3I2ZA

Structure of cold shock protein e from salmonella typhimurium
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
b'SHMSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVTAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA chaperone, negative regulator of cspA transcription
publication title Crystallization and X-ray structure of cold-shock protein E from Salmonella typhimurium
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation
total genus 15
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i2zA00
1QZGA 4JI1Q 2KBNA 4IO9A 3K81C 2BA0A 2VW9A 3RLNA 1FJGL 4UPAA 4X66Q 1YZ6A 1I94L 4A3LG 1AE3A 4AH6A 3J81j 1JJCB 1EQQA 4KLKA 3BJUA 2CWAA 1XNRL 4X64Q 1M90C 3RZDH 3UDFA 4JCVE 3U50C 5GAHC 4OX9L 1YJWA 1LUZA 3M4OH 3K8AA 1TWAH 1A8VA 1E24A 2D0OA 4HJ9A 3I55A 1VQKA 2VQFL 3CCEA 4OO1G 1WI5A 2HQLA 4A3DG 1VQDA 2MFIA 4X62Q 1XPOA 4OONA 1E1OA 3LGJA 5M3FG 2VQEL 4A3KG 2ES2A 3HOUG 4DR4L 4DV4L 3U4ZA 4YCWA 2UXDQ 4XIGS 5H1SE 1GD7A 3G71A 4DV1Q 4OWXB 3F2BA 1SFOH 1PH1A 4L5SA 2KHJA 3GTQH 3HOXH 4GN5A 5M3MH 5IYDH 1KC8C 1S3OA 1TWGH 2JJQA 1Q1BA 2NVXH 1KHIA 4LF7Q 3KOJA 5GAGC 4HIKA 2JA5G 4GKKQ 5HGQA 1RL2A 1HZCA 1YI2A 4A3IG 2WP8J 1J5EQ 4RMFA 1A0IA 4R4CA 3PF4A 1MKHA 1TXYA 1N32L 1UE6A 1UE1A 4HIOA 1HR0Q 4DR7L 4GNXC 4DR5Q 1HNWQ 2Z6KA 3CC7A 3U58A 2GVBA 1IBKL 5GROA 3S1RH 4B3RL 2K50A 2XTIA 4PZ6A 1Y1WG 3I4MG 5C0XI 1BKBA 2OQ0A 3CF5A 4BXXH 4C3JH 5C4XG 2LXKA 3H15A 3IRBA 1VQCA 4DAMA 1NE3A 1XNRQ 1FGUA 2JA9A 3HOWH 1ASZA 5IWAL 3ULLA 2F4VQ 3KFUA 2LSSA 4BY7H 3CCUA 4JI4L 1C0AA 4YWKA 2Q2TA 1Z9FA 3M4QA 4C3HH 4AYBE 3CXCA 2NVQH 1TWCH 2VUMH 4DV6Q 4FDBA 4A3EH 1WFQA 1OXTA 1PH7A 2R7ZG 2B63H 4YWLA 4DR1Q 3PUWA 3M7NA 1G6PA 1QUQA 1Z47A 5C0XG 1XTDA 1XPRA 2DUDA 5AJ3L 5C4JH 2LXJA 1G51A 1JB7A 2K5HA 2RHQB 5IP7H 1RIPA 2WFWA 4JI2L 5IYBH 4DV2L 5M5XH 1K9MC 3GTKH 4A3GH 2AWNA 3G6EA 1T9HA 2D0PA 4DUZL 4EQ5A 1N36Q 4JV5L 3AFQA 1PHJA 1UE5A 1CKOA 1K3RA 3KYHC 1S72A 3PUZA 4GN3B 5GADC 1WCMH 4LWCA 3OTOL 1PA6A 3F2CA 3A74A 4KI0A 3CD6A 3RR5A 4GKJL 1U5KA 2Y0SE 2JA7G 1VCIA 1TWFH 4LF8Q 2UUBL 4DV0Q 3K7AH 4JI1L 3GO5A 4PMWA 2PQAA 3S15H 3E9IA 4X66L 4GOPB 3M9BA 4KHZA 1IBLL 4HJ8A 3I7FA 3CC4A 4NXNQ 1NMGA 1X3FA 1PYBA 1B7YB 2YV5A 3EBEA 3K80C 2K52A 5C44G 1YIJA 4PG3A 4X64L 1VQNA 3D0FA 1Q86C 1HZAA 4JI4Q 1XNQQ 1UWVA 4BBRG 3T1HQ 4A4IA 1EIFA 3PO2H 2OWOA 1L1OB 1IXRA 1VQBA 1QVCA 3B6YA 5E7NA 3STBD 1QVFA 1Q81C 1V43A 1NBWA 3CAMA 2ZJPA 4IPHA 3AEVA 5K36G 1YHAA 3CMEA 3KDFB 2RCNA 1KAWA 4X62L 5DLQE 3DLLA 2B3GA 2UXDL 4DV1L 5M5YH 3HKSA 3H3VH 1U0LA 1YEZA 2K5VA 1CSQA 3EN2A 4O0AA 4A3MG 3F8TA 1HH2P 3FKIH 1CKMA 1PVOA 4NXMQ 2CCZA 2DGYA 1Q1EA 4LF7L 4DV2Q 2UUCQ 1OTCA 1OXVA 3D31A 3F1ZA 4JV5Q 4DUYQ 1J5EL 3TREA 1FL0A 4BBSG 1I3QH 3FHWA 4LNQA 1HR0L 1B70B 4EX5A 3GTPH 1HNWL 4DR5L 4JBKA 1KD1C 4JC0A 4GN4B 2E8GA 2ID0A 3NENA 4JOIC 2ZTEA 3A5UA 1SN8A 1K73C 2Z0SA 4A75A 2A1AA 1QVGA 3S2DH 4RG1A 3UE0A 5C3EH 1PH8A 1IBLQ 2R92H 1GVPA 2ZM6Q 4P72A 2VNUD 2JA6G 5BR8Q 2F4VL 3I4NH 1VQPA 1Q12A 3H0GG 1K0RA 4JI7Q 1SROA 1Q82C 3J7ZC 1YNXA 4JYAL 4A3JH 2YTVA 3I2ZA 4KHPQ 4QJFA 1KIXA 2N3SA 3HOVG 3BZCA 2NVTH 5LMNL 3ICEA 1E22A 2YTYA 4DV6L 4A3LH 2JEAI 3PCOB 2I5MX 2N78A 2MO1A 3J80i 2Q2UA 4DR1L 3ULJA 1BBWA 1YHBA 2KHIA 1C9OA 5JEAG 5IYCG 4GOPC 4JBJA 3NELA 1H95A 1PH4A 3RLFA 3PV0A 4TQUS 3ZJYC 1HJPA 2UXBL 3RN2A 2A19A 3E9HA 2UU9Q 1EIYB 2R93G 4MTNA 1HR0W 4A3DH 1X3GA 4OWTB 4DNIA 3HOUH 1IYJB 5M3FH 4A3KH 4IOAA 4R4IA 5IP9G 3GDEA 4LFCL 5FLMG 1Y1VH 4LUZA 4A76A 1N36L 4QIWE 4JG2A 4L5TA 4P71A 4YY3L 4B3ML 3NBHB 1S40A 1VQ8A 3PUVA 4YCUA 4LUOA 4WJ3M 2JA5H 2Q2HA 1X6OA 4LF8L 3PUXA 4DV0L 2R6GA 4BA1I 4DR2Q 4Y52H 3K0XA 4A3IH 4DPGA 3CCSA 3PF5A 1PH6A 3GTMH 3HOYG 3SGIA 3S1MH 1SLJA 4NXNL 3ER0A 1PYSB 3UDXA 2JK8A 3HOZG 1HNZL 4LFBQ 1CUKA 2K4KA 3A5ZB 4R4TA 1E7ZA 3WWVA 4DKAC 3CCQA 3VDYA 1XNQL 3HOWG 4JYAQ 4LF6Q 4X65Q 3RZOH 4OXPA 4DV3Q 3RNUA 4J15A 3T1HL 2JE6I 1YJ9A 1B8AA 1Y1WH 1G291 5LMNQ 4C2MH 3I4MH 4YCVA 4LF4L 4B3TL 4AQYQ 5C4XH 1PH9A 2E2IH 1JJ2A 3T1YQ 2CWPA 4DV5L 3UE1A 2IY5B 1L0WA 2VUMG 2AHOB 1EOVA 4YWMA 2YTXA 3PIOA 4JI5Q 2QGQA 4UP7A 3ULPA 3RLOA 3AQQA 4A3FG 2HT1A 2JEBI 1J6QA 2AKWB 1KRSA 2PI2A 1SMXA 3ERSX 5HY6A 4NXML 2UXBQ 4JOIA 4GS3A 4A93G 1BVSA 2UUCL 4JI6L 1X9NA 2KENA 4UP9A 1PV4A 1QUQB 2IHEA 4XTCS 3CCMA 4DUYL 4LFCQ 2R7ZH 5JEAJ 4B3MQ 4YY3Q 1OXUA 1XJVA 4R4QA 3UDIA 1MJCA 1EYGA 3TS2A 4X6AH 1K8AC 4QL5A 3CMAA 4QY7A 3KF6A 5FJ8H 2MNAA 1PH2A 3J81i 2HIVA 3PO3H 1X65A 1CKNA 1M1KC 3KLWA 2ZM6L 4ALPA 2ZTDA 4R1JA 1HNZQ 3AYHB 1X3EA 4IPCA 4B3SL 1IZ6A 5BR8L 2ATWA 1XMOQ 2PQAB 4HJ7A 4BY1H 4JI7L 1NJIC 3W5OA 1MIUA 1R9TH 4B3TQ 4LF4Q 2JA7H 4KHPL 2NZOA 3KJOA 4IJHA 4HIDA 2BA1A 3F2DA 2UXCQ 1LTLA 4DV5Q 4GLVB 2ZTCA 2EQSA 4A3CG 2N8NA 5C44H 1VQOA 1LYLA 1GM5A 1YVCA 4ME3A 1VQ6A 4GNXA 4JI3Q 2Z6KC 1VQMA 4C3IH 4BBRH 3W1BA 3CCJA 1A62A 1FVIA 1HZ9A 2HHHL 3W1GA 4JI6Q 2PI2E 4UP8A 1X56A 3G48A 1YHQA 2N49A 2NVYH 2UU9L 1HNXQ 4YHHL 3AFPA 2QA4A 2XGTA 4DR3Q 1W2BA 3FP9A 1KXLA 4H02A 1C7YA 4A3BG 4JI5L 1VQ5A 2VY3A 2WAQG 2D62A 4NB3A 3NEMA 4A3MH 5JJKA 4DK6C 3TEHB 3TRZA 3M4PA 1KRTA 1TWHH 4POGA 3G4SA 3E0EA 3KJPA 2QEXA 4DR2L 2JA8H 3UDGA 3I56A 1QZHA 2FXQA 3M85A 5ELOA 4B3SQ 4P75A 4LW1A 2AMCB 4BBSH 4LUVA 4GLXA 1NTGA 1N33L 2VL6A 1IBMQ 4LFBL 2E2HH 3J80c 1HZBA 4AIMA 4LF6L 4X65L 3JAMi 4TVAB 2I0QA 3OYYA 4DV3L 2MQHA 1SRUA 4LF9Q 3PUYA 4JBMA 1E1TA 4A3JG 3CCRA 1YBYA 4AQYL 2VZAA 3CCVA 2UUAQ 1JJGA 3T1YL 2Q2IA 2L15A 1UE7A 3S1NH 2JA6H 2ASBA 3HKZG 3H0GH 2R7DA 4JI8Q 2HHHQ 4UY8C 5JJLA 2JQOA 1OXXK 2CKZB 5IYDG 3HOXG 2PMZE 5M3MG 4K0KL 2I5LX 3S1QH 4YHHQ 4GLAC 3STBC 1O7IA 1V1QA 3MEFA 1L1OC 2WB1G 3CC2A 2E5LQ 3HOVH 4DR6L 1UEBA 1NY4A 2VS1A 4IFDI 3CP0A 5IYCH 1MJEA 1Y1VG 2HIXA 4PZ8A 3S16H 1XMQQ 3PSIA 1P16A 4MNOA 4POFA 1VS0A 1N34L 3GTGH 4BXXG 1Q7YC 1Y14B 2R93H 1YITA 2BH2A 4PZ7A 4LFAQ 1N33Q 3MXNB 4IJLA 1Q8KA 5IP9H 1CSPA 5FLMH 5IE8A 3L2PA 1A63A 2CFMA 5LMUQ 1VQ4A 1PH5A 1YJNA 1XMOL 4BY7G 1AH9A 5LMNW 4L5RC 4LF5L 2OTJA 1VQJA 2IX0A 3TQYA 2R7FA 1N8RC 1FJGQ 3S17H 2NN6I 4IFDG 3RN5A 3HOYH 2UXCL 3S14H 2IHFA 4NPSA 1I94Q 4A3EG 1XPUA 2B63G 3HOZH 1LM0A 1WYDA 4R4OA 1GKHA 4JI3L 1DGSA 5IT9c 2UUBQ 4K0KQ 1JT8A 4OX9Q 1EUJA 1W3SA 2MO0A 4BA2I 1SR3A 5JJIA 3GTOH 4HIMA 3KF8B 5IP7G 4DR6Q 1D7QA 2RHSB 4IOCA 2VQFQ 3U4VA 1IL2A 5IYBG 1PFSA 2B29A 1HNXL 3J81c 3PIPA 4A3GG 3S2HH 4QQBX 1VQAA 3BU2A 4DR3L 1I50H 2A8VA 2VQEQ 1VQ7A 1KL9A 2GVAA 3HFZB 5J3BA 4QGUA 4DV4Q 4DR4Q 5ELNA 2RF4A 1WCMG 4A3FH 2YU9H 2OTLA 2NN6G 1WOCA 3BZKA 3EIVA 5FLXc 4P73A 1N34Q 4A93H 2K75A 1K83H 1VQLA 5GQOA 4JI0L 3H3VI 1VQ9A 5FJ8G 4DV7L 2IX1A 4AYBG 2AWOA 3CW2C 3PO3G 3L0OA 2BH8A 1JE5A 1EFWA 1N32Q 1VQFA 4Y7NH 4DR7Q 1N9WA 3KF6B 1IBML 2OCEA 1OXSC 2F3IA 4GOPA 4IPDA 1IBKQ 4LF5Q 1CKNB 3CQZH 3PO2G 1WJJA 4B3RQ 2KCMA 3GTJH 3GD7A 4BY1G 3CPWA 3TS0A 4LF9L 2C35B 3JC66 1PH3A 2NZHA 2K5NA 2UUAL 5IY0A 1L1OA 2WAQE 1VQGA 1BBUA 3DM3A 2GN5A 2K14A 1NMFA 5IWAQ 1VQIA 3K7UC 1P8LA 3I4OA 4JI8L 3KDFA 2ZJRA 4O2DA 3CCLA 4IFDJ 2F52A 1X54A 1V9PA 3FKIG 2CQOA 2IT1A 4APVA 1K8GA 4OWWB 1EQRA 5GAEC 2Y0SG 4GNXB 3L7ZC 1X55A 5M5WH 3OW2A 2E5LL 1VQHA 3A0JA 4A3CH 4MZ9A 1JMCA 2KCTA 3PGZA 4HJAA 3Q8DA 2EXDA 3S24A 4DAYB 1AE2A 2EIFA 1KQSA 4P74A 5AJ3Q 4L5QA 1I6HH 3JAMc 4JI0Q 1E3PA 4DK3C 1L2FA 1XMQL 1Q46A 4DV7Q 4JI2Q 3M3YH 1SE8A 5C3EG 2R92G 5EAYA 4GKKL 2YYZA 3J7A5 2PNHA 4IPGA 4DUZQ 4LFAL 1GO3E 3HKZE 2JA8G 4A3BH 2OQKA 2ZJQA 4OO1I 5LMUL 1VQEA 5C0XJ 3I4NG 4WJ4A 1ASYA 4HJ5A 3OTOQ 2ALYB 2E2JH 2I5HA 1D8LA 3CPFA 2V1CC 1EWIA 4GKJQ 3GTLH 4JBWA 1I5FA 2WB1E 2H5XA
chains in the Genus database with same CATH superfamily
2KBNA 3K0YA 3RLNA 4X66Q 3KK7A 3D6CA 3T16A 3BJUA 2WIIB 2A69C 2EY6A 1D1IA 1S4ZA 4XDXA 3GQBA 3U50C 1ET9A 1YJWA 3M4OH 1SYGA 4G7OC 3OOCA 2PW5A 2D0OA 4HJ9A 3I55A 1VQKA 4OO1G 2HDLA 1WCMB 1VQDA 1QILA 4OONA 1E1OA 2VQEL 3QG1A 4DR4L 2WKCA 4K2LA 5H1SE 2UXDQ 1EY5A 4DK1A 2NVXH 4LF7Q 3KOJA 5GAGC 2JA5G 4GKKQ 5HGQA 2KUMA 1RL2A 1HZCA 2E2DC 1YI2A 2WP8J 3PF4A 1N32L 2TSSA 1UE1A 5E4XA 4K5VA 4X3TA 3U58A 4X3UA 2K04A 1C48A 4B3RL 1ZXTA 1Y1WG 4BXXH 1B3AA 1LTID 2EY1A 5EKKA 1NE3A 5EBCA 3HOWH 2F0HA 1ASZA 2B2VC 2K01A 2K33A 2XWBB 2XSCA 5DNFA 1C0AA 1SNDA 4YWKA 2Q2TA 3M4QA 1R4QB 2NVQH 2FFKB 4DV6Q 4FDBA 1STAA 3D8GA 2R7ZG 4DR1Q 1G6PA 5DM73 1WTPA 1B50A 1QUQA 3L9AX 1CI3M 1JB7A 1VMPA 1Z6HA 2E76C 2WFWA 4JI2L 1JR0D 3GTKH 3M4OB 4DAPA 2AWNA 2D0PA 1UAPA 3GV6A 1N36Q 4V190 3KYHC 1S72A 1PA6A 4LWCA 4J1MA 1VCIA 1WTHA 3VR2A 1IKMA 2PQAA 4DXGA 3E9IA 4X66L 4P2CB 3S15H 1BXTA 2NVXB 1KNEA 4J8QA 1ML0D 4FYDA 2K1BA 1X3FA 1YIJA 4PG3A 1VQNA 3D0FA 1S5FD 4JI4Q 5AFWA 3T1HQ 3PO2H 1BO0A 2Q8RE 3BVZA 3QO2A 5M3FB 3HOUB 3P20A 3B6YA 2L1BA 5E7NA 3FDTA 3STBD 1QVFA 4Z9CB 3AEVA 5LHY1 1YHAA 1WTVA 1F2YA 4BS9A 4ZKCB 4HN7A 5IGGA 3CMEA 2RCNA 4JPBW 2E75C 1WD1A 2UXDL 1NUCA 5M5YH 1U0LA 3EN2A 4A3MG 1PVOA 4NXMQ 3QB3A 4LF7L 4DV2Q 2QDBA 3NTKA 5IGBA 1OTCA 4FF3A 3D31A 3BVGA 3F1ZA 3T51B 4JV5Q 4DUYQ 1V1OA 5EGTA 1FL0A 1I3QH 5FOBB 1A2UA 2NVQB 2KECA 2E2IB 2EY5A 1TU2B 2ID0A 4JOIC 3TP8A 1STEA 2Z0SA 1EY6A 2X69A 3S2DH 4RG1A 3NE5B 2GA4B 5TSSA 1PH8A 1IBLQ 2R92H 1PFBA 1B1ZA 1SNQA 3MTSA 1ICWA 3H0GG 1I4HA 3VYTA 1K0RA 2XNAC 3J7ZC 4A3JH 2FMCA 2OEOA 4QJFA 2JSOA 2N3SA 3HOVG 2NVTH 4RH6A 1EY0A 5LMNL 2K28A 3ICEA 3TBIB 4DV6L 5G3LD 2Q2UA 4DR1L 4AYBB 1E2ZA 1YHBA 3PO3B 1C9OA 4FXKC 4IUVA 3M7GA 3NELA 1PH4A 1EY8A 2WV6D 4CGYB 1ILQA 1HCZA 1HTPA 1HR0W 3SVMA 4BY1B 4OWTB 4IOAA 1HXYD 1PRTB 2PPBC 1N36L 1Y1VH 4QB4A 4QIWE 4JG2A 2EYOA 5CV6A 3PUVA 1STGA 1X32A 1O80A 4LUOA 4PNYA 3MXUA 3A7LA 2Q2HA 5M5YB 4Y52H 4BA1I 2L12A 4DPGA 1PH6A 2WACA 3SGIA 3NTIA 3S1MH 5D3IB 1PYSB 4LFBQ 2ZXOA 3VDYA 5CV5A 4KD4A 4X65Q 1HA6A 3T1HL 4J15A 2JE6I 4TKOB 1HFNA 2DJFC 1G291 4H0LC 4C2MH 4DAVA 4LF4L 5IGDA 2EYMA 4DV5L 3IFTA 3S2DB 2IPKD 2VUMG 2AHOB 3VR6A 1EOVA 1EL0A 3MWYW 3RLOA 2JA8B 3AQQA 1SNCA 2AKWB 1SMXA 4NXML 3PQIA 4GS3A 1EU4A 4CJ1B 2KENA 5G3LF 4FNFA 2IHEA 4DUYL 4LFCQ 5J39A 3EVQA 1OXUA 2NVTB 5C0XH 3TS2A 2EYPA 4X6AH 1K8AC 1AEXA 3SDZA 4NDXA 4V0BA 4K6LA 1PH2A 3J81i 2XWJB 1CKNA 1SJHD 4R1JA 1HNZQ 2RDGA 3AYHB 3S1QB 4RAUC 1XMOQ 4HJ7A 3DHQA 1PRTC 1NJIC 1MIUA 1R9TH 2JA7H 1XTCD 1TR5A 4HIDA 2BA1A 1H9KA 1JORA 4EVOA 4A3CG 3E5SA 1VQ6A 3GTGB 1LTSD 2L9HA 4H13C 4C3IH 3S1MB 3W1BA 4B9WA 3W1GA 3C1FA 4UP8A 3G48A 5BN3A 1YHQA 2NVYH 4DAYA 5K36H 1H9RA 3ERQA 2KJXA 4FVMA 4ZUJA 2VY3A 2WAQG 1XWEA 2B2VA 3S14B 5JJKA 3HRZC 1KRTA 5ELDA 2QEXA 1QB5D 1QZHA 3M85A 4B3SQ 2AMCB 2RDFA 4GLXA 4LFBL 2VL6A 3NBIA 1PXUA 3J80c 3K57A 4X65L 3OYYA 5EPKA 1KTKA 2CQAA 2LFNA 1IYVA 3J80E 2ENBA 1RKNA 2UUAQ 3OMCA 2HD3A 2XRSD 4A93B 2ASBA 5T1IA 3T53B 4IN3A 3VR4A 2HHHQ 3OIQA 1ESRA 3CU7A 3W2DA 1HPCA 3MEFA 1JWSD 1SMYD 3D4RA 3CC2A 2E5LQ 4DR6L 1BOSA 3PIO3 1R9TB 2JA7B 1NY4A 3GTJB 5CYUA 4RKLA 1VMCA 2NB0A 1II3A 2D5DA 2OF1A 3KUPA 1VF7A 4PZ8A 5I6YA 1STYA 1XMQQ 3PSIA 4MNOA 4BXXG 1SSOA 4K14A 1Q7YC 2LS01 3J7YW 1GOZA 3MXNB 1CSPA 5ISRA 1PTOH 1ZYRD 4OGQC 4WORA 3NP8A 1YJNA 1XMOL 2R61A 3ND9A 1E2VA 1O78A 4LF5L 4XT3B 3TQYA 1SE3A 1T5EA 3OW7A 3RN5A 1D6EC 4OEMB 4EQNA 1I94Q 3DMUA 3QIAA 3HOZH 1L0XB 1WD0A 2G9DA 1DGSA 1JB3A 5IT9c 1W3SA 2MO0A 1CFMA 2E74C 1IYUA 1SR3A 4BA2I 1B2TA 1BBXC 5C3XA 2VQFQ 1WTQA 1PDQA 5IT9E 2KOLA 1Q8IA 1SYDA 2MUYA 3VA7A 1KL9A 2GVAA 5J3BA 1RODA 4DV4Q 5ELNA 5ELEA 3I8ZA 4KN7C 3IFDA 2RA4A 1K83H 3FPPA 3OIPA 3SE0A 1VQ9A 5FJ8G 4DV7L 3RZDB 4AYBG 1HQRD 3SK4A 3CW2C 3PO3G 1BCPD 3L0OA 1TWAB 1EFWA 4Y7NH 3KF6B 4IUTA 1LT4D 3CQZH 3PO2G 1WJJA 1K3BC 3GD7A 4BY1G 3K5LA 3CPWA 2OXPA 2C35B 4QCLA 1PH3A 2UUAL 1CQVA 1M8AA 1W6KA 5IY0A 2WAQE 5M3MB 1V8QA 3DM3A 4L63B 1LT5D 4HTHA 5CGKA 3K7UC 4O2DA 3Q0AA 1X54A 2A6EC 4APVA 4OWWB 2AQ2B 5FK9C 3OW2A 1H9JA 2LKVA 2E5LL 5JVH3 1EFID 2ZXRA 5FO9B 1KQSA 4L5QA 1GXDC 1I6HH 4N8FA 3JAMc 4JI0Q 1JCKB 1L2FA 1SYBA 1XMQL 3AMUA 4ZKBB 1TS2A 4BY7B 2R92G 5EAYA 2D2CC 2YYZA 2PNHA 4DUZQ 2JA8G 4DU9A 2OQKA 3JAME 1TS4A 4OO1I 1JWMD 1TWCB 5IGFA 2L11A 2E2JH 1GUWA 2I5HA 4A3EB 3CPFA 1EWIA 3GTLH 1I5FA 2H5XA 1YNND 1QZGA 4IO9A 1BCPF 4UPAA 3VR5A 1DOLA 5C4JB 1I94L 1K83B 2ZT9C 4AH6A 2CWAA 4X64Q 2BE5C 3UDFA 1CZGA 3KLRA 4DNTB 4Y7NB 2F0VA 3K8AA 4XT1B 1EYAA 2VXWA 2F0NA 3CQZB 2VQFL 1WI5A 2HQLA 4X62Q 1XPOA 4DV4L 2XVSA 4YCWA 1RCVD 3KLSA 4UDUC 5HURA 4L5SA 4G57A 2PZTA 2BCOA 4KTAA 2PYKA 3HG9A 4HIKA 1STBA 4CDCC 1TT2A 1PTOC 1A0IA 2J4XA 2LY7A 4HIOA 1RD9D 1BF4A 2K5DA 4DR5Q 2GVBA 4G7HC 2QW7A 3C2PA 2K50A 4PZ6A 4LMQD 2OQ0A 2H4OA 4C3JH 2LXKA 3IRBA 3X3MA 5JJZA 2RDHA 3I72A 4U68A 3ULLA 2F4VQ 4KD3A 2QILA 4WRDA 3CCUA 2B8GA 1SNOA 2A6ED 4AYBE 3CXCA 2VUMH 3GTLB 1WFQA 1PH7A 4YWLA 3PUWA 3T4AC 1ENFA 3M7NA 2B39A 4ODGA 3TMEA 1Z47A 5C0XG 1XTDA 4CDFC 2LXJA 5K5PA 5CBAE 3I4NB 1E2WA 3G6EA 1FYCA 4DUZL 3NWSA 3AFQA 1PHJA 3VA5A 3E0JA 1CKOA 1K3RA 3CKIB 4CDEC 4G7ZC 4GN3B 5GADC 1WCMH 2PQEA 3F2CA 4KI0A 4ZCKA 1KDAA 2EJGC 2JA7G 2K7VA 3J81L 2F4IA 4LF8Q 2JYOA 4CHTB 4DV0Q 1I4GA 4RGNA 4PMWA 3OHXC 4HJ8A 3A7AB 4NXNQ 1PYBA 3K5OA 2YV5A 1PZJD 2K52A 1KDBA 4X64L 1HZAA 4C3IG 4A4IA 1EIFA 3MXGA 1IXRA 2N88A 4A3KB 4NW2A 3ND8A 1NBWA 3CAMA 4MN3A 4IPHA 4ZUIA 2ZJPA 5K36G 1KAWA 4X62L 4FF1A 2EY2A 1HUNA 5KNDA 3HKSA 3H3VH 4ME5A 1TVXA 2UUCQ 1OXVA 1EZ8A 2A5HA 3TREA 2WINB 1PTOD 2F0MA 4FO2A 1U4LA 4LNQA 3NWTA 4DR5L 5C4XB 4JBKA 1DXMA 1KD1C 3LNNA 3A5UA 2MGSA 1LTTD 4A75A 2A1AA 2BOSA 2CW0C 5C3EH 2EDGA 3CRKC 1NR4A 2ZM6Q 5COYA 2MJ8A 5BR8Q 2F4VL 1VQPA 1R4PB 5A2QE 5C5MA 4LK1C 4JYAL 2YTVA 1ET6A 1F9QA 1EYCA 1F9SA 2JEAI 3PCOB 2I5MX 5EBDA 2MO1A 3J80i 2A68C 3ULJA 3I73A 1BBWA 4KY7A 4EQPA 2KHIA 1JWUD 1H95A 2SNMA 2JP1A 5I9OA 2HQEA 3ZJYC 5JAVA 2UXBL 3RN2A 3E9HA 1EIYB 3K5MA 3G7LA 3HOUH 1IYJB 5M3FH 1OO9B 3GDEA 4LUZA 4ULLA 5NUCA 4A76A 4P71A 4B3ML 4YY3L 2F0KA 1S40A 1CA6A 3MXNA 3F2UA 4WJ3M 1TIID 1CK1A 5EPLA 2F0QA 4LF8L 4DR2Q 4DV0L 2R6GA 1PTOF 3QOJA 4A3IH 2AUKA 2Y0SB 3ER0A 2CHBD 4NXNL 3HOZG 1CUKA 1Y8OB 2K4KA 3A5ZB 3WWVA 4DFAA 3CCQA 2DY8A 1C8CA 1PFMA 3TZDA 4DV3Q 1YJ9A 1B8AA 5LMNQ 4YCVA 4B3TL 4AQYQ 1PH9A 2E2IH 3TN2A 3R8BA 1GUNA 3UE1A 2IY5B 1L0WA 1BDOA 2IW3A 5C3EB 3DEPA 3PIOA 4M1UB 1I4XA 2EPBA 4RGOS 4ABNA 4F87A 2M2LA 2UUCL 4JI6L 1X9NA 4RHRA 4UP9A 5JPNC 4HCSA 4XTCS 3NTHA 3URYA 2IX3A 4CKCA 2VB2X 1F77A 2Z6BA 1JE4A 1NNXA 4QL5A 4QY7A 3S1NB 3KF6A 5FJ8H 3PO3H 2G9HD 3SK6A 2CW0D 1M1KC 3KLWA 2ZM6L 3WOFA 2A69D 5BR8L 2ATWA 4G4KA 1VDZA 4BY1H 4LF4Q 5DAUA 3TSSA 2AUJD 2F0OA 4DV5Q 3S9WA 4GLVB 1LLRD 1B3QA 1KAAA 3S16B 5C44H 1VQOA 4MTKA 4A3IB 3CHBD 4ME3A 5KYIA 1VQMA 3IKJA 4OHJA 1IW7C 1FVIA 1HZ9A 4O1NA 1X56A 3A55A 5E1FA 1LO5D 3A8IE 1HNXQ 4KKUA 4DR3Q 1W2BA 1KXLA 1CTMA 1DCZA 4NB3A 3S17B 3NEMA 3TRZA 3Q23A 3M4PA 3UI2A 3T56B 2CVRA 2M00A 4DR2L 2JA8H 3UDGA 4BWGB 4K6DA 1RF2D 1LABA 3GTOB 1N33L 1IBMQ 1HZBA 3V96A 4AIMA 1ICFB 3JAMi 4DV3L 1I50B 4LF9Q 4JBMA 4B08A 4AQYL 3CCVA 2YU9B 2QCPX 2JA6H 2M9VA 3HKZG 1EU3A 1DZ1A 2JQOA 3MEHA 4K0KL 3S1QH 3AB9A 1AZQA 4GLAC 5D65A 4ZRZA 1EEID 1JOKA 5JEAH 5IYCH 1MJEA 4IALA 4DNRB 5C44B 3MC0B 1VS0A 1QOHA 1N34L 3GTGH 2R93H 1Y14B 4XXEA 2RBMA 3OPOA 4C3JG 4PV1C 1YITA 1CM9A 4LFAQ 5IP9H 1Q8KA 5IE8A 1A63A 1SAPA 5CR3A 1VQJA 2IX0A 1T5XD 1N8RC 1FJGQ 3HOYH 3S14H 3MZ5A 1LM0A 1TQOA 4O42A 5I6WA 4K5XA 1LTBD 1JT8A 4YIJA 4IUQA 1IW7D 4QF4A 3KF8B 1JQYD 4FP5D 4DR6Q 1D7QA 3QOLA 3HP3A 1IL2A 2B29A 1HNXL 1KLUD 3S2HH 1A3VA 4DR3L 4QGUA 2F0FA 2F0PA 1XYIA 1WCMG 2OTLA 2JA6B 5FLXc 1PZKD 4A93H 1BCPB 4MHEA 2A6HC 1AW7A 5FLXE 1N9WA 1IBML 4GZYC 1U4RA 1IBKQ 4LF5Q 3GTJH 4LF9L 2EJMA 1SFOB 3SEBA 1HQMC 3GTQB 1A2TA 1DM0B 1VQGA 3SR1A 5CC4A 2GN5A 2R93B 1SE2A 5IWAQ 1VQIA 4OELB 5I2XA 3I4OA 4N8X1 2ZJRA 4C56C 3MAQA 3FMCA 1K8GA 2Y0SG 1X55A 3TDQA 3A0JA 4Q5VA 4ZYSA 3S1RB 2PMZB 5M9OA 2KCTA 3PGZA 2Q8IB 2F0UA 4HJAA 3HOYB 2B2WC 1G2TA 1AE2A 2EIFA 1UEAB 1EY4A 3FVQA 1GHKA 3EA6A 4DV7Q 1G2SA 1MSGA 5C3EG 4IPGA 5C4HA 1CT1D 4LFAL 1GO3E 1RHPA 1QCBD 3HKZE 4A3BH 2EE1A 4C3HB 3S2HB 3LWUA 4WFN3 1TY0A 3OTOQ 2ALYB 1SYFA 3E6ZX 5EQ0A 5J1ZA 3HGBA 1UUPA 2UUBQ 3AU7A 1Y8PB 5FO8B 1FJGL 3K81C 2DNEA 1MI2A 2F03A 3J81j 1JJCB 5IGCA 1XNRL 1M90C 4A3GB 3RZDH 4JCVE 2ICEC 3I91A 1TWAH 1A8VA 1D1KA 1E24A 1NAPA 5J22A 1QNKA 3CCEA 1DYQA 1DD2A 1IKLA 3VR3A 3J80L 3HOUG 2N55A 5M3FG 1TWFB 1EOTA 5DM63 1AZPA 1S5DD 4XIGS 1GD7A 3G71A 4DV1Q 1PH1A 2F1MA 2KHJA 5IYDH 3HOXH 5M3MH 1S3OA 2JJQA 3MHBA 2J0TD 3J7AF 5KNCA 4A3IG 2DY7A 4F7XA 4RMFA 2IJ0A 2EYLA 4R4CA 2A6HD 1UE6A 1HR0Q 1QNUA 3Q22A 1VF5C 1IBKL 2C5CA 1PRTD 4H44C 2XTIA 3QWNA 5C0XI 4RGMA 1ENAA 5KRUA 3H15A 1VQCA 2XN9C 3DWPA 3FKIB 4X3KA 4DAMA 3OWFA 1FGUA 3H94A 5IWAL 2O2LD 3KFUA 2A74C 2LSSA 4BY7H 4A3BB 1LV9A 4UHVA 1H9SB 3BYYB 1ZKOA 4XQQA 4HSVA 1Z9FA 4IFDH 1TWCH 4A3EH 1RJTA 3A8KE 2B63H 4RKBA 4FF2A 4ZAIA 1XPRA 3TP7A 2DUDA 5C4JH 1ILPA 1G51A 2K5HA 1RIPA 1CHPD 2F0TA 1FNUA 5M5XH 1K9MC 5IGEA 3RD4A 1T9HA 3G6JB 4EQ5A 5IT9L 5F2DA 4UAIA 3PUZA 3OTOL 2NN6H 3A74A 2DJGC 3A8JE 1LACA 3VYUA 2Y0SE 5ELCA 3OMGA 2UUBL 2EJFC 3K7AH 2EVBA 3GO5A 2HCIA 3HOXB 4IUNA 2G5DA 3M9BA 4KHZA 4N9PA 3GV3A 4K2KA 3CC4A 1B7YB 5C5LA 5C44G 3DXJC 1PRTF 1XNQQ 2F3VA 1UWVA 3TP5A 4CKBA 1L1OB 1VQBA 5CV9A 1WTWA 1BNZA 5JPMC 3BS1A 2OWOA 1QVCA 2B2YC 1D2BA 2MHVA 1Q81C 2V4DA 1EQVA 4L8JA 1SDFA 5DLQE 1Q3LA 3DLLA 2K5WA 4DV1L 3K6OA 1LTAD 2K5VA 3GTMB 1CSQA 3F8TA 1W6JA 1CKMA 4FXDA 1QE6A 2K5QA 2K6AA 1GHJA 1G91A 4KJOA 1LT6D 1RDPD 3RZOB 2O5JC 5L37A 1HR0L 3V05A 4RFBA 1J9OA 4JC0A 4GN4B 2E8GA 2B63B 1K73C 2ZTEA 2F0IA 3X3NA 1H9MA 4K8IA 1QVGA 3SK5A 1TY2A 1GVPA 5LL6X 4EQOA 2JA6G 5M5XB 3I4NH 3QR8A 3JAML 1Q12A 4KHVA 1STNA 2NBFA 3NK9A 4JK1C 4KHPQ 1KIXA 2H1EA 3BZCA 1I4QA 1YNJC 3WOEA 3BG3A 1O7LA 4A3LH 5CMDA 2F0JA 2N78A 3DEOA 3K7AB 1X3PA 3IAYA 5EKLA 5JEAG 5IYCG 4XQJA 2FMMA 3RLFA 1HJPA 2A19A 2R93G 4MTNA 1B53A 4A3DH 1X3GA 4DNIA 1U9RA 4A3KH 1CZWA 3P7JA 4R4IA 5IP9G 4JI5Q 4HAEA 3O13A 3NPPA 2HDMA 4KKTA 3NBHB 1X6OA 3PUXA 4DN4M 2OT2A 3K5NA 5IIFA 3PF5A 3CCSA 3HOYG 4PMCA 1SLJA 3DWQA 3UDXA 5CV4A 4R4TA 2B2WA 1E7ZA 4HMJA 1XNQL 3K58A 4JYAQ 4OXPA 3RNUA 2KVMA 3I4MH 4OIKA 4IURA 5C4XH 4A3MB 2C9OA 4C3HG 2CWPA 4DXFA 3KF8A 1TWHB 2QGQA 3ULPA 1DOKA 2L55A 1J6QA 1KRSA 2PI2A 3ERSX 5HY6A 2UXBQ 4A93G 2E2HB 1PV4A 3I4LA 3CCMA 1ESFA 5JEAJ 4K8JA 4B3MQ 4YY3Q 3E3XA 1JOOA 2SOBA 3W3AA 1EYGA 3NSWA 3CMAA 1MHWC 2MNAA 5KNBA 5CV7A 2HIVA 3H0GB 5D3DA 4IPCA 4DF7A 5KEEA 3HOVB 4OL7A 3IL8A 4A3DB 2BE5D 2KEDA 3W5OA 4B3TQ 4KHPL 3NQIA 2NZOA 3OSOA 1LTGD 3F2DA 2UXCQ 2EQSA 4IUPA 1GM5A 1YVCA 3BVMA 2NTSA 3BDOA 2Z6KC 4BBRH 3CCJA 5D14A 1A62A 3BYTB 3I90A 4JI6Q 2I07B 3HZXA 1SNPA 2K32A 2PI2E 3OWEB 2N49A 1GUOA 4YHHL 3VYRA 3AFPA 2XGTA 3I4MB 4H02A 1C7YA 4A3BG 5CORA 4JI5L 1VQ5A 4ZLTF 1C4QA 4XYOA 4DK6C 4X3SA 1A6XA 3TZUA 4POGA 2EOTA 3E0EA 3KJPA 2FXQA 5ELOA 2KEEA 4P75A 4C1NI 4BBSH 1NTGA 2MP1A 5FO7B 1EIGA 4TVAB 2F0GA 2MQHA 4DA2A 4RHSA 1YBYA 2VZAA 4FXGC 5C6AA 3BDLA 3S1NH 5LL6S 5C4ZA 1MBYA 4DGZA 1D5XC 2B2UC 1UNSA 2R7DA 5JJLA 2RSNA 5IYDG 3HOXG 2PMZE 5M3MG 5A2QL 3STBC 3K59A 1UEBA 2Z4HA 3BDCA 2HIXA 3U9SA 3S16H 4BBRB 2B2YA 4KKSA 2BH2A 1N33Q 4IJLA 5FLMH 1S5ED 5LMUQ 4HEDA 1FR3A 2B8FA 1S5CD 4PMBA 5M5WB 1PH5A 4BY7G 1AH9A 1EIHA 2OTJA 2I46A 2R7FA 4R8NA 3S17H 1SJED 4IFDG 2UXCL 2KHSA 2IHFA 2F0SA 1H9SA 3QJYA 4A3EG 1XPUA 2B63G 1EWCA 4RGTA 1SYCA 2K03A 4R4OA 1HTLD 5E4WC 4K0KQ 4BBSB 1A3TA 4OX9Q 1EUJA 5I4DA 2O5IC 2PCFB 2WAQB 3GTOH 4HIMA 5JJIA 4IOCA 4HSPA 2SEBD 4CJ0B 1PMRA 3BU2A 3LX0A 1I50H 5I2YA 1JC7A 1VQ7A 3FEWX 2AQ3B 3KBGA 4A3FH 2YU9H 1LT3D 2NN6G 3BZKA 3EIVA 4P73A 1N34Q 1AP0A 5GQOA 3H3VI 1HA5A 1QJOA 1EWHA 2AWOA 1BR9A 1Z7TA 5T1GA 3DM1A 1V1PB 2CH4W 1WTOA 4DR7Q 2OCEA 4H7BA 1E0BA 1EZ6A 4ID6A 3SHLA 2JXMB 3JC66 2NZHA 2K5NA 1L1OA 3H3VC 2A68D 1NMFA 4ZK9B 1P8LA 1B9NA 4IFDJ 2IT1A 1EQRA 1O7YA 5GAEC 4GNXB 3L7ZC 5ELFA 4RCOA 2A73B 4MZ9A 3Q8DA 1B9MA 2EXDA 3S24A 5AJ3Q 1D5MC 3MVVA 5E3FA 1J8IA 1E3PA 4DK3C 3HOWB 1Q46A 3M3YH 1SE8A 1HUMA 4GKKL 5BN4A 2AQ1B 2X6LA 1PYWD 2QF7A 5LMUL 1SE4A 3I4NG 4WJ4A 1ASYA 4HJ5A 3J7AV 4GKJQ 4A3FB 2LMCB 4JI1Q 3ZYYX 2BA0A 3R93A 2VW9A 4J6HA 1A3UA 1YZ6A 4A3LG 3GP7A 1AE3A 4KV6A 1EQQA 4KLKA 3GTKB 3EJIA 5GAHC 4OX9L 1LUZA 1DJRD 1CHQD 4I7AA 4KJNA 4A3DG 4HR7B 2MFIA 2ES2A 1KNAA 4A3KG 3LGJA 1AN8A 3N6RA 2DN8A 3U4ZA 4OWXB 3F2BA 1SFOH 3S15B 1Y8NB 3GTQH 4GN5A 1KC8C 3PIP3 1TWGH 1Q1BA 3DUZA 1KHIA 4QMGA 4F88A 5EJWA 3NBHA 1J5EQ 3PO2B 3SK8A 1MKHA 1FNVA 1TXYA 4ILWA 1HFGA 4DR7L 1RTOA 4GNXC 1EQTA 2NUCA 1HNWQ 2Z6KA 3CC7A 3WDNA 5GROA 4IQZA 3S1RH 4TSSA 3MFYA 4JW0A 3I4MG 3CF5A 1BKBA 5C4XG 2B2TC 4M8AA 1EY9A 5EPJA 1WTXA 3N52A 4XQNA 2JA9A 1XNRQ 3M3YB 2NYZD 3NQTA 4JI4L 1I3QB 4C3HH 4R8IA 1KLGD 5I9PA 1OXTA 3I70A 1FGBD 1GJXA 1F2ZA 2F0LA 3M4YA 2R92B 1L0YB 3R2TA 5AJ3L 2F3WA 2RHQB 1F9RA 5IP7H 1PZID 5EKIA 3H09A 5IYBH 4DV2L 1SMYC 2RCFA 4A3GH 4A3JB 4JV5L 3D4DA 1UE5A 2L4NA 2FHTA 2B2UA 3MFGA 4C1NK 3CD6A 4I7ZC 5C3WA 3RR5A 1Y69U 4GKJL 1U5KA 1TWFH 3P1HA 4JI1L 4GOPB 1TWGB 2QDLA 1IBLL 3I7FA 1NMGA 2WB1B 3K80C 4CBVA 3EBEA 1ZYRC 3KBXA 5FLXL 3ONAB 1Q86C 4BBRG 1K8MA 1Y1VB 1V43A 5ELBA 4E6IA 4CDDC 5KYLA 3KDFB 1K0SA 2ZXPA 4JVZA 4KN4C 4HCEA 2B3GA 1MSHA 2FINB 1YEZA 4O0AA 1HH2P 3FKIH 3TP6A 2CCZA 2DGYA 1Q1EA 2MPMA 2RSOA 4F8MA 1J5EL 4FF4A 4BBSG 2CH4A 3FHWA 1WVLA 4C2MB 1B70B 4EX5A 3GTPH 1HNWL 1D5ZC 3NENA 4LAAA 1SN8A 1SYEA 2L0CA 4OIJA 4MIUA 3EQLC 3UE0A 4P72A 2VNUD 1BCPC 3EROA 2KA7A 2VB3X 1CQFA 1SBBB 1DOMA 2EXZA 2HCCA 2KCCA 2Z8LA 1SROA 1Q82C 4JI7Q 1YNXA 3I2ZA 1K28A 4RA8A 2EYFA 2P5ZX 1E22A 3I3CA 2YTYA 1F2MA 4N9TA 1TKWB 3V2TA 2NWGA 1RTNA 1FD7D 4GOPC 4JBJA 4K5WA 4LJZC 3PV0A 4TQUS 3Q6SA 2BDNA 2K05A 1CA5A 4OO1H 2UU9Q 4S3SA 2WKDA 3RUZA 1HRJA 4LFCL 1GUSA 5FLMG 4L5TA 3H91A 1VQ8A 4YCUA 3VYSA 2JA5H 1QG7A 5BN5A 3K0XA 3SXHA 1S5BD 4C3IB 2Z4IA 3GTMH 1JICA 4PQXA 2JK8A 1HNZL 1STHA 4DKAC 2PW7A 2NVYB 1ONLA 3HOWG 4LF6Q 3RZOH 3GTPB 1Y1WH 1YNNC 3HS0C 1G8ZD 1JOQA 1JJ2A 2SNSA 3T1YQ 2NZ1D 3C46A 4YWMA 2YTXA 4UP7A 4A3FG 1NSNS 1TS3A 2JEBI 1TS5A 2HT1A 4B9XA 2PNRC 4JOIA 3L3OC 1KDCA 1B44D 1BVSA 2KCNA 1QUQB 2BDOA 2R7ZH 1BQQT 2X6GA 1I4PA 1XJVA 1ZEQX 1EEFD 1IHZA 4R4QA 3UDIA 1MJCA 1HHVA 1B4OA 1V1PA 1X3QA 2FJ2A 1FNWA 1DONA 4CKEA 1X65A 4ALPA 2ZTDA 3D3RA 1X3EA 4B3SL 1IZ6A 3R2IA 2PQAB 1MD2D 4JI7L 1IL8A 2F0DA 3KJOA 4IJHA 1EY7A 1LTLA 4NMZA 2ZTCA 1PFNA 2JA5B 2N8NA 1LYLA 4GNXA 4JI3Q 2HHHL 3MXPA 4ZQ3A 1PTOB 2Z1CA 2UU9L 2QA4A 1BUVT 1Y1WB 3FP9A 2B2TA 2D62A 5A35A 2Q8TA 4A3MH 4KMUC 3TEHB 2TMPA 1SNMA 3HOZB 1XXGA 1TWHH 1A15A 4QIWB 3G4SA 3A56A 3A54A 3I56A 2J7ZA 4RWSC 4LW1A 4LUVA 2DNCA 2E2HH 1O7ZA 3H6MA 4IUUA 2R7ZB 4R9WA 4LF6L 2I0QA 1SRUA 3PUYA 1E1TA 4A3JG 3ITPA 3CCRA 1F9PA 1JJGA 3T1YL 1EYDA 2Q2IA 2L15A 1UE7A 4QUFA 1NCVA 3H0GH 2EYHA 1F2LA 4JI8Q 4UY8C 1OXXK 2CKZB 2Z9HA 2I5LX 4NKLA 4YHHQ 3LWEA 3FPUB 3HOVH 1O7IA 1V1QA 2D9UA 1L1OC 2WB1G 3C3LA 5IOCA 2QEJC 4WJWA 2VS1A 3U9OA 4IFDI 3CP0A 2O4XA 1Y1VG 3NUCA 3D6WA 2IL8A 3MA2B 2KQ3A 3NXWA 1G6ZA 4IZ8A 1P16A 2SDFA 4POFA 2HUGA 2IWHA 5KIXA 4PZ7A 4HMIA 4RCNA 3FRPB 2XRQD 3L2PA 1MGSA 2CFMA 1VQ4A 1GUTA 5LMNW 4L5RC 2F0EA 5IODA 5CBEE 2NTTA 2NN6I 4KY5A 3NHHA 4NPSA 5CV8A 5JVG3 1I6HB 1QWYA 3D4WA 1WYDA 4Q0FA 2PZWA 1GKHA 4JI3L 1I4RA 3KLSX 1WTRA 1U4PA 3P75A 2RQXA 1AFPA 3R3OA 5IP7G 2RVLA 2RHSB 3U4VA 5IYBG 1PFSA 3J81c 1PLFA 3PIPA 4A3GG 4QQBX 1VQAA 2E2JB 2A8VA 2VQEQ 3HFZB 1U4MA 1XX8A 2QKIC 1SEBD 4DR4Q 1M4VA 1K8OA 2RKSA 1Q90A 2RF4A 2EYJA 1WOCA 4DK0A 4U673 3J81E 3DWAA 1KABA 3EFXD 2K75A 2R3ZA 1VQLA 4JI0L 3C1EA 5KGUA 4L6TB 2IX1A 2F0WA 1N32Q 2BH8A 1JE5A 3RMHA 1VQFA 1OXSC 2F3IA 3HEJA 4IPDA 4GOPA 1CKNB 4B3RQ 2KCMA 2PO4A 3TS0A 3HKZB 2XIWA 1NR2A 4EGVA 1YNJD 1BBUA 2K14A 5DEHA 4JI8L 3Q24A 3KDFA 3CCLA 2F52A 3FKIG 1V9PA 2CQOA 4TRDA 3BZDB 4KY6A 4KK7A 5M5WH 2EZVA 2PZUA 1VQHA 5JOBA 4QUCA 4A3CH 1SXTA 1JMCA 3CRLC 4DAYB 4C3JB 1ENCA 4P74A 5FKAC 4JI2Q 4I65A 3T13A 4CJ2C 3J7A5 1LTRD 2JN4A 4NP5A 2ZJQA 1VQEA 5C0XJ 5HGTA 2ICIA 1GUGA 2VUMB 1D8LA 2V1CC 2L5TA 4JBWA 2WB1E 4XYQA 3PMFA 1I6VC
chains in the Genus database with same CATH topology
1QZGA 4JI1Q 2KBNA 4IO9A 3K81C 2BA0A 2VW9A 3RLNA 1FJGL 4UPAA 4X66Q 1YZ6A 1I94L 4A3LG 1AE3A 4AH6A 3J81j 1JJCB 1EQQA 4KLKA 3BJUA 2CWAA 1XNRL 4X64Q 1M90C 3RZDH 3UDFA 4JCVE 3U50C 5GAHC 4OX9L 1YJWA 1LUZA 3M4OH 3K8AA 1TWAH 1A8VA 1E24A 2D0OA 4HJ9A 3I55A 1VQKA 2VQFL 3CCEA 4OO1G 1WI5A 2HQLA 4A3DG 1VQDA 2MFIA 4X62Q 1XPOA 4OONA 1E1OA 3LGJA 5M3FG 2VQEL 4A3KG 2ES2A 3HOUG 4DR4L 4DV4L 3U4ZA 4YCWA 2UXDQ 4XIGS 5H1SE 1GD7A 3G71A 4DV1Q 4OWXB 3F2BA 1SFOH 1PH1A 4L5SA 2KHJA 3GTQH 3HOXH 4GN5A 5M3MH 5IYDH 1KC8C 1S3OA 1TWGH 2JJQA 1Q1BA 2NVXH 1KHIA 4LF7Q 3KOJA 5GAGC 4HIKA 2JA5G 4GKKQ 5HGQA 1RL2A 1HZCA 1YI2A 4A3IG 2WP8J 1J5EQ 4RMFA 1A0IA 4R4CA 3PF4A 1MKHA 1TXYA 1N32L 1UE6A 1UE1A 4HIOA 1HR0Q 4DR7L 4GNXC 4DR5Q 1HNWQ 2Z6KA 3CC7A 3U58A 2GVBA 1IBKL 5GROA 3S1RH 4B3RL 2K50A 2XTIA 4PZ6A 1Y1WG 3I4MG 5C0XI 1BKBA 2OQ0A 3CF5A 4BXXH 4C3JH 5C4XG 2LXKA 3H15A 3IRBA 1VQCA 4DAMA 1NE3A 1XNRQ 1FGUA 2JA9A 3HOWH 1ASZA 5IWAL 3ULLA 2F4VQ 3KFUA 2LSSA 4BY7H 3CCUA 4JI4L 1C0AA 4YWKA 2Q2TA 1Z9FA 3M4QA 4C3HH 4AYBE 3CXCA 2NVQH 1TWCH 2VUMH 4DV6Q 4FDBA 4A3EH 1WFQA 1OXTA 1PH7A 2R7ZG 2B63H 4YWLA 4DR1Q 3PUWA 3M7NA 1G6PA 1QUQA 1Z47A 5C0XG 1XTDA 1XPRA 2DUDA 5AJ3L 5C4JH 2LXJA 1G51A 1JB7A 2K5HA 2RHQB 5IP7H 1RIPA 2WFWA 4JI2L 5IYBH 4DV2L 5M5XH 1K9MC 3GTKH 4A3GH 2AWNA 3G6EA 1T9HA 2D0PA 4DUZL 4EQ5A 1N36Q 4JV5L 3AFQA 1PHJA 1UE5A 1CKOA 1K3RA 3KYHC 1S72A 3PUZA 4GN3B 5GADC 1WCMH 4LWCA 3OTOL 1PA6A 3F2CA 3A74A 4KI0A 3CD6A 3RR5A 4GKJL 1U5KA 2Y0SE 2JA7G 1VCIA 1TWFH 4LF8Q 2UUBL 4DV0Q 3K7AH 4JI1L 3GO5A 4PMWA 2PQAA 3S15H 3E9IA 4X66L 4GOPB 3M9BA 4KHZA 1IBLL 4HJ8A 3I7FA 3CC4A 4NXNQ 1NMGA 1X3FA 1PYBA 1B7YB 2YV5A 3EBEA 3K80C 2K52A 5C44G 1YIJA 4PG3A 4X64L 1VQNA 3D0FA 1Q86C 1HZAA 4JI4Q 1XNQQ 1UWVA 4BBRG 3T1HQ 4A4IA 1EIFA 3PO2H 2OWOA 1L1OB 1IXRA 1VQBA 1QVCA 3B6YA 5E7NA 3STBD 1QVFA 1Q81C 1V43A 1NBWA 3CAMA 2ZJPA 4IPHA 3AEVA 5K36G 1YHAA 3CMEA 3KDFB 2RCNA 1KAWA 4X62L 5DLQE 3DLLA 2B3GA 2UXDL 4DV1L 5M5YH 3HKSA 3H3VH 1U0LA 1YEZA 2K5VA 1CSQA 3EN2A 4O0AA 4A3MG 3F8TA 1HH2P 3FKIH 1CKMA 1PVOA 4NXMQ 2CCZA 2DGYA 1Q1EA 4LF7L 4DV2Q 2UUCQ 1OTCA 1OXVA 3D31A 3F1ZA 4JV5Q 4DUYQ 1J5EL 3TREA 1FL0A 4BBSG 1I3QH 3FHWA 4LNQA 1HR0L 1B70B 4EX5A 3GTPH 1HNWL 4DR5L 4JBKA 1KD1C 4JC0A 4GN4B 2E8GA 2ID0A 3NENA 4JOIC 2ZTEA 3A5UA 1SN8A 1K73C 2Z0SA 4A75A 2A1AA 1QVGA 3S2DH 4RG1A 3UE0A 5C3EH 1PH8A 1IBLQ 2R92H 1GVPA 2ZM6Q 4P72A 2VNUD 2JA6G 5BR8Q 2F4VL 3I4NH 1VQPA 1Q12A 3H0GG 1K0RA 4JI7Q 1SROA 1Q82C 3J7ZC 1YNXA 4JYAL 4A3JH 2YTVA 3I2ZA 4KHPQ 4QJFA 1KIXA 2N3SA 3HOVG 3BZCA 2NVTH 5LMNL 3ICEA 1E22A 2YTYA 4DV6L 4A3LH 2JEAI 3PCOB 2I5MX 2N78A 2MO1A 3J80i 2Q2UA 4DR1L 3ULJA 1BBWA 1YHBA 2KHIA 1C9OA 5JEAG 5IYCG 4GOPC 4JBJA 3NELA 1H95A 1PH4A 3RLFA 3PV0A 4TQUS 3ZJYC 1HJPA 2UXBL 3RN2A 2A19A 3E9HA 2UU9Q 1EIYB 2R93G 4MTNA 1HR0W 4A3DH 1X3GA 4OWTB 4DNIA 3HOUH 1IYJB 5M3FH 4A3KH 4IOAA 4R4IA 5IP9G 3GDEA 4LFCL 5FLMG 1Y1VH 4LUZA 4A76A 1N36L 4QIWE 4JG2A 4L5TA 4P71A 4YY3L 4B3ML 3NBHB 1S40A 1VQ8A 3PUVA 4YCUA 4LUOA 4WJ3M 2JA5H 2Q2HA 1X6OA 4LF8L 3PUXA 4DV0L 2R6GA 4BA1I 4DR2Q 4Y52H 3K0XA 4A3IH 4DPGA 3CCSA 3PF5A 1PH6A 3GTMH 3HOYG 3SGIA 3S1MH 1SLJA 4NXNL 3ER0A 1PYSB 3UDXA 2JK8A 3HOZG 1HNZL 4LFBQ 1CUKA 2K4KA 3A5ZB 4R4TA 1E7ZA 3WWVA 4DKAC 3CCQA 3VDYA 1XNQL 3HOWG 4JYAQ 4LF6Q 4X65Q 3RZOH 4OXPA 4DV3Q 3RNUA 4J15A 3T1HL 2JE6I 1YJ9A 1B8AA 1Y1WH 1G291 5LMNQ 4C2MH 3I4MH 4YCVA 4LF4L 4B3TL 4AQYQ 5C4XH 1PH9A 2E2IH 1JJ2A 3T1YQ 2CWPA 4DV5L 3UE1A 2IY5B 1L0WA 2VUMG 2AHOB 1EOVA 4YWMA 2YTXA 3PIOA 4JI5Q 2QGQA 4UP7A 3ULPA 3RLOA 3AQQA 4A3FG 2HT1A 2JEBI 1J6QA 2AKWB 1KRSA 2PI2A 1SMXA 3ERSX 5HY6A 4NXML 2UXBQ 4JOIA 4GS3A 4A93G 1BVSA 2UUCL 4JI6L 1X9NA 2KENA 4UP9A 1PV4A 1QUQB 2IHEA 4XTCS 3CCMA 4DUYL 4LFCQ 2R7ZH 5JEAJ 4B3MQ 4YY3Q 1OXUA 1XJVA 4R4QA 3UDIA 1MJCA 1EYGA 3TS2A 4X6AH 1K8AC 4QL5A 3CMAA 4QY7A 3KF6A 5FJ8H 2MNAA 1PH2A 3J81i 2HIVA 3PO3H 1X65A 1CKNA 1M1KC 3KLWA 2ZM6L 4ALPA 2ZTDA 4R1JA 1HNZQ 3AYHB 1X3EA 4IPCA 4B3SL 1IZ6A 5BR8L 2ATWA 1XMOQ 2PQAB 4HJ7A 4BY1H 4JI7L 1NJIC 3W5OA 1MIUA 1R9TH 4B3TQ 4LF4Q 2JA7H 4KHPL 2NZOA 3KJOA 4IJHA 4HIDA 2BA1A 3F2DA 2UXCQ 1LTLA 4DV5Q 4GLVB 2ZTCA 2EQSA 4A3CG 2N8NA 5C44H 1VQOA 1LYLA 1GM5A 1YVCA 4ME3A 1VQ6A 4GNXA 4JI3Q 2Z6KC 1VQMA 4C3IH 4BBRH 3W1BA 3CCJA 1A62A 1FVIA 1HZ9A 2HHHL 3W1GA 4JI6Q 2PI2E 4UP8A 1X56A 3G48A 1YHQA 2N49A 2NVYH 2UU9L 1HNXQ 4YHHL 3AFPA 2QA4A 2XGTA 4DR3Q 1W2BA 3FP9A 1KXLA 4H02A 1C7YA 4A3BG 4JI5L 1VQ5A 2VY3A 2WAQG 2D62A 4NB3A 3NEMA 4A3MH 5JJKA 4DK6C 3TEHB 3TRZA 3M4PA 1KRTA 1TWHH 4POGA 3G4SA 3E0EA 3KJPA 2QEXA 4DR2L 2JA8H 3UDGA 3I56A 1QZHA 2FXQA 3M85A 5ELOA 4B3SQ 4P75A 4LW1A 2AMCB 4BBSH 4LUVA 4GLXA 1NTGA 1N33L 2VL6A 1IBMQ 4LFBL 2E2HH 3J80c 1HZBA 4AIMA 4LF6L 4X65L 3JAMi 4TVAB 2I0QA 3OYYA 4DV3L 2MQHA 1SRUA 4LF9Q 3PUYA 4JBMA 1E1TA 4A3JG 3CCRA 1YBYA 4AQYL 2VZAA 3CCVA 2UUAQ 1JJGA 3T1YL 2Q2IA 2L15A 1UE7A 3S1NH 2JA6H 2ASBA 3HKZG 3H0GH 2R7DA 4JI8Q 2HHHQ 4UY8C 5JJLA 2JQOA 1OXXK 2CKZB 5IYDG 3HOXG 2PMZE 5M3MG 4K0KL 2I5LX 3S1QH 4YHHQ 4GLAC 3STBC 1O7IA 1V1QA 3MEFA 1L1OC 2WB1G 3CC2A 2E5LQ 3HOVH 4DR6L 1UEBA 1NY4A 2VS1A 4IFDI 3CP0A 5IYCH 1MJEA 1Y1VG 2HIXA 4PZ8A 3S16H 1XMQQ 3PSIA 1P16A 4MNOA 4POFA 1VS0A 1N34L 3GTGH 4BXXG 1Q7YC 1Y14B 2R93H 1YITA 2BH2A 4PZ7A 4LFAQ 1N33Q 3MXNB 4IJLA 1Q8KA 5IP9H 1CSPA 5FLMH 5IE8A 3L2PA 1A63A 2CFMA 5LMUQ 1VQ4A 1PH5A 1YJNA 1XMOL 4BY7G 1AH9A 5LMNW 4L5RC 4LF5L 2OTJA 1VQJA 2IX0A 3TQYA 2R7FA 1N8RC 1FJGQ 3S17H 2NN6I 4IFDG 3RN5A 3HOYH 2UXCL 3S14H 2IHFA 4NPSA 1I94Q 4A3EG 1XPUA 2B63G 3HOZH 1LM0A 1WYDA 4R4OA 1GKHA 4JI3L 1DGSA 5IT9c 2UUBQ 4K0KQ 1JT8A 4OX9Q 1EUJA 1W3SA 2MO0A 4BA2I 1SR3A 5JJIA 3GTOH 4HIMA 3KF8B 5IP7G 4DR6Q 1D7QA 2RHSB 4IOCA 2VQFQ 3U4VA 1IL2A 5IYBG 1PFSA 2B29A 1HNXL 3J81c 3PIPA 4A3GG 3S2HH 4QQBX 1VQAA 3BU2A 4DR3L 1I50H 2A8VA 2VQEQ 1VQ7A 1KL9A 2GVAA 3HFZB 5J3BA 4QGUA 4DV4Q 4DR4Q 5ELNA 2RF4A 1WCMG 4A3FH 2YU9H 2OTLA 2NN6G 1WOCA 3BZKA 3EIVA 5FLXc 4P73A 1N34Q 4A93H 2K75A 1K83H 1VQLA 5GQOA 4JI0L 3H3VI 1VQ9A 5FJ8G 4DV7L 2IX1A 4AYBG 2AWOA 3CW2C 3PO3G 3L0OA 2BH8A 1JE5A 1EFWA 1N32Q 1VQFA 4Y7NH 4DR7Q 1N9WA 3KF6B 1IBML 2OCEA 1OXSC 2F3IA 4GOPA 4IPDA 1IBKQ 4LF5Q 1CKNB 3CQZH 3PO2G 1WJJA 4B3RQ 2KCMA 3GTJH 3GD7A 4BY1G 3CPWA 3TS0A 4LF9L 2C35B 3JC66 1PH3A 2NZHA 2K5NA 2UUAL 5IY0A 1L1OA 2WAQE 1VQGA 1BBUA 3DM3A 2GN5A 2K14A 1NMFA 5IWAQ 1VQIA 3K7UC 1P8LA 3I4OA 4JI8L 3KDFA 2ZJRA 4O2DA 3CCLA 4IFDJ 2F52A 1X54A 1V9PA 3FKIG 2CQOA 2IT1A 4APVA 1K8GA 4OWWB 1EQRA 5GAEC 2Y0SG 4GNXB 3L7ZC 1X55A 5M5WH 3OW2A 2E5LL 1VQHA 3A0JA 4A3CH 4MZ9A 1JMCA 2KCTA 3PGZA 4HJAA 3Q8DA 2EXDA 3S24A 4DAYB 1AE2A 2EIFA 1KQSA 4P74A 5AJ3Q 4L5QA 1I6HH 3JAMc 4JI0Q 1E3PA 4DK3C 1L2FA 1XMQL 1Q46A 4DV7Q 4JI2Q 3M3YH 1SE8A 5C3EG 2R92G 5EAYA 4GKKL 2YYZA 3J7A5 2PNHA 4IPGA 4DUZQ 4LFAL 1GO3E 3HKZE 2JA8G 4A3BH 2OQKA 2ZJQA 4OO1I 5LMUL 1VQEA 5C0XJ 3I4NG 4WJ4A 1ASYA 4HJ5A 3OTOQ 2ALYB 2E2JH 2I5HA 1D8LA 3CPFA 2V1CC 1EWIA 4GKJQ 3GTLH 4JBWA 1I5FA 2WB1E 2H5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZG A;  4JI1 Q;  2KBN A;  4IO9 A;  3K81 C;  2BA0 A;  2VW9 A;  3RLN A;  1FJG L;  4UPA A;  4X66 Q;  1YZ6 A;  1I94 L;  4A3L G;  1AE3 A;  4AH6 A;  3J81 j;  1JJC B;  1EQQ A;  4KLK A;  3BJU A;  2CWA A;  1XNR L;  4X64 Q;  1M90 C;  3RZD H;  3UDF A;  4JCV E;  3U50 C;  5GAH C;  4OX9 L;  1YJW A;  1LUZ A;  3M4O H;  3K8A A;  1TWA H;  1A8V A;  1E24 A;  2D0O A;  4HJ9 A;  3I55 A;  1VQK A;  2VQF L;  3CCE A;  4OO1 G;  1WI5 A;  2HQL A;  4A3D G;  1VQD A;  2MFI A;  4X62 Q;  1XPO A;  4OON A;  1E1O A;  3LGJ A;  5M3F G;  2VQE L;  4A3K G;  2ES2 A;  3HOU G;  4DR4 L;  4DV4 L;  3U4Z A;  4YCW A;  2UXD Q;  4XIG S;  5H1S E;  1GD7 A;  3G71 A;  4DV1 Q;  4OWX B;  3F2B A;  1SFO H;  1PH1 A;  4L5S A;  2KHJ A;  3GTQ H;  3HOX H;  4GN5 A;  5M3M H;  5IYD H;  1KC8 C;  1S3O A;  1TWG H;  2JJQ A;  1Q1B A;  2NVX H;  1KHI A;  4LF7 Q;  3KOJ A;  5GAG C;  4HIK A;  2JA5 G;  4GKK Q;  5HGQ A;  1RL2 A;  1HZC A;  1YI2 A;  4A3I G;  2WP8 J;  1J5E Q;  4RMF A;  1A0I A;  4R4C A;  3PF4 A;  1MKH A;  1TXY A;  1N32 L;  1UE6 A;  1UE1 A;  4HIO A;  1HR0 Q;  4DR7 L;  4GNX C;  4DR5 Q;  1HNW Q;  2Z6K A;  3CC7 A;  3U58 A;  2GVB A;  1IBK L;  5GRO A;  3S1R H;  4B3R L;  2K50 A;  2XTI A;  4PZ6 A;  1Y1W G;  3I4M G;  5C0X I;  1BKB A;  2OQ0 A;  3CF5 A;  4BXX H;  4C3J H;  5C4X G;  2LXK A;  3H15 A;  3IRB A;  1VQC A;  4DAM A;  1NE3 A;  1XNR Q;  1FGU A;  2JA9 A;  3HOW H;  1ASZ A;  5IWA L;  3ULL A;  2F4V Q;  3KFU A;  2LSS A;  4BY7 H;  3CCU A;  4JI4 L;  1C0A A;  4YWK A;  2Q2T A;  1Z9F A;  3M4Q A;  4C3H H;  4AYB E;  3CXC A;  2NVQ H;  1TWC H;  2VUM H;  4DV6 Q;  4FDB A;  4A3E H;  1WFQ A;  1OXT A;  1PH7 A;  2R7Z G;  2B63 H;  4YWL A;  4DR1 Q;  3PUW A;  3M7N A;  1G6P A;  1QUQ A;  1Z47 A;  5C0X G;  1XTD A;  1XPR A;  2DUD A;  5AJ3 L;  5C4J H;  2LXJ A;  1G51 A;  1JB7 A;  2K5H A;  2RHQ B;  5IP7 H;  1RIP A;  2WFW A;  4JI2 L;  5IYB H;  4DV2 L;  5M5X H;  1K9M C;  3GTK H;  4A3G H;  2AWN A;  3G6E A;  1T9H A;  2D0P A;  4DUZ L;  4EQ5 A;  1N36 Q;  4JV5 L;  3AFQ A;  1PHJ A;  1UE5 A;  1CKO A;  1K3R A;  3KYH C;  1S72 A;  3PUZ A;  4GN3 B;  5GAD C;  1WCM H;  4LWC A;  3OTO L;  1PA6 A;  3F2C A;  3A74 A;  4KI0 A;  3CD6 A;  3RR5 A;  4GKJ L;  1U5K A;  2Y0S E;  2JA7 G;  1VCI A;  1TWF H;  4LF8 Q;  2UUB L;  4DV0 Q;  3K7A H;  4JI1 L;  3GO5 A;  4PMW A;  2PQA A;  3S15 H;  3E9I A;  4X66 L;  4GOP B;  3M9B A;  4KHZ A;  1IBL L;  4HJ8 A;  3I7F A;  3CC4 A;  4NXN Q;  1NMG A;  1X3F A;  1PYB A;  1B7Y B;  2YV5 A;  3EBE A;  3K80 C;  2K52 A;  5C44 G;  1YIJ A;  4PG3 A;  4X64 L;  1VQN A;  3D0F A;  1Q86 C;  1HZA A;  4JI4 Q;  1XNQ Q;  1UWV A;  4BBR G;  3T1H Q;  4A4I A;  1EIF A;  3PO2 H;  2OWO A;  1L1O B;  1IXR A;  1VQB A;  1QVC A;  3B6Y A;  5E7N A;  3STB D;  1QVF A;  1Q81 C;  1V43 A;  1NBW A;  3CAM A;  2ZJP A;  4IPH A;  3AEV A;  5K36 G;  1YHA A;  3CME A;  3KDF B;  2RCN A;  1KAW A;  4X62 L;  5DLQ E;  3DLL A;  2B3G A;  2UXD L;  4DV1 L;  5M5Y H;  3HKS A;  3H3V H;  1U0L A;  1YEZ A;  2K5V A;  1CSQ A;  3EN2 A;  4O0A A;  4A3M G;  3F8T A;  1HH2 P;  3FKI H;  1CKM A;  1PVO A;  4NXM Q;  2CCZ A;  2DGY A;  1Q1E A;  4LF7 L;  4DV2 Q;  2UUC Q;  1OTC A;  1OXV A;  3D31 A;  3F1Z A;  4JV5 Q;  4DUY Q;  1J5E L;  3TRE A;  1FL0 A;  4BBS G;  1I3Q H;  3FHW A;  4LNQ A;  1HR0 L;  1B70 B;  4EX5 A;  3GTP H;  1HNW L;  4DR5 L;  4JBK A;  1KD1 C;  4JC0 A;  4GN4 B;  2E8G A;  2ID0 A;  3NEN A;  4JOI C;  2ZTE A;  3A5U A;  1SN8 A;  1K73 C;  2Z0S A;  4A75 A;  2A1A A;  1QVG A;  3S2D H;  4RG1 A;  3UE0 A;  5C3E H;  1PH8 A;  1IBL Q;  2R92 H;  1GVP A;  2ZM6 Q;  4P72 A;  2VNU D;  2JA6 G;  5BR8 Q;  2F4V L;  3I4N H;  1VQP A;  1Q12 A;  3H0G G;  1K0R A;  4JI7 Q;  1SRO A;  1Q82 C;  3J7Z C;  1YNX A;  4JYA L;  4A3J H;  2YTV A;  3I2Z A;  4KHP Q;  4QJF A;  1KIX A;  2N3S A;  3HOV G;  3BZC A;  2NVT H;  5LMN L;  3ICE A;  1E22 A;  2YTY A;  4DV6 L;  4A3L H;  2JEA I;  3PCO B;  2I5M X;  2N78 A;  2MO1 A;  3J80 i;  2Q2U A;  4DR1 L;  3ULJ A;  1BBW A;  1YHB A;  2KHI A;  1C9O A;  5JEA G;  5IYC G;  4GOP C;  4JBJ A;  3NEL A;  1H95 A;  1PH4 A;  3RLF A;  3PV0 A;  4TQU S;  3ZJY C;  1HJP A;  2UXB L;  3RN2 A;  2A19 A;  3E9H A;  2UU9 Q;  1EIY B;  2R93 G;  4MTN A;  1HR0 W;  4A3D H;  1X3G A;  4OWT B;  4DNI A;  3HOU H;  1IYJ B;  5M3F H;  4A3K H;  4IOA A;  4R4I A;  5IP9 G;  3GDE A;  4LFC L;  5FLM G;  1Y1V H;  4LUZ A;  4A76 A;  1N36 L;  4QIW E;  4JG2 A;  4L5T A;  4P71 A;  4YY3 L;  4B3M L;  3NBH B;  1S40 A;  1VQ8 A;  3PUV A;  4YCU A;  4LUO A;  4WJ3 M;  2JA5 H;  2Q2H A;  1X6O A;  4LF8 L;  3PUX A;  4DV0 L;  2R6G A;  4BA1 I;  4DR2 Q;  4Y52 H;  3K0X A;  4A3I H;  4DPG A;  3CCS A;  3PF5 A;  1PH6 A;  3GTM H;  3HOY G;  3SGI A;  3S1M H;  1SLJ A;  4NXN L;  3ER0 A;  1PYS B;  3UDX A;  2JK8 A;  3HOZ G;  1HNZ L;  4LFB Q;  1CUK A;  2K4K A;  3A5Z B;  4R4T A;  1E7Z A;  3WWV A;  4DKA C;  3CCQ A;  3VDY A;  1XNQ L;  3HOW G;  4JYA Q;  4LF6 Q;  4X65 Q;  3RZO H;  4OXP A;  4DV3 Q;  3RNU A;  4J15 A;  3T1H L;  2JE6 I;  1YJ9 A;  1B8A A;  1Y1W H;  1G29 1;  5LMN Q;  4C2M H;  3I4M H;  4YCV A;  4LF4 L;  4B3T L;  4AQY Q;  5C4X H;  1PH9 A;  2E2I H;  1JJ2 A;  3T1Y Q;  2CWP A;  4DV5 L;  3UE1 A;  2IY5 B;  1L0W A;  2VUM G;  2AHO B;  1EOV A;  4YWM A;  2YTX A;  3PIO A;  4JI5 Q;  2QGQ A;  4UP7 A;  3ULP A;  3RLO A;  3AQQ A;  4A3F G;  2HT1 A;  2JEB I;  1J6Q A;  2AKW B;  1KRS A;  2PI2 A;  1SMX A;  3ERS X;  5HY6 A;  4NXM L;  2UXB Q;  4JOI A;  4GS3 A;  4A93 G;  1BVS A;  2UUC L;  4JI6 L;  1X9N A;  2KEN A;  4UP9 A;  1PV4 A;  1QUQ B;  2IHE A;  4XTC S;  3CCM A;  4DUY L;  4LFC Q;  2R7Z H;  5JEA J;  4B3M Q;  4YY3 Q;  1OXU A;  1XJV A;  4R4Q A;  3UDI A;  1MJC A;  1EYG A;  3TS2 A;  4X6A H;  1K8A C;  4QL5 A;  3CMA A;  4QY7 A;  3KF6 A;  5FJ8 H;  2MNA A;  1PH2 A;  3J81 i;  2HIV A;  3PO3 H;  1X65 A;  1CKN A;  1M1K C;  3KLW A;  2ZM6 L;  4ALP A;  2ZTD A;  4R1J A;  1HNZ Q;  3AYH B;  1X3E A;  4IPC A;  4B3S L;  1IZ6 A;  5BR8 L;  2ATW A;  1XMO Q;  2PQA B;  4HJ7 A;  4BY1 H;  4JI7 L;  1NJI C;  3W5O A;  1MIU A;  1R9T H;  4B3T Q;  4LF4 Q;  2JA7 H;  4KHP L;  2NZO A;  3KJO A;  4IJH A;  4HID A;  2BA1 A;  3F2D A;  2UXC Q;  1LTL A;  4DV5 Q;  4GLV B;  2ZTC A;  2EQS A;  4A3C G;  2N8N A;  5C44 H;  1VQO A;  1LYL A;  1GM5 A;  1YVC A;  4ME3 A;  1VQ6 A;  4GNX A;  4JI3 Q;  2Z6K C;  1VQM A;  4C3I H;  4BBR H;  3W1B A;  3CCJ A;  1A62 A;  1FVI A;  1HZ9 A;  2HHH L;  3W1G A;  4JI6 Q;  2PI2 E;  4UP8 A;  1X56 A;  3G48 A;  1YHQ A;  2N49 A;  2NVY H;  2UU9 L;  1HNX Q;  4YHH L;  3AFP A;  2QA4 A;  2XGT A;  4DR3 Q;  1W2B A;  3FP9 A;  1KXL A;  4H02 A;  1C7Y A;  4A3B G;  4JI5 L;  1VQ5 A;  2VY3 A;  2WAQ G;  2D62 A;  4NB3 A;  3NEM A;  4A3M H;  5JJK A;  4DK6 C;  3TEH B;  3TRZ A;  3M4P A;  1KRT A;  1TWH H;  4POG A;  3G4S A;  3E0E A;  3KJP A;  2QEX A;  4DR2 L;  2JA8 H;  3UDG A;  3I56 A;  1QZH A;  2FXQ A;  3M85 A;  5ELO A;  4B3S Q;  4P75 A;  4LW1 A;  2AMC B;  4BBS H;  4LUV A;  4GLX A;  1NTG A;  1N33 L;  2VL6 A;  1IBM Q;  4LFB L;  2E2H H;  3J80 c;  1HZB A;  4AIM A;  4LF6 L;  4X65 L;  3JAM i;  4TVA B;  2I0Q A;  3OYY A;  4DV3 L;  2MQH A;  1SRU A;  4LF9 Q;  3PUY A;  4JBM A;  1E1T A;  4A3J G;  3CCR A;  1YBY A;  4AQY L;  2VZA A;  3CCV A;  2UUA Q;  1JJG A;  3T1Y L;  2Q2I A;  2L15 A;  1UE7 A;  3S1N H;  2JA6 H;  2ASB A;  3HKZ G;  3H0G H;  2R7D A;  4JI8 Q;  2HHH Q;  4UY8 C;  5JJL A;  2JQO A;  1OXX K;  2CKZ B;  5IYD G;  3HOX G;  2PMZ E;  5M3M G;  4K0K L;  2I5L X;  3S1Q H;  4YHH Q;  4GLA C;  3STB C;  1O7I A;  1V1Q A;  3MEF A;  1L1O C;  2WB1 G;  3CC2 A;  2E5L Q;  3HOV H;  4DR6 L;  1UEB A;  1NY4 A;  2VS1 A;  4IFD I;  3CP0 A;  5IYC H;  1MJE A;  1Y1V G;  2HIX A;  4PZ8 A;  3S16 H;  1XMQ Q;  3PSI A;  1P16 A;  4MNO A;  4POF A;  1VS0 A;  1N34 L;  3GTG H;  4BXX G;  1Q7Y C;  1Y14 B;  2R93 H;  1YIT A;  2BH2 A;  4PZ7 A;  4LFA Q;  1N33 Q;  3MXN B;  4IJL A;  1Q8K A;  5IP9 H;  1CSP A;  5FLM H;  5IE8 A;  3L2P A;  1A63 A;  2CFM A;  5LMU Q;  1VQ4 A;  1PH5 A;  1YJN A;  1XMO L;  4BY7 G;  1AH9 A;  5LMN W;  4L5R C;  4LF5 L;  2OTJ A;  1VQJ A;  2IX0 A;  3TQY A;  2R7F A;  1N8R C;  1FJG Q;  3S17 H;  2NN6 I;  4IFD G;  3RN5 A;  3HOY H;  2UXC L;  3S14 H;  2IHF A;  4NPS A;  1I94 Q;  4A3E G;  1XPU A;  2B63 G;  3HOZ H;  1LM0 A;  1WYD A;  4R4O A;  1GKH A;  4JI3 L;  1DGS A;  5IT9 c;  2UUB Q;  4K0K Q;  1JT8 A;  4OX9 Q;  1EUJ A;  1W3S A;  2MO0 A;  4BA2 I;  1SR3 A;  5JJI A;  3GTO H;  4HIM A;  3KF8 B;  5IP7 G;  4DR6 Q;  1D7Q A;  2RHS B;  4IOC A;  2VQF Q;  3U4V A;  1IL2 A;  5IYB G;  1PFS A;  2B29 A;  1HNX L;  3J81 c;  3PIP A;  4A3G G;  3S2H H;  4QQB X;  1VQA A;  3BU2 A;  4DR3 L;  1I50 H;  2A8V A;  2VQE Q;  1VQ7 A;  1KL9 A;  2GVA A;  3HFZ B;  5J3B A;  4QGU A;  4DV4 Q;  4DR4 Q;  5ELN A;  2RF4 A;  1WCM G;  4A3F H;  2YU9 H;  2OTL A;  2NN6 G;  1WOC A;  3BZK A;  3EIV A;  5FLX c;  4P73 A;  1N34 Q;  4A93 H;  2K75 A;  1K83 H;  1VQL A;  5GQO A;  4JI0 L;  3H3V I;  1VQ9 A;  5FJ8 G;  4DV7 L;  2IX1 A;  4AYB G;  2AWO A;  3CW2 C;  3PO3 G;  3L0O A;  2BH8 A;  1JE5 A;  1EFW A;  1N32 Q;  1VQF A;  4Y7N H;  4DR7 Q;  1N9W A;  3KF6 B;  1IBM L;  2OCE A;  1OXS C;  2F3I A;  4GOP A;  4IPD A;  1IBK Q;  4LF5 Q;  1CKN B;  3CQZ H;  3PO2 G;  1WJJ A;  4B3R Q;  2KCM A;  3GTJ H;  3GD7 A;  4BY1 G;  3CPW A;  3TS0 A;  4LF9 L;  2C35 B;  3JC6 6;  1PH3 A;  2NZH A;  2K5N A;  2UUA L;  5IY0 A;  1L1O A;  2WAQ E;  1VQG A;  1BBU A;  3DM3 A;  2GN5 A;  2K14 A;  1NMF A;  5IWA Q;  1VQI A;  3K7U C;  1P8L A;  3I4O A;  4JI8 L;  3KDF A;  2ZJR A;  4O2D A;  3CCL A;  4IFD J;  2F52 A;  1X54 A;  1V9P A;  3FKI G;  2CQO A;  2IT1 A;  4APV A;  1K8G A;  4OWW B;  1EQR A;  5GAE C;  2Y0S G;  4GNX B;  3L7Z C;  1X55 A;  5M5W H;  3OW2 A;  2E5L L;  1VQH A;  3A0J A;  4A3C H;  4MZ9 A;  1JMC A;  2KCT A;  3PGZ A;  4HJA A;  3Q8D A;  2EXD A;  3S24 A;  4DAY B;  1AE2 A;  2EIF A;  1KQS A;  4P74 A;  5AJ3 Q;  4L5Q A;  1I6H H;  3JAM c;  4JI0 Q;  1E3P A;  4DK3 C;  1L2F A;  1XMQ L;  1Q46 A;  4DV7 Q;  4JI2 Q;  3M3Y H;  1SE8 A;  5C3E G;  2R92 G;  5EAY A;  4GKK L;  2YYZ A;  3J7A 5;  2PNH A;  4IPG A;  4DUZ Q;  4LFA L;  1GO3 E;  3HKZ E;  2JA8 G;  4A3B H;  2OQK A;  2ZJQ A;  4OO1 I;  5LMU L;  1VQE A;  5C0X J;  3I4N G;  4WJ4 A;  1ASY A;  4HJ5 A;  3OTO Q;  2ALY B;  2E2J H;  2I5H A;  1D8L A;  3CPF A;  2V1C C;  1EWI A;  4GKJ Q;  3GTL H;  4JBW A;  1I5F A;  2WB1 E;  2H5X A; 
#chains in the Genus database with same CATH topology
 2KBN A;  3K0Y A;  3RLN A;  4X66 Q;  3KK7 A;  3D6C A;  3T16 A;  3BJU A;  2WII B;  2A69 C;  2EY6 A;  1D1I A;  1S4Z A;  4XDX A;  3GQB A;  3U50 C;  1ET9 A;  1YJW A;  3M4O H;  1SYG A;  4G7O C;  3OOC A;  2PW5 A;  2D0O A;  4HJ9 A;  3I55 A;  1VQK A;  4OO1 G;  2HDL A;  1WCM B;  1VQD A;  1QIL A;  4OON A;  1E1O A;  2VQE L;  3QG1 A;  4DR4 L;  2WKC A;  4K2L A;  5H1S E;  2UXD Q;  1EY5 A;  4DK1 A;  2NVX H;  4LF7 Q;  3KOJ A;  5GAG C;  2JA5 G;  4GKK Q;  5HGQ A;  2KUM A;  1RL2 A;  1HZC A;  2E2D C;  1YI2 A;  2WP8 J;  3PF4 A;  1N32 L;  2TSS A;  1UE1 A;  5E4X A;  4K5V A;  4X3T A;  3U58 A;  4X3U A;  2K04 A;  1C48 A;  4B3R L;  1ZXT A;  1Y1W G;  4BXX H;  1B3A A;  1LTI D;  2EY1 A;  5EKK A;  1NE3 A;  5EBC A;  3HOW H;  2F0H A;  1ASZ A;  2B2V C;  2K01 A;  2K33 A;  2XWB B;  2XSC A;  5DNF A;  1C0A A;  1SND A;  4YWK A;  2Q2T A;  3M4Q A;  1R4Q B;  2NVQ H;  2FFK B;  4DV6 Q;  4FDB A;  1STA A;  3D8G A;  2R7Z G;  4DR1 Q;  1G6P A;  5DM7 3;  1WTP A;  1B50 A;  1QUQ A;  3L9A X;  1CI3 M;  1JB7 A;  1VMP A;  1Z6H A;  2E76 C;  2WFW A;  4JI2 L;  1JR0 D;  3GTK H;  3M4O B;  4DAP A;  2AWN A;  2D0P A;  1UAP A;  3GV6 A;  1N36 Q;  4V19 0;  3KYH C;  1S72 A;  1PA6 A;  4LWC A;  4J1M A;  1VCI A;  1WTH A;  3VR2 A;  1IKM A;  2PQA A;  4DXG A;  3E9I A;  4X66 L;  4P2C B;  3S15 H;  1BXT A;  2NVX B;  1KNE A;  4J8Q A;  1ML0 D;  4FYD A;  2K1B A;  1X3F A;  1YIJ A;  4PG3 A;  1VQN A;  3D0F A;  1S5F D;  4JI4 Q;  5AFW A;  3T1H Q;  3PO2 H;  1BO0 A;  2Q8R E;  3BVZ A;  3QO2 A;  5M3F B;  3HOU B;  3P20 A;  3B6Y A;  2L1B A;  5E7N A;  3FDT A;  3STB D;  1QVF A;  4Z9C B;  3AEV A;  5LHY 1;  1YHA A;  1WTV A;  1F2Y A;  4BS9 A;  4ZKC B;  4HN7 A;  5IGG A;  3CME A;  2RCN A;  4JPB W;  2E75 C;  1WD1 A;  2UXD L;  1NUC A;  5M5Y H;  1U0L A;  3EN2 A;  4A3M G;  1PVO A;  4NXM Q;  3QB3 A;  4LF7 L;  4DV2 Q;  2QDB A;  3NTK A;  5IGB A;  1OTC A;  4FF3 A;  3D31 A;  3BVG A;  3F1Z A;  3T51 B;  4JV5 Q;  4DUY Q;  1V1O A;  5EGT A;  1FL0 A;  1I3Q H;  5FOB B;  1A2U A;  2NVQ B;  2KEC A;  2E2I B;  2EY5 A;  1TU2 B;  2ID0 A;  4JOI C;  3TP8 A;  1STE A;  2Z0S A;  1EY6 A;  2X69 A;  3S2D H;  4RG1 A;  3NE5 B;  2GA4 B;  5TSS A;  1PH8 A;  1IBL Q;  2R92 H;  1PFB A;  1B1Z A;  1SNQ A;  3MTS A;  1ICW A;  3H0G G;  1I4H A;  3VYT A;  1K0R A;  2XNA C;  3J7Z C;  4A3J H;  2FMC A;  2OEO A;  4QJF A;  2JSO A;  2N3S A;  3HOV G;  2NVT H;  4RH6 A;  1EY0 A;  5LMN L;  2K28 A;  3ICE A;  3TBI B;  4DV6 L;  5G3L D;  2Q2U A;  4DR1 L;  4AYB B;  1E2Z A;  1YHB A;  3PO3 B;  1C9O A;  4FXK C;  4IUV A;  3M7G A;  3NEL A;  1PH4 A;  1EY8 A;  2WV6 D;  4CGY B;  1ILQ A;  1HCZ A;  1HTP A;  1HR0 W;  3SVM A;  4BY1 B;  4OWT B;  4IOA A;  1HXY D;  1PRT B;  2PPB C;  1N36 L;  1Y1V H;  4QB4 A;  4QIW E;  4JG2 A;  2EYO A;  5CV6 A;  3PUV A;  1STG A;  1X32 A;  1O80 A;  4LUO A;  4PNY A;  3MXU A;  3A7L A;  2Q2H A;  5M5Y B;  4Y52 H;  4BA1 I;  2L12 A;  4DPG A;  1PH6 A;  2WAC A;  3SGI A;  3NTI A;  3S1M H;  5D3I B;  1PYS B;  4LFB Q;  2ZXO A;  3VDY A;  5CV5 A;  4KD4 A;  4X65 Q;  1HA6 A;  3T1H L;  4J15 A;  2JE6 I;  4TKO B;  1HFN A;  2DJF C;  1G29 1;  4H0L C;  4C2M H;  4DAV A;  4LF4 L;  5IGD A;  2EYM A;  4DV5 L;  3IFT A;  3S2D B;  2IPK D;  2VUM G;  2AHO B;  3VR6 A;  1EOV A;  1EL0 A;  3MWY W;  3RLO A;  2JA8 B;  3AQQ A;  1SNC A;  2AKW B;  1SMX A;  4NXM L;  3PQI A;  4GS3 A;  1EU4 A;  4CJ1 B;  2KEN A;  5G3L F;  4FNF A;  2IHE A;  4DUY L;  4LFC Q;  5J39 A;  3EVQ A;  1OXU A;  2NVT B;  5C0X H;  3TS2 A;  2EYP A;  4X6A H;  1K8A C;  1AEX A;  3SDZ A;  4NDX A;  4V0B A;  4K6L A;  1PH2 A;  3J81 i;  2XWJ B;  1CKN A;  1SJH D;  4R1J A;  1HNZ Q;  2RDG A;  3AYH B;  3S1Q B;  4RAU C;  1XMO Q;  4HJ7 A;  3DHQ A;  1PRT C;  1NJI C;  1MIU A;  1R9T H;  2JA7 H;  1XTC D;  1TR5 A;  4HID A;  2BA1 A;  1H9K A;  1JOR A;  4EVO A;  4A3C G;  3E5S A;  1VQ6 A;  3GTG B;  1LTS D;  2L9H A;  4H13 C;  4C3I H;  3S1M B;  3W1B A;  4B9W A;  3W1G A;  3C1F A;  4UP8 A;  3G48 A;  5BN3 A;  1YHQ A;  2NVY H;  4DAY A;  5K36 H;  1H9R A;  3ERQ A;  2KJX A;  4FVM A;  4ZUJ A;  2VY3 A;  2WAQ G;  1XWE A;  2B2V A;  3S14 B;  5JJK A;  3HRZ C;  1KRT A;  5ELD A;  2QEX A;  1QB5 D;  1QZH A;  3M85 A;  4B3S Q;  2AMC B;  2RDF A;  4GLX A;  4LFB L;  2VL6 A;  3NBI A;  1PXU A;  3J80 c;  3K57 A;  4X65 L;  3OYY A;  5EPK A;  1KTK A;  2CQA A;  2LFN A;  1IYV A;  3J80 E;  2ENB A;  1RKN A;  2UUA Q;  3OMC A;  2HD3 A;  2XRS D;  4A93 B;  2ASB A;  5T1I A;  3T53 B;  4IN3 A;  3VR4 A;  2HHH Q;  3OIQ A;  1ESR A;  3CU7 A;  3W2D A;  1HPC A;  3MEF A;  1JWS D;  1SMY D;  3D4R A;  3CC2 A;  2E5L Q;  4DR6 L;  1BOS A;  3PIO 3;  1R9T B;  2JA7 B;  1NY4 A;  3GTJ B;  5CYU A;  4RKL A;  1VMC A;  2NB0 A;  1II3 A;  2D5D A;  2OF1 A;  3KUP A;  1VF7 A;  4PZ8 A;  5I6Y A;  1STY A;  1XMQ Q;  3PSI A;  4MNO A;  4BXX G;  1SSO A;  4K14 A;  1Q7Y C;  2LS0 1;  3J7Y W;  1GOZ A;  3MXN B;  1CSP A;  5ISR A;  1PTO H;  1ZYR D;  4OGQ C;  4WOR A;  3NP8 A;  1YJN A;  1XMO L;  2R61 A;  3ND9 A;  1E2V A;  1O78 A;  4LF5 L;  4XT3 B;  3TQY A;  1SE3 A;  1T5E A;  3OW7 A;  3RN5 A;  1D6E C;  4OEM B;  4EQN A;  1I94 Q;  3DMU A;  3QIA A;  3HOZ H;  1L0X B;  1WD0 A;  2G9D A;  1DGS A;  1JB3 A;  5IT9 c;  1W3S A;  2MO0 A;  1CFM A;  2E74 C;  1IYU A;  1SR3 A;  4BA2 I;  1B2T A;  1BBX C;  5C3X A;  2VQF Q;  1WTQ A;  1PDQ A;  5IT9 E;  2KOL A;  1Q8I A;  1SYD A;  2MUY A;  3VA7 A;  1KL9 A;  2GVA A;  5J3B A;  1ROD A;  4DV4 Q;  5ELN A;  5ELE A;  3I8Z A;  4KN7 C;  3IFD A;  2RA4 A;  1K83 H;  3FPP A;  3OIP A;  3SE0 A;  1VQ9 A;  5FJ8 G;  4DV7 L;  3RZD B;  4AYB G;  1HQR D;  3SK4 A;  3CW2 C;  3PO3 G;  1BCP D;  3L0O A;  1TWA B;  1EFW A;  4Y7N H;  3KF6 B;  4IUT A;  1LT4 D;  3CQZ H;  3PO2 G;  1WJJ A;  1K3B C;  3GD7 A;  4BY1 G;  3K5L A;  3CPW A;  2OXP A;  2C35 B;  4QCL A;  1PH3 A;  2UUA L;  1CQV A;  1M8A A;  1W6K A;  5IY0 A;  2WAQ E;  5M3M B;  1V8Q A;  3DM3 A;  4L63 B;  1LT5 D;  4HTH A;  5CGK A;  3K7U C;  4O2D A;  3Q0A A;  1X54 A;  2A6E C;  4APV A;  4OWW B;  2AQ2 B;  5FK9 C;  3OW2 A;  1H9J A;  2LKV A;  2E5L L;  5JVH 3;  1EFI D;  2ZXR A;  5FO9 B;  1KQS A;  4L5Q A;  1GXD C;  1I6H H;  4N8F A;  3JAM c;  4JI0 Q;  1JCK B;  1L2F A;  1SYB A;  1XMQ L;  3AMU A;  4ZKB B;  1TS2 A;  4BY7 B;  2R92 G;  5EAY A;  2D2C C;  2YYZ A;  2PNH A;  4DUZ Q;  2JA8 G;  4DU9 A;  2OQK A;  3JAM E;  1TS4 A;  4OO1 I;  1JWM D;  1TWC B;  5IGF A;  2L11 A;  2E2J H;  1GUW A;  2I5H A;  4A3E B;  3CPF A;  1EWI A;  3GTL H;  1I5F A;  2H5X A;  1YNN D;  1QZG A;  4IO9 A;  1BCP F;  4UPA A;  3VR5 A;  1DOL A;  5C4J B;  1I94 L;  1K83 B;  2ZT9 C;  4AH6 A;  2CWA A;  4X64 Q;  2BE5 C;  3UDF A;  1CZG A;  3KLR A;  4DNT B;  4Y7N B;  2F0V A;  3K8A A;  4XT1 B;  1EYA A;  2VXW A;  2F0N A;  3CQZ B;  2VQF L;  1WI5 A;  2HQL A;  4X62 Q;  1XPO A;  4DV4 L;  2XVS A;  4YCW A;  1RCV D;  3KLS A;  4UDU C;  5HUR A;  4L5S A;  4G57 A;  2PZT A;  2BCO A;  4KTA A;  2PYK A;  3HG9 A;  4HIK A;  1STB A;  4CDC C;  1TT2 A;  1PTO C;  1A0I A;  2J4X A;  2LY7 A;  4HIO A;  1RD9 D;  1BF4 A;  2K5D A;  4DR5 Q;  2GVB A;  4G7H C;  2QW7 A;  3C2P A;  2K50 A;  4PZ6 A;  4LMQ D;  2OQ0 A;  2H4O A;  4C3J H;  2LXK A;  3IRB A;  3X3M A;  5JJZ A;  2RDH A;  3I72 A;  4U68 A;  3ULL A;  2F4V Q;  4KD3 A;  2QIL A;  4WRD A;  3CCU A;  2B8G A;  1SNO A;  2A6E D;  4AYB E;  3CXC A;  2VUM H;  3GTL B;  1WFQ A;  1PH7 A;  4YWL A;  3PUW A;  3T4A C;  1ENF A;  3M7N A;  2B39 A;  4ODG A;  3TME A;  1Z47 A;  5C0X G;  1XTD A;  4CDF C;  2LXJ A;  5K5P A;  5CBA E;  3I4N B;  1E2W A;  3G6E A;  1FYC A;  4DUZ L;  3NWS A;  3AFQ A;  1PHJ A;  3VA5 A;  3E0J A;  1CKO A;  1K3R A;  3CKI B;  4CDE C;  4G7Z C;  4GN3 B;  5GAD C;  1WCM H;  2PQE A;  3F2C A;  4KI0 A;  4ZCK A;  1KDA A;  2EJG C;  2JA7 G;  2K7V A;  3J81 L;  2F4I A;  4LF8 Q;  2JYO A;  4CHT B;  4DV0 Q;  1I4G A;  4RGN A;  4PMW A;  3OHX C;  4HJ8 A;  3A7A B;  4NXN Q;  1PYB A;  3K5O A;  2YV5 A;  1PZJ D;  2K52 A;  1KDB A;  4X64 L;  1HZA A;  4C3I G;  4A4I A;  1EIF A;  3MXG A;  1IXR A;  2N88 A;  4A3K B;  4NW2 A;  3ND8 A;  1NBW A;  3CAM A;  4MN3 A;  4IPH A;  4ZUI A;  2ZJP A;  5K36 G;  1KAW A;  4X62 L;  4FF1 A;  2EY2 A;  1HUN A;  5KND A;  3HKS A;  3H3V H;  4ME5 A;  1TVX A;  2UUC Q;  1OXV A;  1EZ8 A;  2A5H A;  3TRE A;  2WIN B;  1PTO D;  2F0M A;  4FO2 A;  1U4L A;  4LNQ A;  3NWT A;  4DR5 L;  5C4X B;  4JBK A;  1DXM A;  1KD1 C;  3LNN A;  3A5U A;  2MGS A;  1LTT D;  4A75 A;  2A1A A;  2BOS A;  2CW0 C;  5C3E H;  2EDG A;  3CRK C;  1NR4 A;  2ZM6 Q;  5COY A;  2MJ8 A;  5BR8 Q;  2F4V L;  1VQP A;  1R4P B;  5A2Q E;  5C5M A;  4LK1 C;  4JYA L;  2YTV A;  1ET6 A;  1F9Q A;  1EYC A;  1F9S A;  2JEA I;  3PCO B;  2I5M X;  5EBD A;  2MO1 A;  3J80 i;  2A68 C;  3ULJ A;  3I73 A;  1BBW A;  4KY7 A;  4EQP A;  2KHI A;  1JWU D;  1H95 A;  2SNM A;  2JP1 A;  5I9O A;  2HQE A;  3ZJY C;  5JAV A;  2UXB L;  3RN2 A;  3E9H A;  1EIY B;  3K5M A;  3G7L A;  3HOU H;  1IYJ B;  5M3F H;  1OO9 B;  3GDE A;  4LUZ A;  4ULL A;  5NUC A;  4A76 A;  4P71 A;  4B3M L;  4YY3 L;  2F0K A;  1S40 A;  1CA6 A;  3MXN A;  3F2U A;  4WJ3 M;  1TII D;  1CK1 A;  5EPL A;  2F0Q A;  4LF8 L;  4DR2 Q;  4DV0 L;  2R6G A;  1PTO F;  3QOJ A;  4A3I H;  2AUK A;  2Y0S B;  3ER0 A;  2CHB D;  4NXN L;  3HOZ G;  1CUK A;  1Y8O B;  2K4K A;  3A5Z B;  3WWV A;  4DFA A;  3CCQ A;  2DY8 A;  1C8C A;  1PFM A;  3TZD A;  4DV3 Q;  1YJ9 A;  1B8A A;  5LMN Q;  4YCV A;  4B3T L;  4AQY Q;  1PH9 A;  2E2I H;  3TN2 A;  3R8B A;  1GUN A;  3UE1 A;  2IY5 B;  1L0W A;  1BDO A;  2IW3 A;  5C3E B;  3DEP A;  3PIO A;  4M1U B;  1I4X A;  2EPB A;  4RGO S;  4ABN A;  4F87 A;  2M2L A;  2UUC L;  4JI6 L;  1X9N A;  4RHR A;  4UP9 A;  5JPN C;  4HCS A;  4XTC S;  3NTH A;  3URY A;  2IX3 A;  4CKC A;  2VB2 X;  1F77 A;  2Z6B A;  1JE4 A;  1NNX A;  4QL5 A;  4QY7 A;  3S1N B;  3KF6 A;  5FJ8 H;  3PO3 H;  2G9H D;  3SK6 A;  2CW0 D;  1M1K C;  3KLW A;  2ZM6 L;  3WOF A;  2A69 D;  5BR8 L;  2ATW A;  4G4K A;  1VDZ A;  4BY1 H;  4LF4 Q;  5DAU A;  3TSS A;  2AUJ D;  2F0O A;  4DV5 Q;  3S9W A;  4GLV B;  1LLR D;  1B3Q A;  1KAA A;  3S16 B;  5C44 H;  1VQO A;  4MTK A;  4A3I B;  3CHB D;  4ME3 A;  5KYI A;  1VQM A;  3IKJ A;  4OHJ A;  1IW7 C;  1FVI A;  1HZ9 A;  4O1N A;  1X56 A;  3A55 A;  5E1F A;  1LO5 D;  3A8I E;  1HNX Q;  4KKU A;  4DR3 Q;  1W2B A;  1KXL A;  1CTM A;  1DCZ A;  4NB3 A;  3S17 B;  3NEM A;  3TRZ A;  3Q23 A;  3M4P A;  3UI2 A;  3T56 B;  2CVR A;  2M00 A;  4DR2 L;  2JA8 H;  3UDG A;  4BWG B;  4K6D A;  1RF2 D;  1LAB A;  3GTO B;  1N33 L;  1IBM Q;  1HZB A;  3V96 A;  4AIM A;  1ICF B;  3JAM i;  4DV3 L;  1I50 B;  4LF9 Q;  4JBM A;  4B08 A;  4AQY L;  3CCV A;  2YU9 B;  2QCP X;  2JA6 H;  2M9V A;  3HKZ G;  1EU3 A;  1DZ1 A;  2JQO A;  3MEH A;  4K0K L;  3S1Q H;  3AB9 A;  1AZQ A;  4GLA C;  5D65 A;  4ZRZ A;  1EEI D;  1JOK A;  5JEA H;  5IYC H;  1MJE A;  4IAL A;  4DNR B;  5C44 B;  3MC0 B;  1VS0 A;  1QOH A;  1N34 L;  3GTG H;  2R93 H;  1Y14 B;  4XXE A;  2RBM A;  3OPO A;  4C3J G;  4PV1 C;  1YIT A;  1CM9 A;  4LFA Q;  5IP9 H;  1Q8K A;  5IE8 A;  1A63 A;  1SAP A;  5CR3 A;  1VQJ A;  2IX0 A;  1T5X D;  1N8R C;  1FJG Q;  3HOY H;  3S14 H;  3MZ5 A;  1LM0 A;  1TQO A;  4O42 A;  5I6W A;  4K5X A;  1LTB D;  1JT8 A;  4YIJ A;  4IUQ A;  1IW7 D;  4QF4 A;  3KF8 B;  1JQY D;  4FP5 D;  4DR6 Q;  1D7Q A;  3QOL A;  3HP3 A;  1IL2 A;  2B29 A;  1HNX L;  1KLU D;  3S2H H;  1A3V A;  4DR3 L;  4QGU A;  2F0F A;  2F0P A;  1XYI A;  1WCM G;  2OTL A;  2JA6 B;  5FLX c;  1PZK D;  4A93 H;  1BCP B;  4MHE A;  2A6H C;  1AW7 A;  5FLX E;  1N9W A;  1IBM L;  4GZY C;  1U4R A;  1IBK Q;  4LF5 Q;  3GTJ H;  4LF9 L;  2EJM A;  1SFO B;  3SEB A;  1HQM C;  3GTQ B;  1A2T A;  1DM0 B;  1VQG A;  3SR1 A;  5CC4 A;  2GN5 A;  2R93 B;  1SE2 A;  5IWA Q;  1VQI A;  4OEL B;  5I2X A;  3I4O A;  4N8X 1;  2ZJR A;  4C56 C;  3MAQ A;  3FMC A;  1K8G A;  2Y0S G;  1X55 A;  3TDQ A;  3A0J A;  4Q5V A;  4ZYS A;  3S1R B;  2PMZ B;  5M9O A;  2KCT A;  3PGZ A;  2Q8I B;  2F0U A;  4HJA A;  3HOY B;  2B2W C;  1G2T A;  1AE2 A;  2EIF A;  1UEA B;  1EY4 A;  3FVQ A;  1GHK A;  3EA6 A;  4DV7 Q;  1G2S A;  1MSG A;  5C3E G;  4IPG A;  5C4H A;  1CT1 D;  4LFA L;  1GO3 E;  1RHP A;  1QCB D;  3HKZ E;  4A3B H;  2EE1 A;  4C3H B;  3S2H B;  3LWU A;  4WFN 3;  1TY0 A;  3OTO Q;  2ALY B;  1SYF A;  3E6Z X;  5EQ0 A;  5J1Z A;  3HGB A;  1UUP A;  2UUB Q;  3AU7 A;  1Y8P B;  5FO8 B;  1FJG L;  3K81 C;  2DNE A;  1MI2 A;  2F03 A;  3J81 j;  1JJC B;  5IGC A;  1XNR L;  1M90 C;  4A3G B;  3RZD H;  4JCV E;  2ICE C;  3I91 A;  1TWA H;  1A8V A;  1D1K A;  1E24 A;  1NAP A;  5J22 A;  1QNK A;  3CCE A;  1DYQ A;  1DD2 A;  1IKL A;  3VR3 A;  3J80 L;  3HOU G;  2N55 A;  5M3F G;  1TWF B;  1EOT A;  5DM6 3;  1AZP A;  1S5D D;  4XIG S;  1GD7 A;  3G71 A;  4DV1 Q;  1PH1 A;  2F1M A;  2KHJ A;  5IYD H;  3HOX H;  5M3M H;  1S3O A;  2JJQ A;  3MHB A;  2J0T D;  3J7A F;  5KNC A;  4A3I G;  2DY7 A;  4F7X A;  4RMF A;  2IJ0 A;  2EYL A;  4R4C A;  2A6H D;  1UE6 A;  1HR0 Q;  1QNU A;  3Q22 A;  1VF5 C;  1IBK L;  2C5C A;  1PRT D;  4H44 C;  2XTI A;  3QWN A;  5C0X I;  4RGM A;  1ENA A;  5KRU A;  3H15 A;  1VQC A;  2XN9 C;  3DWP A;  3FKI B;  4X3K A;  4DAM A;  3OWF A;  1FGU A;  3H94 A;  5IWA L;  2O2L D;  3KFU A;  2A74 C;  2LSS A;  4BY7 H;  4A3B B;  1LV9 A;  4UHV A;  1H9S B;  3BYY B;  1ZKO A;  4XQQ A;  4HSV A;  1Z9F A;  4IFD H;  1TWC H;  4A3E H;  1RJT A;  3A8K E;  2B63 H;  4RKB A;  4FF2 A;  4ZAI A;  1XPR A;  3TP7 A;  2DUD A;  5C4J H;  1ILP A;  1G51 A;  2K5H A;  1RIP A;  1CHP D;  2F0T A;  1FNU A;  5M5X H;  1K9M C;  5IGE A;  3RD4 A;  1T9H A;  3G6J B;  4EQ5 A;  5IT9 L;  5F2D A;  4UAI A;  3PUZ A;  3OTO L;  2NN6 H;  3A74 A;  2DJG C;  3A8J E;  1LAC A;  3VYU A;  2Y0S E;  5ELC A;  3OMG A;  2UUB L;  2EJF C;  3K7A H;  2EVB A;  3GO5 A;  2HCI A;  3HOX B;  4IUN A;  2G5D A;  3M9B A;  4KHZ A;  4N9P A;  3GV3 A;  4K2K A;  3CC4 A;  1B7Y B;  5C5L A;  5C44 G;  3DXJ C;  1PRT F;  1XNQ Q;  2F3V A;  1UWV A;  3TP5 A;  4CKB A;  1L1O B;  1VQB A;  5CV9 A;  1WTW A;  1BNZ A;  5JPM C;  3BS1 A;  2OWO A;  1QVC A;  2B2Y C;  1D2B A;  2MHV A;  1Q81 C;  2V4D A;  1EQV A;  4L8J A;  1SDF A;  5DLQ E;  1Q3L A;  3DLL A;  2K5W A;  4DV1 L;  3K6O A;  1LTA D;  2K5V A;  3GTM B;  1CSQ A;  3F8T A;  1W6J A;  1CKM A;  4FXD A;  1QE6 A;  2K5Q A;  2K6A A;  1GHJ A;  1G91 A;  4KJO A;  1LT6 D;  1RDP D;  3RZO B;  2O5J C;  5L37 A;  1HR0 L;  3V05 A;  4RFB A;  1J9O A;  4JC0 A;  4GN4 B;  2E8G A;  2B63 B;  1K73 C;  2ZTE A;  2F0I A;  3X3N A;  1H9M A;  4K8I A;  1QVG A;  3SK5 A;  1TY2 A;  1GVP A;  5LL6 X;  4EQO A;  2JA6 G;  5M5X B;  3I4N H;  3QR8 A;  3JAM L;  1Q12 A;  4KHV A;  1STN A;  2NBF A;  3NK9 A;  4JK1 C;  4KHP Q;  1KIX A;  2H1E A;  3BZC A;  1I4Q A;  1YNJ C;  3WOE A;  3BG3 A;  1O7L A;  4A3L H;  5CMD A;  2F0J A;  2N78 A;  3DEO A;  3K7A B;  1X3P A;  3IAY A;  5EKL A;  5JEA G;  5IYC G;  4XQJ A;  2FMM A;  3RLF A;  1HJP A;  2A19 A;  2R93 G;  4MTN A;  1B53 A;  4A3D H;  1X3G A;  4DNI A;  1U9R A;  4A3K H;  1CZW A;  3P7J A;  4R4I A;  5IP9 G;  4JI5 Q;  4HAE A;  3O13 A;  3NPP A;  2HDM A;  4KKT A;  3NBH B;  1X6O A;  3PUX A;  4DN4 M;  2OT2 A;  3K5N A;  5IIF A;  3PF5 A;  3CCS A;  3HOY G;  4PMC A;  1SLJ A;  3DWQ A;  3UDX A;  5CV4 A;  4R4T A;  2B2W A;  1E7Z A;  4HMJ A;  1XNQ L;  3K58 A;  4JYA Q;  4OXP A;  3RNU A;  2KVM A;  3I4M H;  4OIK A;  4IUR A;  5C4X H;  4A3M B;  2C9O A;  4C3H G;  2CWP A;  4DXF A;  3KF8 A;  1TWH B;  2QGQ A;  3ULP A;  1DOK A;  2L55 A;  1J6Q A;  1KRS A;  2PI2 A;  3ERS X;  5HY6 A;  2UXB Q;  4A93 G;  2E2H B;  1PV4 A;  3I4L A;  3CCM A;  1ESF A;  5JEA J;  4K8J A;  4B3M Q;  4YY3 Q;  3E3X A;  1JOO A;  2SOB A;  3W3A A;  1EYG A;  3NSW A;  3CMA A;  1MHW C;  2MNA A;  5KNB A;  5CV7 A;  2HIV A;  3H0G B;  5D3D A;  4IPC A;  4DF7 A;  5KEE A;  3HOV B;  4OL7 A;  3IL8 A;  4A3D B;  2BE5 D;  2KED A;  3W5O A;  4B3T Q;  4KHP L;  3NQI A;  2NZO A;  3OSO A;  1LTG D;  3F2D A;  2UXC Q;  2EQS A;  4IUP A;  1GM5 A;  1YVC A;  3BVM A;  2NTS A;  3BDO A;  2Z6K C;  4BBR H;  3CCJ A;  5D14 A;  1A62 A;  3BYT B;  3I90 A;  4JI6 Q;  2I07 B;  3HZX A;  1SNP A;  2K32 A;  2PI2 E;  3OWE B;  2N49 A;  1GUO A;  4YHH L;  3VYR A;  3AFP A;  2XGT A;  3I4M B;  4H02 A;  1C7Y A;  4A3B G;  5COR A;  4JI5 L;  1VQ5 A;  4ZLT F;  1C4Q A;  4XYO A;  4DK6 C;  4X3S A;  1A6X A;  3TZU A;  4POG A;  2EOT A;  3E0E A;  3KJP A;  2FXQ A;  5ELO A;  2KEE A;  4P75 A;  4C1N I;  4BBS H;  1NTG A;  2MP1 A;  5FO7 B;  1EIG A;  4TVA B;  2F0G A;  2MQH A;  4DA2 A;  4RHS A;  1YBY A;  2VZA A;  4FXG C;  5C6A A;  3BDL A;  3S1N H;  5LL6 S;  5C4Z A;  1MBY A;  4DGZ A;  1D5X C;  2B2U C;  1UNS A;  2R7D A;  5JJL A;  2RSN A;  5IYD G;  3HOX G;  2PMZ E;  5M3M G;  5A2Q L;  3STB C;  3K59 A;  1UEB A;  2Z4H A;  3BDC A;  2HIX A;  3U9S A;  3S16 H;  4BBR B;  2B2Y A;  4KKS A;  2BH2 A;  1N33 Q;  4IJL A;  5FLM H;  1S5E D;  5LMU Q;  4HED A;  1FR3 A;  2B8F A;  1S5C D;  4PMB A;  5M5W B;  1PH5 A;  4BY7 G;  1AH9 A;  1EIH A;  2OTJ A;  2I46 A;  2R7F A;  4R8N A;  3S17 H;  1SJE D;  4IFD G;  2UXC L;  2KHS A;  2IHF A;  2F0S A;  1H9S A;  3QJY A;  4A3E G;  1XPU A;  2B63 G;  1EWC A;  4RGT A;  1SYC A;  2K03 A;  4R4O A;  1HTL D;  5E4W C;  4K0K Q;  4BBS B;  1A3T A;  4OX9 Q;  1EUJ A;  5I4D A;  2O5I C;  2PCF B;  2WAQ B;  3GTO H;  4HIM A;  5JJI A;  4IOC A;  4HSP A;  2SEB D;  4CJ0 B;  1PMR A;  3BU2 A;  3LX0 A;  1I50 H;  5I2Y A;  1JC7 A;  1VQ7 A;  3FEW X;  2AQ3 B;  3KBG A;  4A3F H;  2YU9 H;  1LT3 D;  2NN6 G;  3BZK A;  3EIV A;  4P73 A;  1N34 Q;  1AP0 A;  5GQO A;  3H3V I;  1HA5 A;  1QJO A;  1EWH A;  2AWO A;  1BR9 A;  1Z7T A;  5T1G A;  3DM1 A;  1V1P B;  2CH4 W;  1WTO A;  4DR7 Q;  2OCE A;  4H7B A;  1E0B A;  1EZ6 A;  4ID6 A;  3SHL A;  2JXM B;  3JC6 6;  2NZH A;  2K5N A;  1L1O A;  3H3V C;  2A68 D;  1NMF A;  4ZK9 B;  1P8L A;  1B9N A;  4IFD J;  2IT1 A;  1EQR A;  1O7Y A;  5GAE C;  4GNX B;  3L7Z C;  5ELF A;  4RCO A;  2A73 B;  4MZ9 A;  3Q8D A;  1B9M A;  2EXD A;  3S24 A;  5AJ3 Q;  1D5M C;  3MVV A;  5E3F A;  1J8I A;  1E3P A;  4DK3 C;  3HOW B;  1Q46 A;  3M3Y H;  1SE8 A;  1HUM A;  4GKK L;  5BN4 A;  2AQ1 B;  2X6L A;  1PYW D;  2QF7 A;  5LMU L;  1SE4 A;  3I4N G;  4WJ4 A;  1ASY A;  4HJ5 A;  3J7A V;  4GKJ Q;  4A3F B;  2LMC B;  4JI1 Q;  3ZYY X;  2BA0 A;  3R93 A;  2VW9 A;  4J6H A;  1A3U A;  1YZ6 A;  4A3L G;  3GP7 A;  1AE3 A;  4KV6 A;  1EQQ A;  4KLK A;  3GTK B;  3EJI A;  5GAH C;  4OX9 L;  1LUZ A;  1DJR D;  1CHQ D;  4I7A A;  4KJN A;  4A3D G;  4HR7 B;  2MFI A;  2ES2 A;  1KNA A;  4A3K G;  3LGJ A;  1AN8 A;  3N6R A;  2DN8 A;  3U4Z A;  4OWX B;  3F2B A;  1SFO H;  3S15 B;  1Y8N B;  3GTQ H;  4GN5 A;  1KC8 C;  3PIP 3;  1TWG H;  1Q1B A;  3DUZ A;  1KHI A;  4QMG A;  4F88 A;  5EJW A;  3NBH A;  1J5E Q;  3PO2 B;  3SK8 A;  1MKH A;  1FNV A;  1TXY A;  4ILW A;  1HFG A;  4DR7 L;  1RTO A;  4GNX C;  1EQT A;  2NUC A;  1HNW Q;  2Z6K A;  3CC7 A;  3WDN A;  5GRO A;  4IQZ A;  3S1R H;  4TSS A;  3MFY A;  4JW0 A;  3I4M G;  3CF5 A;  1BKB A;  5C4X G;  2B2T C;  4M8A A;  1EY9 A;  5EPJ A;  1WTX A;  3N52 A;  4XQN A;  2JA9 A;  1XNR Q;  3M3Y B;  2NYZ D;  3NQT A;  4JI4 L;  1I3Q B;  4C3H H;  4R8I A;  1KLG D;  5I9P A;  1OXT A;  3I70 A;  1FGB D;  1GJX A;  1F2Z A;  2F0L A;  3M4Y A;  2R92 B;  1L0Y B;  3R2T A;  5AJ3 L;  2F3W A;  2RHQ B;  1F9R A;  5IP7 H;  1PZI D;  5EKI A;  3H09 A;  5IYB H;  4DV2 L;  1SMY C;  2RCF A;  4A3G H;  4A3J B;  4JV5 L;  3D4D A;  1UE5 A;  2L4N A;  2FHT A;  2B2U A;  3MFG A;  4C1N K;  3CD6 A;  4I7Z C;  5C3W A;  3RR5 A;  1Y69 U;  4GKJ L;  1U5K A;  1TWF H;  3P1H A;  4JI1 L;  4GOP B;  1TWG B;  2QDL A;  1IBL L;  3I7F A;  1NMG A;  2WB1 B;  3K80 C;  4CBV A;  3EBE A;  1ZYR C;  3KBX A;  5FLX L;  3ONA B;  1Q86 C;  4BBR G;  1K8M A;  1Y1V B;  1V43 A;  5ELB A;  4E6I A;  4CDD C;  5KYL A;  3KDF B;  1K0S A;  2ZXP A;  4JVZ A;  4KN4 C;  4HCE A;  2B3G A;  1MSH A;  2FIN B;  1YEZ A;  4O0A A;  1HH2 P;  3FKI H;  3TP6 A;  2CCZ A;  2DGY A;  1Q1E A;  2MPM A;  2RSO A;  4F8M A;  1J5E L;  4FF4 A;  4BBS G;  2CH4 A;  3FHW A;  1WVL A;  4C2M B;  1B70 B;  4EX5 A;  3GTP H;  1HNW L;  1D5Z C;  3NEN A;  4LAA A;  1SN8 A;  1SYE A;  2L0C A;  4OIJ A;  4MIU A;  3EQL C;  3UE0 A;  4P72 A;  2VNU D;  1BCP C;  3ERO A;  2KA7 A;  2VB3 X;  1CQF A;  1SBB B;  1DOM A;  2EXZ A;  2HCC A;  2KCC A;  2Z8L A;  1SRO A;  1Q82 C;  4JI7 Q;  1YNX A;  3I2Z A;  1K28 A;  4RA8 A;  2EYF A;  2P5Z X;  1E22 A;  3I3C A;  2YTY A;  1F2M A;  4N9T A;  1TKW B;  3V2T A;  2NWG A;  1RTN A;  1FD7 D;  4GOP C;  4JBJ A;  4K5W A;  4LJZ C;  3PV0 A;  4TQU S;  3Q6S A;  2BDN A;  2K05 A;  1CA5 A;  4OO1 H;  2UU9 Q;  4S3S A;  2WKD A;  3RUZ A;  1HRJ A;  4LFC L;  1GUS A;  5FLM G;  4L5T A;  3H91 A;  1VQ8 A;  4YCU A;  3VYS A;  2JA5 H;  1QG7 A;  5BN5 A;  3K0X A;  3SXH A;  1S5B D;  4C3I B;  2Z4I A;  3GTM H;  1JIC A;  4PQX A;  2JK8 A;  1HNZ L;  1STH A;  4DKA C;  2PW7 A;  2NVY B;  1ONL A;  3HOW G;  4LF6 Q;  3RZO H;  3GTP B;  1Y1W H;  1YNN C;  3HS0 C;  1G8Z D;  1JOQ A;  1JJ2 A;  2SNS A;  3T1Y Q;  2NZ1 D;  3C46 A;  4YWM A;  2YTX A;  4UP7 A;  4A3F G;  1NSN S;  1TS3 A;  2JEB I;  1TS5 A;  2HT1 A;  4B9X A;  2PNR C;  4JOI A;  3L3O C;  1KDC A;  1B44 D;  1BVS A;  2KCN A;  1QUQ B;  2BDO A;  2R7Z H;  1BQQ T;  2X6G A;  1I4P A;  1XJV A;  1ZEQ X;  1EEF D;  1IHZ A;  4R4Q A;  3UDI A;  1MJC A;  1HHV A;  1B4O A;  1V1P A;  1X3Q A;  2FJ2 A;  1FNW A;  1DON A;  4CKE A;  1X65 A;  4ALP A;  2ZTD A;  3D3R A;  1X3E A;  4B3S L;  1IZ6 A;  3R2I A;  2PQA B;  1MD2 D;  4JI7 L;  1IL8 A;  2F0D A;  3KJO A;  4IJH A;  1EY7 A;  1LTL A;  4NMZ A;  2ZTC A;  1PFN A;  2JA5 B;  2N8N A;  1LYL A;  4GNX A;  4JI3 Q;  2HHH L;  3MXP A;  4ZQ3 A;  1PTO B;  2Z1C A;  2UU9 L;  2QA4 A;  1BUV T;  1Y1W B;  3FP9 A;  2B2T A;  2D62 A;  5A35 A;  2Q8T A;  4A3M H;  4KMU C;  3TEH B;  2TMP A;  1SNM A;  3HOZ B;  1XXG A;  1TWH H;  1A15 A;  4QIW B;  3G4S A;  3A56 A;  3A54 A;  3I56 A;  2J7Z A;  4RWS C;  4LW1 A;  4LUV A;  2DNC A;  2E2H H;  1O7Z A;  3H6M A;  4IUU A;  2R7Z B;  4R9W A;  4LF6 L;  2I0Q A;  1SRU A;  3PUY A;  1E1T A;  4A3J G;  3ITP A;  3CCR A;  1F9P A;  1JJG A;  3T1Y L;  1EYD A;  2Q2I A;  2L15 A;  1UE7 A;  4QUF A;  1NCV A;  3H0G H;  2EYH A;  1F2L A;  4JI8 Q;  4UY8 C;  1OXX K;  2CKZ B;  2Z9H A;  2I5L X;  4NKL A;  4YHH Q;  3LWE A;  3FPU B;  3HOV H;  1O7I A;  1V1Q A;  2D9U A;  1L1O C;  2WB1 G;  3C3L A;  5IOC A;  2QEJ C;  4WJW A;  2VS1 A;  3U9O A;  4IFD I;  3CP0 A;  2O4X A;  1Y1V G;  3NUC A;  3D6W A;  2IL8 A;  3MA2 B;  2KQ3 A;  3NXW A;  1G6Z A;  4IZ8 A;  1P16 A;  2SDF A;  4POF A;  2HUG A;  2IWH A;  5KIX A;  4PZ7 A;  4HMI A;  4RCN A;  3FRP B;  2XRQ D;  3L2P A;  1MGS A;  2CFM A;  1VQ4 A;  1GUT A;  5LMN W;  4L5R C;  2F0E A;  5IOD A;  5CBE E;  2NTT A;  2NN6 I;  4KY5 A;  3NHH A;  4NPS A;  5CV8 A;  5JVG 3;  1I6H B;  1QWY A;  3D4W A;  1WYD A;  4Q0F A;  2PZW A;  1GKH A;  4JI3 L;  1I4R A;  3KLS X;  1WTR A;  1U4P A;  3P75 A;  2RQX A;  1AFP A;  3R3O A;  5IP7 G;  2RVL A;  2RHS B;  3U4V A;  5IYB G;  1PFS A;  3J81 c;  1PLF A;  3PIP A;  4A3G G;  4QQB X;  1VQA A;  2E2J B;  2A8V A;  2VQE Q;  3HFZ B;  1U4M A;  1XX8 A;  2QKI C;  1SEB D;  4DR4 Q;  1M4V A;  1K8O A;  2RKS A;  1Q90 A;  2RF4 A;  2EYJ A;  1WOC A;  4DK0 A;  4U67 3;  3J81 E;  3DWA A;  1KAB A;  3EFX D;  2K75 A;  2R3Z A;  1VQL A;  4JI0 L;  3C1E A;  5KGU A;  4L6T B;  2IX1 A;  2F0W A;  1N32 Q;  2BH8 A;  1JE5 A;  3RMH A;  1VQF A;  1OXS C;  2F3I A;  3HEJ A;  4IPD A;  4GOP A;  1CKN B;  4B3R Q;  2KCM A;  2PO4 A;  3TS0 A;  3HKZ B;  2XIW A;  1NR2 A;  4EGV A;  1YNJ D;  1BBU A;  2K14 A;  5DEH A;  4JI8 L;  3Q24 A;  3KDF A;  3CCL A;  2F52 A;  3FKI G;  1V9P A;  2CQO A;  4TRD A;  3BZD B;  4KY6 A;  4KK7 A;  5M5W H;  2EZV A;  2PZU A;  1VQH A;  5JOB A;  4QUC A;  4A3C H;  1SXT A;  1JMC A;  3CRL C;  4DAY B;  4C3J B;  1ENC A;  4P74 A;  5FKA C;  4JI2 Q;  4I65 A;  3T13 A;  4CJ2 C;  3J7A 5;  1LTR D;  2JN4 A;  4NP5 A;  2ZJQ A;  1VQE A;  5C0X J;  5HGT A;  2ICI A;  1GUG A;  2VUM B;  1D8L A;  2V1C C;  2L5T A;  4JBW A;  2WB1 E;  4XYQ A;  3PMF A;  1I6V C; 
#chains in the Genus database with same CATH homology
 1QZG A;  4JI1 Q;  2KBN A;  4IO9 A;  3K81 C;  2BA0 A;  2VW9 A;  3RLN A;  1FJG L;  4UPA A;  4X66 Q;  1YZ6 A;  1I94 L;  4A3L G;  1AE3 A;  4AH6 A;  3J81 j;  1JJC B;  1EQQ A;  4KLK A;  3BJU A;  2CWA A;  1XNR L;  4X64 Q;  1M90 C;  3RZD H;  3UDF A;  4JCV E;  3U50 C;  5GAH C;  4OX9 L;  1YJW A;  1LUZ A;  3M4O H;  3K8A A;  1TWA H;  1A8V A;  1E24 A;  2D0O A;  4HJ9 A;  3I55 A;  1VQK A;  2VQF L;  3CCE A;  4OO1 G;  1WI5 A;  2HQL A;  4A3D G;  1VQD A;  2MFI A;  4X62 Q;  1XPO A;  4OON A;  1E1O A;  3LGJ A;  5M3F G;  2VQE L;  4A3K G;  2ES2 A;  3HOU G;  4DR4 L;  4DV4 L;  3U4Z A;  4YCW A;  2UXD Q;  4XIG S;  5H1S E;  1GD7 A;  3G71 A;  4DV1 Q;  4OWX B;  3F2B A;  1SFO H;  1PH1 A;  4L5S A;  2KHJ A;  3GTQ H;  3HOX H;  4GN5 A;  5M3M H;  5IYD H;  1KC8 C;  1S3O A;  1TWG H;  2JJQ A;  1Q1B A;  2NVX H;  1KHI A;  4LF7 Q;  3KOJ A;  5GAG C;  4HIK A;  2JA5 G;  4GKK Q;  5HGQ A;  1RL2 A;  1HZC A;  1YI2 A;  4A3I G;  2WP8 J;  1J5E Q;  4RMF A;  1A0I A;  4R4C A;  3PF4 A;  1MKH A;  1TXY A;  1N32 L;  1UE6 A;  1UE1 A;  4HIO A;  1HR0 Q;  4DR7 L;  4GNX C;  4DR5 Q;  1HNW Q;  2Z6K A;  3CC7 A;  3U58 A;  2GVB A;  1IBK L;  5GRO A;  3S1R H;  4B3R L;  2K50 A;  2XTI A;  4PZ6 A;  1Y1W G;  3I4M G;  5C0X I;  1BKB A;  2OQ0 A;  3CF5 A;  4BXX H;  4C3J H;  5C4X G;  2LXK A;  3H15 A;  3IRB A;  1VQC A;  4DAM A;  1NE3 A;  1XNR Q;  1FGU A;  2JA9 A;  3HOW H;  1ASZ A;  5IWA L;  3ULL A;  2F4V Q;  3KFU A;  2LSS A;  4BY7 H;  3CCU A;  4JI4 L;  1C0A A;  4YWK A;  2Q2T A;  1Z9F A;  3M4Q A;  4C3H H;  4AYB E;  3CXC A;  2NVQ H;  1TWC H;  2VUM H;  4DV6 Q;  4FDB A;  4A3E H;  1WFQ A;  1OXT A;  1PH7 A;  2R7Z G;  2B63 H;  4YWL A;  4DR1 Q;  3PUW A;  3M7N A;  1G6P A;  1QUQ A;  1Z47 A;  5C0X G;  1XTD A;  1XPR A;  2DUD A;  5AJ3 L;  5C4J H;  2LXJ A;  1G51 A;  1JB7 A;  2K5H A;  2RHQ B;  5IP7 H;  1RIP A;  2WFW A;  4JI2 L;  5IYB H;  4DV2 L;  5M5X H;  1K9M C;  3GTK H;  4A3G H;  2AWN A;  3G6E A;  1T9H A;  2D0P A;  4DUZ L;  4EQ5 A;  1N36 Q;  4JV5 L;  3AFQ A;  1PHJ A;  1UE5 A;  1CKO A;  1K3R A;  3KYH C;  1S72 A;  3PUZ A;  4GN3 B;  5GAD C;  1WCM H;  4LWC A;  3OTO L;  1PA6 A;  3F2C A;  3A74 A;  4KI0 A;  3CD6 A;  3RR5 A;  4GKJ L;  1U5K A;  2Y0S E;  2JA7 G;  1VCI A;  1TWF H;  4LF8 Q;  2UUB L;  4DV0 Q;  3K7A H;  4JI1 L;  3GO5 A;  4PMW A;  2PQA A;  3S15 H;  3E9I A;  4X66 L;  4GOP B;  3M9B A;  4KHZ A;  1IBL L;  4HJ8 A;  3I7F A;  3CC4 A;  4NXN Q;  1NMG A;  1X3F A;  1PYB A;  1B7Y B;  2YV5 A;  3EBE A;  3K80 C;  2K52 A;  5C44 G;  1YIJ A;  4PG3 A;  4X64 L;  1VQN A;  3D0F A;  1Q86 C;  1HZA A;  4JI4 Q;  1XNQ Q;  1UWV A;  4BBR G;  3T1H Q;  4A4I A;  1EIF A;  3PO2 H;  2OWO A;  1L1O B;  1IXR A;  1VQB A;  1QVC A;  3B6Y A;  5E7N A;  3STB D;  1QVF A;  1Q81 C;  1V43 A;  1NBW A;  3CAM A;  2ZJP A;  4IPH A;  3AEV A;  5K36 G;  1YHA A;  3CME A;  3KDF B;  2RCN A;  1KAW A;  4X62 L;  5DLQ E;  3DLL A;  2B3G A;  2UXD L;  4DV1 L;  5M5Y H;  3HKS A;  3H3V H;  1U0L A;  1YEZ A;  2K5V A;  1CSQ A;  3EN2 A;  4O0A A;  4A3M G;  3F8T A;  1HH2 P;  3FKI H;  1CKM A;  1PVO A;  4NXM Q;  2CCZ A;  2DGY A;  1Q1E A;  4LF7 L;  4DV2 Q;  2UUC Q;  1OTC A;  1OXV A;  3D31 A;  3F1Z A;  4JV5 Q;  4DUY Q;  1J5E L;  3TRE A;  1FL0 A;  4BBS G;  1I3Q H;  3FHW A;  4LNQ A;  1HR0 L;  1B70 B;  4EX5 A;  3GTP H;  1HNW L;  4DR5 L;  4JBK A;  1KD1 C;  4JC0 A;  4GN4 B;  2E8G A;  2ID0 A;  3NEN A;  4JOI C;  2ZTE A;  3A5U A;  1SN8 A;  1K73 C;  2Z0S A;  4A75 A;  2A1A A;  1QVG A;  3S2D H;  4RG1 A;  3UE0 A;  5C3E H;  1PH8 A;  1IBL Q;  2R92 H;  1GVP A;  2ZM6 Q;  4P72 A;  2VNU D;  2JA6 G;  5BR8 Q;  2F4V L;  3I4N H;  1VQP A;  1Q12 A;  3H0G G;  1K0R A;  4JI7 Q;  1SRO A;  1Q82 C;  3J7Z C;  1YNX A;  4JYA L;  4A3J H;  2YTV A;  3I2Z A;  4KHP Q;  4QJF A;  1KIX A;  2N3S A;  3HOV G;  3BZC A;  2NVT H;  5LMN L;  3ICE A;  1E22 A;  2YTY A;  4DV6 L;  4A3L H;  2JEA I;  3PCO B;  2I5M X;  2N78 A;  2MO1 A;  3J80 i;  2Q2U A;  4DR1 L;  3ULJ A;  1BBW A;  1YHB A;  2KHI A;  1C9O A;  5JEA G;  5IYC G;  4GOP C;  4JBJ A;  3NEL A;  1H95 A;  1PH4 A;  3RLF A;  3PV0 A;  4TQU S;  3ZJY C;  1HJP A;  2UXB L;  3RN2 A;  2A19 A;  3E9H A;  2UU9 Q;  1EIY B;  2R93 G;  4MTN A;  1HR0 W;  4A3D H;  1X3G A;  4OWT B;  4DNI A;  3HOU H;  1IYJ B;  5M3F H;  4A3K H;  4IOA A;  4R4I A;  5IP9 G;  3GDE A;  4LFC L;  5FLM G;  1Y1V H;  4LUZ A;  4A76 A;  1N36 L;  4QIW E;  4JG2 A;  4L5T A;  4P71 A;  4YY3 L;  4B3M L;  3NBH B;  1S40 A;  1VQ8 A;  3PUV A;  4YCU A;  4LUO A;  4WJ3 M;  2JA5 H;  2Q2H A;  1X6O A;  4LF8 L;  3PUX A;  4DV0 L;  2R6G A;  4BA1 I;  4DR2 Q;  4Y52 H;  3K0X A;  4A3I H;  4DPG A;  3CCS A;  3PF5 A;  1PH6 A;  3GTM H;  3HOY G;  3SGI A;  3S1M H;  1SLJ A;  4NXN L;  3ER0 A;  1PYS B;  3UDX A;  2JK8 A;  3HOZ G;  1HNZ L;  4LFB Q;  1CUK A;  2K4K A;  3A5Z B;  4R4T A;  1E7Z A;  3WWV A;  4DKA C;  3CCQ A;  3VDY A;  1XNQ L;  3HOW G;  4JYA Q;  4LF6 Q;  4X65 Q;  3RZO H;  4OXP A;  4DV3 Q;  3RNU A;  4J15 A;  3T1H L;  2JE6 I;  1YJ9 A;  1B8A A;  1Y1W H;  1G29 1;  5LMN Q;  4C2M H;  3I4M H;  4YCV A;  4LF4 L;  4B3T L;  4AQY Q;  5C4X H;  1PH9 A;  2E2I H;  1JJ2 A;  3T1Y Q;  2CWP A;  4DV5 L;  3UE1 A;  2IY5 B;  1L0W A;  2VUM G;  2AHO B;  1EOV A;  4YWM A;  2YTX A;  3PIO A;  4JI5 Q;  2QGQ A;  4UP7 A;  3ULP A;  3RLO A;  3AQQ A;  4A3F G;  2HT1 A;  2JEB I;  1J6Q A;  2AKW B;  1KRS A;  2PI2 A;  1SMX A;  3ERS X;  5HY6 A;  4NXM L;  2UXB Q;  4JOI A;  4GS3 A;  4A93 G;  1BVS A;  2UUC L;  4JI6 L;  1X9N A;  2KEN A;  4UP9 A;  1PV4 A;  1QUQ B;  2IHE A;  4XTC S;  3CCM A;  4DUY L;  4LFC Q;  2R7Z H;  5JEA J;  4B3M Q;  4YY3 Q;  1OXU A;  1XJV A;  4R4Q A;  3UDI A;  1MJC A;  1EYG A;  3TS2 A;  4X6A H;  1K8A C;  4QL5 A;  3CMA A;  4QY7 A;  3KF6 A;  5FJ8 H;  2MNA A;  1PH2 A;  3J81 i;  2HIV A;  3PO3 H;  1X65 A;  1CKN A;  1M1K C;  3KLW A;  2ZM6 L;  4ALP A;  2ZTD A;  4R1J A;  1HNZ Q;  3AYH B;  1X3E A;  4IPC A;  4B3S L;  1IZ6 A;  5BR8 L;  2ATW A;  1XMO Q;  2PQA B;  4HJ7 A;  4BY1 H;  4JI7 L;  1NJI C;  3W5O A;  1MIU A;  1R9T H;  4B3T Q;  4LF4 Q;  2JA7 H;  4KHP L;  2NZO A;  3KJO A;  4IJH A;  4HID A;  2BA1 A;  3F2D A;  2UXC Q;  1LTL A;  4DV5 Q;  4GLV B;  2ZTC A;  2EQS A;  4A3C G;  2N8N A;  5C44 H;  1VQO A;  1LYL A;  1GM5 A;  1YVC A;  4ME3 A;  1VQ6 A;  4GNX A;  4JI3 Q;  2Z6K C;  1VQM A;  4C3I H;  4BBR H;  3W1B A;  3CCJ A;  1A62 A;  1FVI A;  1HZ9 A;  2HHH L;  3W1G A;  4JI6 Q;  2PI2 E;  4UP8 A;  1X56 A;  3G48 A;  1YHQ A;  2N49 A;  2NVY H;  2UU9 L;  1HNX Q;  4YHH L;  3AFP A;  2QA4 A;  2XGT A;  4DR3 Q;  1W2B A;  3FP9 A;  1KXL A;  4H02 A;  1C7Y A;  4A3B G;  4JI5 L;  1VQ5 A;  2VY3 A;  2WAQ G;  2D62 A;  4NB3 A;  3NEM A;  4A3M H;  5JJK A;  4DK6 C;  3TEH B;  3TRZ A;  3M4P A;  1KRT A;  1TWH H;  4POG A;  3G4S A;  3E0E A;  3KJP A;  2QEX A;  4DR2 L;  2JA8 H;  3UDG A;  3I56 A;  1QZH A;  2FXQ A;  3M85 A;  5ELO A;  4B3S Q;  4P75 A;  4LW1 A;  2AMC B;  4BBS H;  4LUV A;  4GLX A;  1NTG A;  1N33 L;  2VL6 A;  1IBM Q;  4LFB L;  2E2H H;  3J80 c;  1HZB A;  4AIM A;  4LF6 L;  4X65 L;  3JAM i;  4TVA B;  2I0Q A;  3OYY A;  4DV3 L;  2MQH A;  1SRU A;  4LF9 Q;  3PUY A;  4JBM A;  1E1T A;  4A3J G;  3CCR A;  1YBY A;  4AQY L;  2VZA A;  3CCV A;  2UUA Q;  1JJG A;  3T1Y L;  2Q2I A;  2L15 A;  1UE7 A;  3S1N H;  2JA6 H;  2ASB A;  3HKZ G;  3H0G H;  2R7D A;  4JI8 Q;  2HHH Q;  4UY8 C;  5JJL A;  2JQO A;  1OXX K;  2CKZ B;  5IYD G;  3HOX G;  2PMZ E;  5M3M G;  4K0K L;  2I5L X;  3S1Q H;  4YHH Q;  4GLA C;  3STB C;  1O7I A;  1V1Q A;  3MEF A;  1L1O C;  2WB1 G;  3CC2 A;  2E5L Q;  3HOV H;  4DR6 L;  1UEB A;  1NY4 A;  2VS1 A;  4IFD I;  3CP0 A;  5IYC H;  1MJE A;  1Y1V G;  2HIX A;  4PZ8 A;  3S16 H;  1XMQ Q;  3PSI A;  1P16 A;  4MNO A;  4POF A;  1VS0 A;  1N34 L;  3GTG H;  4BXX G;  1Q7Y C;  1Y14 B;  2R93 H;  1YIT A;  2BH2 A;  4PZ7 A;  4LFA Q;  1N33 Q;  3MXN B;  4IJL A;  1Q8K A;  5IP9 H;  1CSP A;  5FLM H;  5IE8 A;  3L2P A;  1A63 A;  2CFM A;  5LMU Q;  1VQ4 A;  1PH5 A;  1YJN A;  1XMO L;  4BY7 G;  1AH9 A;  5LMN W;  4L5R C;  4LF5 L;  2OTJ A;  1VQJ A;  2IX0 A;  3TQY A;  2R7F A;  1N8R C;  1FJG Q;  3S17 H;  2NN6 I;  4IFD G;  3RN5 A;  3HOY H;  2UXC L;  3S14 H;  2IHF A;  4NPS A;  1I94 Q;  4A3E G;  1XPU A;  2B63 G;  3HOZ H;  1LM0 A;  1WYD A;  4R4O A;  1GKH A;  4JI3 L;  1DGS A;  5IT9 c;  2UUB Q;  4K0K Q;  1JT8 A;  4OX9 Q;  1EUJ A;  1W3S A;  2MO0 A;  4BA2 I;  1SR3 A;  5JJI A;  3GTO H;  4HIM A;  3KF8 B;  5IP7 G;  4DR6 Q;  1D7Q A;  2RHS B;  4IOC A;  2VQF Q;  3U4V A;  1IL2 A;  5IYB G;  1PFS A;  2B29 A;  1HNX L;  3J81 c;  3PIP A;  4A3G G;  3S2H H;  4QQB X;  1VQA A;  3BU2 A;  4DR3 L;  1I50 H;  2A8V A;  2VQE Q;  1VQ7 A;  1KL9 A;  2GVA A;  3HFZ B;  5J3B A;  4QGU A;  4DV4 Q;  4DR4 Q;  5ELN A;  2RF4 A;  1WCM G;  4A3F H;  2YU9 H;  2OTL A;  2NN6 G;  1WOC A;  3BZK A;  3EIV A;  5FLX c;  4P73 A;  1N34 Q;  4A93 H;  2K75 A;  1K83 H;  1VQL A;  5GQO A;  4JI0 L;  3H3V I;  1VQ9 A;  5FJ8 G;  4DV7 L;  2IX1 A;  4AYB G;  2AWO A;  3CW2 C;  3PO3 G;  3L0O A;  2BH8 A;  1JE5 A;  1EFW A;  1N32 Q;  1VQF A;  4Y7N H;  4DR7 Q;  1N9W A;  3KF6 B;  1IBM L;  2OCE A;  1OXS C;  2F3I A;  4GOP A;  4IPD A;  1IBK Q;  4LF5 Q;  1CKN B;  3CQZ H;  3PO2 G;  1WJJ A;  4B3R Q;  2KCM A;  3GTJ H;  3GD7 A;  4BY1 G;  3CPW A;  3TS0 A;  4LF9 L;  2C35 B;  3JC6 6;  1PH3 A;  2NZH A;  2K5N A;  2UUA L;  5IY0 A;  1L1O A;  2WAQ E;  1VQG A;  1BBU A;  3DM3 A;  2GN5 A;  2K14 A;  1NMF A;  5IWA Q;  1VQI A;  3K7U C;  1P8L A;  3I4O A;  4JI8 L;  3KDF A;  2ZJR A;  4O2D A;  3CCL A;  4IFD J;  2F52 A;  1X54 A;  1V9P A;  3FKI G;  2CQO A;  2IT1 A;  4APV A;  1K8G A;  4OWW B;  1EQR A;  5GAE C;  2Y0S G;  4GNX B;  3L7Z C;  1X55 A;  5M5W H;  3OW2 A;  2E5L L;  1VQH A;  3A0J A;  4A3C H;  4MZ9 A;  1JMC A;  2KCT A;  3PGZ A;  4HJA A;  3Q8D A;  2EXD A;  3S24 A;  4DAY B;  1AE2 A;  2EIF A;  1KQS A;  4P74 A;  5AJ3 Q;  4L5Q A;  1I6H H;  3JAM c;  4JI0 Q;  1E3P A;  4DK3 C;  1L2F A;  1XMQ L;  1Q46 A;  4DV7 Q;  4JI2 Q;  3M3Y H;  1SE8 A;  5C3E G;  2R92 G;  5EAY A;  4GKK L;  2YYZ A;  3J7A 5;  2PNH A;  4IPG A;  4DUZ Q;  4LFA L;  1GO3 E;  3HKZ E;  2JA8 G;  4A3B H;  2OQK A;  2ZJQ A;  4OO1 I;  5LMU L;  1VQE A;  5C0X J;  3I4N G;  4WJ4 A;  1ASY A;  4HJ5 A;  3OTO Q;  2ALY B;  2E2J H;  2I5H A;  1D8L A;  3CPF A;  2V1C C;  1EWI A;  4GKJ Q;  3GTL H;  4JBW A;  1I5F A;  2WB1 E;  2H5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...