3I2ZA

Structure of cold shock protein e from salmonella typhimurium
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
SHMSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA chaperone, negative regulator of cspA transcription
publication title Crystallization and X-ray structure of cold-shock protein E from Salmonella typhimurium
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation
total genus 15
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i2zA00
2BH8A 4YHHQ 4BY7H 1V1QA 3JC66 2CKZB 2JA7G 3M4OH 1W3SA 2K4KA 1K3RA 4DV3L 5GAEC 2CCZA 4BA2I 2ES2A 1Q1BA 1N36L 4JI7L 2H5XA 1E7ZA 2NZOA 3J81c 1HR0L 1D7QA 4O2DA 5M5YH 4YCUA 4DV1L 5LMNW 1XJVA 3M9BA 2A1AA 3KOJA 2VZAA 4C3IH 3I4NG 1Q86C 1OXUA 1VQ7A 3I7FA 2UUBL 2R7FA 1QUQA 3A0JA 2NVQH 4DR7Q 4QQBX 3E0EA 2PMZE 1N33Q 4EQ5A 1IBKL 1JMCA 1FL0A 3KLWA 2Q2IA 4DV0L 2KBNA 4JI0Q 4IFDI 1Q1EA 2ZTDA 1G291 2VS1A 2HIXA 1Z47A 1HNXQ 1IYJB 2Q2HA 4A75A 1VCIA 1X9NA 2UXCL 4DV6Q 3HOWG 3PCOB 2OQKA 4LF8Q 4A3GH 3CCUA 4O0AA 2JA5G 1GO3E 1HNWQ 3HOYG 1Q7YC 1MKHA 3M4PA 4P73A 4GKJL 2NZHA 3CD6A 4A3IH 3MEFA 2PQAA 4JI4Q 3J81i 3CMEA 4X66Q 5IE8A 3S24A 1N32L 4UP8A 4JI6L 4EX5A 1OXSC 2DGYA 3PUWA 5IWAQ 4GNXB 3K81C 4LFAL 1CKNB 2CQOA 1OTCA 1PHJA 1UE5A 1YZ6A 1XMQQ 1GVPA 1PH4A 1Q12A 1KRSA 4OXPA 2XTIA 3DLLA 2VQFQ 1PVOA 1J5EQ 4IPHA 2OWOA 3ULLA 2D62A 4PZ6A 1VQNA 4GNXC 1AE2A 4IPGA 1WYDA 1AE3A 4TVAB 4FDBA 1KAWA 1T9HA 3TRZA 1PFSA 2ZM6L 1B8AA 1PH8A 1RIPA 4A3CG 3UE0A 4KHPQ 1UE1A 4LUZA 4LF5L 3ICEA 5M3MG 2K5HA 4GKKL 4P75A 4YCWA 4BY7G 2JA6H 3D0FA 1WCMH 1S72A 2OQ0A 2YV5A 4LF6L 1L1OB 4TQUS 2KHIA 1NMGA 1I6HH 1VQCA 1N34L 2B63G 4XIGS 4AYBE 3PSIA 1SLJA 2K5NA 2E2HH 3ZJYC 3KDFA 3F2DA 4JV5L 3F2CA 3VDYA 4PZ8A 4OWTB 1FJGL 1FVIA 4PZ7A 2UXDL 2VW9A 1SN8A 1DGSA 3BZKA 1S3OA 4DAMA 4JG2A 1I94L 4GLXA 4HIDA 1PH6A 3K80C 2DUDA 3H15A 2HQLA 4X64Q 3OTOQ 3I55A 5ELNA 2VL6A 3STBC 3AFQA 4A3JH 4DR5L 2IX0A 4LUVA 5IYBH 5IYCG 2E8GA 5HGQA 5C0XG 2WP8J 1Y1WH 5FLXc 2WAQG 1XNRQ 4A3GG 4A3DH 4B3SL 1P8LA 2UU9Q 3KF6B 3S15H 2E2JH 2YU9H 1I5FA 1YEZA 3G4SA 2HHHL 2UXBL 4GN4B 4NB3A 5C0XI 3ERSX 3G6EA 1I3QH 1Z9FA 2JK8A 4DR2L 2R7ZH 2EXDA 1UE7A 4JI8L 4YY3L 3ULPA 4JCVE 4GNXA 4K0KL 4DPGA 1CKNA 2ZTCA 4JI2Q 3L0OA 1Q81C 4NXML 1EWIA 3RN2A 5GADC 5JEAJ 1YJWA 3PO3G 4BXXG 4RG1A 1K8GA 2I5LX 3A5UA 1NBWA 1TXYA 1K8AC 2UUBQ 2I5MX 4OO1I 2R93G 4LNQA 4DV4Q 2QA4A 5LMUL 1IBKQ 3U58A 1UEBA 4JYAQ 1HNZL 2F3IA 2N8NA 3F1ZA 2R92H 2A8VA 2D0PA 3FP9A 4NXNL 4BY1H 3EN2A 1VQAA 4YWMA 1YHAA 1IXRA 2WB1E 5C0XJ 5LMNQ 3PIOA 1WJJA 4DR4L 3M7NA 4HIOA 4DR3L 5M3FH 1HR0W 1TWAH 3TS2A 1O7IA 2GN5A 3S1MH 2XGTA 4Y7NH 3CCQA 1KD1C 4JI1Q 5C4XH 2NVTH 4L5SA 2JA6G 1L1OA 1YIJA 2KHJA 3NENA 3T1YQ 2JEBI 2E5LQ 2QGQA 1IBLQ 5BR8Q 3J80c 1NJIC 4B3ML 2IX1A 2C35B 2UUAL 4Y52H 4HIMA 4LFAQ 4BBSH 1X6OA 4OX9Q 3E9HA 1XNQQ 1XPUA 1BVSA 4DV2Q 4HJ5A 4P71A 1CUKA 3HKZE 3CAMA 4JBJA 2R6GA 1VQ4A 2R7DA 2GVAA 4BBRH 2WAQE 1X3EA 3LGJA 2ZJPA 4XTCS 4HJ8A 4JI5Q 1GM5A 3CCVA 4DUYL 3UDIA 4LF4Q 5AJ3L 5IP9H 4DUZQ 4IFDG 1RL2A 4LFCQ 3KFUA 4PMWA 2Z6KA 3KF8B 4B3RQ 5ELOA 2JQOA 3STBD 4UY8C 2HIVA 4HIKA 1X56A 4AYBG 5HY6A 5IYBG 3B6YA 1Y1WG 4A3DG 2B3GA 3KF6A 3HOVH 1VQEA 3CCMA 1QZGA 4J15A 4C2MH 4DK3C 1J6QA 2BA1A 2FXQA 2YTXA 4DR1L 3CMAA 4UP7A 4L5RC 5C44H 3PO2H 3S16H 1X3GA 1A0IA 2R7ZG 2IY5B 1JB7A 4JBWA 3S1QH 2RHSB 3NELA 1PA6A 4B3TL 3L2PA 1X65A 2AWOA 4AQYQ 1IBMQ 2UUCL 4LF7Q 4P72A 1NY4A 1QZHA 1YJNA 4IFDJ 1TWGH 3S2DH 1HZBA 4QIWE 1VQ9A 4LF9Q 4DR6L 2RF4A 1E3PA 1P16A 4DNIA 2F4VQ 4BY1G 4QGUA 3J81j 3H0GH 2K50A 3CPFA 3NEMA 4LW1A 1V9PA 2AHOB 3TQYA 2VQEL 3TS0A 1JJGA 2Y0SE 2YYZA 4IPCA 4JI3L 5M3FG 1WI5A 2NN6I 5H1SE 5FLMG 1C7YA 4YHHL 1TWCH 1VQGA 3L7ZC 1YNXA 2V1CC 1LM0A 3CP0A 3S2HH 5C4XG 4X6AH 3CCRA 1VQ5A 3S14H 1KQSA 4YY3Q 1XMOQ 2IT1A 4AIMA 3MXNB 3UE1A 4BBSG 1VQHA 5GQOA 1PH3A 4LFBQ 1KL9A 3CQZH 2WB1G 3K8AA 1LUZA 2KENA 4KI0A 3T1HQ 2AMCB 4GLVB 3Q8DA 1NE3A 4PG3A 4BBRG 4X65Q 4DR7L 5GAGC 3OYYA 5J3BA 1N33L 2OCEA 1OXXK 1VS0A 1L1OC 1HZAA 2KCMA 1E1OA 1VQIA 2L15A 4UP9A 5JEAG 4GS3A 5IP9G 1MJEA 4NPSA 4JI0L 1EUJA 4JBMA 5C4JH 1G51A 1QVCA 2BH2A 4DV5Q 3I2ZA 1HNXL 4A93H 4A3LH 1X54A 5E7NA 3TEHB 4DV6L 4DV7Q 2A19A 1HH2P 3PIPA 4OWWB 3AEVA 4LF8L 4MNOA 3FHWA 4AH6A 1EYGA 4APVA 3BJUA 1HNWL 3HOVG 4R4IA 3HKZG 4DK6C 4A3EH 1PH1A 4IOCA 2LSSA 3CF5A 3RLNA 1W2BA 2ASBA 4JI4L 2K14A 5IYDH 2PNHA 3U4ZA 1JT8A 4RMFA 4X66L 1HZ9A 2E2IH 3A74A 4A3KH 3H3VH 5C44G 3J7ZC 4DV3Q 3CCEA 2HT1A 4A3IG 1CSPA 2Z6KC 3GTKH 5IWAL 3UDFA 2BA0A 1N36Q 4JI7Q 1G6PA 1HR0Q 2MO1A 4QJFA 5JJKA 3EBEA 4DV1Q 1VQJA 3GTOH 3HOZH 4YWKA 3AYHB 3W1BA 1XMQL 2MFIA 2GVBA 3K0XA 1KXLA 1VQ6A 1A63A 2VQFL 1J5EL 1HJPA 3WWVA 1PH7A 3PGZA 3RLOA 5IP7H 1BBUA 4JC0A 4DV0Q 1D8LA 1EIYB 4JBKA 2ID0A 4KHZA 4KHPL 2PI2A 1VQDA 3GTMH 3PUZA 5FJ8H 3RZOH 2UXCQ 1S40A 5C3EH 4HJ7A 5GROA 3SGIA 1VQLA 4H02A 4JOIA 3D31A 2IHFA 1R9TH 3RR5A 4GKJQ 2I5HA 1NTGA 1E22A 3BZCA 2CFMA 2QEXA 3OW2A 1WCMG 2KCTA 1N32Q 4L5TA 1Q8KA 3GDEA 3CPWA 4JI6Q 3UDXA 1YITA 4B3TQ 1YBYA 3AQQA 4A4IA 1U5KA 3HOXH 4POGA 3PUXA 3F8TA 4X62L 4IO9A 1NMFA 3HFZB 4GN3B 1OXVA 1PYBA 1SMXA 2Y0SG 3CC2A 1TWFH 2OTLA 4X64L 2RHQB 4YWLA 3OTOL 3CCJA 5K36G 1VQMA 1PH2A 2ZM6Q 4GLAC 4A3LG 2D0OA 3K7UC 5M5XH 5IY0A 5M3MH 3CCLA 3S17H 2MQHA 2JEAI 1M1KC 4OONA 1XNRL 5JJLA 1KRTA 3CC4A 4A3JG 4LF5Q 2UU9L 4A3MH 4A3EG 3PUVA 3M4QA 4GKKQ 5IYDG 4HJAA 1JJ2A 4YCVA 1CSQA 3J80i 4A3KG 2B63H 1CKMA 4LF6Q 5GAHC 3FKIH 2ZJRA 4JI2L 4R4QA 2VUMH 1N9WA 2WFWA 1X55A 1N34Q 1LYLA 3KDFB 3H3VI 4WJ4A 1K0RA 2AWNA 3HOZG 2JE6I 2F52A 3GTLH 1A8VA 4DV4L 3E9IA 1VQOA 4JV5Q 4JYAL 3CXCA 3CCSA 4ALPA 1FJGQ 1C9OA 2UXDQ 2CWAA 4MZ9A 3PV0A 3U50C 3I4MH 4HJ9A 2JA9A 4LUOA 5IP7G 2ATWA 1QVGA 3RN5A 4A3FH 3ER0A 2JA8H 1I94Q 2R92G 5LMNL 2N3SA 1VQFA 1IL2A 5IYCH 4GN5A 1B70B 2NN6G 5FJ8G 4MTNA 3GTJH 1C0AA 3KJOA 4DR5Q 5C3EG 1PH5A 1ASYA 4GOPB 4JI1L 1ASZA 1WFQA 4B3SQ 3T1YL 2E5LL 2HHHQ 3UDGA 1IBLL 5BR8L 3HOUH 2UXBQ 3A5ZB 4DR2Q 3RNUA 3M85A 1SRUA 2N49A 3PO3H 4OX9L 1XNQL 4BXXH 4JI8Q 1KHIA 4LWCA 2PI2E 4DV2L 4GOPC 4K0KQ 3HOXG 2K5VA 1EOVA 3KJPA 4DAYB 1VQKA 2OTJA 4NXMQ 2R93H 3G71A 2JJQA 2Q2UA 1Q82C 1U0LA 4R4CA 4JI5L 1H95A 4JOIC 4LF4L 4A3BH 2IHEA 3W1GA 1E1TA 5LMUQ 4DUZL 1K83H 1HNZQ 4LFCL 1SROA 2ZTEA 3GTPH 4B3RL 4NXNQ 1EFWA 4R4TA 4OO1G 4C3JH 3S1RH 4IJHA 3DM3A 3S1NH 4A76A 1TWHH 1LTLA 4DR4Q 4ME3A 4R1JA 1B7YB 2EIFA 2K75A 3CW2C 1Y1VH 5DLQE 4OWXB 4DR3Q 4A3MG 1XPRA 1N8RC 1UWVA 5EAYA 1UE6A 3AFPA 3NBHB 2ALYB 2JA7H 3JAMc 1AH9A 4R4OA 4DKAC 1A62A 1Y14B 3FKIG 1PH9A 1YVCA 4B3MQ 2VUMG 3PO2G 3GO5A 1XPOA 1KIXA 1K9MC 2UUAQ 2MNAA 2ZJQA 3HKSA 1QVFA 4AQYL 4X62Q 2YTVA 1IBML 2EQSA 2NVYH 3GD7A 3I56A 4LF7L 1SR3A 4WJ3M 3GTGH 3M3YH 1PYSB 3I4NH 4P74A 4LF9L 1YHQA 3I4MG 2N78A 3PF5A 1QUQB 2Q2TA 5IT9c 2F4VL 4DUYQ 3CC7A 2CWPA 4IOAA 3KYHC 5AJ3Q 2Z0SA 3U4VA 3F2BA 4A3FG 1L0WA 1FGUA 2I0QA 2JA8G 3K7AH 1OXTA 4QL5A 1IZ6A 1CKOA 1SE8A 2VY3A 1M90C 3H0GG 2LXKA 4KLKA 1GKHA 3TREA 4GOPA 3HOWH 1HZCA 1JE5A 3JAMi 2NVXH 2JA5H 1V43A 1I50H 3HOYH 2VNUD 1Q46A 3I4OA 3BU2A 2RCNA 1EQQA 1EQRA 2K52A 5M5WH 4UPAA 4QY7A 3PUYA 3W5OA 2B29A 4DR1Q 1VQPA 1XMOL 3HOUG 2PQAB 2MO0A 3PF4A 4LFBL 1KC8C 3T1HL 3J7A5 4X65L 4L5QA 2LXJA 1VQ8A 1VQBA 1YHBA 2UUCQ 3IRBA 1EIFA 1BKBA 1YI2A 3EIVA 3G48A 4A3BG 1XTDA 1GD7A 4DR6Q 1JJCB 5JJIA 4DV5L 1K73C 1WOCA 4A3CH 2AKWB 3RLFA 4IJLA 1L2FA 4DV7L 1E24A 1YJ9A 1SFOH 3GTQH 5FLMH 4IPDA 3RZDH 2YTYA 4POFA 4A93G 1PV4A 1X3FA 4BA1I 2VQEQ 4C3HH 1BBWA 4JI3Q 1MJCA 1MIUA 3ULJA 1Y1VG
chains in the Genus database with same CATH superfamily
4YHHQ 2D9UA 1V1QA 3KBGA 4OL7A 3D8GA 3D4DA 2EJFC 2K32A 2ES2A 1Q1BA 4JI7L 2H5XA 1IL8A 4I65A 5LMNW 3O13A 2A1AA 4XQNA 2Z4HA 3I4NG 2F0GA 1I6VC 1H9JA 1QUQA 3E0EA 5KYIA 4EQ5A 1IBKL 1FL0A 2G9HD 4DV0L 2NBFA 3HGBA 4Q5VA 4IFDI 2B2VA 1G291 1HNXQ 1Z47A 4A75A 1X9NA 1VCIA 2Z6BA 5CGKA 1O7YA 1E2ZA 4LF8Q 1A3VA 3URYA 1Y8NB 3GQBA 3X3MA 1HNWQ 4G7OC 3S14B 2PQAA 4H44C 3J81i 1AW7A 1LLRD 4X66Q 1NR4A 2K7VA 4JI6L 4EX5A 1OXSC 3X3NA 3ND8A 3CQZB 4LFAL 1PRTD 4WJWA 4RWSC 3PMFA 1PFNA 1Q12A 1KRSA 2KVMA 3ULLA 3HRZC 4N8X1 4PZ6A 3TBIB 4RH6A 1BOSA 1RIPA 1XWEA 2P5ZX 4FVMA 4C3HG 4A3EB 4YCWA 1Y8PB 3D0FA 2E2IB 2OQ0A 4P2CB 4LF6L 4TQUS 1TS2A 4MIUA 2F0IA 2I46A 4DK0A 3HEJA 4XIGS 4AYBE 1SLJA 2K5NA 3GTOB 3ZJYC 3KDFA 3F2DA 3R3OA 1JR0D 5J39A 4RA8A 4PZ8A 3F2CA 1FVIA 1LV9A 2VW9A 2K6AA 1A2UA 2PW7A 5K36H 4NP5A 4HIDA 3K80C 3NK9A 2B8FA 3GTMB 3I55A 1SYDA 5ELNA 3D4RA 1LABA 2IX0A 4LUVA 1SYEA 1WD1A 5IYCG 2E8GA 5C0XG 2WP8J 2ZXPA 4A3GG 1A6XA 1R9TB 1TKWB 5KRUA 3S15H 1YEZA 3G4SA 2SOBA 4EQPA 5JPMC 3ERSX 2LS01 2JK8A 2O2LD 2EXDA 1XX8A 3VR2A 4JCVE 2EE1A 4DPGA 2G9DA 2ZTCA 3TP8A 1XYIA 3L0OA 3PO3G 5JEAJ 5ELBA 3C46A 3A5UA 3TMEA 1NBWA 3SDZA 2UUBQ 1B3QA 1TWFB 1HNZL 5EPJA 4NXNL 1BF4A 4EQNA 1U4RA 1IXRA 2KEDA 5C0XJ 5CV4A 3I70A 2EYHA 3KLRA 4HIOA 3OMCA 5M3FH 2DN8A 1TWAH 2GN5A 5HGTA 1SDFA 3S1MH 2XGTA 2Z1CA 5C4XH 2NVTH 1CZGA 4L5SA 3WDNA 2JA6G 2KHJA 3T1YQ 3FKIB 2B2UC 1NAPA 5BR8Q 1NJIC 1QB5D 5BN5A 1X6OA 1XNQQ 1XPUA 3GTLB 1HA6A 2R7DA 3P1HA 2JN4A 4HJ8A 4DUYL 3UDIA 5AJ3L 4OO1H 1UNSA 1K8OA 3P20A 3KFUA 4B3RQ 1PZID 1SNOA 4KTAA 2JQOA 2B2YC 3STBD 5JVG3 5HY6A 4A3DG 4C2MH 5C6AA 1J6QA 3PO2H 3S16H 2K5DA 4JBWA 3S1QH 3VR6A 2RDGA 4AQYQ 4LF7Q 2UUCL 2H1EA 3Q6SA 4L6TB 4QIWE 2PPBC 4LF9Q 4DR6L 2RF4A 1E3PA 4QGUA 4C3JB 2ICEC 3FVQA 3NEMA 4KJNA 1V9PA 4HN7A 2VQEL 1JJGA 4JI3L 4IPCA 1B9NA 2NN6I 1HQRD 1ESFA 3L7ZC 3ONAB 1PLFA 1YNXA 2V1CC 4ILWA 1LM0A 4CDEC 1G6ZA 1VQ5A 1KQSA 3LWUA 2N88A 1JE4A 1VQHA 5GQOA 1PH3A 4LFBQ 3GTGB 1CFMA 2XWBB 3I4NB 2KENA 1WVLA 3Q8DA 1NE3A 5J1ZA 4BBRG 4X65Q 3VYUA 1B9MA 3IFTA 5J3BA 1DCZA 1N33L 2N55A 3NTIA 4C3IG 1VS0A 1LT5D 3VYTA 1LTGD 1EUJA 4A3LH 1X54A 3K5MA 4DV7Q 4OO1I 3PIPA 3MFGA 2R61A 3AEVA 4MNOA 3FHWA 2FMMA 1EU4A 1I50B 2CW0C 4IOCA 3CF5A 1W2BA 2K14A 1VF7A 1QG7A 1SNQA 1Z6HA 5C44G 3GTKH 3UDFA 4NMZA 1JWMD 4JI7Q 1CI3M 4HMJA 3K5NA 2PZTA 1K3BC 3AYHB 3W1BA 2PZWA 1Y8OB 2F0FA 1A63A 1J5EL 4ZCKA 3WWVA 4L63B 1PH7A 4CKBA 4H13C 1BBUA 4DV0Q 4JBKA 1YNND 1QNUA 3RZDB 1TS5A 2O5IC 2EYLA 4C3HB 1S40A 5C3EH 1PRTB 3SGIA 4XQQA 3M4OB 4QB4A 5J22A 2XN9C 1J9OA 2QEXA 1KAAA 2A6EC 5M5YB 4CKEA 4JI6Q 1YBYA 3NUCA 4GN3B 1A15A 1ET6A 1EWCA 1OXVA 1PYBA 1SMXA 3A7LA 2NVQB 5TSSA 1ZYRD 3CC2A 1CHPD 2NUCA 2BE5C 2RHQB 1EIHA 1Q3LA 4HSPA 4LAAA 3S17H 2JEAI 5JJLA 1XNRL 4A3GB 3R8BA 1E2VA 4I7AA 5C4ZA 5IOCA 5CV5A 3M4QA 5IYDG 1JJ2A 1CSQA 2PMZB 3J80i 3I72A 4A3KG 5G3LF 4LF6Q 1RF2D 4JI2L 1N9WA 4IN3A 4FF2A 2AWNA 3HOZG 2JE6I 1VQOA 2DJGC 2A73B 2A6HD 3CCSA 1C9OA 3ND9A 1D5XC 3U50C 3PV0A 4FNFA 5KGUA 2HD3A 5EGTA 3ER0A 4RCOA 5IYCH 4GN5A 3GTJH 4ME5A 4JK1C 4R8NA 2XVSA 3BDLA 3NE5B 4OEMB 2JA6B 1WFQA 2KECA 2FHTA 2RBMA 1HHVA 3HOUH 4G4KA 4FYDA 1STNA 2WV6D 1I6HB 1DZ1A 3NTKA 2N49A 3PO3H 4OX9L 4GOPC 4LWCA 1EIGA 2PI2E 2Y0SB 3G71A 5COYA 2JJQA 1UEAB 4JI5L 4JOIC 4A3BH 4DUZL 4DNTB 4ZKBB 1HNZQ 1M4VA 1FNVA 4K6LA 1SMYC 1F77A 2MP1A 4NXNQ 4A3JB 3KF8A 4G7ZC 3S1RH 2EPBA 1LTLA 4A3DB 3ITPA 4I7ZC 2EIFA 2K75A 4A3MG 3K57A 3E0JA 3H91A 3NBHB 2ALYB 2JA7H 1I3QB 1A3UA 2LMCB 1Y14B 2RA4A 4K5XA 4PV1C 2VUMG 4DK1A 1MSHA 2MNAA 2ZJQA 2E2DC 4X62Q 1TS4A 2EQSA 4G57A 2EVBA 4WJ3M 1EY5A 3EROA 2F0DA 2F0EA 3QOJA 5DNFA 3I4MG 2N78A 3PF5A 2F4VL 4DUYQ 2CWPA 5AJ3Q 2I0QA 2JA8G 4HR7B 4K6DA 1R4PB 2JP1A 3TREA 4KLKA 5C3WA 1JE5A 1BQQT 1V43A 2VNUD 1Q46A 1K8MA 3NXWA 3EA6A 1JOKA 2DY7A 4UPAA 1XMOL 3PUYA 2F0TA 2JYOA 3CRLC 2MO0A 4HEDA 1IW7D 1W6KA 4K14A 4DAYA 2RSOA 1PRTC 3NPPA 4BBRB 3J7A5 1AN8A 2K28A 2UUCQ 3IRBA 1GHJA 1MD2D 1YI2A 3G48A 1G91A 1DXMA 1F2YA 3TP7A 4LMQD 4DR6Q 1JJCB 4CHTB 5JJIA 1K73C 2L9HA 4ZUIA 2AKWB 4IJLA 1YJ9A 1SFOH 3GTQH 3BVZA 2IL8A 2VQEQ 1LACA 1BBWA 4JI3Q 5IGDA 2BH8A 4BY7H 1C8CA 3K5LA 2K4KA 5C44B 1LT4D 5CC4A 4BA2I 4RGMA 1RTNA 1D7QA 1ENAA 1HR0L 4O2DA 2VZAA 4C3IH 1EZ6A 1TWGB 1OXUA 4V0BA 3I7FA 2UUBL 3I90A 2PMZE 1N33Q 4JVZA 1JMCA 3I3CA 3OSOA 2KBNA 3H0GB 4MHEA 2VS1A 2Q2HA 3V96A 3HOWG 4KD3A 2JA5G 3HOYG 1LTBD 1MKHA 4GKJL 2FINB 5BN3A 3MEFA 2F0PA 1B1ZA 1N32L 3PUWA 2DGYA 1B50A 2WKDA 3K81C 2KQ3A 1CKNB 2NZ1D 2CQOA 5CV8A 1WD0A 4NDXA 1UE5A 1YZ6A 1GVPA 4F8MA 1PH4A 3DLLA 1EYAA 1J5EQ 4K2LA 1VQNA 5JVH3 1AE2A 1BUVT 1WYDA 1EYDA 4GNXC 1S5CD 1KAWA 4FDBA 1PFSA 3OIPA 1PH8A 3UE0A 1SSOA 4LF5L 1WTPA 4JW0A 4GKKL 1U4MA 4A3KB 3OOCA 3CHBD 2AQ2B 1SE3A 4RKBA 3V05A 2B2YA 3MWYW 1X3QA 2E2HH 3HOZB 2CH4W 5CR3A 2F0QA 4ABNA 1FJGL 4PZ7A 3MVVA 3NP8A 1DGSA 4XYQA 1BBXC 3TP6A 3BZKA 1XXGA 4IFDH 2XSCA 4JG2A 2J0TD 3IFDA 3STBC 3AFQA 4DR5L 3R2IA 5IYBH 1Y1WH 5HGQA 3QOLA 1XNRQ 1TY2A 2PNRC 4B3SL 1LT3D 3KF6B 2E2JH 2YU9H 1I5FA 3BVGA 4NB3A 2TMPA 3G6EA 1JQYD 4DR2L 2R7ZH 4KKUA 4JI8L 1KNEA 4K0KL 4JI2Q 1EWIA 1YJWA 1HRJA 5CV6A 1OO9B 1TXYA 2KCCA 5T1GA 3T13A 3PIO3 1EY4A 2RKSA 5LMUL 1UEBA 3NWTA 2F3IA 3Q24A 3F1ZA 3A56A 2QEJC 2K01A 5EJWA 5CBAE 4BY1H 1VQAA 2E74C 4YWMA 5LL6S 3T51B 4DF7A 4DR4L 4C3JG 3TS2A 4A3MB 1O7IA 5E3FA 1EU3A 1VF5C 2B63B 3NENA 3FDTA 1PRTF 1HTPA 3BZDB 2VUMB 2WACA 3HG9A 3ZYYX 3QWNA 4Y52H 4HIMA 2DNCA 1SJHD 4OX9Q 2RSNA 4HJ5A 2EJMA 4IALA 1VQ4A 1HXYD 5CORA 2WAQE 2ZJPA 2M2LA 5JAVA 3I4MB 2FMCA 4JI5Q 3CCVA 5IP9H 4DUZQ 1IKLA 3DUZA 2JA8B 1EFID 3FRPB 3T4AC 4PMWA 1GXDC 1D5ZC 2HIVA 2LFNA 2B3GA 3HOVH 1VQEA 4J15A 1O80A 1BR9A 3JAME 3CKIB 3AB9A 1STAA 1X32A 1EWHA 1QOHA 1SAPA 1X3GA 1EY0A 1J8IA 2R93B 2RHSB 1PA6A 1WTHA 3L2PA 1X65A 5IGBA 3K0YA 4P72A 1YJNA 4FF1A 1VQ9A 3FMCA 3GTPB 2F4VQ 1YNNC 2NB0A 3CPFA 2K33A 3S1NB 2IPKD 3TS0A 5H1SE 1VQGA 3DHQA 3CP0A 1HCZA 3MC0B 4X6AH 5ISRA 1BCPD 3S14H 1XMOQ 5DM63 4AIMA 1FR3A 1FGBD 3UE1A 4BBSG 1KL9A 2BDNA 3CQZH 1NSNS 1KABA 1LUZA 2DNEA 1NNXA 3K8AA 4RKLA 2F0SA 4PG3A 4QMGA 3SEBA 3L3OC 1GUSA 3OYYA 1MI2A 1F9SA 1HZAA 2KCMA 5JEAG 1VQIA 4GS3A 1HUMA 3G6JB 1EOTA 1CTMA 5CMDA 5E7NA 1EQVA 3HOWB 4XYOA 2QDLA 4DV6L 2A19A 2QF7A 1I4GA 1EYGA 2NVXB 2JA5B 5LHY1 3BJUA 1SYGA 1CQVA 3TZUA 3HOYB 2DJFC 3HKZG 4DK6C 4A3EH 5D3IB 1PH1A 2LSSA 2ASBA 5M5WB 1DM0B 4J6HA 1HZ9A 2E2IH 3A74A 1RTOA 1CSPA 2Z6KC 1VMCA 5IWAL 3J81E 4K8JA 1GUNA 1G6PA 1HR0Q 5JJKA 3GTOH 2GVBA 3K0XA 2A6HC 2B8GA 2H4OA 3K59A 3PGZA 3RMHA 1B3AA 4JC0A 5I4DA 4RFBA 1D8LA 2XRSD 2ID0A 3A7AB 4KHPL 2PI2A 1VQDA 4K2KA 3GTMH 2NN6H 3OMGA 3PUZA 4NKLA 1CHQD 5FJ8H 2QDBA 1LTRD 1L0YB 1SNCA 3KLSX 4JOIA 1R9TH 3BDCA 3D31A 4GKJQ 1E22A 3BZCA 2CFMA 1LTID 3OW2A 2X69A 2WB1B 1N32Q 4L5TA 3GDEA 5IODA 1YITA 3AQQA 4HSVA 1BO0A 2F0OA 4X62L 4IO9A 2Y0SG 1TWFH 4CGYB 3NBIA 3W2DA 4YWLA 1STEA 3OTOL 2D0OA 3K7UC 4CDCC 4OONA 1FD7D 4A3JG 4LF5Q 3KLSA 3LX0A 1K28A 1PDQA 2A68D 4GKKQ 4A3IB 4HJAA 3VYRA 5M9OA 3J7YW 3QIAA 3F2UA 2C9OA 5GAHC 3FKIH 2WFWA 3KDFB 1V8QA 3GTLH 4DV4L 3CXCA 1FJGQ 4GZYC 1LT6D 1TQOA 1QCBD 2JA9A 5IP7G 2ATWA 2VB3X 3RN5A 4N9TA 3LWEA 2F0JA 4QCLA 1B70B 2RDHA 1PTOD 3SHLA 4DR5Q 1ASYA 4GOPB 3WOFA 2NTSA 1WCMB 4B3SQ 1LTSD 2E5LL 2AQ3B 1IBLL 2MPMA 3A5ZB 4DR2Q 3M85A 1IW7C 2PCFB 4JI8Q 1KHIA 4DXFA 4IZ8A 4RGOS 4K0KQ 3HOXG 2OTJA 1EOVA 4C1NK 3Q23A 4QUCA 1U0LA 4R4CA 3OHXC 1H95A 4LF4L 1HTLD 1RJTA 3W1GA 5LMUQ 1AZPA 4O42A 4LFCL 1ML0D 1SROA 1EFWA 4IUUA 4C3JH 1Z7TA 4IUVA 4DGZA 5LL6X 4DR4Q 4WORA 4R1JA 4OWXB 1B7YB 3CW2C 2VXWA 1XPRA 1UWVA 3AFPA 3K6OA 1H9RA 1PMRA 1O7LA 3EFXD 1SNMA 1YVCA 1QVFA 1QNKA 1IBML 3GD7A 3M4YA 2O4XA 1KDCA 3GTGH 1S5FD 1PYSB 3I4NH 4KMUC 4F88A 2ICIA 3DXJC 5DEHA 1F2ZA 2R92B 3KYHC 2L55A 2Z0SA 4A3FG 3KK7A 1OXTA 4QL5A 2VY3A 2KCNA 3H0GG 1HZCA 4Y7NB 1II3A 1I50H 3I4OA 4NW2A 2OEOA 2RCNA 1EQRA 1GUTA 2K52A 3W5OA 5CV9A 2B29A 1GHKA 4BBSB 1SBBB 3N6RA 2M9VA 1F2LA 1B44D 1PZJD 3T56B 2FJ2A 3T1HL 1KC8C 4L5QA 1WTRA 1YHBA 1BKBA 5FKAC 3EIVA 1DONA 5IGCA 4MTKA 3OW7A 1S4ZA 4DV5L 4HTHA 1WOCA 1L2FA 1E24A 4KN4C 3RZDH 2YTYA 2IWHA 1PV4A 1X3FA 2OT2A 4C3HH 1H9SB 3HKZB 4DA2A 1MJCA 1MIUA 3ULJA 1Y1VG 1LTAD 1IYVA 3M4OH 1K3RA 5E4WC 5GAEC 2CCZA 1IHZA 5M5YH 4YCUA 4DV1L 1XJVA 3NHHA 2EDGA 3KOJA 2D2CC 4IQZA 4DFAA 1Q86C 2Q8RE 5JEAH 3S2DB 2R7FA 2NVQH 5FO9B 2G5DA 3M7GA 3KLWA 2Q2IA 2VB2X 2C5CA 1Q1EA 2ZTDA 1IYJB 4DV6Q 3TZDA 3PCOB 5C0XH 2OQKA 1TWCB 4A3GH 3CCUA 3D4WA 4O0AA 3S2HB 3M4PA 1EEFD 3DEOA 1V1PB 1KDAA 3CMEA 5ELCA 4UP8A 3DMUA 4IUQA 1JWUD 5IWAQ 4GNXB 1WTWA 1OTCA 1U9RA 3VYSA 2HDMA 3H6MA 2E75C 2F0NA 2D62A 2KHSA 2SNMA 4IPGA 5C4JB 1AE3A 4TVAB 5D14A 4A93B 3S9WA 2ZM6L 1B8AA 4FXGC 4A3CG 5C4HA 1TVXA 2SDFA 4RHSA 1JICA 1CQFA 4KHPQ 3Q0AA 3L9AX 4M1UB 1B4OA 2PZUA 3ICEA 3P75A 1GUOA 2Q8IB 1RHPA 2RCFA 1EY6A 2JA6H 2XIWA 5DM73 2KEEA 2HCCA 1S72A 1L1OB 5A35A 1KLGD 2KHIA 3A54A 1I6HH 1N34L 2B63G 3J80E 4JV5L 3W3AA 4OWTB 3J7AF 4X3KA 5KNDA 3P7JA 1WTXA 1ESRA 1ZEQX 5IGFA 1I4QA 1S3OA 4X3UA 4GLXA 1PH6A 4FP5D 1SNPA 3OTOQ 3RZOB 2VL6A 1STBA 4K8IA 4A3JH 4A3DH 4X3TA 2F0WA 3A8JE 1P8LA 1RKNA 1AZQA 3E3XA 2HHHL 1FYCA 2UXBL 3EQLC 4GN4B 2EXZA 5C0XI 1I3QH 1Z9FA 3ULPA 1KTKA 1D5MC 3OPOA 1D1IA 3BVMA 1CKNA 3E6ZX 3HOXB 3MXGA 1Q81C 4NXML 4BXXG 1I4RA 5GADC 2I5LX 1PTOB 4E6IA 2R93G 1K8AC 1JOQA 4DV4Q 1AP0A 3U58A 1NUCA 2N8NA 4XT3B 3BS1A 4TRDA 2D0PA 3FP9A 2A5HA 5M5XB 1EYCA 5M3MB 1WJJA 3M7NA 1HR0W 4CJ1B 4DAPA 1JORA 1KD1C 3U9SA 2CQAA 5KIXA 2JEBI 2E5LQ 1IBLQ 3J80c 1TU2B 1YNJD 5FO7B 2QKIC 2UUAL 1BXTA 5KNCA 3HKZE 4JBJA 2R6GA 2SNSA 3TDQA 3C1EA 2AQ1B 2CVRA 4BBRH 1X3EA 3LGJA 5I2XA 1STYA 3G7LA 1D6EC 2B39A 5C5LA 4LF4Q 2AUJD 4A3FB 1RL2A 4J1MA 4LFCQ 1GUGA 3WOEA 2Z6KA 3KF8B 1IKMA 5ELOA 2E76C 2NYZD 4UY8C 4HIKA 2D5DA 3B6YA 3KF6A 1QZGA 3DM1A 4DK3C 2BA1A 2FXQA 4DR1L 1EQTA 2EY1A 3CMAA 4KKTA 1CA5A 5C44H 2CHBD 1BDOA 1QJOA 2O5JC 3I4LA 1IBMQ 1NY4A 1TWGH 1K83B 4EQOA 5IT9E 1P16A 4DNIA 3J81j 1ENCA 4XT1B 1I4HA 3H0GH 1F2MA 2K50A 2B2UA 1GUWA 1TWHB 3TQYA 2Y0SE 2YYZA 5M3FG 1PYWD 1Y1VB 4ZLTF 5DAUA 1JOOA 1B53A 5C4XG 3DWAA 3CCRA 2EY6A 4ULLA 4ODGA 4YY3Q 1T5XD 3MXNB 2NVYB 3C1FA 3M3YB 2WB1G 4KI0A 3T1HQ 2AMCB 4GLVB 3IL8A 4DR7L 3QG1A 3H3VC 3PIP3 1L1OC 1E1OA 3TP5A 4UP9A 2K05A 4NPSA 4JI0L 4JBMA 3K7AB 1QVCA 1L0XB 4DV5Q 4PNYA 3NQTA 3K58A 3TEHB 1A3TA 5EKKA 4AH6A 2A68C 3RLNA 5IYDH 4JI4L 4RMFA 1SYCA 4ZAIA 3DWPA 4A3KH 3J7ZC 2HT1A 3CCEA 4A3IG 2PYKA 1DOLA 3HZXA 5ELDA 1D2BA 2MO1A 4QUFA 4DV1Q 1VQJA 3HOZH 4YWKA 1XMQL 2MFIA 5ELEA 2EJGC 1VQ6A 2VQFL 5A2QE 1KNAA 3CRKC 3VA5A 1SNDA 5KEEA 4KHZA 5C3XA 5KNBA 1PTOC 4U673 3D6WA 2M00A 3A8KE 4S3SA 5GROA 1VQLA 2IHFA 3RR5A 4BS9A 2F0VA 1QILA 3BYTB 1WCMG 2KCTA 1SEBD 5E1FA 1FNWA 3UDXA 4B3TQ 4HAEA 1U5KA 3PUXA 5EKLA 4Z9CB 1EL0A 1NMFA 1HFGA 2BOSA 3V2TA 1IYUA 1EY8A 5D3DA 1EY9A 4X64L 3CCJA 1PH2A 2ZM6Q 1I4XA 4RAUC 4A3LG 3CCLA 4WFN3 1M1KC 3HP3A 2EY2A 5FO8B 1BCPF 3CC4A 2UU9L 4A3MH 1SJED 3PUVA 4KD4A 3ERQA 4ZQ3A 1SYBA 2L11A 1ICWA 3TN2A 2B63H 1CKMA 2VUMH 4R4QA 1N34Q 1PXUA 1LYLA 3MXPA 2F0UA 1PFBA 4WJ4A 1K0RA 1BNZA 2F52A 3MTSA 1DOMA 4JV5Q 1CK1A 4JYAL 2CWAA 3I4MH 4HJ9A 3N52A 4LUOA 2IW3A 2JA8H 2R92G 2F0KA 4KK7A 5JJZA 3QJYA 5LMNL 2N3SA 5A2QL 2IJ0A 3C3LA 3SK4A 4MTNA 1C0AA 3KJOA 4DU9A 5EKIA 5C3EG 4JI1L 4QIWB 4LK1C 1CA6A 4YIJA 2HHHQ 2UXBQ 3EJIA 5I2YA 4BXXH 1SRUA 4DV2L 4UAIA 3SXHA 2R93H 4XXEA 3KJPA 1EZ8A 2A69D 1VQKA 4NXMQ 3EVQA 3MFYA 1HUNA 1GOZA 4UHVA 3H09A 2IHEA 2KUMA 1E1TA 1ZYRC 2ZTEA 3MHBA 3NQIA 3GTPH 4R4TA 4N9PA 3R2TA 1MHWC 1H9MA 4IJHA 3S1NH 4IUTA 4ME3A 4V190 3QO2A 3S15B 5EAYA 1UE6A 1KLUD 4FXKC 2PQEA 1MSGA 2HQEA 3JAMc 1RDPD 1WTVA 1QE6A 1PH9A 3GO5A 2UUAQ 1KIXA 2YTVA 1MBYA 2L1BA 1SR3A 2F0MA 1ZKOA 3JAML 3BDOA 1W6JA 4P74A 1YHQA 1QUQB 3DEPA 3SK6A 3U4VA 3F2BA 1JB3A 1CKOA 1M90C 1SE8A 5M3FB 1JWSD 1TWAB 2LXKA 5D65A 3HOWH 4GOPA 3S1MB 2JSOA 4JPBW 2NVXH 1K0SA 2JA5H 3HOYH 2NVTB 5C4XB 3BU2A 2B2WC 5M5WH 2B2TC 4QY7A 4DR1Q 1O78A 3HOUG 2PQAB 4FF4A 2MJ8A 2ENBA 2LXJA 1RODA 4OHJA 2OXPA 2IX3A 4A3BG 4BWGB 1LO5D 1XTDA 1PTOF 3OWEB 4ZYSA 4TKOB 1EY7A 1Y69U 4G7HC 2EZVA 1WTOA 4IPDA 4A93G 4FXDA 4BA1I 4OIJA 3U9OA 4C2MB 2Z4IA 1GJXA 3JC66 2CKZB 1CT1D 2JA7G 1W3SA 3A55A 3S16B 3PO2B 4DV3L 5FK9C 1N36L 3S1QB 1E7ZA 2NZOA 3J81c 2F3VA 1TY0A 2BCOA 3M9BA 2RVLA 2JXMB 1VQ7A 3A8IE 3AMUA 5CV7A 4DR7Q 3A0JA 4QQBX 3J81L 1DOKA 3K5OA 4JI0Q 2HIXA 2UXCL 5CYUA 5CBEE 1GO3E 2QCPX 1Q7YC 4P73A 5FLXE 2NZHA 3CD6A 4A3IH 4JI4Q 5IE8A 4CJ0B 1STGA 3S24A 1ILPA 5L37A 3VR4A 4EVOA 1S5ED 2HUGA 1NCVA 2OF1A 1PHJA 4J8QA 1XMQQ 2K5QA 4OXPA 3PQIA 2XTIA 4UDUC 4XDXA 2VQFQ 1PVOA 4IPHA 2OWOA 3CU7A 5IGEA 1F9RA 3MZ5A 5KYLA 1T9HA 3TRZA 2WINB 1VDZA 2ZXRA 1AEXA 1H9SA 1UE1A 4LUZA 1UAPA 4KY6A 5M3MG 2K5HA 3E5SA 2MGSA 4P75A 3IAYA 4BY7G 1WCMH 4B08A 2YV5A 2MUYA 3GTKB 1YNJC 1NMGA 1VQCA 1H9KA 3PSIA 1U4LA 2WKCA 3VDYA 2UXDL 4PMCA 3GV6A 1SN8A 2AUKA 2PW5A 2HCIA 1F9PA 4DAMA 1I94L 2DUDA 5E4XA 3H15A 2F03A 2HQLA 4X64Q 4L8JA 1NR2A 5C3EB 2CH4A 2X6LA 4B9WA 5FLXc 2WAQG 1V1PA 1A2TA 4HCSA 2UU9Q 4CKCA 1C48A 5JPNC 1RCVD 1E0BA 1UE7A 4YY3L 2B2VC 4GNXA 4R9WA 5FLXL 3RN2A 1STHA 4RG1A 1K8GA 3I8ZA 2I5MX 4H7BA 4LNQA 2QA4A 3NWSA 1R4QB 1IBKQ 4JYAQ 3SK8A 2R92H 5NUCA 1TR5A 2A8VA 3EN2A 4ZUJA 3QB3A 4TSSA 1YHAA 3T16A 2WB1E 3S17B 5LMNQ 1C4QA 1BCPB 5JOBA 3PIOA 4KY5A 1ICFB 4DR3L 1DJRD 4HMIA 2A74C 4Y7NH 3CCQA 5C5MA 4JI1Q 1L1OA 3NBHA 1YIJA 2F0LA 1QWYA 2QGQA 2PO4A 4ID6A 2RDFA 3DWQA 4K5WA 4B3ML 2IX1A 1G8ZD 2C35B 4LFAQ 4BBSH 4FO2A 3E9HA 5IGGA 1BVSA 3I73A 4DV2Q 4P71A 1CUKA 3CAMA 5IIFA 4RHRA 2GVAA 3TSSA 3RUZA 4KV6A 4XTCS 5T1IA 1GM5A 5ELFA 3FPPA 4IFDG 3QR8A 1JCKB 3GTJB 1X56A 4B9XA 4AYBG 5IYBG 1Y1WG 2V4DA 1CM9A 3CCMA 1LTTD 2EYJA 1ZXTA 4ZKCB 2YTXA 4IURA 3HOUB 2X6GA 4UP7A 4WRDA 4L5RC 3PO3B 1V1OA 2R7ZG 1A0IA 2IY5B 1B2TA 1JB7A 3I91A 3RD4A 3NELA 4B3TL 4LJZC 4OGQC 2KOLA 4IUNA 2AWOA 1QZHA 2K04A 4A3BB 4IFDJ 1TT2A 3S2DH 1HZBA 2RQXA 1X3PA 4BY1G 1TIID 3S1RB 4IUPA 1MGSA 4KJOA 2AHOB 4LW1A 1D1KA 2BDOA 1WI5A 5FLMG 1C7YA 2Q8TA 1TWCH 4YHHL 2XNAC 2JA7B 3SVMA 1ENFA 3S2HH 1FNUA 1SXTA 3AU7A 5F2DA 2L12A 2IT1A 3HS0C 5HURA 2QILA 1SYFA 4OELB 5G3LD 3OWFA 2XRQD 5GAGC 3NSWA 3FPUB 1M8AA 2OCEA 1OXXK 4H0LC 2L15A 4F7XA 1MJEA 5IP9G 5EPKA 5C4JH 1G51A 2BH2A 1HNXL 3I2ZA 4A93H 4CJ2C 2NWGA 2J7ZA 4C56C 1HH2P 1Q90A 4OWWB 4FF3A 4LF8L 3UI2A 4APVA 1HNWL 3HOVG 1SE4A 4R4IA 1U4PA 3BYYB 1JT8A 2PNHA 3U4ZA 4X66L 3H3VH 3R93A 4DV3Q 3VA7A 3J7AV 2BA0A 1N36Q 5EQ0A 3GP7A 1KDBA 4QJFA 3NTHA 3EBEA 5I6WA 4RGTA 2EYOA 1KXLA 4XQJA 4C1NI 1G2SA 4ZRZA 1HJPA 2FFKB 4Q0FA 3RLOA 3VR5A 5IP7H 2K03A 3MXUA 2LY7A 1EIYB 1SFOB 3GTQB 3GV3A 3RZOH 1XTCD 4HCEA 2UXCQ 4HJ7A 2F4IA 4BY7B 4DN4M 4KN7C 2KA7A 4H02A 2I5HA 1NTGA 4KKSA 5EBCA 3MXNA 1BCPC 5BN4A 1Q8KA 4R8IA 3CPWA 3KBXA 4POGA 4A4IA 3HOXH 2A69C 1PZKD 3F8TA 4C3IB 3HFZB 1T5EA 1PTOH 1S5DD 5K5PA 1AFPA 1DD2A 4O1NA 2OTLA 1E2WA 3J80L 4F87A 3T53B 2R3ZA 2XWJB 3OIQA 1VQMA 5K36G 4GLAC 5M5XH 5IY0A 5M3MH 2MQHA 4X3SA 2WAQB 1ILQA 1ET9A 2F0HA 2K5WA 2ZT9C 2KJXA 1KRTA 5EBDA 2CW0D 4A3EG 2I07B 2LKVA 1JC7A 4YCVA 4CBVA 4DAVA 1G2TA 2EYFA 5AFWA 2ZJRA 1X55A 3H3VI 1RD9D 4EGVA 1F9QA 1ONLA 4ZK9B 1TS3A 1A8VA 3E9IA 1O7ZA 3SK5A 3MEHA 4RGNA 4ALPA 2UXDQ 4MZ9A 1HQMC 2B2WA 2B2TA 4MN3A 1QVGA 1WTQA 4DXGA 4A3FH 4KY7A 1I94Q 4U68A 1SE2A 1VQFA 1IL2A 2EOTA 5I6YA 1S5BD 2NN6G 5FJ8G 3VR3A 4CDDC 1I4PA 1PH5A 1ASZA 2F3WA 2TSSA 3T1YL 2K1BA 3UDGA 5BR8L 1UUPA 3SR1A 3RNUA 1XNQL 2A6ED 2E2HB 2L4NA 3D3RA 2K5VA 4DAYB 3H94A 2Q2UA 4KHVA 1Q82C 3MA2B 1PFMA 2NTTA 1K83H 2BE5D 4B3RL 4N8FA 4OO1G 1EEID 5EPLA 3DM3A 4AYBB 4A76A 1TWHH 4CDFC 1Y1WB 1DYQA 5DLQE 4DR3Q 1Y1VH 2L0CA 1N8RC 2YU9B 2E2JB 2L5TA 1AH9A 4R4OA 4DKAC 2R7ZB 2SEBD 3FEWX 1A62A 3FKIG 4B3MQ 3PO2G 1XPOA 1K9MC 3HKSA 4AQYL 4LF7L 3SE0A 2NVYH 3I56A 3M3YH 2QW7A 3Q22A 4LF9L 1HA5A 3LNNA 4OIKA 2Q2TA 5IT9c 4BY1B 4IOAA 3CC7A 4M8AA 5FOBB 2EYMA 1L0WA 1FGUA 3K7AH 2Z8LA 4K5VA 2Z9HA 1IZ6A 4PQXA 2F1MA 1GKHA 1CZWA 2WIIB 3MAQA 3JAMi 5IT9L 3C2PA 1EQQA 1VMPA 3D6CA 4PMBA 1VQPA 2GA4B 4DNRB 3PF4A 1HPCA 4LFBL 2ZXOA 2HDLA 4QF4A 1HFNA 3BG3A 4X65L 1VQ8A 5I9OA 2EY5A 1VQBA 1EIFA 3KUPA 1Q8IA 1GD7A 1SMYD 4A3CH 3RLFA 4DV7L 5I9PA 5FLMH 2EYPA 4POFA 3IKJA 4RCNA 3HOVB 2MHVA 2J4XA 2DY8A
chains in the Genus database with same CATH topology
2BH8A 4YHHQ 4BY7H 1V1QA 3JC66 2CKZB 2JA7G 3M4OH 1W3SA 2K4KA 1K3RA 4DV3L 5GAEC 2CCZA 4BA2I 2ES2A 1Q1BA 1N36L 4JI7L 2H5XA 1E7ZA 2NZOA 3J81c 1HR0L 1D7QA 4O2DA 5M5YH 4YCUA 4DV1L 5LMNW 1XJVA 3M9BA 2A1AA 3KOJA 2VZAA 4C3IH 3I4NG 1Q86C 1OXUA 1VQ7A 3I7FA 2UUBL 2R7FA 1QUQA 3A0JA 2NVQH 4DR7Q 4QQBX 3E0EA 2PMZE 1N33Q 4EQ5A 1IBKL 1JMCA 1FL0A 3KLWA 2Q2IA 4DV0L 2KBNA 4JI0Q 4IFDI 1Q1EA 2ZTDA 1G291 2VS1A 2HIXA 1Z47A 1HNXQ 1IYJB 2Q2HA 4A75A 1VCIA 1X9NA 2UXCL 4DV6Q 3HOWG 3PCOB 2OQKA 4LF8Q 4A3GH 3CCUA 4O0AA 2JA5G 1GO3E 1HNWQ 3HOYG 1Q7YC 1MKHA 3M4PA 4P73A 4GKJL 2NZHA 3CD6A 4A3IH 3MEFA 2PQAA 4JI4Q 3J81i 3CMEA 4X66Q 5IE8A 3S24A 1N32L 4UP8A 4JI6L 4EX5A 1OXSC 2DGYA 3PUWA 5IWAQ 4GNXB 3K81C 4LFAL 1CKNB 2CQOA 1OTCA 1PHJA 1UE5A 1YZ6A 1XMQQ 1GVPA 1PH4A 1Q12A 1KRSA 4OXPA 2XTIA 3DLLA 2VQFQ 1PVOA 1J5EQ 4IPHA 2OWOA 3ULLA 2D62A 4PZ6A 1VQNA 4GNXC 1AE2A 4IPGA 1WYDA 1AE3A 4TVAB 4FDBA 1KAWA 1T9HA 3TRZA 1PFSA 2ZM6L 1B8AA 1PH8A 1RIPA 4A3CG 3UE0A 4KHPQ 1UE1A 4LUZA 4LF5L 3ICEA 5M3MG 2K5HA 4GKKL 4P75A 4YCWA 4BY7G 2JA6H 3D0FA 1WCMH 1S72A 2OQ0A 2YV5A 4LF6L 1L1OB 4TQUS 2KHIA 1NMGA 1I6HH 1VQCA 1N34L 2B63G 4XIGS 4AYBE 3PSIA 1SLJA 2K5NA 2E2HH 3ZJYC 3KDFA 3F2DA 4JV5L 3F2CA 3VDYA 4PZ8A 4OWTB 1FJGL 1FVIA 4PZ7A 2UXDL 2VW9A 1SN8A 1DGSA 3BZKA 1S3OA 4DAMA 4JG2A 1I94L 4GLXA 4HIDA 1PH6A 3K80C 2DUDA 3H15A 2HQLA 4X64Q 3OTOQ 3I55A 5ELNA 2VL6A 3STBC 3AFQA 4A3JH 4DR5L 2IX0A 4LUVA 5IYBH 5IYCG 2E8GA 5HGQA 5C0XG 2WP8J 1Y1WH 5FLXc 2WAQG 1XNRQ 4A3GG 4A3DH 4B3SL 1P8LA 2UU9Q 3KF6B 3S15H 2E2JH 2YU9H 1I5FA 1YEZA 3G4SA 2HHHL 2UXBL 4GN4B 4NB3A 5C0XI 3ERSX 3G6EA 1I3QH 1Z9FA 2JK8A 4DR2L 2R7ZH 2EXDA 1UE7A 4JI8L 4YY3L 3ULPA 4JCVE 4GNXA 4K0KL 4DPGA 1CKNA 2ZTCA 4JI2Q 3L0OA 1Q81C 4NXML 1EWIA 3RN2A 5GADC 5JEAJ 1YJWA 3PO3G 4BXXG 4RG1A 1K8GA 2I5LX 3A5UA 1NBWA 1TXYA 1K8AC 2UUBQ 2I5MX 4OO1I 2R93G 4LNQA 4DV4Q 2QA4A 5LMUL 1IBKQ 3U58A 1UEBA 4JYAQ 1HNZL 2F3IA 2N8NA 3F1ZA 2R92H 2A8VA 2D0PA 3FP9A 4NXNL 4BY1H 3EN2A 1VQAA 4YWMA 1YHAA 1IXRA 2WB1E 5C0XJ 5LMNQ 3PIOA 1WJJA 4DR4L 3M7NA 4HIOA 4DR3L 5M3FH 1HR0W 1TWAH 3TS2A 1O7IA 2GN5A 3S1MH 2XGTA 4Y7NH 3CCQA 1KD1C 4JI1Q 5C4XH 2NVTH 4L5SA 2JA6G 1L1OA 1YIJA 2KHJA 3NENA 3T1YQ 2JEBI 2E5LQ 2QGQA 1IBLQ 5BR8Q 3J80c 1NJIC 4B3ML 2IX1A 2C35B 2UUAL 4Y52H 4HIMA 4LFAQ 4BBSH 1X6OA 4OX9Q 3E9HA 1XNQQ 1XPUA 1BVSA 4DV2Q 4HJ5A 4P71A 1CUKA 3HKZE 3CAMA 4JBJA 2R6GA 1VQ4A 2R7DA 2GVAA 4BBRH 2WAQE 1X3EA 3LGJA 2ZJPA 4XTCS 4HJ8A 4JI5Q 1GM5A 3CCVA 4DUYL 3UDIA 4LF4Q 5AJ3L 5IP9H 4DUZQ 4IFDG 1RL2A 4LFCQ 3KFUA 4PMWA 2Z6KA 3KF8B 4B3RQ 5ELOA 2JQOA 3STBD 4UY8C 2HIVA 4HIKA 1X56A 4AYBG 5HY6A 5IYBG 3B6YA 1Y1WG 4A3DG 2B3GA 3KF6A 3HOVH 1VQEA 3CCMA 1QZGA 4J15A 4C2MH 4DK3C 1J6QA 2BA1A 2FXQA 2YTXA 4DR1L 3CMAA 4UP7A 4L5RC 5C44H 3PO2H 3S16H 1X3GA 1A0IA 2R7ZG 2IY5B 1JB7A 4JBWA 3S1QH 2RHSB 3NELA 1PA6A 4B3TL 3L2PA 1X65A 2AWOA 4AQYQ 1IBMQ 2UUCL 4LF7Q 4P72A 1NY4A 1QZHA 1YJNA 4IFDJ 1TWGH 3S2DH 1HZBA 4QIWE 1VQ9A 4LF9Q 4DR6L 2RF4A 1E3PA 1P16A 4DNIA 2F4VQ 4BY1G 4QGUA 3J81j 3H0GH 2K50A 3CPFA 3NEMA 4LW1A 1V9PA 2AHOB 3TQYA 2VQEL 3TS0A 1JJGA 2Y0SE 2YYZA 4IPCA 4JI3L 5M3FG 1WI5A 2NN6I 5H1SE 5FLMG 1C7YA 4YHHL 1TWCH 1VQGA 3L7ZC 1YNXA 2V1CC 1LM0A 3CP0A 3S2HH 5C4XG 4X6AH 3CCRA 1VQ5A 3S14H 1KQSA 4YY3Q 1XMOQ 2IT1A 4AIMA 3MXNB 3UE1A 4BBSG 1VQHA 5GQOA 1PH3A 4LFBQ 1KL9A 3CQZH 2WB1G 3K8AA 1LUZA 2KENA 4KI0A 3T1HQ 2AMCB 4GLVB 3Q8DA 1NE3A 4PG3A 4BBRG 4X65Q 4DR7L 5GAGC 3OYYA 5J3BA 1N33L 2OCEA 1OXXK 1VS0A 1L1OC 1HZAA 2KCMA 1E1OA 1VQIA 2L15A 4UP9A 5JEAG 4GS3A 5IP9G 1MJEA 4NPSA 4JI0L 1EUJA 4JBMA 5C4JH 1G51A 1QVCA 2BH2A 4DV5Q 3I2ZA 1HNXL 4A93H 4A3LH 1X54A 5E7NA 3TEHB 4DV6L 4DV7Q 2A19A 1HH2P 3PIPA 4OWWB 3AEVA 4LF8L 4MNOA 3FHWA 4AH6A 1EYGA 4APVA 3BJUA 1HNWL 3HOVG 4R4IA 3HKZG 4DK6C 4A3EH 1PH1A 4IOCA 2LSSA 3CF5A 3RLNA 1W2BA 2ASBA 4JI4L 2K14A 5IYDH 2PNHA 3U4ZA 1JT8A 4RMFA 4X66L 1HZ9A 2E2IH 3A74A 4A3KH 3H3VH 5C44G 3J7ZC 4DV3Q 3CCEA 2HT1A 4A3IG 1CSPA 2Z6KC 3GTKH 5IWAL 3UDFA 2BA0A 1N36Q 4JI7Q 1G6PA 1HR0Q 2MO1A 4QJFA 5JJKA 3EBEA 4DV1Q 1VQJA 3GTOH 3HOZH 4YWKA 3AYHB 3W1BA 1XMQL 2MFIA 2GVBA 3K0XA 1KXLA 1VQ6A 1A63A 2VQFL 1J5EL 1HJPA 3WWVA 1PH7A 3PGZA 3RLOA 5IP7H 1BBUA 4JC0A 4DV0Q 1D8LA 1EIYB 4JBKA 2ID0A 4KHZA 4KHPL 2PI2A 1VQDA 3GTMH 3PUZA 5FJ8H 3RZOH 2UXCQ 1S40A 5C3EH 4HJ7A 5GROA 3SGIA 1VQLA 4H02A 4JOIA 3D31A 2IHFA 1R9TH 3RR5A 4GKJQ 2I5HA 1NTGA 1E22A 3BZCA 2CFMA 2QEXA 3OW2A 1WCMG 2KCTA 1N32Q 4L5TA 1Q8KA 3GDEA 3CPWA 4JI6Q 3UDXA 1YITA 4B3TQ 1YBYA 3AQQA 4A4IA 1U5KA 3HOXH 4POGA 3PUXA 3F8TA 4X62L 4IO9A 1NMFA 3HFZB 4GN3B 1OXVA 1PYBA 1SMXA 2Y0SG 3CC2A 1TWFH 2OTLA 4X64L 2RHQB 4YWLA 3OTOL 3CCJA 5K36G 1VQMA 1PH2A 2ZM6Q 4GLAC 4A3LG 2D0OA 3K7UC 5M5XH 5IY0A 5M3MH 3CCLA 3S17H 2MQHA 2JEAI 1M1KC 4OONA 1XNRL 5JJLA 1KRTA 3CC4A 4A3JG 4LF5Q 2UU9L 4A3MH 4A3EG 3PUVA 3M4QA 4GKKQ 5IYDG 4HJAA 1JJ2A 4YCVA 1CSQA 3J80i 4A3KG 2B63H 1CKMA 4LF6Q 5GAHC 3FKIH 2ZJRA 4JI2L 4R4QA 2VUMH 1N9WA 2WFWA 1X55A 1N34Q 1LYLA 3KDFB 3H3VI 4WJ4A 1K0RA 2AWNA 3HOZG 2JE6I 2F52A 3GTLH 1A8VA 4DV4L 3E9IA 1VQOA 4JV5Q 4JYAL 3CXCA 3CCSA 4ALPA 1FJGQ 1C9OA 2UXDQ 2CWAA 4MZ9A 3PV0A 3U50C 3I4MH 4HJ9A 2JA9A 4LUOA 5IP7G 2ATWA 1QVGA 3RN5A 4A3FH 3ER0A 2JA8H 1I94Q 2R92G 5LMNL 2N3SA 1VQFA 1IL2A 5IYCH 4GN5A 1B70B 2NN6G 5FJ8G 4MTNA 3GTJH 1C0AA 3KJOA 4DR5Q 5C3EG 1PH5A 1ASYA 4GOPB 4JI1L 1ASZA 1WFQA 4B3SQ 3T1YL 2E5LL 2HHHQ 3UDGA 1IBLL 5BR8L 3HOUH 2UXBQ 3A5ZB 4DR2Q 3RNUA 3M85A 1SRUA 2N49A 3PO3H 4OX9L 1XNQL 4BXXH 4JI8Q 1KHIA 4LWCA 2PI2E 4DV2L 4GOPC 4K0KQ 3HOXG 2K5VA 1EOVA 3KJPA 4DAYB 1VQKA 2OTJA 4NXMQ 2R93H 3G71A 2JJQA 2Q2UA 1Q82C 1U0LA 4R4CA 4JI5L 1H95A 4JOIC 4LF4L 4A3BH 2IHEA 3W1GA 1E1TA 5LMUQ 4DUZL 1K83H 1HNZQ 4LFCL 1SROA 2ZTEA 3GTPH 4B3RL 4NXNQ 1EFWA 4R4TA 4OO1G 4C3JH 3S1RH 4IJHA 3DM3A 3S1NH 4A76A 1TWHH 1LTLA 4DR4Q 4ME3A 4R1JA 1B7YB 2EIFA 2K75A 3CW2C 1Y1VH 5DLQE 4OWXB 4DR3Q 4A3MG 1XPRA 1N8RC 1UWVA 5EAYA 1UE6A 3AFPA 3NBHB 2ALYB 2JA7H 3JAMc 1AH9A 4R4OA 4DKAC 1A62A 1Y14B 3FKIG 1PH9A 1YVCA 4B3MQ 2VUMG 3PO2G 3GO5A 1XPOA 1KIXA 1K9MC 2UUAQ 2MNAA 2ZJQA 3HKSA 1QVFA 4AQYL 4X62Q 2YTVA 1IBML 2EQSA 2NVYH 3GD7A 3I56A 4LF7L 1SR3A 4WJ3M 3GTGH 3M3YH 1PYSB 3I4NH 4P74A 4LF9L 1YHQA 3I4MG 2N78A 3PF5A 1QUQB 2Q2TA 5IT9c 2F4VL 4DUYQ 3CC7A 2CWPA 4IOAA 3KYHC 5AJ3Q 2Z0SA 3U4VA 3F2BA 4A3FG 1L0WA 1FGUA 2I0QA 2JA8G 3K7AH 1OXTA 4QL5A 1IZ6A 1CKOA 1SE8A 2VY3A 1M90C 3H0GG 2LXKA 4KLKA 1GKHA 3TREA 4GOPA 3HOWH 1HZCA 1JE5A 3JAMi 2NVXH 2JA5H 1V43A 1I50H 3HOYH 2VNUD 1Q46A 3I4OA 3BU2A 2RCNA 1EQQA 1EQRA 2K52A 5M5WH 4UPAA 4QY7A 3PUYA 3W5OA 2B29A 4DR1Q 1VQPA 1XMOL 3HOUG 2PQAB 2MO0A 3PF4A 4LFBL 1KC8C 3T1HL 3J7A5 4X65L 4L5QA 2LXJA 1VQ8A 1VQBA 1YHBA 2UUCQ 3IRBA 1EIFA 1BKBA 1YI2A 3EIVA 3G48A 4A3BG 1XTDA 1GD7A 4DR6Q 1JJCB 5JJIA 4DV5L 1K73C 1WOCA 4A3CH 2AKWB 3RLFA 4IJLA 1L2FA 4DV7L 1E24A 1YJ9A 1SFOH 3GTQH 5FLMH 4IPDA 3RZDH 2YTYA 4POFA 4A93G 1PV4A 1X3FA 4BA1I 2VQEQ 4C3HH 1BBWA 4JI3Q 1MJCA 1MIUA 3ULJA 1Y1VG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH8 A;  4YHH Q;  4BY7 H;  1V1Q A;  3JC6 6;  2CKZ B;  2JA7 G;  3M4O H;  1W3S A;  2K4K A;  1K3R A;  4DV3 L;  5GAE C;  2CCZ A;  4BA2 I;  2ES2 A;  1Q1B A;  1N36 L;  4JI7 L;  2H5X A;  1E7Z A;  2NZO A;  3J81 c;  1HR0 L;  1D7Q A;  4O2D A;  5M5Y H;  4YCU A;  4DV1 L;  5LMN W;  1XJV A;  3M9B A;  2A1A A;  3KOJ A;  2VZA A;  4C3I H;  3I4N G;  1Q86 C;  1OXU A;  1VQ7 A;  3I7F A;  2UUB L;  2R7F A;  1QUQ A;  3A0J A;  2NVQ H;  4DR7 Q;  4QQB X;  3E0E A;  2PMZ E;  1N33 Q;  4EQ5 A;  1IBK L;  1JMC A;  1FL0 A;  3KLW A;  2Q2I A;  4DV0 L;  2KBN A;  4JI0 Q;  4IFD I;  1Q1E A;  2ZTD A;  1G29 1;  2VS1 A;  2HIX A;  1Z47 A;  1HNX Q;  1IYJ B;  2Q2H A;  4A75 A;  1VCI A;  1X9N A;  2UXC L;  4DV6 Q;  3HOW G;  3PCO B;  2OQK A;  4LF8 Q;  4A3G H;  3CCU A;  4O0A A;  2JA5 G;  1GO3 E;  1HNW Q;  3HOY G;  1Q7Y C;  1MKH A;  3M4P A;  4P73 A;  4GKJ L;  2NZH A;  3CD6 A;  4A3I H;  3MEF A;  2PQA A;  4JI4 Q;  3J81 i;  3CME A;  4X66 Q;  5IE8 A;  3S24 A;  1N32 L;  4UP8 A;  4JI6 L;  4EX5 A;  1OXS C;  2DGY A;  3PUW A;  5IWA Q;  4GNX B;  3K81 C;  4LFA L;  1CKN B;  2CQO A;  1OTC A;  1PHJ A;  1UE5 A;  1YZ6 A;  1XMQ Q;  1GVP A;  1PH4 A;  1Q12 A;  1KRS A;  4OXP A;  2XTI A;  3DLL A;  2VQF Q;  1PVO A;  1J5E Q;  4IPH A;  2OWO A;  3ULL A;  2D62 A;  4PZ6 A;  1VQN A;  4GNX C;  1AE2 A;  4IPG A;  1WYD A;  1AE3 A;  4TVA B;  4FDB A;  1KAW A;  1T9H A;  3TRZ A;  1PFS A;  2ZM6 L;  1B8A A;  1PH8 A;  1RIP A;  4A3C G;  3UE0 A;  4KHP Q;  1UE1 A;  4LUZ A;  4LF5 L;  3ICE A;  5M3M G;  2K5H A;  4GKK L;  4P75 A;  4YCW A;  4BY7 G;  2JA6 H;  3D0F A;  1WCM H;  1S72 A;  2OQ0 A;  2YV5 A;  4LF6 L;  1L1O B;  4TQU S;  2KHI A;  1NMG A;  1I6H H;  1VQC A;  1N34 L;  2B63 G;  4XIG S;  4AYB E;  3PSI A;  1SLJ A;  2K5N A;  2E2H H;  3ZJY C;  3KDF A;  3F2D A;  4JV5 L;  3F2C A;  3VDY A;  4PZ8 A;  4OWT B;  1FJG L;  1FVI A;  4PZ7 A;  2UXD L;  2VW9 A;  1SN8 A;  1DGS A;  3BZK A;  1S3O A;  4DAM A;  4JG2 A;  1I94 L;  4GLX A;  4HID A;  1PH6 A;  3K80 C;  2DUD A;  3H15 A;  2HQL A;  4X64 Q;  3OTO Q;  3I55 A;  5ELN A;  2VL6 A;  3STB C;  3AFQ A;  4A3J H;  4DR5 L;  2IX0 A;  4LUV A;  5IYB H;  5IYC G;  2E8G A;  5HGQ A;  5C0X G;  2WP8 J;  1Y1W H;  5FLX c;  2WAQ G;  1XNR Q;  4A3G G;  4A3D H;  4B3S L;  1P8L A;  2UU9 Q;  3KF6 B;  3S15 H;  2E2J H;  2YU9 H;  1I5F A;  1YEZ A;  3G4S A;  2HHH L;  2UXB L;  4GN4 B;  4NB3 A;  5C0X I;  3ERS X;  3G6E A;  1I3Q H;  1Z9F A;  2JK8 A;  4DR2 L;  2R7Z H;  2EXD A;  1UE7 A;  4JI8 L;  4YY3 L;  3ULP A;  4JCV E;  4GNX A;  4K0K L;  4DPG A;  1CKN A;  2ZTC A;  4JI2 Q;  3L0O A;  1Q81 C;  4NXM L;  1EWI A;  3RN2 A;  5GAD C;  5JEA J;  1YJW A;  3PO3 G;  4BXX G;  4RG1 A;  1K8G A;  2I5L X;  3A5U A;  1NBW A;  1TXY A;  1K8A C;  2UUB Q;  2I5M X;  4OO1 I;  2R93 G;  4LNQ A;  4DV4 Q;  2QA4 A;  5LMU L;  1IBK Q;  3U58 A;  1UEB A;  4JYA Q;  1HNZ L;  2F3I A;  2N8N A;  3F1Z A;  2R92 H;  2A8V A;  2D0P A;  3FP9 A;  4NXN L;  4BY1 H;  3EN2 A;  1VQA A;  4YWM A;  1YHA A;  1IXR A;  2WB1 E;  5C0X J;  5LMN Q;  3PIO A;  1WJJ A;  4DR4 L;  3M7N A;  4HIO A;  4DR3 L;  5M3F H;  1HR0 W;  1TWA H;  3TS2 A;  1O7I A;  2GN5 A;  3S1M H;  2XGT A;  4Y7N H;  3CCQ A;  1KD1 C;  4JI1 Q;  5C4X H;  2NVT H;  4L5S A;  2JA6 G;  1L1O A;  1YIJ A;  2KHJ A;  3NEN A;  3T1Y Q;  2JEB I;  2E5L Q;  2QGQ A;  1IBL Q;  5BR8 Q;  3J80 c;  1NJI C;  4B3M L;  2IX1 A;  2C35 B;  2UUA L;  4Y52 H;  4HIM A;  4LFA Q;  4BBS H;  1X6O A;  4OX9 Q;  3E9H A;  1XNQ Q;  1XPU A;  1BVS A;  4DV2 Q;  4HJ5 A;  4P71 A;  1CUK A;  3HKZ E;  3CAM A;  4JBJ A;  2R6G A;  1VQ4 A;  2R7D A;  2GVA A;  4BBR H;  2WAQ E;  1X3E A;  3LGJ A;  2ZJP A;  4XTC S;  4HJ8 A;  4JI5 Q;  1GM5 A;  3CCV A;  4DUY L;  3UDI A;  4LF4 Q;  5AJ3 L;  5IP9 H;  4DUZ Q;  4IFD G;  1RL2 A;  4LFC Q;  3KFU A;  4PMW A;  2Z6K A;  3KF8 B;  4B3R Q;  5ELO A;  2JQO A;  3STB D;  4UY8 C;  2HIV A;  4HIK A;  1X56 A;  4AYB G;  5HY6 A;  5IYB G;  3B6Y A;  1Y1W G;  4A3D G;  2B3G A;  3KF6 A;  3HOV H;  1VQE A;  3CCM A;  1QZG A;  4J15 A;  4C2M H;  4DK3 C;  1J6Q A;  2BA1 A;  2FXQ A;  2YTX A;  4DR1 L;  3CMA A;  4UP7 A;  4L5R C;  5C44 H;  3PO2 H;  3S16 H;  1X3G A;  1A0I A;  2R7Z G;  2IY5 B;  1JB7 A;  4JBW A;  3S1Q H;  2RHS B;  3NEL A;  1PA6 A;  4B3T L;  3L2P A;  1X65 A;  2AWO A;  4AQY Q;  1IBM Q;  2UUC L;  4LF7 Q;  4P72 A;  1NY4 A;  1QZH A;  1YJN A;  4IFD J;  1TWG H;  3S2D H;  1HZB A;  4QIW E;  1VQ9 A;  4LF9 Q;  4DR6 L;  2RF4 A;  1E3P A;  1P16 A;  4DNI A;  2F4V Q;  4BY1 G;  4QGU A;  3J81 j;  3H0G H;  2K50 A;  3CPF A;  3NEM A;  4LW1 A;  1V9P A;  2AHO B;  3TQY A;  2VQE L;  3TS0 A;  1JJG A;  2Y0S E;  2YYZ A;  4IPC A;  4JI3 L;  5M3F G;  1WI5 A;  2NN6 I;  5H1S E;  5FLM G;  1C7Y A;  4YHH L;  1TWC H;  1VQG A;  3L7Z C;  1YNX A;  2V1C C;  1LM0 A;  3CP0 A;  3S2H H;  5C4X G;  4X6A H;  3CCR A;  1VQ5 A;  3S14 H;  1KQS A;  4YY3 Q;  1XMO Q;  2IT1 A;  4AIM A;  3MXN B;  3UE1 A;  4BBS G;  1VQH A;  5GQO A;  1PH3 A;  4LFB Q;  1KL9 A;  3CQZ H;  2WB1 G;  3K8A A;  1LUZ A;  2KEN A;  4KI0 A;  3T1H Q;  2AMC B;  4GLV B;  3Q8D A;  1NE3 A;  4PG3 A;  4BBR G;  4X65 Q;  4DR7 L;  5GAG C;  3OYY A;  5J3B A;  1N33 L;  2OCE A;  1OXX K;  1VS0 A;  1L1O C;  1HZA A;  2KCM A;  1E1O A;  1VQI A;  2L15 A;  4UP9 A;  5JEA G;  4GS3 A;  5IP9 G;  1MJE A;  4NPS A;  4JI0 L;  1EUJ A;  4JBM A;  5C4J H;  1G51 A;  1QVC A;  2BH2 A;  4DV5 Q;  3I2Z A;  1HNX L;  4A93 H;  4A3L H;  1X54 A;  5E7N A;  3TEH B;  4DV6 L;  4DV7 Q;  2A19 A;  1HH2 P;  3PIP A;  4OWW B;  3AEV A;  4LF8 L;  4MNO A;  3FHW A;  4AH6 A;  1EYG A;  4APV A;  3BJU A;  1HNW L;  3HOV G;  4R4I A;  3HKZ G;  4DK6 C;  4A3E H;  1PH1 A;  4IOC A;  2LSS A;  3CF5 A;  3RLN A;  1W2B A;  2ASB A;  4JI4 L;  2K14 A;  5IYD H;  2PNH A;  3U4Z A;  1JT8 A;  4RMF A;  4X66 L;  1HZ9 A;  2E2I H;  3A74 A;  4A3K H;  3H3V H;  5C44 G;  3J7Z C;  4DV3 Q;  3CCE A;  2HT1 A;  4A3I G;  1CSP A;  2Z6K C;  3GTK H;  5IWA L;  3UDF A;  2BA0 A;  1N36 Q;  4JI7 Q;  1G6P A;  1HR0 Q;  2MO1 A;  4QJF A;  5JJK A;  3EBE A;  4DV1 Q;  1VQJ A;  3GTO H;  3HOZ H;  4YWK A;  3AYH B;  3W1B A;  1XMQ L;  2MFI A;  2GVB A;  3K0X A;  1KXL A;  1VQ6 A;  1A63 A;  2VQF L;  1J5E L;  1HJP A;  3WWV A;  1PH7 A;  3PGZ A;  3RLO A;  5IP7 H;  1BBU A;  4JC0 A;  4DV0 Q;  1D8L A;  1EIY B;  4JBK A;  2ID0 A;  4KHZ A;  4KHP L;  2PI2 A;  1VQD A;  3GTM H;  3PUZ A;  5FJ8 H;  3RZO H;  2UXC Q;  1S40 A;  5C3E H;  4HJ7 A;  5GRO A;  3SGI A;  1VQL A;  4H02 A;  4JOI A;  3D31 A;  2IHF A;  1R9T H;  3RR5 A;  4GKJ Q;  2I5H A;  1NTG A;  1E22 A;  3BZC A;  2CFM A;  2QEX A;  3OW2 A;  1WCM G;  2KCT A;  1N32 Q;  4L5T A;  1Q8K A;  3GDE A;  3CPW A;  4JI6 Q;  3UDX A;  1YIT A;  4B3T Q;  1YBY A;  3AQQ A;  4A4I A;  1U5K A;  3HOX H;  4POG A;  3PUX A;  3F8T A;  4X62 L;  4IO9 A;  1NMF A;  3HFZ B;  4GN3 B;  1OXV A;  1PYB A;  1SMX A;  2Y0S G;  3CC2 A;  1TWF H;  2OTL A;  4X64 L;  2RHQ B;  4YWL A;  3OTO L;  3CCJ A;  5K36 G;  1VQM A;  1PH2 A;  2ZM6 Q;  4GLA C;  4A3L G;  2D0O A;  3K7U C;  5M5X H;  5IY0 A;  5M3M H;  3CCL A;  3S17 H;  2MQH A;  2JEA I;  1M1K C;  4OON A;  1XNR L;  5JJL A;  1KRT A;  3CC4 A;  4A3J G;  4LF5 Q;  2UU9 L;  4A3M H;  4A3E G;  3PUV A;  3M4Q A;  4GKK Q;  5IYD G;  4HJA A;  1JJ2 A;  4YCV A;  1CSQ A;  3J80 i;  4A3K G;  2B63 H;  1CKM A;  4LF6 Q;  5GAH C;  3FKI H;  2ZJR A;  4JI2 L;  4R4Q A;  2VUM H;  1N9W A;  2WFW A;  1X55 A;  1N34 Q;  1LYL A;  3KDF B;  3H3V I;  4WJ4 A;  1K0R A;  2AWN A;  3HOZ G;  2JE6 I;  2F52 A;  3GTL H;  1A8V A;  4DV4 L;  3E9I A;  1VQO A;  4JV5 Q;  4JYA L;  3CXC A;  3CCS A;  4ALP A;  1FJG Q;  1C9O A;  2UXD Q;  2CWA A;  4MZ9 A;  3PV0 A;  3U50 C;  3I4M H;  4HJ9 A;  2JA9 A;  4LUO A;  5IP7 G;  2ATW A;  1QVG A;  3RN5 A;  4A3F H;  3ER0 A;  2JA8 H;  1I94 Q;  2R92 G;  5LMN L;  2N3S A;  1VQF A;  1IL2 A;  5IYC H;  4GN5 A;  1B70 B;  2NN6 G;  5FJ8 G;  4MTN A;  3GTJ H;  1C0A A;  3KJO A;  4DR5 Q;  5C3E G;  1PH5 A;  1ASY A;  4GOP B;  4JI1 L;  1ASZ A;  1WFQ A;  4B3S Q;  3T1Y L;  2E5L L;  2HHH Q;  3UDG A;  1IBL L;  5BR8 L;  3HOU H;  2UXB Q;  3A5Z B;  4DR2 Q;  3RNU A;  3M85 A;  1SRU A;  2N49 A;  3PO3 H;  4OX9 L;  1XNQ L;  4BXX H;  4JI8 Q;  1KHI A;  4LWC A;  2PI2 E;  4DV2 L;  4GOP C;  4K0K Q;  3HOX G;  2K5V A;  1EOV A;  3KJP A;  4DAY B;  1VQK A;  2OTJ A;  4NXM Q;  2R93 H;  3G71 A;  2JJQ A;  2Q2U A;  1Q82 C;  1U0L A;  4R4C A;  4JI5 L;  1H95 A;  4JOI C;  4LF4 L;  4A3B H;  2IHE A;  3W1G A;  1E1T A;  5LMU Q;  4DUZ L;  1K83 H;  1HNZ Q;  4LFC L;  1SRO A;  2ZTE A;  3GTP H;  4B3R L;  4NXN Q;  1EFW A;  4R4T A;  4OO1 G;  4C3J H;  3S1R H;  4IJH A;  3DM3 A;  3S1N H;  4A76 A;  1TWH H;  1LTL A;  4DR4 Q;  4ME3 A;  4R1J A;  1B7Y B;  2EIF A;  2K75 A;  3CW2 C;  1Y1V H;  5DLQ E;  4OWX B;  4DR3 Q;  4A3M G;  1XPR A;  1N8R C;  1UWV A;  5EAY A;  1UE6 A;  3AFP A;  3NBH B;  2ALY B;  2JA7 H;  3JAM c;  1AH9 A;  4R4O A;  4DKA C;  1A62 A;  1Y14 B;  3FKI G;  1PH9 A;  1YVC A;  4B3M Q;  2VUM G;  3PO2 G;  3GO5 A;  1XPO A;  1KIX A;  1K9M C;  2UUA Q;  2MNA A;  2ZJQ A;  3HKS A;  1QVF A;  4AQY L;  4X62 Q;  2YTV A;  1IBM L;  2EQS A;  2NVY H;  3GD7 A;  3I56 A;  4LF7 L;  1SR3 A;  4WJ3 M;  3GTG H;  3M3Y H;  1PYS B;  3I4N H;  4P74 A;  4LF9 L;  1YHQ A;  3I4M G;  2N78 A;  3PF5 A;  1QUQ B;  2Q2T A;  5IT9 c;  2F4V L;  4DUY Q;  3CC7 A;  2CWP A;  4IOA A;  3KYH C;  5AJ3 Q;  2Z0S A;  3U4V A;  3F2B A;  4A3F G;  1L0W A;  1FGU A;  2I0Q A;  2JA8 G;  3K7A H;  1OXT A;  4QL5 A;  1IZ6 A;  1CKO A;  1SE8 A;  2VY3 A;  1M90 C;  3H0G G;  2LXK A;  4KLK A;  1GKH A;  3TRE A;  4GOP A;  3HOW H;  1HZC A;  1JE5 A;  3JAM i;  2NVX H;  2JA5 H;  1V43 A;  1I50 H;  3HOY H;  2VNU D;  1Q46 A;  3I4O A;  3BU2 A;  2RCN A;  1EQQ A;  1EQR A;  2K52 A;  5M5W H;  4UPA A;  4QY7 A;  3PUY A;  3W5O A;  2B29 A;  4DR1 Q;  1VQP A;  1XMO L;  3HOU G;  2PQA B;  2MO0 A;  3PF4 A;  4LFB L;  1KC8 C;  3T1H L;  3J7A 5;  4X65 L;  4L5Q A;  2LXJ A;  1VQ8 A;  1VQB A;  1YHB A;  2UUC Q;  3IRB A;  1EIF A;  1BKB A;  1YI2 A;  3EIV A;  3G48 A;  4A3B G;  1XTD A;  1GD7 A;  4DR6 Q;  1JJC B;  5JJI A;  4DV5 L;  1K73 C;  1WOC A;  4A3C H;  2AKW B;  3RLF A;  4IJL A;  1L2F A;  4DV7 L;  1E24 A;  1YJ9 A;  1SFO H;  3GTQ H;  5FLM H;  4IPD A;  3RZD H;  2YTY A;  4POF A;  4A93 G;  1PV4 A;  1X3F A;  4BA1 I;  2VQE Q;  4C3H H;  1BBW A;  4JI3 Q;  1MJC A;  1MIU A;  3ULJ A;  1Y1V G; 
#chains in the Genus database with same CATH topology
 4YHH Q;  2D9U A;  1V1Q A;  3KBG A;  4OL7 A;  3D8G A;  3D4D A;  2EJF C;  2K32 A;  2ES2 A;  1Q1B A;  4JI7 L;  2H5X A;  1IL8 A;  4I65 A;  5LMN W;  3O13 A;  2A1A A;  4XQN A;  2Z4H A;  3I4N G;  2F0G A;  1I6V C;  1H9J A;  1QUQ A;  3E0E A;  5KYI A;  4EQ5 A;  1IBK L;  1FL0 A;  2G9H D;  4DV0 L;  2NBF A;  3HGB A;  4Q5V A;  4IFD I;  2B2V A;  1G29 1;  1HNX Q;  1Z47 A;  4A75 A;  1X9N A;  1VCI A;  2Z6B A;  5CGK A;  1O7Y A;  1E2Z A;  4LF8 Q;  1A3V A;  3URY A;  1Y8N B;  3GQB A;  3X3M A;  1HNW Q;  4G7O C;  3S14 B;  2PQA A;  4H44 C;  3J81 i;  1AW7 A;  1LLR D;  4X66 Q;  1NR4 A;  2K7V A;  4JI6 L;  4EX5 A;  1OXS C;  3X3N A;  3ND8 A;  3CQZ B;  4LFA L;  1PRT D;  4WJW A;  4RWS C;  3PMF A;  1PFN A;  1Q12 A;  1KRS A;  2KVM A;  3ULL A;  3HRZ C;  4N8X 1;  4PZ6 A;  3TBI B;  4RH6 A;  1BOS A;  1RIP A;  1XWE A;  2P5Z X;  4FVM A;  4C3H G;  4A3E B;  4YCW A;  1Y8P B;  3D0F A;  2E2I B;  2OQ0 A;  4P2C B;  4LF6 L;  4TQU S;  1TS2 A;  4MIU A;  2F0I A;  2I46 A;  4DK0 A;  3HEJ A;  4XIG S;  4AYB E;  1SLJ A;  2K5N A;  3GTO B;  3ZJY C;  3KDF A;  3F2D A;  3R3O A;  1JR0 D;  5J39 A;  4RA8 A;  4PZ8 A;  3F2C A;  1FVI A;  1LV9 A;  2VW9 A;  2K6A A;  1A2U A;  2PW7 A;  5K36 H;  4NP5 A;  4HID A;  3K80 C;  3NK9 A;  2B8F A;  3GTM B;  3I55 A;  1SYD A;  5ELN A;  3D4R A;  1LAB A;  2IX0 A;  4LUV A;  1SYE A;  1WD1 A;  5IYC G;  2E8G A;  5C0X G;  2WP8 J;  2ZXP A;  4A3G G;  1A6X A;  1R9T B;  1TKW B;  5KRU A;  3S15 H;  1YEZ A;  3G4S A;  2SOB A;  4EQP A;  5JPM C;  3ERS X;  2LS0 1;  2JK8 A;  2O2L D;  2EXD A;  1XX8 A;  3VR2 A;  4JCV E;  2EE1 A;  4DPG A;  2G9D A;  2ZTC A;  3TP8 A;  1XYI A;  3L0O A;  3PO3 G;  5JEA J;  5ELB A;  3C46 A;  3A5U A;  3TME A;  1NBW A;  3SDZ A;  2UUB Q;  1B3Q A;  1TWF B;  1HNZ L;  5EPJ A;  4NXN L;  1BF4 A;  4EQN A;  1U4R A;  1IXR A;  2KED A;  5C0X J;  5CV4 A;  3I70 A;  2EYH A;  3KLR A;  4HIO A;  3OMC A;  5M3F H;  2DN8 A;  1TWA H;  2GN5 A;  5HGT A;  1SDF A;  3S1M H;  2XGT A;  2Z1C A;  5C4X H;  2NVT H;  1CZG A;  4L5S A;  3WDN A;  2JA6 G;  2KHJ A;  3T1Y Q;  3FKI B;  2B2U C;  1NAP A;  5BR8 Q;  1NJI C;  1QB5 D;  5BN5 A;  1X6O A;  1XNQ Q;  1XPU A;  3GTL B;  1HA6 A;  2R7D A;  3P1H A;  2JN4 A;  4HJ8 A;  4DUY L;  3UDI A;  5AJ3 L;  4OO1 H;  1UNS A;  1K8O A;  3P20 A;  3KFU A;  4B3R Q;  1PZI D;  1SNO A;  4KTA A;  2JQO A;  2B2Y C;  3STB D;  5JVG 3;  5HY6 A;  4A3D G;  4C2M H;  5C6A A;  1J6Q A;  3PO2 H;  3S16 H;  2K5D A;  4JBW A;  3S1Q H;  3VR6 A;  2RDG A;  4AQY Q;  4LF7 Q;  2UUC L;  2H1E A;  3Q6S A;  4L6T B;  4QIW E;  2PPB C;  4LF9 Q;  4DR6 L;  2RF4 A;  1E3P A;  4QGU A;  4C3J B;  2ICE C;  3FVQ A;  3NEM A;  4KJN A;  1V9P A;  4HN7 A;  2VQE L;  1JJG A;  4JI3 L;  4IPC A;  1B9N A;  2NN6 I;  1HQR D;  1ESF A;  3L7Z C;  3ONA B;  1PLF A;  1YNX A;  2V1C C;  4ILW A;  1LM0 A;  4CDE C;  1G6Z A;  1VQ5 A;  1KQS A;  3LWU A;  2N88 A;  1JE4 A;  1VQH A;  5GQO A;  1PH3 A;  4LFB Q;  3GTG B;  1CFM A;  2XWB B;  3I4N B;  2KEN A;  1WVL A;  3Q8D A;  1NE3 A;  5J1Z A;  4BBR G;  4X65 Q;  3VYU A;  1B9M A;  3IFT A;  5J3B A;  1DCZ A;  1N33 L;  2N55 A;  3NTI A;  4C3I G;  1VS0 A;  1LT5 D;  3VYT A;  1LTG D;  1EUJ A;  4A3L H;  1X54 A;  3K5M A;  4DV7 Q;  4OO1 I;  3PIP A;  3MFG A;  2R61 A;  3AEV A;  4MNO A;  3FHW A;  2FMM A;  1EU4 A;  1I50 B;  2CW0 C;  4IOC A;  3CF5 A;  1W2B A;  2K14 A;  1VF7 A;  1QG7 A;  1SNQ A;  1Z6H A;  5C44 G;  3GTK H;  3UDF A;  4NMZ A;  1JWM D;  4JI7 Q;  1CI3 M;  4HMJ A;  3K5N A;  2PZT A;  1K3B C;  3AYH B;  3W1B A;  2PZW A;  1Y8O B;  2F0F A;  1A63 A;  1J5E L;  4ZCK A;  3WWV A;  4L63 B;  1PH7 A;  4CKB A;  4H13 C;  1BBU A;  4DV0 Q;  4JBK A;  1YNN D;  1QNU A;  3RZD B;  1TS5 A;  2O5I C;  2EYL A;  4C3H B;  1S40 A;  5C3E H;  1PRT B;  3SGI A;  4XQQ A;  3M4O B;  4QB4 A;  5J22 A;  2XN9 C;  1J9O A;  2QEX A;  1KAA A;  2A6E C;  5M5Y B;  4CKE A;  4JI6 Q;  1YBY A;  3NUC A;  4GN3 B;  1A15 A;  1ET6 A;  1EWC A;  1OXV A;  1PYB A;  1SMX A;  3A7L A;  2NVQ B;  5TSS A;  1ZYR D;  3CC2 A;  1CHP D;  2NUC A;  2BE5 C;  2RHQ B;  1EIH A;  1Q3L A;  4HSP A;  4LAA A;  3S17 H;  2JEA I;  5JJL A;  1XNR L;  4A3G B;  3R8B A;  1E2V A;  4I7A A;  5C4Z A;  5IOC A;  5CV5 A;  3M4Q A;  5IYD G;  1JJ2 A;  1CSQ A;  2PMZ B;  3J80 i;  3I72 A;  4A3K G;  5G3L F;  4LF6 Q;  1RF2 D;  4JI2 L;  1N9W A;  4IN3 A;  4FF2 A;  2AWN A;  3HOZ G;  2JE6 I;  1VQO A;  2DJG C;  2A73 B;  2A6H D;  3CCS A;  1C9O A;  3ND9 A;  1D5X C;  3U50 C;  3PV0 A;  4FNF A;  5KGU A;  2HD3 A;  5EGT A;  3ER0 A;  4RCO A;  5IYC H;  4GN5 A;  3GTJ H;  4ME5 A;  4JK1 C;  4R8N A;  2XVS A;  3BDL A;  3NE5 B;  4OEM B;  2JA6 B;  1WFQ A;  2KEC A;  2FHT A;  2RBM A;  1HHV A;  3HOU H;  4G4K A;  4FYD A;  1STN A;  2WV6 D;  1I6H B;  1DZ1 A;  3NTK A;  2N49 A;  3PO3 H;  4OX9 L;  4GOP C;  4LWC A;  1EIG A;  2PI2 E;  2Y0S B;  3G71 A;  5COY A;  2JJQ A;  1UEA B;  4JI5 L;  4JOI C;  4A3B H;  4DUZ L;  4DNT B;  4ZKB B;  1HNZ Q;  1M4V A;  1FNV A;  4K6L A;  1SMY C;  1F77 A;  2MP1 A;  4NXN Q;  4A3J B;  3KF8 A;  4G7Z C;  3S1R H;  2EPB A;  1LTL A;  4A3D B;  3ITP A;  4I7Z C;  2EIF A;  2K75 A;  4A3M G;  3K57 A;  3E0J A;  3H91 A;  3NBH B;  2ALY B;  2JA7 H;  1I3Q B;  1A3U A;  2LMC B;  1Y14 B;  2RA4 A;  4K5X A;  4PV1 C;  2VUM G;  4DK1 A;  1MSH A;  2MNA A;  2ZJQ A;  2E2D C;  4X62 Q;  1TS4 A;  2EQS A;  4G57 A;  2EVB A;  4WJ3 M;  1EY5 A;  3ERO A;  2F0D A;  2F0E A;  3QOJ A;  5DNF A;  3I4M G;  2N78 A;  3PF5 A;  2F4V L;  4DUY Q;  2CWP A;  5AJ3 Q;  2I0Q A;  2JA8 G;  4HR7 B;  4K6D A;  1R4P B;  2JP1 A;  3TRE A;  4KLK A;  5C3W A;  1JE5 A;  1BQQ T;  1V43 A;  2VNU D;  1Q46 A;  1K8M A;  3NXW A;  3EA6 A;  1JOK A;  2DY7 A;  4UPA A;  1XMO L;  3PUY A;  2F0T A;  2JYO A;  3CRL C;  2MO0 A;  4HED A;  1IW7 D;  1W6K A;  4K14 A;  4DAY A;  2RSO A;  1PRT C;  3NPP A;  4BBR B;  3J7A 5;  1AN8 A;  2K28 A;  2UUC Q;  3IRB A;  1GHJ A;  1MD2 D;  1YI2 A;  3G48 A;  1G91 A;  1DXM A;  1F2Y A;  3TP7 A;  4LMQ D;  4DR6 Q;  1JJC B;  4CHT B;  5JJI A;  1K73 C;  2L9H A;  4ZUI A;  2AKW B;  4IJL A;  1YJ9 A;  1SFO H;  3GTQ H;  3BVZ A;  2IL8 A;  2VQE Q;  1LAC A;  1BBW A;  4JI3 Q;  5IGD A;  2BH8 A;  4BY7 H;  1C8C A;  3K5L A;  2K4K A;  5C44 B;  1LT4 D;  5CC4 A;  4BA2 I;  4RGM A;  1RTN A;  1D7Q A;  1ENA A;  1HR0 L;  4O2D A;  2VZA A;  4C3I H;  1EZ6 A;  1TWG B;  1OXU A;  4V0B A;  3I7F A;  2UUB L;  3I90 A;  2PMZ E;  1N33 Q;  4JVZ A;  1JMC A;  3I3C A;  3OSO A;  2KBN A;  3H0G B;  4MHE A;  2VS1 A;  2Q2H A;  3V96 A;  3HOW G;  4KD3 A;  2JA5 G;  3HOY G;  1LTB D;  1MKH A;  4GKJ L;  2FIN B;  5BN3 A;  3MEF A;  2F0P A;  1B1Z A;  1N32 L;  3PUW A;  2DGY A;  1B50 A;  2WKD A;  3K81 C;  2KQ3 A;  1CKN B;  2NZ1 D;  2CQO A;  5CV8 A;  1WD0 A;  4NDX A;  1UE5 A;  1YZ6 A;  1GVP A;  4F8M A;  1PH4 A;  3DLL A;  1EYA A;  1J5E Q;  4K2L A;  1VQN A;  5JVH 3;  1AE2 A;  1BUV T;  1WYD A;  1EYD A;  4GNX C;  1S5C D;  1KAW A;  4FDB A;  1PFS A;  3OIP A;  1PH8 A;  3UE0 A;  1SSO A;  4LF5 L;  1WTP A;  4JW0 A;  4GKK L;  1U4M A;  4A3K B;  3OOC A;  3CHB D;  2AQ2 B;  1SE3 A;  4RKB A;  3V05 A;  2B2Y A;  3MWY W;  1X3Q A;  2E2H H;  3HOZ B;  2CH4 W;  5CR3 A;  2F0Q A;  4ABN A;  1FJG L;  4PZ7 A;  3MVV A;  3NP8 A;  1DGS A;  4XYQ A;  1BBX C;  3TP6 A;  3BZK A;  1XXG A;  4IFD H;  2XSC A;  4JG2 A;  2J0T D;  3IFD A;  3STB C;  3AFQ A;  4DR5 L;  3R2I A;  5IYB H;  1Y1W H;  5HGQ A;  3QOL A;  1XNR Q;  1TY2 A;  2PNR C;  4B3S L;  1LT3 D;  3KF6 B;  2E2J H;  2YU9 H;  1I5F A;  3BVG A;  4NB3 A;  2TMP A;  3G6E A;  1JQY D;  4DR2 L;  2R7Z H;  4KKU A;  4JI8 L;  1KNE A;  4K0K L;  4JI2 Q;  1EWI A;  1YJW A;  1HRJ A;  5CV6 A;  1OO9 B;  1TXY A;  2KCC A;  5T1G A;  3T13 A;  3PIO 3;  1EY4 A;  2RKS A;  5LMU L;  1UEB A;  3NWT A;  2F3I A;  3Q24 A;  3F1Z A;  3A56 A;  2QEJ C;  2K01 A;  5EJW A;  5CBA E;  4BY1 H;  1VQA A;  2E74 C;  4YWM A;  5LL6 S;  3T51 B;  4DF7 A;  4DR4 L;  4C3J G;  3TS2 A;  4A3M B;  1O7I A;  5E3F A;  1EU3 A;  1VF5 C;  2B63 B;  3NEN A;  3FDT A;  1PRT F;  1HTP A;  3BZD B;  2VUM B;  2WAC A;  3HG9 A;  3ZYY X;  3QWN A;  4Y52 H;  4HIM A;  2DNC A;  1SJH D;  4OX9 Q;  2RSN A;  4HJ5 A;  2EJM A;  4IAL A;  1VQ4 A;  1HXY D;  5COR A;  2WAQ E;  2ZJP A;  2M2L A;  5JAV A;  3I4M B;  2FMC A;  4JI5 Q;  3CCV A;  5IP9 H;  4DUZ Q;  1IKL A;  3DUZ A;  2JA8 B;  1EFI D;  3FRP B;  3T4A C;  4PMW A;  1GXD C;  1D5Z C;  2HIV A;  2LFN A;  2B3G A;  3HOV H;  1VQE A;  4J15 A;  1O80 A;  1BR9 A;  3JAM E;  3CKI B;  3AB9 A;  1STA A;  1X32 A;  1EWH A;  1QOH A;  1SAP A;  1X3G A;  1EY0 A;  1J8I A;  2R93 B;  2RHS B;  1PA6 A;  1WTH A;  3L2P A;  1X65 A;  5IGB A;  3K0Y A;  4P72 A;  1YJN A;  4FF1 A;  1VQ9 A;  3FMC A;  3GTP B;  2F4V Q;  1YNN C;  2NB0 A;  3CPF A;  2K33 A;  3S1N B;  2IPK D;  3TS0 A;  5H1S E;  1VQG A;  3DHQ A;  3CP0 A;  1HCZ A;  3MC0 B;  4X6A H;  5ISR A;  1BCP D;  3S14 H;  1XMO Q;  5DM6 3;  4AIM A;  1FR3 A;  1FGB D;  3UE1 A;  4BBS G;  1KL9 A;  2BDN A;  3CQZ H;  1NSN S;  1KAB A;  1LUZ A;  2DNE A;  1NNX A;  3K8A A;  4RKL A;  2F0S A;  4PG3 A;  4QMG A;  3SEB A;  3L3O C;  1GUS A;  3OYY A;  1MI2 A;  1F9S A;  1HZA A;  2KCM A;  5JEA G;  1VQI A;  4GS3 A;  1HUM A;  3G6J B;  1EOT A;  1CTM A;  5CMD A;  5E7N A;  1EQV A;  3HOW B;  4XYO A;  2QDL A;  4DV6 L;  2A19 A;  2QF7 A;  1I4G A;  1EYG A;  2NVX B;  2JA5 B;  5LHY 1;  3BJU A;  1SYG A;  1CQV A;  3TZU A;  3HOY B;  2DJF C;  3HKZ G;  4DK6 C;  4A3E H;  5D3I B;  1PH1 A;  2LSS A;  2ASB A;  5M5W B;  1DM0 B;  4J6H A;  1HZ9 A;  2E2I H;  3A74 A;  1RTO A;  1CSP A;  2Z6K C;  1VMC A;  5IWA L;  3J81 E;  4K8J A;  1GUN A;  1G6P A;  1HR0 Q;  5JJK A;  3GTO H;  2GVB A;  3K0X A;  2A6H C;  2B8G A;  2H4O A;  3K59 A;  3PGZ A;  3RMH A;  1B3A A;  4JC0 A;  5I4D A;  4RFB A;  1D8L A;  2XRS D;  2ID0 A;  3A7A B;  4KHP L;  2PI2 A;  1VQD A;  4K2K A;  3GTM H;  2NN6 H;  3OMG A;  3PUZ A;  4NKL A;  1CHQ D;  5FJ8 H;  2QDB A;  1LTR D;  1L0Y B;  1SNC A;  3KLS X;  4JOI A;  1R9T H;  3BDC A;  3D31 A;  4GKJ Q;  1E22 A;  3BZC A;  2CFM A;  1LTI D;  3OW2 A;  2X69 A;  2WB1 B;  1N32 Q;  4L5T A;  3GDE A;  5IOD A;  1YIT A;  3AQQ A;  4HSV A;  1BO0 A;  2F0O A;  4X62 L;  4IO9 A;  2Y0S G;  1TWF H;  4CGY B;  3NBI A;  3W2D A;  4YWL A;  1STE A;  3OTO L;  2D0O A;  3K7U C;  4CDC C;  4OON A;  1FD7 D;  4A3J G;  4LF5 Q;  3KLS A;  3LX0 A;  1K28 A;  1PDQ A;  2A68 D;  4GKK Q;  4A3I B;  4HJA A;  3VYR A;  5M9O A;  3J7Y W;  3QIA A;  3F2U A;  2C9O A;  5GAH C;  3FKI H;  2WFW A;  3KDF B;  1V8Q A;  3GTL H;  4DV4 L;  3CXC A;  1FJG Q;  4GZY C;  1LT6 D;  1TQO A;  1QCB D;  2JA9 A;  5IP7 G;  2ATW A;  2VB3 X;  3RN5 A;  4N9T A;  3LWE A;  2F0J A;  4QCL A;  1B70 B;  2RDH A;  1PTO D;  3SHL A;  4DR5 Q;  1ASY A;  4GOP B;  3WOF A;  2NTS A;  1WCM B;  4B3S Q;  1LTS D;  2E5L L;  2AQ3 B;  1IBL L;  2MPM A;  3A5Z B;  4DR2 Q;  3M85 A;  1IW7 C;  2PCF B;  4JI8 Q;  1KHI A;  4DXF A;  4IZ8 A;  4RGO S;  4K0K Q;  3HOX G;  2OTJ A;  1EOV A;  4C1N K;  3Q23 A;  4QUC A;  1U0L A;  4R4C A;  3OHX C;  1H95 A;  4LF4 L;  1HTL D;  1RJT A;  3W1G A;  5LMU Q;  1AZP A;  4O42 A;  4LFC L;  1ML0 D;  1SRO A;  1EFW A;  4IUU A;  4C3J H;  1Z7T A;  4IUV A;  4DGZ A;  5LL6 X;  4DR4 Q;  4WOR A;  4R1J A;  4OWX B;  1B7Y B;  3CW2 C;  2VXW A;  1XPR A;  1UWV A;  3AFP A;  3K6O A;  1H9R A;  1PMR A;  1O7L A;  3EFX D;  1SNM A;  1YVC A;  1QVF A;  1QNK A;  1IBM L;  3GD7 A;  3M4Y A;  2O4X A;  1KDC A;  3GTG H;  1S5F D;  1PYS B;  3I4N H;  4KMU C;  4F88 A;  2ICI A;  3DXJ C;  5DEH A;  1F2Z A;  2R92 B;  3KYH C;  2L55 A;  2Z0S A;  4A3F G;  3KK7 A;  1OXT A;  4QL5 A;  2VY3 A;  2KCN A;  3H0G G;  1HZC A;  4Y7N B;  1II3 A;  1I50 H;  3I4O A;  4NW2 A;  2OEO A;  2RCN A;  1EQR A;  1GUT A;  2K52 A;  3W5O A;  5CV9 A;  2B29 A;  1GHK A;  4BBS B;  1SBB B;  3N6R A;  2M9V A;  1F2L A;  1B44 D;  1PZJ D;  3T56 B;  2FJ2 A;  3T1H L;  1KC8 C;  4L5Q A;  1WTR A;  1YHB A;  1BKB A;  5FKA C;  3EIV A;  1DON A;  5IGC A;  4MTK A;  3OW7 A;  1S4Z A;  4DV5 L;  4HTH A;  1WOC A;  1L2F A;  1E24 A;  4KN4 C;  3RZD H;  2YTY A;  2IWH A;  1PV4 A;  1X3F A;  2OT2 A;  4C3H H;  1H9S B;  3HKZ B;  4DA2 A;  1MJC A;  1MIU A;  3ULJ A;  1Y1V G;  1LTA D;  1IYV A;  3M4O H;  1K3R A;  5E4W C;  5GAE C;  2CCZ A;  1IHZ A;  5M5Y H;  4YCU A;  4DV1 L;  1XJV A;  3NHH A;  2EDG A;  3KOJ A;  2D2C C;  4IQZ A;  4DFA A;  1Q86 C;  2Q8R E;  5JEA H;  3S2D B;  2R7F A;  2NVQ H;  5FO9 B;  2G5D A;  3M7G A;  3KLW A;  2Q2I A;  2VB2 X;  2C5C A;  1Q1E A;  2ZTD A;  1IYJ B;  4DV6 Q;  3TZD A;  3PCO B;  5C0X H;  2OQK A;  1TWC B;  4A3G H;  3CCU A;  3D4W A;  4O0A A;  3S2H B;  3M4P A;  1EEF D;  3DEO A;  1V1P B;  1KDA A;  3CME A;  5ELC A;  4UP8 A;  3DMU A;  4IUQ A;  1JWU D;  5IWA Q;  4GNX B;  1WTW A;  1OTC A;  1U9R A;  3VYS A;  2HDM A;  3H6M A;  2E75 C;  2F0N A;  2D62 A;  2KHS A;  2SNM A;  4IPG A;  5C4J B;  1AE3 A;  4TVA B;  5D14 A;  4A93 B;  3S9W A;  2ZM6 L;  1B8A A;  4FXG C;  4A3C G;  5C4H A;  1TVX A;  2SDF A;  4RHS A;  1JIC A;  1CQF A;  4KHP Q;  3Q0A A;  3L9A X;  4M1U B;  1B4O A;  2PZU A;  3ICE A;  3P75 A;  1GUO A;  2Q8I B;  1RHP A;  2RCF A;  1EY6 A;  2JA6 H;  2XIW A;  5DM7 3;  2KEE A;  2HCC A;  1S72 A;  1L1O B;  5A35 A;  1KLG D;  2KHI A;  3A54 A;  1I6H H;  1N34 L;  2B63 G;  3J80 E;  4JV5 L;  3W3A A;  4OWT B;  3J7A F;  4X3K A;  5KND A;  3P7J A;  1WTX A;  1ESR A;  1ZEQ X;  5IGF A;  1I4Q A;  1S3O A;  4X3U A;  4GLX A;  1PH6 A;  4FP5 D;  1SNP A;  3OTO Q;  3RZO B;  2VL6 A;  1STB A;  4K8I A;  4A3J H;  4A3D H;  4X3T A;  2F0W A;  3A8J E;  1P8L A;  1RKN A;  1AZQ A;  3E3X A;  2HHH L;  1FYC A;  2UXB L;  3EQL C;  4GN4 B;  2EXZ A;  5C0X I;  1I3Q H;  1Z9F A;  3ULP A;  1KTK A;  1D5M C;  3OPO A;  1D1I A;  3BVM A;  1CKN A;  3E6Z X;  3HOX B;  3MXG A;  1Q81 C;  4NXM L;  4BXX G;  1I4R A;  5GAD C;  2I5L X;  1PTO B;  4E6I A;  2R93 G;  1K8A C;  1JOQ A;  4DV4 Q;  1AP0 A;  3U58 A;  1NUC A;  2N8N A;  4XT3 B;  3BS1 A;  4TRD A;  2D0P A;  3FP9 A;  2A5H A;  5M5X B;  1EYC A;  5M3M B;  1WJJ A;  3M7N A;  1HR0 W;  4CJ1 B;  4DAP A;  1JOR A;  1KD1 C;  3U9S A;  2CQA A;  5KIX A;  2JEB I;  2E5L Q;  1IBL Q;  3J80 c;  1TU2 B;  1YNJ D;  5FO7 B;  2QKI C;  2UUA L;  1BXT A;  5KNC A;  3HKZ E;  4JBJ A;  2R6G A;  2SNS A;  3TDQ A;  3C1E A;  2AQ1 B;  2CVR A;  4BBR H;  1X3E A;  3LGJ A;  5I2X A;  1STY A;  3G7L A;  1D6E C;  2B39 A;  5C5L A;  4LF4 Q;  2AUJ D;  4A3F B;  1RL2 A;  4J1M A;  4LFC Q;  1GUG A;  3WOE A;  2Z6K A;  3KF8 B;  1IKM A;  5ELO A;  2E76 C;  2NYZ D;  4UY8 C;  4HIK A;  2D5D A;  3B6Y A;  3KF6 A;  1QZG A;  3DM1 A;  4DK3 C;  2BA1 A;  2FXQ A;  4DR1 L;  1EQT A;  2EY1 A;  3CMA A;  4KKT A;  1CA5 A;  5C44 H;  2CHB D;  1BDO A;  1QJO A;  2O5J C;  3I4L A;  1IBM Q;  1NY4 A;  1TWG H;  1K83 B;  4EQO A;  5IT9 E;  1P16 A;  4DNI A;  3J81 j;  1ENC A;  4XT1 B;  1I4H A;  3H0G H;  1F2M A;  2K50 A;  2B2U A;  1GUW A;  1TWH B;  3TQY A;  2Y0S E;  2YYZ A;  5M3F G;  1PYW D;  1Y1V B;  4ZLT F;  5DAU A;  1JOO A;  1B53 A;  5C4X G;  3DWA A;  3CCR A;  2EY6 A;  4ULL A;  4ODG A;  4YY3 Q;  1T5X D;  3MXN B;  2NVY B;  3C1F A;  3M3Y B;  2WB1 G;  4KI0 A;  3T1H Q;  2AMC B;  4GLV B;  3IL8 A;  4DR7 L;  3QG1 A;  3H3V C;  3PIP 3;  1L1O C;  1E1O A;  3TP5 A;  4UP9 A;  2K05 A;  4NPS A;  4JI0 L;  4JBM A;  3K7A B;  1QVC A;  1L0X B;  4DV5 Q;  4PNY A;  3NQT A;  3K58 A;  3TEH B;  1A3T A;  5EKK A;  4AH6 A;  2A68 C;  3RLN A;  5IYD H;  4JI4 L;  4RMF A;  1SYC A;  4ZAI A;  3DWP A;  4A3K H;  3J7Z C;  2HT1 A;  3CCE A;  4A3I G;  2PYK A;  1DOL A;  3HZX A;  5ELD A;  1D2B A;  2MO1 A;  4QUF A;  4DV1 Q;  1VQJ A;  3HOZ H;  4YWK A;  1XMQ L;  2MFI A;  5ELE A;  2EJG C;  1VQ6 A;  2VQF L;  5A2Q E;  1KNA A;  3CRK C;  3VA5 A;  1SND A;  5KEE A;  4KHZ A;  5C3X A;  5KNB A;  1PTO C;  4U67 3;  3D6W A;  2M00 A;  3A8K E;  4S3S A;  5GRO A;  1VQL A;  2IHF A;  3RR5 A;  4BS9 A;  2F0V A;  1QIL A;  3BYT B;  1WCM G;  2KCT A;  1SEB D;  5E1F A;  1FNW A;  3UDX A;  4B3T Q;  4HAE A;  1U5K A;  3PUX A;  5EKL A;  4Z9C B;  1EL0 A;  1NMF A;  1HFG A;  2BOS A;  3V2T A;  1IYU A;  1EY8 A;  5D3D A;  1EY9 A;  4X64 L;  3CCJ A;  1PH2 A;  2ZM6 Q;  1I4X A;  4RAU C;  4A3L G;  3CCL A;  4WFN 3;  1M1K C;  3HP3 A;  2EY2 A;  5FO8 B;  1BCP F;  3CC4 A;  2UU9 L;  4A3M H;  1SJE D;  3PUV A;  4KD4 A;  3ERQ A;  4ZQ3 A;  1SYB A;  2L11 A;  1ICW A;  3TN2 A;  2B63 H;  1CKM A;  2VUM H;  4R4Q A;  1N34 Q;  1PXU A;  1LYL A;  3MXP A;  2F0U A;  1PFB A;  4WJ4 A;  1K0R A;  1BNZ A;  2F52 A;  3MTS A;  1DOM A;  4JV5 Q;  1CK1 A;  4JYA L;  2CWA A;  3I4M H;  4HJ9 A;  3N52 A;  4LUO A;  2IW3 A;  2JA8 H;  2R92 G;  2F0K A;  4KK7 A;  5JJZ A;  3QJY A;  5LMN L;  2N3S A;  5A2Q L;  2IJ0 A;  3C3L A;  3SK4 A;  4MTN A;  1C0A A;  3KJO A;  4DU9 A;  5EKI A;  5C3E G;  4JI1 L;  4QIW B;  4LK1 C;  1CA6 A;  4YIJ A;  2HHH Q;  2UXB Q;  3EJI A;  5I2Y A;  4BXX H;  1SRU A;  4DV2 L;  4UAI A;  3SXH A;  2R93 H;  4XXE A;  3KJP A;  1EZ8 A;  2A69 D;  1VQK A;  4NXM Q;  3EVQ A;  3MFY A;  1HUN A;  1GOZ A;  4UHV A;  3H09 A;  2IHE A;  2KUM A;  1E1T A;  1ZYR C;  2ZTE A;  3MHB A;  3NQI A;  3GTP H;  4R4T A;  4N9P A;  3R2T A;  1MHW C;  1H9M A;  4IJH A;  3S1N H;  4IUT A;  4ME3 A;  4V19 0;  3QO2 A;  3S15 B;  5EAY A;  1UE6 A;  1KLU D;  4FXK C;  2PQE A;  1MSG A;  2HQE A;  3JAM c;  1RDP D;  1WTV A;  1QE6 A;  1PH9 A;  3GO5 A;  2UUA Q;  1KIX A;  2YTV A;  1MBY A;  2L1B A;  1SR3 A;  2F0M A;  1ZKO A;  3JAM L;  3BDO A;  1W6J A;  4P74 A;  1YHQ A;  1QUQ B;  3DEP A;  3SK6 A;  3U4V A;  3F2B A;  1JB3 A;  1CKO A;  1M90 C;  1SE8 A;  5M3F B;  1JWS D;  1TWA B;  2LXK A;  5D65 A;  3HOW H;  4GOP A;  3S1M B;  2JSO A;  4JPB W;  2NVX H;  1K0S A;  2JA5 H;  3HOY H;  2NVT B;  5C4X B;  3BU2 A;  2B2W C;  5M5W H;  2B2T C;  4QY7 A;  4DR1 Q;  1O78 A;  3HOU G;  2PQA B;  4FF4 A;  2MJ8 A;  2ENB A;  2LXJ A;  1ROD A;  4OHJ A;  2OXP A;  2IX3 A;  4A3B G;  4BWG B;  1LO5 D;  1XTD A;  1PTO F;  3OWE B;  4ZYS A;  4TKO B;  1EY7 A;  1Y69 U;  4G7H C;  2EZV A;  1WTO A;  4IPD A;  4A93 G;  4FXD A;  4BA1 I;  4OIJ A;  3U9O A;  4C2M B;  2Z4I A;  1GJX A;  3JC6 6;  2CKZ B;  1CT1 D;  2JA7 G;  1W3S A;  3A55 A;  3S16 B;  3PO2 B;  4DV3 L;  5FK9 C;  1N36 L;  3S1Q B;  1E7Z A;  2NZO A;  3J81 c;  2F3V A;  1TY0 A;  2BCO A;  3M9B A;  2RVL A;  2JXM B;  1VQ7 A;  3A8I E;  3AMU A;  5CV7 A;  4DR7 Q;  3A0J A;  4QQB X;  3J81 L;  1DOK A;  3K5O A;  4JI0 Q;  2HIX A;  2UXC L;  5CYU A;  5CBE E;  1GO3 E;  2QCP X;  1Q7Y C;  4P73 A;  5FLX E;  2NZH A;  3CD6 A;  4A3I H;  4JI4 Q;  5IE8 A;  4CJ0 B;  1STG A;  3S24 A;  1ILP A;  5L37 A;  3VR4 A;  4EVO A;  1S5E D;  2HUG A;  1NCV A;  2OF1 A;  1PHJ A;  4J8Q A;  1XMQ Q;  2K5Q A;  4OXP A;  3PQI A;  2XTI A;  4UDU C;  4XDX A;  2VQF Q;  1PVO A;  4IPH A;  2OWO A;  3CU7 A;  5IGE A;  1F9R A;  3MZ5 A;  5KYL A;  1T9H A;  3TRZ A;  2WIN B;  1VDZ A;  2ZXR A;  1AEX A;  1H9S A;  1UE1 A;  4LUZ A;  1UAP A;  4KY6 A;  5M3M G;  2K5H A;  3E5S A;  2MGS A;  4P75 A;  3IAY A;  4BY7 G;  1WCM H;  4B08 A;  2YV5 A;  2MUY A;  3GTK B;  1YNJ C;  1NMG A;  1VQC A;  1H9K A;  3PSI A;  1U4L A;  2WKC A;  3VDY A;  2UXD L;  4PMC A;  3GV6 A;  1SN8 A;  2AUK A;  2PW5 A;  2HCI A;  1F9P A;  4DAM A;  1I94 L;  2DUD A;  5E4X A;  3H15 A;  2F03 A;  2HQL A;  4X64 Q;  4L8J A;  1NR2 A;  5C3E B;  2CH4 A;  2X6L A;  4B9W A;  5FLX c;  2WAQ G;  1V1P A;  1A2T A;  4HCS A;  2UU9 Q;  4CKC A;  1C48 A;  5JPN C;  1RCV D;  1E0B A;  1UE7 A;  4YY3 L;  2B2V C;  4GNX A;  4R9W A;  5FLX L;  3RN2 A;  1STH A;  4RG1 A;  1K8G A;  3I8Z A;  2I5M X;  4H7B A;  4LNQ A;  2QA4 A;  3NWS A;  1R4Q B;  1IBK Q;  4JYA Q;  3SK8 A;  2R92 H;  5NUC A;  1TR5 A;  2A8V A;  3EN2 A;  4ZUJ A;  3QB3 A;  4TSS A;  1YHA A;  3T16 A;  2WB1 E;  3S17 B;  5LMN Q;  1C4Q A;  1BCP B;  5JOB A;  3PIO A;  4KY5 A;  1ICF B;  4DR3 L;  1DJR D;  4HMI A;  2A74 C;  4Y7N H;  3CCQ A;  5C5M A;  4JI1 Q;  1L1O A;  3NBH A;  1YIJ A;  2F0L A;  1QWY A;  2QGQ A;  2PO4 A;  4ID6 A;  2RDF A;  3DWQ A;  4K5W A;  4B3M L;  2IX1 A;  1G8Z D;  2C35 B;  4LFA Q;  4BBS H;  4FO2 A;  3E9H A;  5IGG A;  1BVS A;  3I73 A;  4DV2 Q;  4P71 A;  1CUK A;  3CAM A;  5IIF A;  4RHR A;  2GVA A;  3TSS A;  3RUZ A;  4KV6 A;  4XTC S;  5T1I A;  1GM5 A;  5ELF A;  3FPP A;  4IFD G;  3QR8 A;  1JCK B;  3GTJ B;  1X56 A;  4B9X A;  4AYB G;  5IYB G;  1Y1W G;  2V4D A;  1CM9 A;  3CCM A;  1LTT D;  2EYJ A;  1ZXT A;  4ZKC B;  2YTX A;  4IUR A;  3HOU B;  2X6G A;  4UP7 A;  4WRD A;  4L5R C;  3PO3 B;  1V1O A;  2R7Z G;  1A0I A;  2IY5 B;  1B2T A;  1JB7 A;  3I91 A;  3RD4 A;  3NEL A;  4B3T L;  4LJZ C;  4OGQ C;  2KOL A;  4IUN A;  2AWO A;  1QZH A;  2K04 A;  4A3B B;  4IFD J;  1TT2 A;  3S2D H;  1HZB A;  2RQX A;  1X3P A;  4BY1 G;  1TII D;  3S1R B;  4IUP A;  1MGS A;  4KJO A;  2AHO B;  4LW1 A;  1D1K A;  2BDO A;  1WI5 A;  5FLM G;  1C7Y A;  2Q8T A;  1TWC H;  4YHH L;  2XNA C;  2JA7 B;  3SVM A;  1ENF A;  3S2H H;  1FNU A;  1SXT A;  3AU7 A;  5F2D A;  2L12 A;  2IT1 A;  3HS0 C;  5HUR A;  2QIL A;  1SYF A;  4OEL B;  5G3L D;  3OWF A;  2XRQ D;  5GAG C;  3NSW A;  3FPU B;  1M8A A;  2OCE A;  1OXX K;  4H0L C;  2L15 A;  4F7X A;  1MJE A;  5IP9 G;  5EPK A;  5C4J H;  1G51 A;  2BH2 A;  1HNX L;  3I2Z A;  4A93 H;  4CJ2 C;  2NWG A;  2J7Z A;  4C56 C;  1HH2 P;  1Q90 A;  4OWW B;  4FF3 A;  4LF8 L;  3UI2 A;  4APV A;  1HNW L;  3HOV G;  1SE4 A;  4R4I A;  1U4P A;  3BYY B;  1JT8 A;  2PNH A;  3U4Z A;  4X66 L;  3H3V H;  3R93 A;  4DV3 Q;  3VA7 A;  3J7A V;  2BA0 A;  1N36 Q;  5EQ0 A;  3GP7 A;  1KDB A;  4QJF A;  3NTH A;  3EBE A;  5I6W A;  4RGT A;  2EYO A;  1KXL A;  4XQJ A;  4C1N I;  1G2S A;  4ZRZ A;  1HJP A;  2FFK B;  4Q0F A;  3RLO A;  3VR5 A;  5IP7 H;  2K03 A;  3MXU A;  2LY7 A;  1EIY B;  1SFO B;  3GTQ B;  3GV3 A;  3RZO H;  1XTC D;  4HCE A;  2UXC Q;  4HJ7 A;  2F4I A;  4BY7 B;  4DN4 M;  4KN7 C;  2KA7 A;  4H02 A;  2I5H A;  1NTG A;  4KKS A;  5EBC A;  3MXN A;  1BCP C;  5BN4 A;  1Q8K A;  4R8I A;  3CPW A;  3KBX A;  4POG A;  4A4I A;  3HOX H;  2A69 C;  1PZK D;  3F8T A;  4C3I B;  3HFZ B;  1T5E A;  1PTO H;  1S5D D;  5K5P A;  1AFP A;  1DD2 A;  4O1N A;  2OTL A;  1E2W A;  3J80 L;  4F87 A;  3T53 B;  2R3Z A;  2XWJ B;  3OIQ A;  1VQM A;  5K36 G;  4GLA C;  5M5X H;  5IY0 A;  5M3M H;  2MQH A;  4X3S A;  2WAQ B;  1ILQ A;  1ET9 A;  2F0H A;  2K5W A;  2ZT9 C;  2KJX A;  1KRT A;  5EBD A;  2CW0 D;  4A3E G;  2I07 B;  2LKV A;  1JC7 A;  4YCV A;  4CBV A;  4DAV A;  1G2T A;  2EYF A;  5AFW A;  2ZJR A;  1X55 A;  3H3V I;  1RD9 D;  4EGV A;  1F9Q A;  1ONL A;  4ZK9 B;  1TS3 A;  1A8V A;  3E9I A;  1O7Z A;  3SK5 A;  3MEH A;  4RGN A;  4ALP A;  2UXD Q;  4MZ9 A;  1HQM C;  2B2W A;  2B2T A;  4MN3 A;  1QVG A;  1WTQ A;  4DXG A;  4A3F H;  4KY7 A;  1I94 Q;  4U68 A;  1SE2 A;  1VQF A;  1IL2 A;  2EOT A;  5I6Y A;  1S5B D;  2NN6 G;  5FJ8 G;  3VR3 A;  4CDD C;  1I4P A;  1PH5 A;  1ASZ A;  2F3W A;  2TSS A;  3T1Y L;  2K1B A;  3UDG A;  5BR8 L;  1UUP A;  3SR1 A;  3RNU A;  1XNQ L;  2A6E D;  2E2H B;  2L4N A;  3D3R A;  2K5V A;  4DAY B;  3H94 A;  2Q2U A;  4KHV A;  1Q82 C;  3MA2 B;  1PFM A;  2NTT A;  1K83 H;  2BE5 D;  4B3R L;  4N8F A;  4OO1 G;  1EEI D;  5EPL A;  3DM3 A;  4AYB B;  4A76 A;  1TWH H;  4CDF C;  1Y1W B;  1DYQ A;  5DLQ E;  4DR3 Q;  1Y1V H;  2L0C A;  1N8R C;  2YU9 B;  2E2J B;  2L5T A;  1AH9 A;  4R4O A;  4DKA C;  2R7Z B;  2SEB D;  3FEW X;  1A62 A;  3FKI G;  4B3M Q;  3PO2 G;  1XPO A;  1K9M C;  3HKS A;  4AQY L;  4LF7 L;  3SE0 A;  2NVY H;  3I56 A;  3M3Y H;  2QW7 A;  3Q22 A;  4LF9 L;  1HA5 A;  3LNN A;  4OIK A;  2Q2T A;  5IT9 c;  4BY1 B;  4IOA A;  3CC7 A;  4M8A A;  5FOB B;  2EYM A;  1L0W A;  1FGU A;  3K7A H;  2Z8L A;  4K5V A;  2Z9H A;  1IZ6 A;  4PQX A;  2F1M A;  1GKH A;  1CZW A;  2WII B;  3MAQ A;  3JAM i;  5IT9 L;  3C2P A;  1EQQ A;  1VMP A;  3D6C A;  4PMB A;  1VQP A;  2GA4 B;  4DNR B;  3PF4 A;  1HPC A;  4LFB L;  2ZXO A;  2HDL A;  4QF4 A;  1HFN A;  3BG3 A;  4X65 L;  1VQ8 A;  5I9O A;  2EY5 A;  1VQB A;  1EIF A;  3KUP A;  1Q8I A;  1GD7 A;  1SMY D;  4A3C H;  3RLF A;  4DV7 L;  5I9P A;  5FLM H;  2EYP A;  4POF A;  3IKJ A;  4RCN A;  3HOV B;  2MHV A;  2J4X A;  2DY8 A; 
#chains in the Genus database with same CATH homology
 2BH8 A;  4YHH Q;  4BY7 H;  1V1Q A;  3JC6 6;  2CKZ B;  2JA7 G;  3M4O H;  1W3S A;  2K4K A;  1K3R A;  4DV3 L;  5GAE C;  2CCZ A;  4BA2 I;  2ES2 A;  1Q1B A;  1N36 L;  4JI7 L;  2H5X A;  1E7Z A;  2NZO A;  3J81 c;  1HR0 L;  1D7Q A;  4O2D A;  5M5Y H;  4YCU A;  4DV1 L;  5LMN W;  1XJV A;  3M9B A;  2A1A A;  3KOJ A;  2VZA A;  4C3I H;  3I4N G;  1Q86 C;  1OXU A;  1VQ7 A;  3I7F A;  2UUB L;  2R7F A;  1QUQ A;  3A0J A;  2NVQ H;  4DR7 Q;  4QQB X;  3E0E A;  2PMZ E;  1N33 Q;  4EQ5 A;  1IBK L;  1JMC A;  1FL0 A;  3KLW A;  2Q2I A;  4DV0 L;  2KBN A;  4JI0 Q;  4IFD I;  1Q1E A;  2ZTD A;  1G29 1;  2VS1 A;  2HIX A;  1Z47 A;  1HNX Q;  1IYJ B;  2Q2H A;  4A75 A;  1VCI A;  1X9N A;  2UXC L;  4DV6 Q;  3HOW G;  3PCO B;  2OQK A;  4LF8 Q;  4A3G H;  3CCU A;  4O0A A;  2JA5 G;  1GO3 E;  1HNW Q;  3HOY G;  1Q7Y C;  1MKH A;  3M4P A;  4P73 A;  4GKJ L;  2NZH A;  3CD6 A;  4A3I H;  3MEF A;  2PQA A;  4JI4 Q;  3J81 i;  3CME A;  4X66 Q;  5IE8 A;  3S24 A;  1N32 L;  4UP8 A;  4JI6 L;  4EX5 A;  1OXS C;  2DGY A;  3PUW A;  5IWA Q;  4GNX B;  3K81 C;  4LFA L;  1CKN B;  2CQO A;  1OTC A;  1PHJ A;  1UE5 A;  1YZ6 A;  1XMQ Q;  1GVP A;  1PH4 A;  1Q12 A;  1KRS A;  4OXP A;  2XTI A;  3DLL A;  2VQF Q;  1PVO A;  1J5E Q;  4IPH A;  2OWO A;  3ULL A;  2D62 A;  4PZ6 A;  1VQN A;  4GNX C;  1AE2 A;  4IPG A;  1WYD A;  1AE3 A;  4TVA B;  4FDB A;  1KAW A;  1T9H A;  3TRZ A;  1PFS A;  2ZM6 L;  1B8A A;  1PH8 A;  1RIP A;  4A3C G;  3UE0 A;  4KHP Q;  1UE1 A;  4LUZ A;  4LF5 L;  3ICE A;  5M3M G;  2K5H A;  4GKK L;  4P75 A;  4YCW A;  4BY7 G;  2JA6 H;  3D0F A;  1WCM H;  1S72 A;  2OQ0 A;  2YV5 A;  4LF6 L;  1L1O B;  4TQU S;  2KHI A;  1NMG A;  1I6H H;  1VQC A;  1N34 L;  2B63 G;  4XIG S;  4AYB E;  3PSI A;  1SLJ A;  2K5N A;  2E2H H;  3ZJY C;  3KDF A;  3F2D A;  4JV5 L;  3F2C A;  3VDY A;  4PZ8 A;  4OWT B;  1FJG L;  1FVI A;  4PZ7 A;  2UXD L;  2VW9 A;  1SN8 A;  1DGS A;  3BZK A;  1S3O A;  4DAM A;  4JG2 A;  1I94 L;  4GLX A;  4HID A;  1PH6 A;  3K80 C;  2DUD A;  3H15 A;  2HQL A;  4X64 Q;  3OTO Q;  3I55 A;  5ELN A;  2VL6 A;  3STB C;  3AFQ A;  4A3J H;  4DR5 L;  2IX0 A;  4LUV A;  5IYB H;  5IYC G;  2E8G A;  5HGQ A;  5C0X G;  2WP8 J;  1Y1W H;  5FLX c;  2WAQ G;  1XNR Q;  4A3G G;  4A3D H;  4B3S L;  1P8L A;  2UU9 Q;  3KF6 B;  3S15 H;  2E2J H;  2YU9 H;  1I5F A;  1YEZ A;  3G4S A;  2HHH L;  2UXB L;  4GN4 B;  4NB3 A;  5C0X I;  3ERS X;  3G6E A;  1I3Q H;  1Z9F A;  2JK8 A;  4DR2 L;  2R7Z H;  2EXD A;  1UE7 A;  4JI8 L;  4YY3 L;  3ULP A;  4JCV E;  4GNX A;  4K0K L;  4DPG A;  1CKN A;  2ZTC A;  4JI2 Q;  3L0O A;  1Q81 C;  4NXM L;  1EWI A;  3RN2 A;  5GAD C;  5JEA J;  1YJW A;  3PO3 G;  4BXX G;  4RG1 A;  1K8G A;  2I5L X;  3A5U A;  1NBW A;  1TXY A;  1K8A C;  2UUB Q;  2I5M X;  4OO1 I;  2R93 G;  4LNQ A;  4DV4 Q;  2QA4 A;  5LMU L;  1IBK Q;  3U58 A;  1UEB A;  4JYA Q;  1HNZ L;  2F3I A;  2N8N A;  3F1Z A;  2R92 H;  2A8V A;  2D0P A;  3FP9 A;  4NXN L;  4BY1 H;  3EN2 A;  1VQA A;  4YWM A;  1YHA A;  1IXR A;  2WB1 E;  5C0X J;  5LMN Q;  3PIO A;  1WJJ A;  4DR4 L;  3M7N A;  4HIO A;  4DR3 L;  5M3F H;  1HR0 W;  1TWA H;  3TS2 A;  1O7I A;  2GN5 A;  3S1M H;  2XGT A;  4Y7N H;  3CCQ A;  1KD1 C;  4JI1 Q;  5C4X H;  2NVT H;  4L5S A;  2JA6 G;  1L1O A;  1YIJ A;  2KHJ A;  3NEN A;  3T1Y Q;  2JEB I;  2E5L Q;  2QGQ A;  1IBL Q;  5BR8 Q;  3J80 c;  1NJI C;  4B3M L;  2IX1 A;  2C35 B;  2UUA L;  4Y52 H;  4HIM A;  4LFA Q;  4BBS H;  1X6O A;  4OX9 Q;  3E9H A;  1XNQ Q;  1XPU A;  1BVS A;  4DV2 Q;  4HJ5 A;  4P71 A;  1CUK A;  3HKZ E;  3CAM A;  4JBJ A;  2R6G A;  1VQ4 A;  2R7D A;  2GVA A;  4BBR H;  2WAQ E;  1X3E A;  3LGJ A;  2ZJP A;  4XTC S;  4HJ8 A;  4JI5 Q;  1GM5 A;  3CCV A;  4DUY L;  3UDI A;  4LF4 Q;  5AJ3 L;  5IP9 H;  4DUZ Q;  4IFD G;  1RL2 A;  4LFC Q;  3KFU A;  4PMW A;  2Z6K A;  3KF8 B;  4B3R Q;  5ELO A;  2JQO A;  3STB D;  4UY8 C;  2HIV A;  4HIK A;  1X56 A;  4AYB G;  5HY6 A;  5IYB G;  3B6Y A;  1Y1W G;  4A3D G;  2B3G A;  3KF6 A;  3HOV H;  1VQE A;  3CCM A;  1QZG A;  4J15 A;  4C2M H;  4DK3 C;  1J6Q A;  2BA1 A;  2FXQ A;  2YTX A;  4DR1 L;  3CMA A;  4UP7 A;  4L5R C;  5C44 H;  3PO2 H;  3S16 H;  1X3G A;  1A0I A;  2R7Z G;  2IY5 B;  1JB7 A;  4JBW A;  3S1Q H;  2RHS B;  3NEL A;  1PA6 A;  4B3T L;  3L2P A;  1X65 A;  2AWO A;  4AQY Q;  1IBM Q;  2UUC L;  4LF7 Q;  4P72 A;  1NY4 A;  1QZH A;  1YJN A;  4IFD J;  1TWG H;  3S2D H;  1HZB A;  4QIW E;  1VQ9 A;  4LF9 Q;  4DR6 L;  2RF4 A;  1E3P A;  1P16 A;  4DNI A;  2F4V Q;  4BY1 G;  4QGU A;  3J81 j;  3H0G H;  2K50 A;  3CPF A;  3NEM A;  4LW1 A;  1V9P A;  2AHO B;  3TQY A;  2VQE L;  3TS0 A;  1JJG A;  2Y0S E;  2YYZ A;  4IPC A;  4JI3 L;  5M3F G;  1WI5 A;  2NN6 I;  5H1S E;  5FLM G;  1C7Y A;  4YHH L;  1TWC H;  1VQG A;  3L7Z C;  1YNX A;  2V1C C;  1LM0 A;  3CP0 A;  3S2H H;  5C4X G;  4X6A H;  3CCR A;  1VQ5 A;  3S14 H;  1KQS A;  4YY3 Q;  1XMO Q;  2IT1 A;  4AIM A;  3MXN B;  3UE1 A;  4BBS G;  1VQH A;  5GQO A;  1PH3 A;  4LFB Q;  1KL9 A;  3CQZ H;  2WB1 G;  3K8A A;  1LUZ A;  2KEN A;  4KI0 A;  3T1H Q;  2AMC B;  4GLV B;  3Q8D A;  1NE3 A;  4PG3 A;  4BBR G;  4X65 Q;  4DR7 L;  5GAG C;  3OYY A;  5J3B A;  1N33 L;  2OCE A;  1OXX K;  1VS0 A;  1L1O C;  1HZA A;  2KCM A;  1E1O A;  1VQI A;  2L15 A;  4UP9 A;  5JEA G;  4GS3 A;  5IP9 G;  1MJE A;  4NPS A;  4JI0 L;  1EUJ A;  4JBM A;  5C4J H;  1G51 A;  1QVC A;  2BH2 A;  4DV5 Q;  3I2Z A;  1HNX L;  4A93 H;  4A3L H;  1X54 A;  5E7N A;  3TEH B;  4DV6 L;  4DV7 Q;  2A19 A;  1HH2 P;  3PIP A;  4OWW B;  3AEV A;  4LF8 L;  4MNO A;  3FHW A;  4AH6 A;  1EYG A;  4APV A;  3BJU A;  1HNW L;  3HOV G;  4R4I A;  3HKZ G;  4DK6 C;  4A3E H;  1PH1 A;  4IOC A;  2LSS A;  3CF5 A;  3RLN A;  1W2B A;  2ASB A;  4JI4 L;  2K14 A;  5IYD H;  2PNH A;  3U4Z A;  1JT8 A;  4RMF A;  4X66 L;  1HZ9 A;  2E2I H;  3A74 A;  4A3K H;  3H3V H;  5C44 G;  3J7Z C;  4DV3 Q;  3CCE A;  2HT1 A;  4A3I G;  1CSP A;  2Z6K C;  3GTK H;  5IWA L;  3UDF A;  2BA0 A;  1N36 Q;  4JI7 Q;  1G6P A;  1HR0 Q;  2MO1 A;  4QJF A;  5JJK A;  3EBE A;  4DV1 Q;  1VQJ A;  3GTO H;  3HOZ H;  4YWK A;  3AYH B;  3W1B A;  1XMQ L;  2MFI A;  2GVB A;  3K0X A;  1KXL A;  1VQ6 A;  1A63 A;  2VQF L;  1J5E L;  1HJP A;  3WWV A;  1PH7 A;  3PGZ A;  3RLO A;  5IP7 H;  1BBU A;  4JC0 A;  4DV0 Q;  1D8L A;  1EIY B;  4JBK A;  2ID0 A;  4KHZ A;  4KHP L;  2PI2 A;  1VQD A;  3GTM H;  3PUZ A;  5FJ8 H;  3RZO H;  2UXC Q;  1S40 A;  5C3E H;  4HJ7 A;  5GRO A;  3SGI A;  1VQL A;  4H02 A;  4JOI A;  3D31 A;  2IHF A;  1R9T H;  3RR5 A;  4GKJ Q;  2I5H A;  1NTG A;  1E22 A;  3BZC A;  2CFM A;  2QEX A;  3OW2 A;  1WCM G;  2KCT A;  1N32 Q;  4L5T A;  1Q8K A;  3GDE A;  3CPW A;  4JI6 Q;  3UDX A;  1YIT A;  4B3T Q;  1YBY A;  3AQQ A;  4A4I A;  1U5K A;  3HOX H;  4POG A;  3PUX A;  3F8T A;  4X62 L;  4IO9 A;  1NMF A;  3HFZ B;  4GN3 B;  1OXV A;  1PYB A;  1SMX A;  2Y0S G;  3CC2 A;  1TWF H;  2OTL A;  4X64 L;  2RHQ B;  4YWL A;  3OTO L;  3CCJ A;  5K36 G;  1VQM A;  1PH2 A;  2ZM6 Q;  4GLA C;  4A3L G;  2D0O A;  3K7U C;  5M5X H;  5IY0 A;  5M3M H;  3CCL A;  3S17 H;  2MQH A;  2JEA I;  1M1K C;  4OON A;  1XNR L;  5JJL A;  1KRT A;  3CC4 A;  4A3J G;  4LF5 Q;  2UU9 L;  4A3M H;  4A3E G;  3PUV A;  3M4Q A;  4GKK Q;  5IYD G;  4HJA A;  1JJ2 A;  4YCV A;  1CSQ A;  3J80 i;  4A3K G;  2B63 H;  1CKM A;  4LF6 Q;  5GAH C;  3FKI H;  2ZJR A;  4JI2 L;  4R4Q A;  2VUM H;  1N9W A;  2WFW A;  1X55 A;  1N34 Q;  1LYL A;  3KDF B;  3H3V I;  4WJ4 A;  1K0R A;  2AWN A;  3HOZ G;  2JE6 I;  2F52 A;  3GTL H;  1A8V A;  4DV4 L;  3E9I A;  1VQO A;  4JV5 Q;  4JYA L;  3CXC A;  3CCS A;  4ALP A;  1FJG Q;  1C9O A;  2UXD Q;  2CWA A;  4MZ9 A;  3PV0 A;  3U50 C;  3I4M H;  4HJ9 A;  2JA9 A;  4LUO A;  5IP7 G;  2ATW A;  1QVG A;  3RN5 A;  4A3F H;  3ER0 A;  2JA8 H;  1I94 Q;  2R92 G;  5LMN L;  2N3S A;  1VQF A;  1IL2 A;  5IYC H;  4GN5 A;  1B70 B;  2NN6 G;  5FJ8 G;  4MTN A;  3GTJ H;  1C0A A;  3KJO A;  4DR5 Q;  5C3E G;  1PH5 A;  1ASY A;  4GOP B;  4JI1 L;  1ASZ A;  1WFQ A;  4B3S Q;  3T1Y L;  2E5L L;  2HHH Q;  3UDG A;  1IBL L;  5BR8 L;  3HOU H;  2UXB Q;  3A5Z B;  4DR2 Q;  3RNU A;  3M85 A;  1SRU A;  2N49 A;  3PO3 H;  4OX9 L;  1XNQ L;  4BXX H;  4JI8 Q;  1KHI A;  4LWC A;  2PI2 E;  4DV2 L;  4GOP C;  4K0K Q;  3HOX G;  2K5V A;  1EOV A;  3KJP A;  4DAY B;  1VQK A;  2OTJ A;  4NXM Q;  2R93 H;  3G71 A;  2JJQ A;  2Q2U A;  1Q82 C;  1U0L A;  4R4C A;  4JI5 L;  1H95 A;  4JOI C;  4LF4 L;  4A3B H;  2IHE A;  3W1G A;  1E1T A;  5LMU Q;  4DUZ L;  1K83 H;  1HNZ Q;  4LFC L;  1SRO A;  2ZTE A;  3GTP H;  4B3R L;  4NXN Q;  1EFW A;  4R4T A;  4OO1 G;  4C3J H;  3S1R H;  4IJH A;  3DM3 A;  3S1N H;  4A76 A;  1TWH H;  1LTL A;  4DR4 Q;  4ME3 A;  4R1J A;  1B7Y B;  2EIF A;  2K75 A;  3CW2 C;  1Y1V H;  5DLQ E;  4OWX B;  4DR3 Q;  4A3M G;  1XPR A;  1N8R C;  1UWV A;  5EAY A;  1UE6 A;  3AFP A;  3NBH B;  2ALY B;  2JA7 H;  3JAM c;  1AH9 A;  4R4O A;  4DKA C;  1A62 A;  1Y14 B;  3FKI G;  1PH9 A;  1YVC A;  4B3M Q;  2VUM G;  3PO2 G;  3GO5 A;  1XPO A;  1KIX A;  1K9M C;  2UUA Q;  2MNA A;  2ZJQ A;  3HKS A;  1QVF A;  4AQY L;  4X62 Q;  2YTV A;  1IBM L;  2EQS A;  2NVY H;  3GD7 A;  3I56 A;  4LF7 L;  1SR3 A;  4WJ3 M;  3GTG H;  3M3Y H;  1PYS B;  3I4N H;  4P74 A;  4LF9 L;  1YHQ A;  3I4M G;  2N78 A;  3PF5 A;  1QUQ B;  2Q2T A;  5IT9 c;  2F4V L;  4DUY Q;  3CC7 A;  2CWP A;  4IOA A;  3KYH C;  5AJ3 Q;  2Z0S A;  3U4V A;  3F2B A;  4A3F G;  1L0W A;  1FGU A;  2I0Q A;  2JA8 G;  3K7A H;  1OXT A;  4QL5 A;  1IZ6 A;  1CKO A;  1SE8 A;  2VY3 A;  1M90 C;  3H0G G;  2LXK A;  4KLK A;  1GKH A;  3TRE A;  4GOP A;  3HOW H;  1HZC A;  1JE5 A;  3JAM i;  2NVX H;  2JA5 H;  1V43 A;  1I50 H;  3HOY H;  2VNU D;  1Q46 A;  3I4O A;  3BU2 A;  2RCN A;  1EQQ A;  1EQR A;  2K52 A;  5M5W H;  4UPA A;  4QY7 A;  3PUY A;  3W5O A;  2B29 A;  4DR1 Q;  1VQP A;  1XMO L;  3HOU G;  2PQA B;  2MO0 A;  3PF4 A;  4LFB L;  1KC8 C;  3T1H L;  3J7A 5;  4X65 L;  4L5Q A;  2LXJ A;  1VQ8 A;  1VQB A;  1YHB A;  2UUC Q;  3IRB A;  1EIF A;  1BKB A;  1YI2 A;  3EIV A;  3G48 A;  4A3B G;  1XTD A;  1GD7 A;  4DR6 Q;  1JJC B;  5JJI A;  4DV5 L;  1K73 C;  1WOC A;  4A3C H;  2AKW B;  3RLF A;  4IJL A;  1L2F A;  4DV7 L;  1E24 A;  1YJ9 A;  1SFO H;  3GTQ H;  5FLM H;  4IPD A;  3RZD H;  2YTY A;  4POF A;  4A93 G;  1PV4 A;  1X3F A;  4BA1 I;  2VQE Q;  4C3H H;  1BBW A;  4JI3 Q;  1MJC A;  1MIU A;  3ULJ A;  1Y1V G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...