZ A;  4I4R A;  1IRP A;  1ISV A;  1SZ6 B;  2ZQN A;  2FO1 A;  4DEP A;  3HAL A;  3O4B A;  4LO3 C;  5FZY A;  1G9A A;  1ISZ A;  3I2A A;  4AN6 A;  2D7R A;  2M49 A;  1R8N A;  3T8S A;  2D23 A;  3P6I A;  3BRG C;  3BAU A;  1S0E A;  3OJM A;  1HKN A;  4OWK A;  4X39 A;  1S0D A;  4IY9 A;  5F8Y A;  3BAG A;  1TWM A;  1A8D A;  2D1Z A;  1UPS A;  2ZR1 B;  4TLP A;  2HWM A;  1SR4 A;  3OGF A;  5BXP A;  3VT1 A;  3FJI A;  3WO3 A;  3TC2 A;  1DIW A;  3HBW A;  4DCK C;  3N7M A;  1EV2 A;  2F2F C;  4G9N A;  4AN7 B;  4LO0 A;  4EKX B;  2D43 A;  3WIN C;  2D24 A;  1JY0 A;  2Z48 A;  4I1B A;  1JT7 A;  5DZU A;  4P6A A;  3CRI A;  2DRZ A;  2LIE A;  4QBV A;  3V0A A;  2D44 A;  3PME A;  4D0Z A;  1QXM A;  2YUG A;  1BAS A;  1BFC A;  1VCL A;  1YTO A;  4G9M A;  1AF9 A;  1JT5 A;  3BRD A;  2AFG A;  1HWP B;  1XHB A;  1TWE A;  5F8S A;  4ZLB B;  1W3F A;  2FGF A;  1P63 A;  3IM7 A;  2HWA A;  3PG0 A;  4JRA A;  1JTC A;  1IHK A;  3N7K A;  4EB2 B;  3BAO A;  1JT3 A;  2HZ9 A;  1ONK B;  1I1E A;  3V0A B;  1IT0 A;  3E8L C;  4II0 A;  3VSF A;  3LTQ A;  4KEJ A;  5B2H A;  4R6U B;  4X3A A;  1G82 A;  3V0B A;  4I37 A;  4KBB A;  4LO7 B;  4Q9P A;  3FJD A;  4JP0 A;  2MC2 A;  3O49 A;  1ABR B;  2ESU A;  2BEA A;  2I1B A;  2IHO A;  3QR5 A;  1S0C A;  1FV2 A;  3Q7Y A;  5DVH A;  1ISW A;  4Q9G A;  3CA4 A;  4P0L A;  3IAG C;  1HIB A;  4KC3 A;  1T9F A;  3BA4 A;  3V0B B;  4QKR A;  3P53 A;  5BOW A;  1YBI A;  4IYB A;  3H6S E;  2ET2 A;  1BAR A;  3EF2 A;  3OBT A;  4X37 A;  1II4 A;  3BRF A;  1RY7 A;  4EEE B;  5F8W A;  3BA7 A;  1W3A A;  4JKX B;  3UD8 A;  1NUN A;  3F1R A;  2Y9W C;  3FJK A;  1EVT A;  2QN4 A;  5BXT A;  4OW4 A;  2VLC A;  1ILR 1;  1FWV A;  3UD7 A;  3C9Z A;  1PC8 B;  1RZO B;  4J2X A;  4ZFU B;  4KEK A;  4LO7 C;  1EYL A;  4ISQ A;  3CU1 B;  3I29 B;  5JLV A;  2Y9F A;  31BI A;  3WMV A;  4ZBV B;  1JLY A;  5FZZ A;  4FVV A;  1BA7 A;  3NJ5 A;  3S8J A;  1OQL B;  1RML A;  7I1B A;  3CA6 A;  1IIL A;  1ITB A;  4ZA3 B;  1J0S A;  4IY8 A;  2GO2 A;  3CQA A;  3CRH A;  21BI A;  1AVU A;  4EFP A;  3FJJ A;  5BP5 C;  1G9B A;  1HWM B;  1WD4 A;  4ZGR B;  4QBC A;  4D0T A;  4WBC A;  2DS0 A;  4OWJ A;  3AKG A;  1IJT A;  2Z49 A;  3OBR A;  3FJB A;  3FJ9 A;  1Z4S A;  1WD3 A;  1S0L A;  1RG8 A;  3A22 A;  1PWA A;  2X2T A;  3ZX7 A;  3IM6 A;  2KLL A;  1DQG A;  2F8X C;  3N7L A;  1V6X A;  4I8M A;  2KI6 B;  3FJA A;  1WBC A;  3HSM A;  5EC5 A;  1Q03 A;  2MIB A;  4I4X A;  1PZZ A;  5D61 A;  5D62 A;  8I1B A;  3UDA A;  4A7Y A;  2KH2 A;  3FJC A;  4LO2 A;  1TFM B;  5BXS A;  2D7I A;  4XFT A;  2NP0 A;  4JPZ A;  3POK A;  1R8O A;  2D20 A;  5F90 A;  4IHZ A;  2Y9G A;  2AXM A;  3IM5 A;  4L4H A;  4A7K A;  1QQK A;  3VWC A;  4I4Q A;  1AVW B;  1Q1U A;  3FUQ A;  1AFC A;  3V79 C;  1TOO A;  2Q9X A;  9ILB A;  4P0K A;  3JRR A;  4ZKT B;  1TIE A;  5BXR A;  4I0Y A;  4QD2 B;  1S0F A;  3UJ4 A;  1AVX B;  2X2S A;  3UD9 A;  1BFB A; 
#chains in the Genus database with same CATH topology
 1YF8 B;  4GAI A;  1T4Q A;  4I4O A;  1Q04 A;  4L4I A;  4QC4 A;  3VEQ A;  2E4M A;  3CA0 A;  3R4S A;  5FNX A;  1FMM S;  3JUT A;  3WO4 A;  3FGM A;  3ZXD A;  5BP5 A;  3Q7X A;  1BFF A;  3BB2 A;  1G9C A;  3LLP A;  1GGP B;  1KNM A;  3ILA A;  2VU9 A;  1M2T B;  1D0H A;  3Q7W A;  3BAH A;  1DJS B;  3ZXG A;  2KKI A;  4A7Z A;  5DSS B;  1IRA X;  3IIR A;  2VSE A;  2ERM A;  4XFU A;  2LIQ A;  3HN1 A;  2BEB A;  4H04 A;  4I4U A;  4LO2 C;  3BAV A;  4EFR A;  2VXT I;  1S0B A;  2DRY A;  4GOY A;  5G00 A;  2WBC A;  3W9T A;  1QQL A;  4QD2 C;  2GZB A;  4J23 B;  1F31 A;  2J3P A;  1E0O A;  3OJV A;  5EG6 C;  4JAW A;  2RST A;  3CA3 A;  1S0G A;  1V6V A;  4MZH A;  3ZC8 A;  3CRG A;  3PHZ A;  1IOB A;  1JQZ A;  1PUM B;  3CA1 A;  3FUO A;  3VSZ A;  3VT2 A;  4G6M A;  3AZW A;  3O4C A;  2NYY A;  1V6U A;  1BLD A;  3NBE A;  4GOV A;  2E4M C;  4Z8S B;  4UY4 A;  1Z2V A;  1HCE A;  2AAI B;  4I3N A;  2K43 A;  3WMU A;  2FFV A;  5D63 A;  4QO3 A;  4ZOT A;  4OUJ A;  1JT4 A;  4GP0 A;  3SNV A;  2P39 A;  4I96 A;  1TP0 A;  1M16 A;  5JMC A;  5FNW A;  4QAL A;  4I4Y A;  2ZQO A;  4J2S A;  2IWT B;  4I4V A;  4LO1 A;  3VT0 A;  3BX1 C;  1K5V A;  5I1B A;  1CVS A;  1XG6 A;  4MZG B;  1FN0 A;  3BAD A;  4I6I A;  3R4U A;  5GAQ A;  3K1X A;  3NBC A;  4CJM A;  4IQP A;  1FWU A;  3H6R B;  1BFG A;  3BA5 A;  3FJH A;  4YOL A;  2RG9 B;  4USP A;  1CE7 B;  3HMY A;  6I1B A;  2L5X A;  1L2H A;  2DRE A;  4IZE A;  2P23 A;  4OWL A;  1Z0H A;  1HCD A;  4OEE A;  4D8H A;  4Z9W B;  1XYF A;  2K4A B;  3AKH A;  1AVA C;  3RSJ A;  4FGF A;  4JQ0 A;  1WBA A;  3AH2 A;  4G6J A;  3HOM A;  1DFC A;  3FFZ A;  5EHA A;  4IZX A;  3FJE A;  4HR6 C;  4XFS A;  1TTU A;  4USO A;  1DFQ A;  2VUA A;  1FQ9 A;  2NM1 A;  2Y9X E;  3MPP G;  4X38 A;  3CA5 A;  5DUY A;  1ISX A;  5BQU A;  1FGA A;  1W3G A;  3O44 A;  2NZ9 A;  3FJ8 A;  1MC9 A;  2R9K B;  4QKS A;  2QYI B;  4I4P A;  3WA1 A;  4I2S A;  1DZC A;  4XKI A;  4DEN A;  1MD6 A;  4GP3 A;  1FMZ A;  3UJ0 A;  3BAQ A;  2BFH A;  4LO1 C;  3KMV A;  3O4A A;  4HJJ A;  4JKQ A;  5FZU A;  3RMX A;  2NTD A;  3A23 A;  3N7J A;  4I4S A;  2UUS A;  4OEF A;  3AH1 A;  2AQZ A;  3AJ5 A;  3P6J A;  3VUO A;  1G9D A;  1N4K A;  3AZV A;  2FFU A;  3RTI B;  1EPW A;  4ISR A;  3D7W B;  3QYD A;  3O4O A;  1YYN A;  4HA2 A;  1JLX A;  3NBD A;  3BTA A;  3AKF A;  2K8R A;  1HWN B;  3CAH A;  3S8K A;  1AXM A;  2NVH A;  2VXR A;  3H6Q A;  3WO2 A;  1SR4 C;  3A21 A;  4LO3 A;  1V6W A;  1I1B A;  1BLA A;  3N0K A;  1ISY A;  4LO0 C;  3RTJ B;  1K5U A;  2MLL B;  1HWO B;  5BQU C;  2XOA A;  3F62 B;  4F34 A;  5E24 E;  2VSA A;  4LO8 B;  1DZD A;  3A07 A;  4I7I A;  4OEG A;  3O5W B;  3B9U A;  3PUB A;  3FJF A;  3OJ2 A;  2KI4 A;  3NBN A;  3MAL A;  3OGG A;  1YXW A;  1FV3 A;  4J2Y A;  2RQ9 A;  4F83 A;  2F2F A;  1DLL A;  4P0J A;  1DQO A;  4END A;  3WIN A;  4H9W A;  1PUU B;  4Q91 A;  2WRY A;  2HW9 A;  3AKI A;  3O3Q A;  4J2K A;  3H6R A;  3I2X A;  4G1R A;  3RMY A;  4GAF A;  4PC4 A;  3ZC9 A;  4KEI A;  2Q3N B;  4ION A;  5HPZ A;  1NZK A;  3AH4 A;  2D22 A;  3O4D A;  4ZFY B;  5BVP I;  4I1E A;  4EFQ A;  4ZFW B;  3AJ6 A;  2FDB M;  41BI A;  1XZZ A;  4I4R A;  1IRP A;  1ISV A;  1SZ6 B;  2ZQN A;  2FO1 A;  4DEP A;  3HAL A;  3O4B A;  4LO3 C;  5FZY A;  1G9A A;  1ISZ A;  3I2A A;  4AN6 A;  2D7R A;  2M49 A;  1R8N A;  3T8S A;  2D23 A;  3P6I A;  3BRG C;  3BAU A;  1S0E A;  3OJM A;  1HKN A;  4OWK A;  4X39 A;  1S0D A;  4IY9 A;  5F8Y A;  3BAG A;  1TWM A;  1A8D A;  2D1Z A;  1UPS A;  2ZR1 B;  4TLP A;  2HWM A;  1SR4 A;  3OGF A;  5BXP A;  3VT1 A;  3FJI A;  3WO3 A;  3TC2 A;  1DIW A;  3HBW A;  4DCK C;  3N7M A;  1EV2 A;  2F2F C;  4G9N A;  4AN7 B;  4LO0 A;  4EKX B;  2D43 A;  3WIN C;  2D24 A;  1JY0 A;  2Z48 A;  4I1B A;  1JT7 A;  5DZU A;  4P6A A;  3CRI A;  2DRZ A;  2LIE A;  4QBV A;  3V0A A;  2D44 A;  3PME A;  4D0Z A;  1QXM A;  2YUG A;  1BAS A;  1BFC A;  1VCL A;  1YTO A;  4G9M A;  1AF9 A;  1JT5 A;  3BRD A;  2AFG A;  1HWP B;  1XHB A;  1TWE A;  5F8S A;  4ZLB B;  1W3F A;  4MZF B;  2FGF A;  1P63 A;  3IM7 A;  2HWA A;  3PG0 A;  4JRA A;  1JTC A;  1IHK A;  3N7K A;  4EB2 B;  3BAO A;  1JT3 A;  2HZ9 A;  4H75 A;  1ONK B;  1I1E A;  3V0A B;  1IT0 A;  3E8L C;  4II0 A;  3VSF A;  3LTQ A;  4KEJ A;  5B2H A;  4R6U B;  4X3A A;  1G82 A;  3V0B A;  4I37 A;  4KBB A;  4LO7 B;  4Q9P A;  3FJD A;  4JP0 A;  2MC2 A;  3O49 A;  1ABR B;  2ESU A;  2BEA A;  2I1B A;  2IHO A;  3QR5 A;  1S0C A;  1FV2 A;  3Q7Y A;  5DVH A;  1ISW A;  4Q9G A;  3CA4 A;  4P0L A;  3IAG C;  1HIB A;  4KC3 A;  1T9F A;  3BA4 A;  3V0B B;  4QKR A;  3P53 A;  5BOW A;  1YBI A;  4IYB A;  3H6S E;  2ET2 A;  1BAR A;  3EF2 A;  3OBT A;  4X37 A;  1II4 A;  3BRF A;  1RY7 A;  4EEE B;  5F8W A;  3BA7 A;  1W3A A;  4JKX B;  3UD8 A;  1NUN A;  3F1R A;  2Y9W C;  2NS2 A;  3FJK A;  1EVT A;  2QN4 A;  5BXT A;  4OW4 A;  2VLC A;  1ILR 1;  1FWV A;  3UD7 A;  3C9Z A;  1PC8 B;  1RZO B;  4J2X A;  4ZFU B;  4KEK A;  4LO7 C;  1EYL A;  4ISQ A;  3CU1 B;  3I29 B;  5JLV A;  2Y9F A;  31BI A;  3WMV A;  4ZBV B;  1JLY A;  5FZZ A;  4FVV A;  1BA7 A;  3NJ5 A;  3S8J A;  1OQL B;  1RML A;  7I1B A;  3CA6 A;  1IIL A;  1ITB A;  4ZA3 B;  1J0S A;  4IY8 A;  2GO2 A;  3CQA A;  3CRH A;  21BI A;  1AVU A;  4EFP A;  3FJJ A;  5BP5 C;  1G9B A;  1HWM B;  1WD4 A;  4ZGR B;  4QBC A;  4D0T A;  4WBC A;  2DS0 A;  4OWJ A;  3AKG A;  1IJT A;  2Z49 A;  3OBR A;  3FJB A;  3FJ9 A;  1Z4S A;  1WD3 A;  1S0L A;  1RG8 A;  3A22 A;  1PWA A;  2X2T A;  3ZX7 A;  3IM6 A;  2KLL A;  1DQG A;  2F8X C;  3N7L A;  1V6X A;  4I8M A;  2KI6 B;  3FJA A;  1WBC A;  3HSM A;  5EC5 A;  1Q03 A;  2MIB A;  4I4X A;  1PZZ A;  5D61 A;  5D62 A;  8I1B A;  3UDA A;  4A7Y A;  2KH2 A;  3FJC A;  4LO2 A;  1TFM B;  5BXS A;  2D7I A;  4XFT A;  2NP0 A;  4JPZ A;  3POK A;  1R8O A;  2D20 A;  5F90 A;  4IHZ A;  2Y9G A;  2AXM A;  3IM5 A;  4L4H A;  4A7K A;  1QQK A;  3VWC A;  4I4Q A;  1AVW B;  1Q1U A;  3FUQ A;  1AFC A;  3V79 C;  1TOO A;  2Q9X A;  9ILB A;  4P0K A;  3JRR A;  4ZKT B;  1TIE A;  5BXR A;  4I0Y A;  4QD2 B;  1S0F A;  3UJ4 A;  1AVX B;  2X2S A;  3UD9 A;  1BFB A; 
#chains in the Genus database with same CATH homology
 1YF8 B;  4GAI A;  1T4Q A;  4I4O A;  1Q04 A;  4L4I A;  4QC4 A;  3VEQ A;  2E4M A;  3CA0 A;  3R4S A;  5FNX A;  1FMM S;  3JUT A;  3WO4 A;  3FGM A;  3ZXD A;  5BP5 A;  3Q7X A;  1BFF A;  3BB2 A;  1G9C A;  3LLP A;  1GGP B;  1KNM A;  3ILA A;  2VU9 A;  1M2T B;  1D0H A;  3Q7W A;  3BAH A;  1DJS B;  3ZXG A;  2KKI A;  4A7Z A;  5DSS B;  1IRA X;  3IIR A;  2VSE A;  2ERM A;  4XFU A;  2LIQ A;  3HN1 A;  2BEB A;  4H04 A;  4I4U A;  4LO2 C;  3BAV A;  4EFR A;  2VXT I;  1S0B A;  2DRY A;  4GOY A;  5G00 A;  2WBC A;  3W9T A;  1QQL A;  4QD2 C;  2GZB A;  4J23 B;  1F31 A;  2J3P A;  1E0O A;  3OJV A;  5EG6 C;  4JAW A;  2RST A;  3CA3 A;  1S0G A;  1V6V A;  4MZH A;  3ZC8 A;  3CRG A;  3PHZ A;  1IOB A;  1JQZ A;  1PUM B;  3CA1 A;  3FUO A;  3VSZ A;  3VT2 A;  4G6M A;  3AZW A;  3O4C A;  2NYY A;  1V6U A;  1BLD A;  3NBE A;  4GOV A;  2E4M C;  4Z8S B;  4UY4 A;  1Z2V A;  1HCE A;  2AAI B;  4I3N A;  2K43 A;  3WMU A;  2FFV A;  5D63 A;  4QO3 A;  4ZOT A;  4OUJ A;  1JT4 A;  4GP0 A;  3SNV A;  2P39 A;  4I96 A;  1TP0 A;  1M16 A;  5JMC A;  5FNW A;  4QAL A;  4I4Y A;  2ZQO A;  4J2S A;  2IWT B;  4I4V A;  4LO1 A;  3VT0 A;  3BX1 C;  1K5V A;  5I1B A;  1CVS A;  1XG6 A;  4MZG B;  1FN0 A;  3BAD A;  4I6I A;  3R4U A;  5GAQ A;  3K1X A;  3NBC A;  4CJM A;  4IQP A;  1FWU A;  3H6R B;  1BFG A;  3BA5 A;  3FJH A;  4YOL A;  2RG9 B;  4USP A;  1CE7 B;  3HMY A;  6I1B A;  2L5X A;  1L2H A;  2DRE A;  4IZE A;  2P23 A;  4OWL A;  1Z0H A;  1HCD A;  4OEE A;  4D8H A;  4Z9W B;  1XYF A;  2K4A B;  3AKH A;  1AVA C;  3RSJ A;  4FGF A;  4JQ0 A;  1WBA A;  3AH2 A;  4G6J A;  3HOM A;  1DFC A;  3FFZ A;  5EHA A;  4IZX A;  3FJE A;  4HR6 C;  4XFS A;  1TTU A;  4USO A;  1DFQ A;  2VUA A;  1FQ9 A;  2NM1 A;  2Y9X E;  3MPP G;  4X38 A;  3CA5 A;  5DUY A;  1ISX A;  5BQU A;  1FGA A;  1W3G A;  3O44 A;  2NZ9 A;  3FJ8 A;  1MC9 A;  2R9K B;  4QKS A;  2QYI B;  4I4P A;  3WA1 A;  4I2S A;  1DZC A;  4XKI A;  4DEN A;  1MD6 A;  4GP3 A;  1FMZ A;  3UJ0 A;  3BAQ A;  2BFH A;  4LO1 C;  3KMV A;  3O4A A;  4HJJ A;  4JKQ A;  5FZU A;  3RMX A;  2NTD A;  3A23 A;  3N7J A;  4I4S A;  2UUS A;  4OEF A;  3AH1 A;  2AQZ A;  3AJ5 A;  3P6J A;  3VUO A;  1G9D A;  1N4K A;  3AZV A;  2FFU A;  3RTI B;  1EPW A;  4ISR A;  3D7W B;  3QYD A;  3O4O A;  1YYN A;  4HA2 A;  1JLX A;  3NBD A;  3BTA A;  3AKF A;  2K8R A;  1HWN B;  3CAH A;  3S8K A;  1AXM A;  2NVH A;  2VXR A;  3H6Q A;  3WO2 A;  1SR4 C;  3A21 A;  4LO3 A;  1V6W A;  1I1B A;  1BLA A;  3N0K A;  1ISY A;  4LO0 C;  3RTJ B;  1K5U A;  2MLL B;  1HWO B;  5BQU C;  2XOA A;  3F62 B;  4F34 A;  5E24 E;  2VSA A;  4LO8 B;  1DZD A;  3A07 A;  4I7I A;  4OEG A;  3O5W B;  3B9U A;  3PUB A;  3FJF A;  3OJ2 A;  2KI4 A;  3NBN A;  3MAL A;  3OGG A;  1YXW A;  1FV3 A;  4J2Y A;  2RQ9 A;  4F83 A;  2F2F A;  1DLL A;  4P0J A;  1DQO A;  4END A;  3WIN A;  4H9W A;  1PUU B;  4Q91 A;  2WRY A;  2HW9 A;  3AKI A;  3O3Q A;  4J2K A;  3H6R A;  3I2X A;  4G1R A;  3RMY A;  4GAF A;  4PC4 A;  3ZC9 A;  4KEI A;  2Q3N B;  4ION A;  5HPZ A;  1NZK A;  3AH4 A;  2D22 A;  3O4D A;  4ZFY B;  5BVP I;  4I1E A;  4EFQ A;  4ZFW B;  3AJ6 A;  2FDB M;  41BI A;  1XZZ A;  4I4R A;  1IRP A;  1ISV A;  1SZ6 B;  2ZQN A;  2FO1 A;  4DEP A;  3HAL A;  3O4B A;  4LO3 C;  5FZY A;  1G9A A;  1ISZ A;  3I2A A;  4AN6 A;  2D7R A;  2M49 A;  1R8N A;  3T8S A;  2D23 A;  3P6I A;  3BRG C;  3BAU A;  1S0E A;  3OJM A;  1HKN A;  4OWK A;  4X39 A;  1S0D A;  4IY9 A;  5F8Y A;  3BAG A;  1TWM A;  1A8D A;  2D1Z A;  1UPS A;  2ZR1 B;  4TLP A;  2HWM A;  1SR4 A;  3OGF A;  5BXP A;  3VT1 A;  3FJI A;  3WO3 A;  3TC2 A;  1DIW A;  3HBW A;  4DCK C;  3N7M A;  1EV2 A;  2F2F C;  4G9N A;  4AN7 B;  4LO0 A;  4EKX B;  2D43 A;  3WIN C;  2D24 A;  1JY0 A;  2Z48 A;  4I1B A;  1JT7 A;  5DZU A;  4P6A A;  3CRI A;  2DRZ A;  2LIE A;  4QBV A;  3V0A A;  2D44 A;  3PME A;  4D0Z A;  1QXM A;  2YUG A;  1BAS A;  1BFC A;  1VCL A;  1YTO A;  4G9M A;  1AF9 A;  1JT5 A;  3BRD A;  2AFG A;  1HWP B;  1XHB A;  1TWE A;  5F8S A;  4ZLB B;  1W3F A;  4MZF B;  2FGF A;  1P63 A;  3IM7 A;  2HWA A;  3PG0 A;  4JRA A;  1JTC A;  1IHK A;  3N7K A;  4EB2 B;  3BAO A;  1JT3 A;  2HZ9 A;  4H75 A;  1ONK B;  1I1E A;  3V0A B;  1IT0 A;  3E8L C;  4II0 A;  3VSF A;  3LTQ A;  4KEJ A;  5B2H A;  4R6U B;  4X3A A;  1G82 A;  3V0B A;  4I37 A;  4KBB A;  4LO7 B;  4Q9P A;  3FJD A;  4JP0 A;  2MC2 A;  3O49 A;  1ABR B;  2ESU A;  2BEA A;  2I1B A;  2IHO A;  3QR5 A;  1S0C A;  1FV2 A;  3Q7Y A;  5DVH A;  1ISW A;  4Q9G A;  3CA4 A;  4P0L A;  3IAG C;  1HIB A;  4KC3 A;  1T9F A;  3BA4 A;  3V0B B;  4QKR A;  3P53 A;  5BOW A;  1YBI A;  4IYB A;  3H6S E;  2ET2 A;  1BAR A;  3EF2 A;  3OBT A;  4X37 A;  1II4 A;  3BRF A;  1RY7 A;  4EEE B;  5F8W A;  3BA7 A;  1W3A A;  4JKX B;  3UD8 A;  1NUN A;  3F1R A;  2Y9W C;  2NS2 A;  3FJK A;  1EVT A;  2QN4 A;  5BXT A;  4OW4 A;  2VLC A;  1ILR 1;  1FWV A;  3UD7 A;  3C9Z A;  1PC8 B;  1RZO B;  4J2X A;  4ZFU B;  4KEK A;  4LO7 C;  1EYL A;  4ISQ A;  3CU1 B;  3I29 B;  5JLV A;  2Y9F A;  31BI A;  3WMV A;  4ZBV B;  1JLY A;  5FZZ A;  4FVV A;  1BA7 A;  3NJ5 A;  3S8J A;  1OQL B;  1RML A;  7I1B A;  3CA6 A;  1IIL A;  1ITB A;  4ZA3 B;  1J0S A;  4IY8 A;  2GO2 A;  3CQA A;  3CRH A;  21BI A;  1AVU A;  4EFP A;  3FJJ A;  5BP5 C;  1G9B A;  1HWM B;  1WD4 A;  4ZGR B;  4QBC A;  4D0T A;  4WBC A;  2DS0 A;  4OWJ A;  3AKG A;  1IJT A;  2Z49 A;  3OBR A;  3FJB A;  3FJ9 A;  1Z4S A;  1WD3 A;  1S0L A;  1RG8 A;  3A22 A;  1PWA A;  2X2T A;  3ZX7 A;  3IM6 A;  2KLL A;  1DQG A;  2F8X C;  3N7L A;  1V6X A;  4I8M A;  2KI6 B;  3FJA A;  1WBC A;  3HSM A;  5EC5 A;  1Q03 A;  2MIB A;  4I4X A;  1PZZ A;  5D61 A;  5D62 A;  8I1B A;  3UDA A;  4A7Y A;  2KH2 A;  3FJC A;  4LO2 A;  1TFM B;  5BXS A;  2D7I A;  4XFT A;  2NP0 A;  4JPZ A;  3POK A;  1R8O A;  2D20 A;  5F90 A;  4IHZ A;  2Y9G A;  2AXM A;  3IM5 A;  4L4H A;  4A7K A;  1QQK A;  3VWC A;  4I4Q A;  1AVW B;  1Q1U A;  3FUQ A;  1AFC A;  3V79 C;  1TOO A;  2Q9X A;  9ILB A;  4P0K A;  3JRR A;  4ZKT B;  1TIE A;  5BXR A;  4I0Y A;  4QD2 B;  1S0F A;  3UJ4 A;  1AVX B;  2X2S A;  3UD9 A;  1BFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...