3I2ZA

Structure of cold shock protein e from salmonella typhimurium
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
SHMSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVTAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallization and X-ray structure of cold-shock protein E from Salmonella typhimurium
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Gene regulation
molecule keywords RNA chaperone, negative regulator of cspA transcription
total genus 15
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i2zA00
3T1YL 4DV0Q 3G48A 4BXXG 1NE3A 4IFDJ 3AEVA 3GTMH 1HZCA 2CWAA 3BZCA 1XNQQ 4IPHA 3CC2A 1YVCA 1K8AC 3HOXG 2MFIA 1Q86C 1PA6A 1SN8A 2YTYA 4JI8Q 2XGTA 3WWVA 1PYBA 4DV4L 4X6AH 2AWOA 5GAHC 3S1QH 4JV5L 2JA8G 3E0EA 1KD1C 1PYSB 2MNAA 4AQYL 3OW2A 2N49A 1R9TH 4LFAL 2HIXA 4YWKA 1HNZQ 3CAMA 3GTGH 4C3IH 1HNWQ 1RL2A 2BA1A 5LMNQ 3I55A 2YTXA 3PIOA 5GAEC 1C9OA 3RLNA 2Q2HA 1IBKL 3S14H 1CUKA 4LF6L 3KF6B 1X54A 3HOUG 1VCIA 2YTVA 4LUVA 4IO9A 4JI0Q 1VQIA 3L0OA 1Y1WG 2HT1A 4GNXC 2NZHA 1UEBA 4LFCQ 1EQQA 3HFZB 3F2BA 2HIVA 2ZTEA 4DR5Q 4AH6A 1JJCB 3HOUH 3PO2G 1SLJA 2AMCB 1KIXA 2DUDA 4DR1L 4A3BH 4HIMA 3K7UC 4DKAC 1GVPA 2HQLA 1S72A 1Q82C 3CCLA 2R93G 5C44H 4DAMA 3J80c 5IP9G 3VDYA 3CMAA 4LF8Q 4NXNQ 3PO2H 2CQOA 4WJ3M 3KLWA 3FP9A 4IJHA 5JEAJ 4DR2L 4A3KH 2N3SA 3RN2A 4JI5L 4OX9L 4L5RC 2JA8H 1SRUA 2WP8J 4DV2Q 5FLMH 1Q46A 1EFWA 3GTKH 3HOWH 3S1MH 4JYAQ 1N34L 1MJCA 4A3GH 4GLXA 4KHPL 4LF5Q 4P74A 1FL0A 3LGJA 5FLMG 1PH1A 3HOVH 3STBD 5LMUL 4UP8A 2RCNA 4BBSH 2NN6G 3E9HA 2E5LQ 4LF8L 1X6OA 3PIPA 3L7ZC 2NZOA 1PV4A 2CKZB 4DAYB 2WFWA 1IBML 4R4IA 1Y14B 2Q2IA 4LUZA 3CC4A 4A93G 2K5NA 3AQQA 3S17H 4JI3Q 3KJOA 1PH5A 4GN5A 4IOAA 3AFPA 4DPGA 1I50H 1SR3A 4UP7A 1PH8A 2QGQA 3HOYH 3L2PA 3J81j 1N33Q 3JAMi 2L15A 1PHJA 1M90C 2UU9Q 4DK6C 1Q81C 1K3RA 4GOPA 3M7NA 1VQBA 4BY7H 3CMEA 4A3GG 4KHZA 4NXMQ 3A74A 1G6PA 1OXSC 2ZTDA 3K0XA 4JC0A 1KRSA 2AWNA 4MZ9A 1P8LA 4DV7Q 1HH2P 4JI7Q 4JI6Q 3S1RH 3GO5A 1TXYA 1YEZA 4HJ8A 5K36G 1NY4A 4UY8C 3UE1A 3UDXA 5C44G 4JBWA 4R4QA 4DNIA 5AJ3Q 2F52A 3STBC 3NELA 3DLLA 1YHQA 3PUWA 3KFUA 4A3BG 1A63A 4DV3Q 5BR8Q 3CCQA 3TS2A 4YHHQ 3OTOL 4LF9Q 3M85A 1MKHA 5GADC 3BU2A 1KRTA 1K73C 1PH2A 5M3FG 2VY3A 4HIDA 1PVOA 1PH7A 1IBMQ 2B63G 4DV1L 4A93H 5HGQA 1LYLA 2VUMG 5LMUQ 4GKJL 2R7DA 2VZAA 4BA2I 4XTCS 5IT9c 1XNRQ 3HKZE 4C3HH 3J81i 3GD7A 4LW1A 4JI4L 3CPFA 4GKKL 3E9IA 3GTJH 3PUZA 4JI4Q 4IFDG 3TQYA 1YJNA 3PV0A 4Y7NH 1VQ4A 4JI1L 3H3VI 4A3DH 2IX0A 5J3BA 4LNQA 2YYZA 1NTGA 2IX1A 2VQEL 3U4VA 4QGUA 1YZ6A 4O0AA 2JQOA 1HJPA 2C35B 2UUBQ 2VUMH 3S2DH 3UDIA 3FHWA 5IP9H 1EYGA 2RF4A 1VQ9A 4BBRH 4DV5L 1A8VA 1KAWA 3RR5A 4LF7L 1X3FA 1I3QH 4JCVE 1E24A 3I7FA 3PUYA 2JJQA 2XTIA 5M3FH 1X55A 2JE6I 1HNXL 4GKJQ 2DGYA 1W2BA 5BR8L 4EQ5A 4APVA 4P73A 2EQSA 1N32L 2UUAL 1T9HA 2PQAB 4P72A 4OWWB 1D7QA 1A62A 1HNZL 1HNWL 4P75A 3UDGA 3A5ZB 1SFOH 4L5QA 5ELNA 3IRBA 1WCMH 1M1KC 4UPAA 2I5HA 1CKNB 1TWFH 4DV7L 4GOPC 3CCEA 1B7YB 3RN5A 1ASZA 4JI7L 3HOZG 5JJLA 4JOIA 2RHQB 4QL5A 4JI8L 3RLOA 2JA5H 3PCOB 1UE1A 2V1CC 4IJLA 3SGIA 4L5SA 1VQNA 1X3GA 2UXCL 4A3FH 4X64Q 1XNQL 1EUJA 2OQKA 2D62A 4A3CG 2Q2UA 2Z6KA 4A3JG 4DUYQ 2UUAQ 4NXNL 3AFQA 1UE6A 2IT1A 4KI0A 1K0RA 1GD7A 1K9MC 2UXBL 4OWTB 2K75A 4OO1G 3AYHB 2B3GA 2Z6KC 5C4XH 1GM5A 2K14A 2UXDL 2K50A 1W3SA 2VL6A 1A0IA 2A19A 1VQPA 4LF9L 2ZJPA 4B3RL 1JB7A 5M5WH 4IOCA 4A3EH 1OXTA 3W1GA 4YCUA 3M3YH 4ME3A 1IBKQ 2BH2A 1X56A 1N36L 2A8VA 3JC66 4LF5L 1S3OA 2QA4A 5C0XG 1WOCA 2ALYB 4DUZL 3A5UA 1WYDA 1IL2A 4DR4L 2GN5A 2JEBI 3EIVA 3CCRA 4P71A 3B6YA 1KL9A 3CCMA 4BA1I 4LF4L 3CCJA 3CC7A 1JMCA 2K5VA 1JT8A 4DV2L 4H02A 1CSPA 3G6EA 3S16H 4JBJA 2OCEA 1VQOA 3HOWG 1KHIA 2EIFA 5JJKA 2R6GA 4PZ7A 1J5EL 4JG2A 3M4PA 2QEXA 1OXVA 2UU9L 4FDBA 1V9PA 3M4QA 3RNUA 3G4SA 1B70B 1HZBA 5E7NA 5GROA 5C4XG 4R4CA 2ATWA 1L1OC 4MTNA 4LF7Q 3KF6A 4A3IH 1G291 3F1ZA 2GVAA 4X66Q 1MJEA 4MNOA 3K81C 4WJ4A 1YHAA 2AKWB 5LMNW 4DV3L 2R92G 1WJJA 1QZHA 1LUZA 3CD6A 5AJ3L 2VQFQ 1Y1WH 1N8RC 4DUYL 1E7ZA 1JE5A 1K8GA 4B3MQ 4PMWA 4X64L 2Y0SE 3KDFA 2PMZE 5IP7H 3CPWA 5EAYA 4GOPB 2I5LX 4JV5Q 1LTLA 2CWPA 2MO0A 3ER0A 1X65A 4DR3Q 3W5OA 1E3PA 4DUZQ 4GLVB 2NVYH 4YCWA 3KYHC 4TQUS 1IZ6A 3TEHB 4AYBE 1XNRL 4DV4Q 1KC8C 1FJGQ 2AHOB 5C4JH 1WFQA 5IYDG 1HZ9A 2E2HH 2YV5A 4JOIC 1GO3E 4YWLA 1YJ9A 2VQFL 1N32Q 3MEFA 2KCMA 3H0GG 5C3EG 1VQ6A 2BH8A 5JJIA 4B3RQ 4C3JH 2IHEA 3PF4A 4C2MH 1L1OB 4JBKA 2HHHQ 5H1SE 2UXDQ 1QUQB 1NBWA 1YJWA 4IPCA 1I6HH 1J6QA 2Z0SA 4GLAC 4A4IA 4A75A 1K83H 1OTCA 1B8AA 4RG1A 5M5YH 1KXLA 2KCTA 5IYBH 2LXKA 4L5TA 2FXQA 3ULJA 5IYCG 2ZM6Q 3PUXA 1ASYA 5FJ8G 3H0GH 5M3MH 3ERSX 5GAGC 1FJGL 4HJAA 4JBMA 2UXCQ 1Q12A 1Q8KA 1XPUA 2MO1A 3I4OA 1OXXK 2KHJA 3NEMA 5FLXc 1PH3A 4LF4Q 3D0FA 3J80i 3ZJYC 2N8NA 2F4VL 3TREA 4NPSA 1YBYA 4BY1G 4A3MG 4JI5Q 4OX9Q 3PO3H 4DR4Q 2VNUD 3I4MH 3ULPA 1P16A 4GN4B 1VQHA 5IYBG 1YNXA 4AIMA 1LM0A 1G51A 4GS3A 3CF5A 4DV6L 2K4KA 2K5HA 1BKBA 1EWIA 1X9NA 4PZ6A 1HNXQ 4DR1Q 1Y1VH 2KHIA 1XPOA 1Q7YC 3CCSA 1XTDA 1VQDA 2A1AA 1PFSA 1TWHH 4OONA 4UP9A 2IHFA 4HIKA 1RIPA 3BZKA 2N78A 5DLQE 3GDEA 4GN3B 3K7AH 1JJ2A 4A3CH 1E1OA 1IYJB 3HKZG 1UWVA 4LF6Q 1Q1BA 4A3FG 4JI0L 1S40A 5LMNL 2OTJA 3PGZA 1VQKA 1XMQQ 2LSSA 4JI6L 3RZOH 1YHBA 3NBHB 3TS0A 2ID0A 1TWGH 3U50C 4X62L 1U5KA 3I2ZA 5IP7G 2PI2A 1N34Q 2D0PA 2JA7G 1SROA 2PNHA 4X65Q 2I0QA 3S15H 1BBWA 1CKNA 1QVCA 1C0AA 3K8AA 2K52A 1O7IA 1VQCA 3FKIH 5C0XJ 2Q2TA 2PI2E 3T1HL 1IBLQ 2OTLA 2WB1G 3KDFB 1L0WA 4LUOA 2ES2A 2JA6G 2JK8A 4A3IG 3CCVA 4A3LH 1VQFA 1Y1VG 4DR7L 4DK3C 3I4NG 1HR0W 2H5XA 1VQAA 3ICEA 1CSQA 4A3LG 3HOVG 1YIJA 2RHSB 5GQOA 4NB3A 1VS0A 4A3MH 5C3EH 5HY6A 2JA6H 1FGUA 2B29A 3F2CA 4B3TL 1VQ8A 1QUQA 3Q8DA 4A3JH 4LFAQ 4B3SL 4YY3Q 4DR3L 2KENA 3PUVA 1PH6A 3CW2C 5M3MG 4YY3L 2JA5G 1L2FA 5FJ8H 1QVFA 1NJIC 4NXML 3RLFA 4IPDA 2JA7H 1V43A 1QVGA 4B3TQ 1UE5A 2NN6I 2B63H 1I94Q 3S24A 5M5XH 4QY7A 4JI2Q 1XMOQ 2R93H 3J81c 2VW9A 4EX5A 4DV0L 3UDFA 1AE2A 4AYBG 4LFBQ 1D8LA 1BVSA 3U58A 2R7FA 4X66L 4GNXB 3S2HH 4K0KL 3M9BA 3BJUA 4JI3L 2Y0SG 5C0XI 4HJ7A 1H95A 2F3IA 4K0KQ 3EBEA 2R7ZH 4KLKA 2WB1E 2UXBQ 1CKMA 4LFCL 3H3VH 1E22A 1EOVA 5IYDH 3J7ZC 1I94L 2YU9H 1HR0L 1VQGA 2IY5B 5IE8A 2WAQE 1VQ5A 1VQEA 4O2DA 3TRZA 1WCMG 2F4VQ 3UE0A 1VQMA 4GKKQ 3JAMc 4JYAL 3PO3G 4RMFA 4B3SQ 4POFA 4BY1H 3K80C 4A76A 4Y52H 4PG3A 2NVXH 1VQLA 1XMQL 1KQSA 4OWXB 2E8GA 2R92H 4HIOA 1Q1EA 2WAQG 2VS1A 1HR0Q 2ZM6L 3GTQH 1CKOA 4DV1Q 3D31A 2GVBA 2EXDA 4IPGA 2E2JH 4YHHL 4YCVA 5IYCH 3CXCA 3CCUA 2ZJQA 1AH9A 1TWAH 3RZDH 5IWAL 4XIGS 2LXJA 3F2DA 3DM3A 2CCZA 3I4NH 2OWOA 1BBUA 3T1HQ 3GTPH 4GNXA 4DV6Q 1I5FA 1PH4A 3HKSA 5ELOA 2VQEQ 4J15A 1SMXA 2UUCL 1GKHA 1J5EQ 4OO1I 4JI1Q 2E2IH 1SE8A 3FKIG 2I5MX 3CP0A 1EIFA 1UE7A 1WI5A 4HJ5A 4QJFA 4AQYQ 4KHPQ 4LWCA 1VQJA 2KBNA 3F8TA 4POGA 4X62Q 3HOYG 1JJGA 1EQRA 1C7YA 3HOZH 2ZJRA 1Z9FA 4R4TA 4TVAB 4B3ML 2JEAI 1N36Q 3PSIA 4DR2Q 3M4OH 3H15A 1TWCH 1N33L 1FVIA 3T1YQ 1X3EA 2ASBA 5IY0A 1YI2A 2PQAA 3NENA 3S1NH 4IFDI 1N9WA 3W1BA 4ALPA 3MXNB 4DR5L 1L1OA 2UUBL 3OTOQ 4BBRG 1AE3A 1IBLL 2MQHA 4LFBL 2JA9A 3EN2A 2E5LL 3OYYA 1NMGA 2CFMA 2D0OA 3I4MG 1E1TA 1PH9A 2R7ZG 1U0LA 3PF5A 4OXPA 1XMOL 4JI2L 1XPRA 4DR6L 4PZ8A 1NMFA 2NVTH 4BBSG 3GTOH 3KF8B 4X65L 1XJVA 3HOXH 4BY7G 1YITA 1V1QA 1IXRA 1DGSA 3I56A 2OQ0A 3J7A5 4DR6Q 2BA0A 4BXXH 2NVQH 1HZAA 2ZTCA 3KOJA 2UUCQ 3G71A 4A3KG 1QZGA 3GTLH 5JEAG 3KJPA 1MIUA 4R4OA 4A3EG 3A0JA 5IWAQ 1VQ7A 4DR7Q 4R1JA 3ULLA 3CQZH 4DV5Q 1EIYB 3U4ZA 4HJ9A 4QQBX 4YWMA 1OXUA 4QIWE 2HHHL 4A3DG 1Z47A
chains in the Genus database with same CATH superfamily
3NBIA 4BXXG 1NE3A 1UNSA 2F0LA 4IFDJ 1YVCA 3HOXG 2C5CA 3WWVA 2AWOA 1Y69U 1KD1C 2MNAA 1JWSD 2PW7A 5I6WA 4LFAL 1HNZQ 1HNWQ 3CAMA 4C3IH 3RLNA 1IBKL 2F0TA 4LF6L 1U4LA 1BCPC 3K5NA 2ICEC 3VYUA 3TP7A 3SXHA 2AMCB 3HOYB 1KIXA 4DKAC 1E2WA 2ZT9C 3MVVA 1SDFA 4WJ3M 1LT5D 3KLWA 4DR2L 3IL8A 3W2DA 1LTSD 1DD2A 3RN2A 2A6EC 1Q46A 2FINB 2PZUA 4A3GH 2F0NA 1VMPA 5T1IA 1FL0A 5FLMG 3HOVH 1YNJD 1E2VA 1KDAA 2BE5D 5TSSA 3L7ZC 5NUCA 3R8BA 1ESFA 1M4VA 1IBML 3H0GB 1M8AA 1Y14B 2Q2IA 2K5NA 3AQQA 4RH6A 5JEAH 3KJOA 3S16B 2RSOA 5KNBA 1SSOA 3J81j 2KHSA 1AEXA 4FVMA 4DK6C 3J80E 3NSWA 1K3RA 5KYLA 4GOPA 1D1IA 3OWFA 4EQOA 4NXMQ 2G9HD 2E2HB 1GUWA 3K0XA 4JC0A 1P8LA 4DV7Q 5K36G 1TXYA 3UE1A 5C44G 1GJXA 1CM9A 1RTNA 4DNIA 2HCCA 5BR8Q 1EY9A 3CCQA 4YHHQ 3OTOL 1OO9B 4PMCA 3HS0C 2K33A 3GTGB 5GADC 5EGTA 2VY3A 2F0HA 4DFAA 1PH7A 1B9MA 1PTOD 2ICIA 2B63B 1LYLA 2VUMG 2R7ZB 5C3XA 5D14A 2R7DA 2PW5A 4OHJA 4BA2I 3N52A 4XTCS 5IT9c 4XQNA 1A2UA 1VMCA 3HKZE 3GD7A 1WTWA 3T53B 1MI2A 3TQYA 3SK8A 2O2LD 3IFDA 2F03A 1VQ4A 3EROA 4JI1L 5J3BA 2AQ2B 2VB3X 2YYZA 4E6IA 2IX1A 2VQEL 4QGUA 2SNMA 1HJPA 2VUMH 5IP9H 4BBRH 1AZPA 1QILA 3I3CA 4DV5L 1A8VA 2O5JC 2DY8A 1ZKOA 2JJQA 2XTIA 2JE6I 5ELBA 4F8MA 2DGYA 5I9OA 3EA6A 2IX3A 2HDLA 1N32L 1IHZA 2PQAB 4P72A 1A62A 3IRBA 1DJRD 2I5HA 4JI7L 4A93B 4QL5A 4JI8L 3RLOA 4Q0FA 2UXCL 2TMPA 3FPUB 1WD0A 4A3JG 4DUYQ 2UUAQ 1E0BA 4KI0A 4DXGA 2UXBL 4X3UA 2K7VA 2L5TA 2A6ED 5C4XH 3S1MB 2Z6KC 2B2TA 2K14A 3Q24A 2NB0A 4LF9L 3SDZA 2ZJPA 4B3RL 3VYSA 3P75A 2Q8IB 1CQFA 2DJGC 4YCUA 3M3YH 1N36L 4XXEA 3Q6SA 1AFPA 4WFN3 5C0XG 1WOCA 1S5ED 2ALYB 4H7BA 2JEBI 4P71A 3CCMA 4BA1I 3CCJA 1CSPA 3G6EA 5FLXL 1SE4A 2WAQB 1C4QA 1CFMA 3M4PA 3SR1A 4EGVA 4RGNA 4LAAA 1B70B 2G5DA 3K5LA 2ATWA 1L1OC 4MTNA 2EJFC 1G291 3F1ZA 1XXGA 2GVAA 1B2TA 1STYA 1U4RA 3HZXA 3BS1A 4MNOA 1W6KA 1SNMA 2R92B 2ZXOA 4WJ4A 1YHAA 5IGGA 1LUZA 4KKTA 1CZGA 1SMYD 4HCSA 5ELCA 4DUYL 1Y1WH 1TWCB 5G3LD 1R4QB 4ZK9B 4NKLA 2Q8RE 2CWPA 2O5IC 5I9PA 2HCIA 1CA5A 1E3PA 4DUZQ 2NVYH 1HQMC 4DV4Q 1LTGD 2BDNA 1WFQA 5KYIA 2E2HH 1B50A 1GO3E 1NCVA 3JAML 1YJ9A 1N32Q 5D3IB 3H0GG 5JJIA 3NWSA 1VF7A 2IHEA 1S5BD 3PF4A 2XWJB 1QUQB 5EKIA 1I6HH 2Z0SA 1RODA 3I91A 2QCPX 1MSGA 4L5TA 2L55A 3ULJA 3RD4A 3DEOA 1F9RA 4HJAA 1Q12A 3I4OA 1OXXK 3S2HB 1PH3A 1Y1VB 1CI3M 3D0FA 4C2MB 2ZXPA 3J80i 3ZJYC 3I4NB 2M9VA 3TREA 4OX9Q 1STBA 1FYCA 3PO3H 5IT9L 2WACA 5C44B 1DYQA 5JPNC 5IYBG 2IW3A 4GS3A 2K4KA 1X9NA 3KBGA 1HNXQ 4DR1Q 4GKJL 2A1AA 1VQDA 4CGYB 1WCMB 2F0PA 1KLGD 5JJZA 3WOFA 1SYCA 4GN3B 1E1OA 3HKZG 1DM0B 1UWVA 2QDLA 4JI0L 2X69A 3PGZA 5E3FA 2EYMA 2LSSA 3RZOH 4FXGC 1YHBA 1YNNC 3NBHB 3M7GA 3TN2A 1TWGH 1V1PB 3U50C 4X62L 1HUNA 1N34Q 3S15H 4X65Q 2PNHA 5DM63 1CQVA 4K6DA 1CKNA 1LT4D 1SYGA 4QMGA 2SOBA 1LT6D 1O7IA 3FKIH 1G8ZD 2PI2E 4CJ1B 1IBLQ 2OTLA 2JA6G 2K04A 2ES2A 2JK8A 4A3IG 2MUYA 4C3HB 3CRKC 1BCPF 3T13A 1SE3A 4XQQA 1K8MA 2R93B 2EDGA 4A3DB 2RHSB 3BYTB 3HOVB 1FNWA 2A73B 2B29A 4B3TL 4K2KA 4YY3Q 5M3FB 5M3MG 1G2SA 2H4OA 4YY3L 2B2YA 2JA7H 1QVGA 1UE5A 4N8FA 1I94Q 4QY7A 1IW7C 1LO5D 4N8X1 1BVSA 4OO1H 4JW0A 3U58A 3K6OA 5C5LA 1Z6HA 4X66L 3S2HH 4JI3L 4BY7B 3EBEA 1VDZA 2RQXA 5ELFA 2IWHA 3H3VH 1E22A 2YU9H 1I94L 1HR0L 2MP1A 3TMEA 2F0WA 5IE8A 3OHXC 3J80L 3TRZA 5COYA 1VQMA 3QJYA 3JAMc 4JYAL 1LABA 4RMFA 3K80C 5CV4A 4Y52H 3DUZA 4PG3A 3J7YW 1JE4A 2CVRA 3OMGA 1BNZA 1ENFA 3SE0A 1VQLA 1CK1A 1Q1EA 2WAQG 1HR0Q 2ZM6L 3MWYW 4DV1Q 3MXNA 2JXMB 2GVBA 2EYJA 2F0EA 3DWPA 1AH9A 2F0QA 2JA8B 4XIGS 3F2DA 2CH4A 5I4DA 2OWOA 4I7AA 4RGMA 4C3JG 3A56A 3FKIB 1SE8A 3S1NB 4ABNA 1II3A 1EIFA 4J8QA 2Z4IA 3UI2A 4HMJA 1SNCA 2K32A 1YNND 2A6HC 4POGA 3EQLC 4NW2A 3HOZH 4L63B 1Z9FA 5IGBA 3MAQA 1N33L 2ASBA 4DK1A 1YI2A 4PQXA 1N9WA 4ALPA 1STNA 4DR5L 1STHA 3HOWB 4KN7C 1QJOA 1IBLL 2MQHA 4BBRB 4ZCKA 2E5LL 3OYYA 1RTOA 2D0OA 3I4MG 4JI2L 2VUMB 4C56C 3HEJA 4TRDA 3GTOH 3NP8A 1HFGA 4X65L 2PZWA 1V1QA 1IXRA 1V1PA 1DGSA 3I56A 1EQTA 2M2LA 4M8AA 5FO9B 1NAPA 5E1FA 2L11A 2ZTCA 2WB1B 1MSHA 3D8GA 3GTLH 3S1QB 4A3EB 2WINB 4R4OA 3A0JA 5IWAQ 2E75C 1R9TB 3ULLA 3WDNA 3KUPA 3CQZH 4HJ9A 4CKBA 3S1RB 1GHJA 4YWMA 5C3WA 1V1OA 1HZCA 2XRSD 3CC2A 4R8IA 1I4QA 3H09A 1Q86C 1PA6A 2R3ZA 1SN8A 2YTYA 4DV4L 1K3BC 5A2QL 1BDOA 1D5ZC 3OW2A 2N49A 2HIXA 4YWKA 1TY0A 2B2UC 1ZYRD 3I55A 1CUKA 4N9TA 3KF6B 3R2TA 2RKSA 1D5XC 3L0OA 4GNXC 5DNFA 3NTIA 4XT1B 1EQQA 2NBFA 2XRQD 4DR5Q 1EY5A 2QKIC 1JJCB 1MBYA 4A3MB 4H13C 1BCPB 3K7UC 2KEEA 2R93G 2EYLA 1I4PA 1S72A 5C44H 4KJNA 2F0KA 4DAMA 3J80c 4K8JA 1EY4A 4KKSA 5EBDA 3BG3A 4A3KH 4OX9L 2JA8H 2WP8J 5FLMH 3GTKH 1V8QA 1Y8OB 4GLXA 4DNTB 1JB3A 4IUTA 5EPLA 1PH1A 3HKZB 4N9PA 4BBSH 2F0GA 2RCNA 3DWAA 5J22A 2E5LQ 1PV4A 2CKZB 4DAYB 3HOXB 1EZ6A 4LUZA 1BQQT 2LS01 4IOAA 1EEID 4DPGA 2F0UA 1PH8A 1JWUD 4UP7A 2QGQA 2B2VC 3BDCA 1N33Q 1PHJA 2L15A 1Q81C 1VQBA 4A3GG 2NWGA 4CDFC 3A74A 3VR3A 1NR2A 4C3IG 3NXWA 4JI6Q 3S1RH 3W3AA 3BDLA 2EPBA 2IL8A 3STBC 1B9NA 3DLLA 3PUWA 4A3BG 2NZ1D 4DV3Q 4B08A 2EY2A 1FR3A 4LF9Q 3K59A 3BU2A 2EY5A 5M3FG 1X32A 1HTPA 1PVOA 2QW7A 1EL0A 1HRJA 1SYEA 2B63G 4DV1L 4A93H 5HGQA 4V190 1VF5C 4RKLA 3MA2B 3E3XA 3L3OC 1WD1A 1TQOA 1XNRQ 1S4ZA 3GV3A 4C3HH 4LW1A 2Y0SB 4JI4L 2BE5C 1PTOF 1TS5A 1JOQA 4JI4Q 1WTQA 1NNXA 4NMZA 4A3DH 1F2ZA 4LNQA 1DZ1A 4MIUA 3U4VA 5EPJA 2RDHA 4O0AA 1TWFB 3S2DH 1HXYD 2A68C 4JK1C 3RR5A 2L12A 2KECA 5KRUA 1X55A 1W2BA 5BR8L 4QUCA 4APVA 1JICA 2WV6D 1Q3LA 1T9HA 3S14B 4OWWB 1D7QA 1SFOH 5ELNA 3KLRA 4GOPC 1TWFH 3HOZG 3VR4A 1WTVA 2JA5H 1DXMA 5CV7A 4L5SA 2QILA 4A3CG 3VYRA 3L9AX 3OWEB 1F9QA 3AFQA 3GTJB 3ERQA 1QCBD 1K0RA 3BDOA 3MXUA 2UXDL 2VL6A 1VQPA 1JQYD 1TT2A 2A68D 4IOCA 3GV6A 2EYFA 4GZYC 2HUGA 1IBKQ 5DM73 1S3OA 1SNPA 2QA4A 2A74C 4O42A 3O13A 3CC7A 1I50B 3S16H 1ET6A 2OCEA 3HOWG 3TBIB 4K2LA 1SYBA 1U9RA 2QEXA 5M5WB 4FDBA 3R2IA 3M4QA 5I2XA 4RA8A 2F0VA 1HZBA 1H9MA 2F0MA 3NK9A 5GROA 3VR6A 3M3YB 5C4XG 1EU3A 5I6YA 2LMCB 1LTBD 2MPMA 3SEBA 4RCNA 1GUGA 2JA7B 4IALA 4CDCC 4UAIA 4DV3L 5LMNW 3FMCA 1I4XA 2VQFQ 4DAPA 4B3MQ 4PMWA 4X64L 2Y0SE 4K5XA 4BS9A 3CPWA 4GOPB 2I5LX 4JV5Q 2K5DA 4DR3Q 1PRTC 4YCWA 2K01A 5LL6S 1HZ9A 1HPCA 1KNAA 2EJMA 4ZUJA 2KCMA 2KOLA 1ICFB 4C3JH 4JBKA 1O78A 4XYQA 4GLAC 3C3LA 4A75A 3HP3A 1S5DD 2KVMA 3ZYYX 2LXKA 5IYCG 3K57A 5C4ZA 5FJ8G 1SMYC 4LMQD 4FNFA 3ERSX 1Q8KA 1I6VC 2MO1A 2F0JA 3QR8A 4LF4Q 2XNAC 4MTKA 1RDPD 2P5ZX 4A3MG 4IUVA 3RZDB 3GP7A 1FGBD 1P16A 4GN4B 1SJHD 3ND8A 4AIMA 1G51A 3PIP3 4LF8L 1EWIA 2R7ZH 1NR4A 1XPOA 3CCSA 1PFSA 4OONA 4HIKA 3BZKA 3VYTA 1JJ2A 4A3CH 1IYJB 1EZ8A 2DNEA 3T4AC 4OIKA 2FHTA 4RWSC 2SNSA 1XMQQ 1C48A 4JI6L 5LHY1 3TS0A 2ID0A 5IGDA 3OMCA 1ZYRC 2D0PA 1SROA 2I0QA 4NP5A 1BR9A 3E5SA 1C0AA 2WB1G 3KDFB 1A3TA 2F0DA 1L0WA 3QWNA 5K5PA 1Y1VG 4DK3C 1TWGB 3I4NG 3J7AF 3ICEA 3HOVG 2A69C 1VS0A 5C3EH 2JA6H 3BVZA 1VQ8A 4M1UB 4B3SL 4DR3L 1Z7TA 2KENA 3PUVA 3NUCA 1PH6A 1RCVD 3CW2C 1QNUA 3M4YA 2R61A 1NJIC 3RLFA 1V43A 2CW0C 1J9OA 2NN6I 3R3OA 2B63H 4KK7A 5M5XH 3QO2A 1XMOQ 4DNRB 4FF4A 4OEMB 4DV0L 3VA5A 1DOKA 2R7FA 3OIPA 1EWHA 3M9BA 3BJUA 4HJ7A 2Y0SG 2F3IA 3Q22A 3I72A 2WB1E 2UXBQ 1CKMA 4BY1B 3GTQB 1SJED 3QB3A 3SK5A 5C4JB 3AU7A 1ET9A 2IY5B 5K36H 1VQ5A 5FKAC 1B4OA 2AUJD 1WCMG 3ONAB 1MGSA 2FFKB 3PO3G 3PQIA 3N6RA 1PZKD 2DY7A 1KQSA 2R92H 2VS1A 5KNDA 4WRDA 3AB9A 2G9DA 4DAVA 2LKVA 2EXDA 1HA6A 5IYCH 3CXCA 1FNVA 3RZDH 4B9XA 5CYUA 3HOZB 3DM3A 3I4NH 3NQIA 4KTAA 1BBUA 3LWEA 3T1HQ 3GTPH 4GNXA 1PH4A 1I5FA 2UUCL 1J5EQ 4JI1Q 2E2IH 1STGA 1FNUA 4C3HG 2NVQB 1WI5A 4KHPQ 4LWCA 1KLUD 2KBNA 5A35A 5FOBB 1JJGA 3E0JA 4B3ML 2JEAI 4TVAB 1F2LA 2N55A 3FPPA 4DR2Q 3M4OH 3H15A 1JOOA 5D65A 1FVIA 3T1YQ 1GOZA 1X3EA 1HA5A 1EOTA 3P20A 3MZ5A 1NUCA 2NVYB 1FD7D 3D3RA 1EU4A 2CQAA 5IGEA 5F2DA 3AMUA 4BBRG 4A3FB 1NMGA 2CFMA 1E1TA 1PH9A 1U0LA 3FRPB 3PF5A 1XMOL 4DR6L 4S3SA 1H9KA 2AUKA 1IL8A 4BY7G 2F4IA 3K58A 1GUSA 2BA0A 4CDDC 1ML0D 3QIAA 2UUCQ 3G71A 2XVSA 3D4WA 3Q23A 1QZGA 2JA6B 1SYDA 3IAYA 4DU9A 1Y8NB 1MIUA 1VQ7A 1HFNA 4DR7Q 3G7LA 2HD3A 1K0SA 1OXUA 3HOUG 1Z47A 4DV0Q 1WTOA 3AEVA 1XNQQ 2XSCA 4X3TA 4IPHA 1K8AC 5T1GA 4CJ0B 2XGTA 3S1QH 2JA8G 3E0EA 2KQ3A 4AQYL 3TP6A 1R9TH 3GQBA 3GTGH 1A2TA 1RL2A 2YTXA 3PIOA 5GAEC 1C9OA 4ZKBB 2X6GA 3S14H 2RSNA 4JI0Q 2YTVA 4LUVA 1VQIA 1Q90A 1HCZA 2D2CC 2WKDA 1UEBA 2K5QA 2PQEA 4LFCQ 4XDXA 1BUVT 3URYA 4KY5A 4JVZA 4AH6A 3PO2G 1SLJA 2DUDA 4DR1L 1GVPA 2HQLA 3CCLA 1Q82C 5IP9G 3CMAA 4LF8Q 4NXNQ 2CQOA 2EE1A 4XYOA 2D5DA 1EYAA 1SYFA 5IGCA 2RDFA 4JI5L 1AN8A 3S1MH 4DV2Q 1A3UA 2KEDA 2E2JB 5HGTA 2A5HA 2KUMA 4P74A 3X3NA 3H3VC 3STBD 5LMUL 3E9HA 3PIPA 1ENAA 1KDCA 2NZOA 3A55A 3KK7A 2WFWA 1G91A 4R4IA 1PDQA 5ISRA 5HURA 4QCLA 4A93G 2F0OA 4EVOA 3S17H 4GN5A 3AFPA 1SR3A 3L2PA 2B2WA 1M90C 4G7OC 4C3JB 5KIXA 5CV9A 4BY7H 3CMEA 5G3LF 2JSOA 4KHZA 1OXSC 2ZTDA 3SK4A 4JI7Q 1HH2P 5J39A 3GO5A 2JP1A 4HJ8A 3X3MA 1WTPA 4JBWA 3KFUA 1YHQA 4K5VA 5C3EB 2B2UA 5IT9E 4OIJA 2Z9HA 4RAUC 3OOCA 2RCFA 3RUZA 1K73C 1PH2A 5D3DA 2K5WA 2RDGA 1G2TA 3NTHA 2IJ0A 5LMUQ 4R9WA 3I4MB 3FEWX 2KCCA 1Q8IA 2B39A 4HSPA 2L9HA 1RD9D 1LTTD 5CBAE 4DA2A 1DCZA 4GKKL 3E9IA 3GTJH 3MXPA 3PUZA 4U673 4IFDG 1SXTA 2MHVA 3BVMA 1YJNA 4PMBA 2JN4A 4Y7NH 1BF4A 2IX0A 1NTGA 2RVLA 1YZ6A 2JQOA 2C35B 4BWGB 3FHWA 1EYGA 1VQ9A 1S5FD 3U9OA 5FLXE 4C3IB 1X3FA 1I3QH 4JCVE 1E24A 1E2ZA 3PUYA 4EQ5A 2BCOA 4QUFA 2UUAL 1F9SA 1I4GA 5KNCA 4P75A 4WJWA 3A5ZB 3UDGA 1M1KC 1WCMH 5M5XB 4UPAA 3S2DB 1ASZA 4DV7L 3RN5A 4CBVA 2EOTA 4JOIA 2RHQB 4KV6A 3RMHA 1C8CA 3HOYH 3PCOB 1UE1A 2V1CC 3CQZB 3OSOA 4IJLA 3SGIA 4X64Q 1XNQL 1EUJA 2D62A 2PO4A 5JOBA 2TSSA 2Q2UA 2E76C 2F0FA 1WTRA 4NXNL 1UE6A 1DOLA 3DWQA 5EJWA 1K9MC 1LTRD 4OO1G 1HQRD 1GM5A 1W3SA 1H9RA 1PTOH 2A19A 1TS4A 1CTMA 1JC7A 5EKKA 4A3EH 4K5WA 2I07B 2WIIB 3W1GA 1U4MA 2BH2A 1R4PB 4UDUC 4G57A 4LF5L 5CV6A 3V96A 3A5UA 2GN5A 2NTSA 1ILQA 4HR7B 1KL9A 2SEBD 2K5VA 1UEAB 4JBJA 5JJKA 1KHIA 2R6GA 3FDTA 1SFOB 1J5EL 1B3QA 1TS2A 2Z1CA 1V9PA 2B2VA 4L6TB 1G6ZA 3G4SA 1CHQD 3K0YA 5ELEA 4R4CA 1AZQA 4X66Q 3RZOB 1MJEA 1XX8A 1B1ZA 3K81C 3QG1A 2AKWB 3I8ZA 1QZHA 4FXKC 1N8RC 1W6JA 1EEFD 1TS3A 2PMZE 2PYKA 3KDFA 2EVBA 1T5EA 1LTLA 5JAVA 2MO0A 3ER0A 3W5OA 2H1EA 1XNRL 4TQUS 1KC8C 5IYDG 4UHVA 2DNCA 1JWMD 4ULLA 2E2IB 4YWLA 1U4PA 1GHKA 3MEFA 1VQ6A 3MEHA 2BH8A 1L1OB 3D4DA 2J0TD 3CU7A 1RKNA 1LTAD 1Y8PB 1NBWA 1YJWA 4IPCA 1J6QA 3MTSA 1B8AA 4PV1C 5E4WC 1TR5A 4RG1A 5M5YH 4IUNA 1KXLA 2KCTA 2ZM6Q 2E2DC 4Y7NB 2MGSA 2PCFB 5GAGC 4JBMA 1FJGL 5M9OA 1XPUA 2KHJA 3NEMA 4P2CB 3DMUA 2N8NA 1EWCA 2DN8A 1YBYA 4DR4Q 2VNUD 1JCKB 2K1BA 4ZKCB 1VQHA 5M5YB 1LM0A 5CGKA 4ZRZA 2K5HA 4DV6L 1XTCD 2K03A 1Q7YC 2KHIA 5E4XA 5LL6X 2C9OA 4UP9A 4FP5D 2IHFA 3H6MA 3I90A 5DLQE 2N78A 1ONLA 3GDEA 4ODGA 2EXZA 4LF6Q 1Q1BA 4A3FG 5EBCA 5DEHA 1S40A 4MHEA 5LMNL 4AYBB 1PFNA 5C4XB 1U5KA 2IPKD 2PI2A 2NTTA 2JA7G 1BBWA 1IKLA 3SK6A 3MFGA 2BDOA 3K8AA 2K52A 1VQCA 5C0XJ 5ELDA 2L1BA 2L0CA 2CHBD 5CR3A 1GUNA 4A3LH 3IKJA 4HCEA 1CA6A 1KDBA 1VQAA 3S15B 2L4NA 1CSQA 2NN6H 4NB3A 4OL7A 3A54A 1CZWA 3P7JA 1RHPA 1EY7A 1QUQA 1TY2A 4LFAQ 4KY7A 2JA5G 5FJ8H 4FXDA 4JI2Q 3J81c 4CHTB 3D6WA 4TKOB 4C1NK 3JAME 3QOLA 4GNXB 4K0KL 3NHHA 1H95A 5C0XI 3T56B 4K0KQ 4KLKA 2F0IA 3DXJC 4LFCL 1EOVA 2Z4HA 5IYDH 1D5MC 1BOSA 1VQGA 2ZXRA 5CC4A 2WAQE 1VQEA 3UE0A 5FO8B 4ZLTF 3LWUA 2EY6A 4F88A 4B3SQ 4POFA 4BY1H 2B2WC 4A76A 3A8JE 1TVXA 2NVXH 4OWXB 2E8GA 4HTHA 1CKOA 4HN7A 5CV5A 2PNRC 4RKBA 4YCVA 3TP8A 3CCUA 4ZAIA 5IWAL 1KTKA 4U68A 3G6JB 2B8FA 4DV6Q 2JYOA 2VQEQ 4J15A 2DJFC 4OO1I 2I5MX 3TDQA 4AQYQ 1ICWA 4A3IB 3T51B 1LLRD 3HOYG 1STEA 1C7YA 4CKEA 3V05A 3WOEA 5CBEE 2ZJRA 1N36Q 2XIWA 1PYWD 5A2QE 4YIJA 1H9JA 4ILWA 2HQEA 4Q5VA 4QB4A 4CJ2C 3TZUA 4EQPA 5M3MB 4J6HA 3OTOQ 1AE3A 2QDBA 4IUPA 3EN2A 2R7ZG 2K6AA 4OXPA 1ESRA 1K83B 4PZ8A 3KF8B 1XJVA 2AQ1B 3HOXH 1YITA 4IFDH 1UAPA 4IUUA 2OQ0A 5IOCA 3J7A5 3GTMB 3BZDB 4DR6Q 1PZJD 4BXXH 2EZVA 2NVQH 3KOJA 2XN9C 1UUPA 2FJ2A 3KJPA 3K5MA 2K28A 3K5OA 4R1JA 2NVTB 1EIYB 4HSVA 4QIWE 5FK9C 4YHHL 2HHHL 3PO2H 3I4LA 4QF4A 3T1YL 3G48A 3NE5B 4KD3A 3GTMH 1WVLA 2CWAA 3BZCA 2MFIA 4JI8Q 4X6AH 1PYBA 1EFID 5GAHC 4JV5L 1PYSB 3J81L 1B53A 5EPKA 3ITPA 4OGQC 1BBXC 2BA1A 5LMNQ 3S17B 5BN4A 4G7HC 2Q2HA 1H9SB 1O7LA 2PPBC 3A8IE 1X54A 1VCIA 4IO9A 2EJGC 1Y1WG 2HT1A 3U9SA 2NZHA 4B9WA 1QE6A 3HFZB 3F2BA 2HIVA 2ZTEA 1EYDA 3HOUH 4A3BH 4HIMA 4HEDA 3VDYA 4ZUIA 5JVH3 3CRLC 1J8IA 3VA7A 3FP9A 1PLFA 4IJHA 1QG7A 5JEAJ 3CKIB 2F3WA 3EJIA 3H91A 1LV9A 2F3VA 2B8GA 2N3SA 5EQ0A 4L5RC 1SRUA 3PMFA 4XQJA 1EFWA 3HOWH 4JYAQ 1SNQA 1N34L 1MJCA 4RGOS 4MN3A 4I65A 1LT3D 4KHPL 4LF5Q 2Z6BA 3HOUB 3TZDA 3LGJA 3TSSA 4UP8A 1QOHA 2NN6G 1X6OA 1SEBD 4K6LA 1MD2D 1F2YA 1RJTA 1B44D 2FMMA 3EFXD 3CC4A 3GTOB 1X3PA 3NBHA 4KKUA 4JI3Q 1PH5A 1I50H 5AFWA 1O80A 2J7ZA 5J1ZA 3JAMi 3HGBA 2UU9Q 4FO2A 3F2UA 3M7NA 1L0YB 3Q0AA 3LNNA 1G6PA 4RHRA 1KRSA 2AWNA 4MZ9A 1YEZA 2ENBA 1PRTB 1NY4A 4UY8C 2D9UA 1SNOA 3UDXA 2BOSA 4R4QA 5AJ3Q 1YNJC 2F52A 3NELA 3PIO3 1A63A 3TS2A 5BN5A 1HHVA 3M85A 1MKHA 4H44C 5DAUA 2V4DA 1KRTA 1KNEA 5IODA 4HIDA 1IBMQ 4L8JA 2EY1A 1QB5D 1KAAA 2O4XA 4BBSB 2VZAA 3VR2A 2X6LA 3J81i 4K14A 3PO2B 3CPFA 4OELB 4ZYSA 4F87A 1I3QB 1JORA 3PV0A 3E6ZX 3H3VI 2I46A 4C1NI 3DHQA 4DF7A 1QNKA 3OW7A 5JPMC 2UUBQ 3UDIA 5KEEA 2RF4A 3T16A 1TIID 4G7ZC 1KAWA 4LF7L 1IYVA 5M3FH 3I7FA 2SDFA 3D4RA 1HNXL 4GKJQ 1F2MA 3I70A 4K8IA 4P73A 2EQSA 2FMCA 5EKLA 4KY6A 3C1EA 1HNZL 1HNWL 4L5QA 4O1NA 1CKNB 2F0SA 1B7YB 3CCEA 5JJLA 1CHPD 1PZID 1VQNA 1X3GA 4A3FH 4CDEC 2OQKA 2NUCA 2Z6KA 2LY7A 2EYOA 2IT1A 3LX0A 2NYZD 1GD7A 4OWTB 3D6CA 2K75A 3S9WA 3AYHB 2B3GA 3MC0B 2K50A 1HTLD 5JVG3 1A0IA 2CW0D 1JB7A 5M5WH 1OXTA 2M00A 4ME3A 1RF2D 1X56A 4I7ZC 2A8VA 1F9PA 3JC66 4NDXA 4A3BB 1DONA 3P1HA 2RBMA 4DUZL 3H94A 4DR4L 1WYDA 1IL2A 1ZXTA 3EIVA 5C5MA 3CCRA 2EYHA 1AP0A 3B6YA 2A69D 4LF4L 3EVQA 1JMCA 3A7AB 1JT8A 4DV2L 1H9SA 4H02A 1VQOA 1KABA 5CORA 2EIFA 4PZ7A 4JG2A 1TKWB 5C6AA 1OXVA 2UU9L 1CT1D 1D1KA 3RNUA 1Y1WB 5E7NA 4DK0A 4IURA 1EYCA 4LF7Q 3KF6A 4A3IH 3FVQA 1I4RA 1LACA 2OF1A 1EIGA 5IGFA 2R92G 1WJJA 3CD6A 5AJ3L 1K8GA 1E7ZA 1JE5A 4KN4C 5IP7H 1A6XA 1IW7D 1IYUA 1GUOA 5EAYA 1X65A 4GLVB 1S5CD 3KYHC 4AYBE 1IZ6A 3TEHB 1I6HB 1FJGQ 2AHOB 5C4JH 1PMRA 4V0BA 2YV5A 4JOIC 3J7AV 3KLSX 2VQFL 2J4XA 5C3EG 4B3RQ 1MHWC 4C2MH 4DXFA 2HHHQ 5H1SE 2XWBB 2UXDQ 3NTKA 4A4IA 1K83H 3KF8A 1OTCA 4KD4A 5IYBH 2FXQA 1TU2B 3PUXA 4WORA 3I73A 2WKCA 1ASYA 1B3AA 3H0GH 5M3MH 2UXCQ 5C4HA 5FLXc 3C2PA 4FF2A 2F4VL 4KHVA 4NPSA 4BY1G 4JI5Q 1TWAB 3ULPA 2GA4B 4HAEA 2B2TC 1AW7A 5BN3A 3R93A 1YNXA 4Z9CB 2E74C 3CF5A 4A3KB 1BKBA 3I4MH 4PZ6A 1Y1VH 1XTDA 4RHSA 4QIWB 1TWHH 2OXPA 4IQZA 1RIPA 2K05A 1EY0A 4RFBA 1A3VA 3K7AH 3C46A 5CV8A 1EQVA 2OTJA 1VQKA 1IKMA 4DAYA 3BYYB 4LJZC 3I2ZA 3KBXA 5IP7G 2PMZB 3NQTA 4J1MA 5CMDA 2OT2A 1SNDA 1L0XB 1K8OA 1PFBA 3OIQA 2PZTA 1QVCA 3J81E 4F7XA 4LK1C 2Q2TA 4EQNA 2AQ3B 3HRZC 3T1HL 1WTHA 2VB2X 4LUOA 3CCVA 1JOKA 4X3SA 1ENCA 1A15A 1VQFA 4DR7L 4X3KA 1HR0W 2H5XA 2VXWA 2OEOA 4TSSA 4A3LG 1YIJA 1SE2A 2LFNA 3KLSA 5GQOA 3V2TA 4A3MH 2QEJC 5HY6A 1FGUA 1WTXA 2B2YC 1JR0D 4HMIA 3F2CA 3DEPA 4KMUC 3Q8DA 4A3JH 1GUTA 1XWEA 5C0XH 3GTPB 1PFMA 1PTOC 3A8KE 1L2FA 1QVFA 4NXML 4ME5A 4IPDA 1SBBB 1TWHB 3CHBD 1QWYA 4B3TQ 2YU9B 4FYDA 3GTKB 3S24A 2R93H 2VW9A 4FF3A 4EX5A 1X3QA 3UDFA 1AE2A 4AYBG 4LFBQ 2CH4W 3SHLA 1D8LA 1I4HA 1T5XD 3VR5A 3MHBA 3M4OB 4PNYA 3J7ZC 2NVXB 1BCPD 1STAA 1D6EC 3OPOA 1BXTA 1D2BA 4ID6A 2EYPA 2KCNA 1DOMA 2MJ8A 4JPBW 4O2DA 2F4VQ 3K7AB 1EY6A 4GKKQ 4FF1A 1XMQL 1PXUA 4DGZA 4HIOA 4XT3B 3GTQH 1SAPA 3D31A 4IPGA 2E2JH 2F1MA 1EY8A 2ZJQA 1TWAH 4H0LC 3C1FA 2LXJA 5IIFA 2CCZA 2JA5B 3HKSA 5ELOA 3TP5A 1SMXA 1GKHA 1BO0A 3SVMA 3FKIG 1ZEQX 3CP0A 1UE7A 4HJ5A 4QJFA 1LTID 1VQJA 4ZQ3A 3F8TA 3HG9A 1PTOB 4X62Q 2KA7A 1EQRA 4IN3A 5FO7B 1O7ZA 4R4TA 1PRTD 1NSNS 3PSIA 1TWCH 5IY0A 2PQAA 3NENA 3S1NH 4IFDI 1F77A 5KGUA 3W1BA 3IFTA 3MXNB 3BVGA 4RGTA 1L1OA 2UUBL 3ND9A 1EIHA 3MFYA 4RCOA 1HUMA 4LFBL 5L37A 2JA9A 3NWTA 4G4KA 3DM1A 1O7YA 4CKCA 3GTLB 2HDMA 1XPRA 2Q8TA 1NMFA 1XYIA 2NVTH 1GXDC 4BBSG 2Z8LA 2KJXA 1ILPA 4KJOA 2N88A 1PRTF 5I2YA 2RA4A 3MXGA 4DN4M 1HZAA 4A3JB 4R8NA 3A7LA 4A3KG 4A3GB 1K28A 5JEAG 3QOJA 4A3EG 2A6HD 4DV5Q 4QQBX 3U4ZA 4IUQA 2QF7A 3PO3B 4IZ8A 3NPPA 4A3DG
chains in the Genus database with same CATH topology
3T1YL 4DV0Q 3G48A 4BXXG 1NE3A 4IFDJ 3AEVA 3GTMH 1HZCA 2CWAA 3BZCA 1XNQQ 4IPHA 3CC2A 1YVCA 1K8AC 3HOXG 2MFIA 1Q86C 1PA6A 1SN8A 2YTYA 4JI8Q 2XGTA 3WWVA 1PYBA 4DV4L 4X6AH 2AWOA 5GAHC 3S1QH 4JV5L 2JA8G 3E0EA 1KD1C 1PYSB 2MNAA 4AQYL 3OW2A 2N49A 1R9TH 4LFAL 2HIXA 4YWKA 1HNZQ 3CAMA 3GTGH 4C3IH 1HNWQ 1RL2A 2BA1A 5LMNQ 3I55A 2YTXA 3PIOA 5GAEC 1C9OA 3RLNA 2Q2HA 1IBKL 3S14H 1CUKA 4LF6L 3KF6B 1X54A 3HOUG 1VCIA 2YTVA 4LUVA 4IO9A 4JI0Q 1VQIA 3L0OA 1Y1WG 2HT1A 4GNXC 2NZHA 1UEBA 4LFCQ 1EQQA 3HFZB 3F2BA 2HIVA 2ZTEA 4DR5Q 4AH6A 1JJCB 3HOUH 3PO2G 1SLJA 2AMCB 1KIXA 2DUDA 4DR1L 4A3BH 4HIMA 3K7UC 4DKAC 1GVPA 2HQLA 1S72A 1Q82C 3CCLA 2R93G 5C44H 4DAMA 3J80c 5IP9G 3VDYA 3CMAA 4LF8Q 4NXNQ 3PO2H 2CQOA 4WJ3M 3KLWA 3FP9A 4IJHA 5JEAJ 4DR2L 4A3KH 2N3SA 3RN2A 4JI5L 4OX9L 4L5RC 2JA8H 1SRUA 2WP8J 4DV2Q 5FLMH 1Q46A 1EFWA 3GTKH 3HOWH 3S1MH 4JYAQ 1N34L 1MJCA 4A3GH 4GLXA 4KHPL 4LF5Q 4P74A 1FL0A 3LGJA 5FLMG 1PH1A 3HOVH 3STBD 5LMUL 4UP8A 2RCNA 4BBSH 2NN6G 3E9HA 2E5LQ 4LF8L 1X6OA 3PIPA 3L7ZC 2NZOA 1PV4A 2CKZB 4DAYB 2WFWA 1IBML 4R4IA 1Y14B 2Q2IA 4LUZA 3CC4A 4A93G 2K5NA 3AQQA 3S17H 4JI3Q 3KJOA 1PH5A 4GN5A 4IOAA 3AFPA 4DPGA 1I50H 1SR3A 4UP7A 1PH8A 2QGQA 3HOYH 3L2PA 3J81j 1N33Q 3JAMi 2L15A 1PHJA 1M90C 2UU9Q 4DK6C 1Q81C 1K3RA 4GOPA 3M7NA 1VQBA 4BY7H 3CMEA 4A3GG 4KHZA 4NXMQ 3A74A 1G6PA 1OXSC 2ZTDA 3K0XA 4JC0A 1KRSA 2AWNA 4MZ9A 1P8LA 4DV7Q 1HH2P 4JI7Q 4JI6Q 3S1RH 3GO5A 1TXYA 1YEZA 4HJ8A 5K36G 1NY4A 4UY8C 3UE1A 3UDXA 5C44G 4JBWA 4R4QA 4DNIA 5AJ3Q 2F52A 3STBC 3NELA 3DLLA 1YHQA 3PUWA 3KFUA 4A3BG 1A63A 4DV3Q 5BR8Q 3CCQA 3TS2A 4YHHQ 3OTOL 4LF9Q 3M85A 1MKHA 5GADC 3BU2A 1KRTA 1K73C 1PH2A 5M3FG 2VY3A 4HIDA 1PVOA 1PH7A 1IBMQ 2B63G 4DV1L 4A93H 5HGQA 1LYLA 2VUMG 5LMUQ 4GKJL 2R7DA 2VZAA 4BA2I 4XTCS 5IT9c 1XNRQ 3HKZE 4C3HH 3J81i 3GD7A 4LW1A 4JI4L 3CPFA 4GKKL 3E9IA 3GTJH 3PUZA 4JI4Q 4IFDG 3TQYA 1YJNA 3PV0A 4Y7NH 1VQ4A 4JI1L 3H3VI 4A3DH 2IX0A 5J3BA 4LNQA 2YYZA 1NTGA 2IX1A 2VQEL 3U4VA 4QGUA 1YZ6A 4O0AA 2JQOA 1HJPA 2C35B 2UUBQ 2VUMH 3S2DH 3UDIA 3FHWA 5IP9H 1EYGA 2RF4A 1VQ9A 4BBRH 4DV5L 1A8VA 1KAWA 3RR5A 4LF7L 1X3FA 1I3QH 4JCVE 1E24A 3I7FA 3PUYA 2JJQA 2XTIA 5M3FH 1X55A 2JE6I 1HNXL 4GKJQ 2DGYA 1W2BA 5BR8L 4EQ5A 4APVA 4P73A 2EQSA 1N32L 2UUAL 1T9HA 2PQAB 4P72A 4OWWB 1D7QA 1A62A 1HNZL 1HNWL 4P75A 3UDGA 3A5ZB 1SFOH 4L5QA 5ELNA 3IRBA 1WCMH 1M1KC 4UPAA 2I5HA 1CKNB 1TWFH 4DV7L 4GOPC 3CCEA 1B7YB 3RN5A 1ASZA 4JI7L 3HOZG 5JJLA 4JOIA 2RHQB 4QL5A 4JI8L 3RLOA 2JA5H 3PCOB 1UE1A 2V1CC 4IJLA 3SGIA 4L5SA 1VQNA 1X3GA 2UXCL 4A3FH 4X64Q 1XNQL 1EUJA 2OQKA 2D62A 4A3CG 2Q2UA 2Z6KA 4A3JG 4DUYQ 2UUAQ 4NXNL 3AFQA 1UE6A 2IT1A 4KI0A 1K0RA 1GD7A 1K9MC 2UXBL 4OWTB 2K75A 4OO1G 3AYHB 2B3GA 2Z6KC 5C4XH 1GM5A 2K14A 2UXDL 2K50A 1W3SA 2VL6A 1A0IA 2A19A 1VQPA 4LF9L 2ZJPA 4B3RL 1JB7A 5M5WH 4IOCA 4A3EH 1OXTA 3W1GA 4YCUA 3M3YH 4ME3A 1IBKQ 2BH2A 1X56A 1N36L 2A8VA 3JC66 4LF5L 1S3OA 2QA4A 5C0XG 1WOCA 2ALYB 4DUZL 3A5UA 1WYDA 1IL2A 4DR4L 2GN5A 2JEBI 3EIVA 3CCRA 4P71A 3B6YA 1KL9A 3CCMA 4BA1I 4LF4L 3CCJA 3CC7A 1JMCA 2K5VA 1JT8A 4DV2L 4H02A 1CSPA 3G6EA 3S16H 4JBJA 2OCEA 1VQOA 3HOWG 1KHIA 2EIFA 5JJKA 2R6GA 4PZ7A 1J5EL 4JG2A 3M4PA 2QEXA 1OXVA 2UU9L 4FDBA 1V9PA 3M4QA 3RNUA 3G4SA 1B70B 1HZBA 5E7NA 5GROA 5C4XG 4R4CA 2ATWA 1L1OC 4MTNA 4LF7Q 3KF6A 4A3IH 1G291 3F1ZA 2GVAA 4X66Q 1MJEA 4MNOA 3K81C 4WJ4A 1YHAA 2AKWB 5LMNW 4DV3L 2R92G 1WJJA 1QZHA 1LUZA 3CD6A 5AJ3L 2VQFQ 1Y1WH 1N8RC 4DUYL 1E7ZA 1JE5A 1K8GA 4B3MQ 4PMWA 4X64L 2Y0SE 3KDFA 2PMZE 5IP7H 3CPWA 5EAYA 4GOPB 2I5LX 4JV5Q 1LTLA 2CWPA 2MO0A 3ER0A 1X65A 4DR3Q 3W5OA 1E3PA 4DUZQ 4GLVB 2NVYH 4YCWA 3KYHC 4TQUS 1IZ6A 3TEHB 4AYBE 1XNRL 4DV4Q 1KC8C 1FJGQ 2AHOB 5C4JH 1WFQA 5IYDG 1HZ9A 2E2HH 2YV5A 4JOIC 1GO3E 4YWLA 1YJ9A 2VQFL 1N32Q 3MEFA 2KCMA 3H0GG 5C3EG 1VQ6A 2BH8A 5JJIA 4B3RQ 4C3JH 2IHEA 3PF4A 4C2MH 1L1OB 4JBKA 2HHHQ 5H1SE 2UXDQ 1QUQB 1NBWA 1YJWA 4IPCA 1I6HH 1J6QA 2Z0SA 4GLAC 4A4IA 4A75A 1K83H 1OTCA 1B8AA 4RG1A 5M5YH 1KXLA 2KCTA 5IYBH 2LXKA 4L5TA 2FXQA 3ULJA 5IYCG 2ZM6Q 3PUXA 1ASYA 5FJ8G 3H0GH 5M3MH 3ERSX 5GAGC 1FJGL 4HJAA 4JBMA 2UXCQ 1Q12A 1Q8KA 1XPUA 2MO1A 3I4OA 1OXXK 2KHJA 3NEMA 5FLXc 1PH3A 4LF4Q 3D0FA 3J80i 3ZJYC 2N8NA 2F4VL 3TREA 4NPSA 1YBYA 4BY1G 4A3MG 4JI5Q 4OX9Q 3PO3H 4DR4Q 2VNUD 3I4MH 3ULPA 1P16A 4GN4B 1VQHA 5IYBG 1YNXA 4AIMA 1LM0A 1G51A 4GS3A 3CF5A 4DV6L 2K4KA 2K5HA 1BKBA 1EWIA 1X9NA 4PZ6A 1HNXQ 4DR1Q 1Y1VH 2KHIA 1XPOA 1Q7YC 3CCSA 1XTDA 1VQDA 2A1AA 1PFSA 1TWHH 4OONA 4UP9A 2IHFA 4HIKA 1RIPA 3BZKA 2N78A 5DLQE 3GDEA 4GN3B 3K7AH 1JJ2A 4A3CH 1E1OA 1IYJB 3HKZG 1UWVA 4LF6Q 1Q1BA 4A3FG 4JI0L 1S40A 5LMNL 2OTJA 3PGZA 1VQKA 1XMQQ 2LSSA 4JI6L 3RZOH 1YHBA 3NBHB 3TS0A 2ID0A 1TWGH 3U50C 4X62L 1U5KA 3I2ZA 5IP7G 2PI2A 1N34Q 2D0PA 2JA7G 1SROA 2PNHA 4X65Q 2I0QA 3S15H 1BBWA 1CKNA 1QVCA 1C0AA 3K8AA 2K52A 1O7IA 1VQCA 3FKIH 5C0XJ 2Q2TA 2PI2E 3T1HL 1IBLQ 2OTLA 2WB1G 3KDFB 1L0WA 4LUOA 2ES2A 2JA6G 2JK8A 4A3IG 3CCVA 4A3LH 1VQFA 1Y1VG 4DR7L 4DK3C 3I4NG 1HR0W 2H5XA 1VQAA 3ICEA 1CSQA 4A3LG 3HOVG 1YIJA 2RHSB 5GQOA 4NB3A 1VS0A 4A3MH 5C3EH 5HY6A 2JA6H 1FGUA 2B29A 3F2CA 4B3TL 1VQ8A 1QUQA 3Q8DA 4A3JH 4LFAQ 4B3SL 4YY3Q 4DR3L 2KENA 3PUVA 1PH6A 3CW2C 5M3MG 4YY3L 2JA5G 1L2FA 5FJ8H 1QVFA 1NJIC 4NXML 3RLFA 4IPDA 2JA7H 1V43A 1QVGA 4B3TQ 1UE5A 2NN6I 2B63H 1I94Q 3S24A 5M5XH 4QY7A 4JI2Q 1XMOQ 2R93H 3J81c 2VW9A 4EX5A 4DV0L 3UDFA 1AE2A 4AYBG 4LFBQ 1D8LA 1BVSA 3U58A 2R7FA 4X66L 4GNXB 3S2HH 4K0KL 3M9BA 3BJUA 4JI3L 2Y0SG 5C0XI 4HJ7A 1H95A 2F3IA 4K0KQ 3EBEA 2R7ZH 4KLKA 2WB1E 2UXBQ 1CKMA 4LFCL 3H3VH 1E22A 1EOVA 5IYDH 3J7ZC 1I94L 2YU9H 1HR0L 1VQGA 2IY5B 5IE8A 2WAQE 1VQ5A 1VQEA 4O2DA 3TRZA 1WCMG 2F4VQ 3UE0A 1VQMA 4GKKQ 3JAMc 4JYAL 3PO3G 4RMFA 4B3SQ 4POFA 4BY1H 3K80C 4A76A 4Y52H 4PG3A 2NVXH 1VQLA 1XMQL 1KQSA 4OWXB 2E8GA 2R92H 4HIOA 1Q1EA 2WAQG 2VS1A 1HR0Q 2ZM6L 3GTQH 1CKOA 4DV1Q 3D31A 2GVBA 2EXDA 4IPGA 2E2JH 4YHHL 4YCVA 5IYCH 3CXCA 3CCUA 2ZJQA 1AH9A 1TWAH 3RZDH 5IWAL 4XIGS 2LXJA 3F2DA 3DM3A 2CCZA 3I4NH 2OWOA 1BBUA 3T1HQ 3GTPH 4GNXA 4DV6Q 1I5FA 1PH4A 3HKSA 5ELOA 2VQEQ 4J15A 1SMXA 2UUCL 1GKHA 1J5EQ 4OO1I 4JI1Q 2E2IH 1SE8A 3FKIG 2I5MX 3CP0A 1EIFA 1UE7A 1WI5A 4HJ5A 4QJFA 4AQYQ 4KHPQ 4LWCA 1VQJA 2KBNA 3F8TA 4POGA 4X62Q 3HOYG 1JJGA 1EQRA 1C7YA 3HOZH 2ZJRA 1Z9FA 4R4TA 4TVAB 4B3ML 2JEAI 1N36Q 3PSIA 4DR2Q 3M4OH 3H15A 1TWCH 1N33L 1FVIA 3T1YQ 1X3EA 2ASBA 5IY0A 1YI2A 2PQAA 3NENA 3S1NH 4IFDI 1N9WA 3W1BA 4ALPA 3MXNB 4DR5L 1L1OA 2UUBL 3OTOQ 4BBRG 1AE3A 1IBLL 2MQHA 4LFBL 2JA9A 3EN2A 2E5LL 3OYYA 1NMGA 2CFMA 2D0OA 3I4MG 1E1TA 1PH9A 2R7ZG 1U0LA 3PF5A 4OXPA 1XMOL 4JI2L 1XPRA 4DR6L 4PZ8A 1NMFA 2NVTH 4BBSG 3GTOH 3KF8B 4X65L 1XJVA 3HOXH 4BY7G 1YITA 1V1QA 1IXRA 1DGSA 3I56A 2OQ0A 3J7A5 4DR6Q 2BA0A 4BXXH 2NVQH 1HZAA 2ZTCA 3KOJA 2UUCQ 3G71A 4A3KG 1QZGA 3GTLH 5JEAG 3KJPA 1MIUA 4R4OA 4A3EG 3A0JA 5IWAQ 1VQ7A 4DR7Q 4R1JA 3ULLA 3CQZH 4DV5Q 1EIYB 3U4ZA 4HJ9A 4QQBX 4YWMA 1OXUA 4QIWE 2HHHL 4A3DG 1Z47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y L;  4DV0 Q;  3G48 A;  4BXX G;  1NE3 A;  4IFD J;  3AEV A;  3GTM H;  1HZC A;  2CWA A;  3BZC A;  1XNQ Q;  4IPH A;  3CC2 A;  1YVC A;  1K8A C;  3HOX G;  2MFI A;  1Q86 C;  1PA6 A;  1SN8 A;  2YTY A;  4JI8 Q;  2XGT A;  3WWV A;  1PYB A;  4DV4 L;  4X6A H;  2AWO A;  5GAH C;  3S1Q H;  4JV5 L;  2JA8 G;  3E0E A;  1KD1 C;  1PYS B;  2MNA A;  4AQY L;  3OW2 A;  2N49 A;  1R9T H;  4LFA L;  2HIX A;  4YWK A;  1HNZ Q;  3CAM A;  3GTG H;  4C3I H;  1HNW Q;  1RL2 A;  2BA1 A;  5LMN Q;  3I55 A;  2YTX A;  3PIO A;  5GAE C;  1C9O A;  3RLN A;  2Q2H A;  1IBK L;  3S14 H;  1CUK A;  4LF6 L;  3KF6 B;  1X54 A;  3HOU G;  1VCI A;  2YTV A;  4LUV A;  4IO9 A;  4JI0 Q;  1VQI A;  3L0O A;  1Y1W G;  2HT1 A;  4GNX C;  2NZH A;  1UEB A;  4LFC Q;  1EQQ A;  3HFZ B;  3F2B A;  2HIV A;  2ZTE A;  4DR5 Q;  4AH6 A;  1JJC B;  3HOU H;  3PO2 G;  1SLJ A;  2AMC B;  1KIX A;  2DUD A;  4DR1 L;  4A3B H;  4HIM A;  3K7U C;  4DKA C;  1GVP A;  2HQL A;  1S72 A;  1Q82 C;  3CCL A;  2R93 G;  5C44 H;  4DAM A;  3J80 c;  5IP9 G;  3VDY A;  3CMA A;  4LF8 Q;  4NXN Q;  3PO2 H;  2CQO A;  4WJ3 M;  3KLW A;  3FP9 A;  4IJH A;  5JEA J;  4DR2 L;  4A3K H;  2N3S A;  3RN2 A;  4JI5 L;  4OX9 L;  4L5R C;  2JA8 H;  1SRU A;  2WP8 J;  4DV2 Q;  5FLM H;  1Q46 A;  1EFW A;  3GTK H;  3HOW H;  3S1M H;  4JYA Q;  1N34 L;  1MJC A;  4A3G H;  4GLX A;  4KHP L;  4LF5 Q;  4P74 A;  1FL0 A;  3LGJ A;  5FLM G;  1PH1 A;  3HOV H;  3STB D;  5LMU L;  4UP8 A;  2RCN A;  4BBS H;  2NN6 G;  3E9H A;  2E5L Q;  4LF8 L;  1X6O A;  3PIP A;  3L7Z C;  2NZO A;  1PV4 A;  2CKZ B;  4DAY B;  2WFW A;  1IBM L;  4R4I A;  1Y14 B;  2Q2I A;  4LUZ A;  3CC4 A;  4A93 G;  2K5N A;  3AQQ A;  3S17 H;  4JI3 Q;  3KJO A;  1PH5 A;  4GN5 A;  4IOA A;  3AFP A;  4DPG A;  1I50 H;  1SR3 A;  4UP7 A;  1PH8 A;  2QGQ A;  3HOY H;  3L2P A;  3J81 j;  1N33 Q;  3JAM i;  2L15 A;  1PHJ A;  1M90 C;  2UU9 Q;  4DK6 C;  1Q81 C;  1K3R A;  4GOP A;  3M7N A;  1VQB A;  4BY7 H;  3CME A;  4A3G G;  4KHZ A;  4NXM Q;  3A74 A;  1G6P A;  1OXS C;  2ZTD A;  3K0X A;  4JC0 A;  1KRS A;  2AWN A;  4MZ9 A;  1P8L A;  4DV7 Q;  1HH2 P;  4JI7 Q;  4JI6 Q;  3S1R H;  3GO5 A;  1TXY A;  1YEZ A;  4HJ8 A;  5K36 G;  1NY4 A;  4UY8 C;  3UE1 A;  3UDX A;  5C44 G;  4JBW A;  4R4Q A;  4DNI A;  5AJ3 Q;  2F52 A;  3STB C;  3NEL A;  3DLL A;  1YHQ A;  3PUW A;  3KFU A;  4A3B G;  1A63 A;  4DV3 Q;  5BR8 Q;  3CCQ A;  3TS2 A;  4YHH Q;  3OTO L;  4LF9 Q;  3M85 A;  1MKH A;  5GAD C;  3BU2 A;  1KRT A;  1K73 C;  1PH2 A;  5M3F G;  2VY3 A;  4HID A;  1PVO A;  1PH7 A;  1IBM Q;  2B63 G;  4DV1 L;  4A93 H;  5HGQ A;  1LYL A;  2VUM G;  5LMU Q;  4GKJ L;  2R7D A;  2VZA A;  4BA2 I;  4XTC S;  5IT9 c;  1XNR Q;  3HKZ E;  4C3H H;  3J81 i;  3GD7 A;  4LW1 A;  4JI4 L;  3CPF A;  4GKK L;  3E9I A;  3GTJ H;  3PUZ A;  4JI4 Q;  4IFD G;  3TQY A;  1YJN A;  3PV0 A;  4Y7N H;  1VQ4 A;  4JI1 L;  3H3V I;  4A3D H;  2IX0 A;  5J3B A;  4LNQ A;  2YYZ A;  1NTG A;  2IX1 A;  2VQE L;  3U4V A;  4QGU A;  1YZ6 A;  4O0A A;  2JQO A;  1HJP A;  2C35 B;  2UUB Q;  2VUM H;  3S2D H;  3UDI A;  3FHW A;  5IP9 H;  1EYG A;  2RF4 A;  1VQ9 A;  4BBR H;  4DV5 L;  1A8V A;  1KAW A;  3RR5 A;  4LF7 L;  1X3F A;  1I3Q H;  4JCV E;  1E24 A;  3I7F A;  3PUY A;  2JJQ A;  2XTI A;  5M3F H;  1X55 A;  2JE6 I;  1HNX L;  4GKJ Q;  2DGY A;  1W2B A;  5BR8 L;  4EQ5 A;  4APV A;  4P73 A;  2EQS A;  1N32 L;  2UUA L;  1T9H A;  2PQA B;  4P72 A;  4OWW B;  1D7Q A;  1A62 A;  1HNZ L;  1HNW L;  4P75 A;  3UDG A;  3A5Z B;  1SFO H;  4L5Q A;  5ELN A;  3IRB A;  1WCM H;  1M1K C;  4UPA A;  2I5H A;  1CKN B;  1TWF H;  4DV7 L;  4GOP C;  3CCE A;  1B7Y B;  3RN5 A;  1ASZ A;  4JI7 L;  3HOZ G;  5JJL A;  4JOI A;  2RHQ B;  4QL5 A;  4JI8 L;  3RLO A;  2JA5 H;  3PCO B;  1UE1 A;  2V1C C;  4IJL A;  3SGI A;  4L5S A;  1VQN A;  1X3G A;  2UXC L;  4A3F H;  4X64 Q;  1XNQ L;  1EUJ A;  2OQK A;  2D62 A;  4A3C G;  2Q2U A;  2Z6K A;  4A3J G;  4DUY Q;  2UUA Q;  4NXN L;  3AFQ A;  1UE6 A;  2IT1 A;  4KI0 A;  1K0R A;  1GD7 A;  1K9M C;  2UXB L;  4OWT B;  2K75 A;  4OO1 G;  3AYH B;  2B3G A;  2Z6K C;  5C4X H;  1GM5 A;  2K14 A;  2UXD L;  2K50 A;  1W3S A;  2VL6 A;  1A0I A;  2A19 A;  1VQP A;  4LF9 L;  2ZJP A;  4B3R L;  1JB7 A;  5M5W H;  4IOC A;  4A3E H;  1OXT A;  3W1G A;  4YCU A;  3M3Y H;  4ME3 A;  1IBK Q;  2BH2 A;  1X56 A;  1N36 L;  2A8V A;  3JC6 6;  4LF5 L;  1S3O A;  2QA4 A;  5C0X G;  1WOC A;  2ALY B;  4DUZ L;  3A5U A;  1WYD A;  1IL2 A;  4DR4 L;  2GN5 A;  2JEB I;  3EIV A;  3CCR A;  4P71 A;  3B6Y A;  1KL9 A;  3CCM A;  4BA1 I;  4LF4 L;  3CCJ A;  3CC7 A;  1JMC A;  2K5V A;  1JT8 A;  4DV2 L;  4H02 A;  1CSP A;  3G6E A;  3S16 H;  4JBJ A;  2OCE A;  1VQO A;  3HOW G;  1KHI A;  2EIF A;  5JJK A;  2R6G A;  4PZ7 A;  1J5E L;  4JG2 A;  3M4P A;  2QEX A;  1OXV A;  2UU9 L;  4FDB A;  1V9P A;  3M4Q A;  3RNU A;  3G4S A;  1B70 B;  1HZB A;  5E7N A;  5GRO A;  5C4X G;  4R4C A;  2ATW A;  1L1O C;  4MTN A;  4LF7 Q;  3KF6 A;  4A3I H;  1G29 1;  3F1Z A;  2GVA A;  4X66 Q;  1MJE A;  4MNO A;  3K81 C;  4WJ4 A;  1YHA A;  2AKW B;  5LMN W;  4DV3 L;  2R92 G;  1WJJ A;  1QZH A;  1LUZ A;  3CD6 A;  5AJ3 L;  2VQF Q;  1Y1W H;  1N8R C;  4DUY L;  1E7Z A;  1JE5 A;  1K8G A;  4B3M Q;  4PMW A;  4X64 L;  2Y0S E;  3KDF A;  2PMZ E;  5IP7 H;  3CPW A;  5EAY A;  4GOP B;  2I5L X;  4JV5 Q;  1LTL A;  2CWP A;  2MO0 A;  3ER0 A;  1X65 A;  4DR3 Q;  3W5O A;  1E3P A;  4DUZ Q;  4GLV B;  2NVY H;  4YCW A;  3KYH C;  4TQU S;  1IZ6 A;  3TEH B;  4AYB E;  1XNR L;  4DV4 Q;  1KC8 C;  1FJG Q;  2AHO B;  5C4J H;  1WFQ A;  5IYD G;  1HZ9 A;  2E2H H;  2YV5 A;  4JOI C;  1GO3 E;  4YWL A;  1YJ9 A;  2VQF L;  1N32 Q;  3MEF A;  2KCM A;  3H0G G;  5C3E G;  1VQ6 A;  2BH8 A;  5JJI A;  4B3R Q;  4C3J H;  2IHE A;  3PF4 A;  4C2M H;  1L1O B;  4JBK A;  2HHH Q;  5H1S E;  2UXD Q;  1QUQ B;  1NBW A;  1YJW A;  4IPC A;  1I6H H;  1J6Q A;  2Z0S A;  4GLA C;  4A4I A;  4A75 A;  1K83 H;  1OTC A;  1B8A A;  4RG1 A;  5M5Y H;  1KXL A;  2KCT A;  5IYB H;  2LXK A;  4L5T A;  2FXQ A;  3ULJ A;  5IYC G;  2ZM6 Q;  3PUX A;  1ASY A;  5FJ8 G;  3H0G H;  5M3M H;  3ERS X;  5GAG C;  1FJG L;  4HJA A;  4JBM A;  2UXC Q;  1Q12 A;  1Q8K A;  1XPU A;  2MO1 A;  3I4O A;  1OXX K;  2KHJ A;  3NEM A;  5FLX c;  1PH3 A;  4LF4 Q;  3D0F A;  3J80 i;  3ZJY C;  2N8N A;  2F4V L;  3TRE A;  4NPS A;  1YBY A;  4BY1 G;  4A3M G;  4JI5 Q;  4OX9 Q;  3PO3 H;  4DR4 Q;  2VNU D;  3I4M H;  3ULP A;  1P16 A;  4GN4 B;  1VQH A;  5IYB G;  1YNX A;  4AIM A;  1LM0 A;  1G51 A;  4GS3 A;  3CF5 A;  4DV6 L;  2K4K A;  2K5H A;  1BKB A;  1EWI A;  1X9N A;  4PZ6 A;  1HNX Q;  4DR1 Q;  1Y1V H;  2KHI A;  1XPO A;  1Q7Y C;  3CCS A;  1XTD A;  1VQD A;  2A1A A;  1PFS A;  1TWH H;  4OON A;  4UP9 A;  2IHF A;  4HIK A;  1RIP A;  3BZK A;  2N78 A;  5DLQ E;  3GDE A;  4GN3 B;  3K7A H;  1JJ2 A;  4A3C H;  1E1O A;  1IYJ B;  3HKZ G;  1UWV A;  4LF6 Q;  1Q1B A;  4A3F G;  4JI0 L;  1S40 A;  5LMN L;  2OTJ A;  3PGZ A;  1VQK A;  1XMQ Q;  2LSS A;  4JI6 L;  3RZO H;  1YHB A;  3NBH B;  3TS0 A;  2ID0 A;  1TWG H;  3U50 C;  4X62 L;  1U5K A;  3I2Z A;  5IP7 G;  2PI2 A;  1N34 Q;  2D0P A;  2JA7 G;  1SRO A;  2PNH A;  4X65 Q;  2I0Q A;  3S15 H;  1BBW A;  1CKN A;  1QVC A;  1C0A A;  3K8A A;  2K52 A;  1O7I A;  1VQC A;  3FKI H;  5C0X J;  2Q2T A;  2PI2 E;  3T1H L;  1IBL Q;  2OTL A;  2WB1 G;  3KDF B;  1L0W A;  4LUO A;  2ES2 A;  2JA6 G;  2JK8 A;  4A3I G;  3CCV A;  4A3L H;  1VQF A;  1Y1V G;  4DR7 L;  4DK3 C;  3I4N G;  1HR0 W;  2H5X A;  1VQA A;  3ICE A;  1CSQ A;  4A3L G;  3HOV G;  1YIJ A;  2RHS B;  5GQO A;  4NB3 A;  1VS0 A;  4A3M H;  5C3E H;  5HY6 A;  2JA6 H;  1FGU A;  2B29 A;  3F2C A;  4B3T L;  1VQ8 A;  1QUQ A;  3Q8D A;  4A3J H;  4LFA Q;  4B3S L;  4YY3 Q;  4DR3 L;  2KEN A;  3PUV A;  1PH6 A;  3CW2 C;  5M3M G;  4YY3 L;  2JA5 G;  1L2F A;  5FJ8 H;  1QVF A;  1NJI C;  4NXM L;  3RLF A;  4IPD A;  2JA7 H;  1V43 A;  1QVG A;  4B3T Q;  1UE5 A;  2NN6 I;  2B63 H;  1I94 Q;  3S24 A;  5M5X H;  4QY7 A;  4JI2 Q;  1XMO Q;  2R93 H;  3J81 c;  2VW9 A;  4EX5 A;  4DV0 L;  3UDF A;  1AE2 A;  4AYB G;  4LFB Q;  1D8L A;  1BVS A;  3U58 A;  2R7F A;  4X66 L;  4GNX B;  3S2H H;  4K0K L;  3M9B A;  3BJU A;  4JI3 L;  2Y0S G;  5C0X I;  4HJ7 A;  1H95 A;  2F3I A;  4K0K Q;  3EBE A;  2R7Z H;  4KLK A;  2WB1 E;  2UXB Q;  1CKM A;  4LFC L;  3H3V H;  1E22 A;  1EOV A;  5IYD H;  3J7Z C;  1I94 L;  2YU9 H;  1HR0 L;  1VQG A;  2IY5 B;  5IE8 A;  2WAQ E;  1VQ5 A;  1VQE A;  4O2D A;  3TRZ A;  1WCM G;  2F4V Q;  3UE0 A;  1VQM A;  4GKK Q;  3JAM c;  4JYA L;  3PO3 G;  4RMF A;  4B3S Q;  4POF A;  4BY1 H;  3K80 C;  4A76 A;  4Y52 H;  4PG3 A;  2NVX H;  1VQL A;  1XMQ L;  1KQS A;  4OWX B;  2E8G A;  2R92 H;  4HIO A;  1Q1E A;  2WAQ G;  2VS1 A;  1HR0 Q;  2ZM6 L;  3GTQ H;  1CKO A;  4DV1 Q;  3D31 A;  2GVB A;  2EXD A;  4IPG A;  2E2J H;  4YHH L;  4YCV A;  5IYC H;  3CXC A;  3CCU A;  2ZJQ A;  1AH9 A;  1TWA H;  3RZD H;  5IWA L;  4XIG S;  2LXJ A;  3F2D A;  3DM3 A;  2CCZ A;  3I4N H;  2OWO A;  1BBU A;  3T1H Q;  3GTP H;  4GNX A;  4DV6 Q;  1I5F A;  1PH4 A;  3HKS A;  5ELO A;  2VQE Q;  4J15 A;  1SMX A;  2UUC L;  1GKH A;  1J5E Q;  4OO1 I;  4JI1 Q;  2E2I H;  1SE8 A;  3FKI G;  2I5M X;  3CP0 A;  1EIF A;  1UE7 A;  1WI5 A;  4HJ5 A;  4QJF A;  4AQY Q;  4KHP Q;  4LWC A;  1VQJ A;  2KBN A;  3F8T A;  4POG A;  4X62 Q;  3HOY G;  1JJG A;  1EQR A;  1C7Y A;  3HOZ H;  2ZJR A;  1Z9F A;  4R4T A;  4TVA B;  4B3M L;  2JEA I;  1N36 Q;  3PSI A;  4DR2 Q;  3M4O H;  3H15 A;  1TWC H;  1N33 L;  1FVI A;  3T1Y Q;  1X3E A;  2ASB A;  5IY0 A;  1YI2 A;  2PQA A;  3NEN A;  3S1N H;  4IFD I;  1N9W A;  3W1B A;  4ALP A;  3MXN B;  4DR5 L;  1L1O A;  2UUB L;  3OTO Q;  4BBR G;  1AE3 A;  1IBL L;  2MQH A;  4LFB L;  2JA9 A;  3EN2 A;  2E5L L;  3OYY A;  1NMG A;  2CFM A;  2D0O A;  3I4M G;  1E1T A;  1PH9 A;  2R7Z G;  1U0L A;  3PF5 A;  4OXP A;  1XMO L;  4JI2 L;  1XPR A;  4DR6 L;  4PZ8 A;  1NMF A;  2NVT H;  4BBS G;  3GTO H;  3KF8 B;  4X65 L;  1XJV A;  3HOX H;  4BY7 G;  1YIT A;  1V1Q A;  1IXR A;  1DGS A;  3I56 A;  2OQ0 A;  3J7A 5;  4DR6 Q;  2BA0 A;  4BXX H;  2NVQ H;  1HZA A;  2ZTC A;  3KOJ A;  2UUC Q;  3G71 A;  4A3K G;  1QZG A;  3GTL H;  5JEA G;  3KJP A;  1MIU A;  4R4O A;  4A3E G;  3A0J A;  5IWA Q;  1VQ7 A;  4DR7 Q;  4R1J A;  3ULL A;  3CQZ H;  4DV5 Q;  1EIY B;  3U4Z A;  4HJ9 A;  4QQB X;  4YWM A;  1OXU A;  4QIW E;  2HHH L;  4A3D G;  1Z47 A; 
#chains in the Genus database with same CATH topology
 3NBI A;  4BXX G;  1NE3 A;  1UNS A;  2F0L A;  4IFD J;  1YVC A;  3HOX G;  2C5C A;  3WWV A;  2AWO A;  1Y69 U;  1KD1 C;  2MNA A;  1JWS D;  2PW7 A;  5I6W A;  4LFA L;  1HNZ Q;  1HNW Q;  3CAM A;  4C3I H;  3RLN A;  1IBK L;  2F0T A;  4LF6 L;  1U4L A;  1BCP C;  3K5N A;  2ICE C;  3VYU A;  3TP7 A;  3SXH A;  2AMC B;  3HOY B;  1KIX A;  4DKA C;  1E2W A;  2ZT9 C;  3MVV A;  1SDF A;  4WJ3 M;  1LT5 D;  3KLW A;  4DR2 L;  3IL8 A;  3W2D A;  1LTS D;  1DD2 A;  3RN2 A;  2A6E C;  1Q46 A;  2FIN B;  2PZU A;  4A3G H;  2F0N A;  1VMP A;  5T1I A;  1FL0 A;  5FLM G;  3HOV H;  1YNJ D;  1E2V A;  1KDA A;  2BE5 D;  5TSS A;  3L7Z C;  5NUC A;  3R8B A;  1ESF A;  1M4V A;  1IBM L;  3H0G B;  1M8A A;  1Y14 B;  2Q2I A;  2K5N A;  3AQQ A;  4RH6 A;  5JEA H;  3KJO A;  3S16 B;  2RSO A;  5KNB A;  1SSO A;  3J81 j;  2KHS A;  1AEX A;  4FVM A;  4DK6 C;  3J80 E;  3NSW A;  1K3R A;  5KYL A;  4GOP A;  1D1I A;  3OWF A;  4EQO A;  4NXM Q;  2G9H D;  2E2H B;  1GUW A;  3K0X A;  4JC0 A;  1P8L A;  4DV7 Q;  5K36 G;  1TXY A;  3UE1 A;  5C44 G;  1GJX A;  1CM9 A;  1RTN A;  4DNI A;  2HCC A;  5BR8 Q;  1EY9 A;  3CCQ A;  4YHH Q;  3OTO L;  1OO9 B;  4PMC A;  3HS0 C;  2K33 A;  3GTG B;  5GAD C;  5EGT A;  2VY3 A;  2F0H A;  4DFA A;  1PH7 A;  1B9M A;  1PTO D;  2ICI A;  2B63 B;  1LYL A;  2VUM G;  2R7Z B;  5C3X A;  5D14 A;  2R7D A;  2PW5 A;  4OHJ A;  4BA2 I;  3N52 A;  4XTC S;  5IT9 c;  4XQN A;  1A2U A;  1VMC A;  3HKZ E;  3GD7 A;  1WTW A;  3T53 B;  1MI2 A;  3TQY A;  3SK8 A;  2O2L D;  3IFD A;  2F03 A;  1VQ4 A;  3ERO A;  4JI1 L;  5J3B A;  2AQ2 B;  2VB3 X;  2YYZ A;  4E6I A;  2IX1 A;  2VQE L;  4QGU A;  2SNM A;  1HJP A;  2VUM H;  5IP9 H;  4BBR H;  1AZP A;  1QIL A;  3I3C A;  4DV5 L;  1A8V A;  2O5J C;  2DY8 A;  1ZKO A;  2JJQ A;  2XTI A;  2JE6 I;  5ELB A;  4F8M A;  2DGY A;  5I9O A;  3EA6 A;  2IX3 A;  2HDL A;  1N32 L;  1IHZ A;  2PQA B;  4P72 A;  1A62 A;  3IRB A;  1DJR D;  2I5H A;  4JI7 L;  4A93 B;  4QL5 A;  4JI8 L;  3RLO A;  4Q0F A;  2UXC L;  2TMP A;  3FPU B;  1WD0 A;  4A3J G;  4DUY Q;  2UUA Q;  1E0B A;  4KI0 A;  4DXG A;  2UXB L;  4X3U A;  2K7V A;  2L5T A;  2A6E D;  5C4X H;  3S1M B;  2Z6K C;  2B2T A;  2K14 A;  3Q24 A;  2NB0 A;  4LF9 L;  3SDZ A;  2ZJP A;  4B3R L;  3VYS A;  3P75 A;  2Q8I B;  1CQF A;  2DJG C;  4YCU A;  3M3Y H;  1N36 L;  4XXE A;  3Q6S A;  1AFP A;  4WFN 3;  5C0X G;  1WOC A;  1S5E D;  2ALY B;  4H7B A;  2JEB I;  4P71 A;  3CCM A;  4BA1 I;  3CCJ A;  1CSP A;  3G6E A;  5FLX L;  1SE4 A;  2WAQ B;  1C4Q A;  1CFM A;  3M4P A;  3SR1 A;  4EGV A;  4RGN A;  4LAA A;  1B70 B;  2G5D A;  3K5L A;  2ATW A;  1L1O C;  4MTN A;  2EJF C;  1G29 1;  3F1Z A;  1XXG A;  2GVA A;  1B2T A;  1STY A;  1U4R A;  3HZX A;  3BS1 A;  4MNO A;  1W6K A;  1SNM A;  2R92 B;  2ZXO A;  4WJ4 A;  1YHA A;  5IGG A;  1LUZ A;  4KKT A;  1CZG A;  1SMY D;  4HCS A;  5ELC A;  4DUY L;  1Y1W H;  1TWC B;  5G3L D;  1R4Q B;  4ZK9 B;  4NKL A;  2Q8R E;  2CWP A;  2O5I C;  5I9P A;  2HCI A;  1CA5 A;  1E3P A;  4DUZ Q;  2NVY H;  1HQM C;  4DV4 Q;  1LTG D;  2BDN A;  1WFQ A;  5KYI A;  2E2H H;  1B50 A;  1GO3 E;  1NCV A;  3JAM L;  1YJ9 A;  1N32 Q;  5D3I B;  3H0G G;  5JJI A;  3NWS A;  1VF7 A;  2IHE A;  1S5B D;  3PF4 A;  2XWJ B;  1QUQ B;  5EKI A;  1I6H H;  2Z0S A;  1ROD A;  3I91 A;  2QCP X;  1MSG A;  4L5T A;  2L55 A;  3ULJ A;  3RD4 A;  3DEO A;  1F9R A;  4HJA A;  1Q12 A;  3I4O A;  1OXX K;  3S2H B;  1PH3 A;  1Y1V B;  1CI3 M;  3D0F A;  4C2M B;  2ZXP A;  3J80 i;  3ZJY C;  3I4N B;  2M9V A;  3TRE A;  4OX9 Q;  1STB A;  1FYC A;  3PO3 H;  5IT9 L;  2WAC A;  5C44 B;  1DYQ A;  5JPN C;  5IYB G;  2IW3 A;  4GS3 A;  2K4K A;  1X9N A;  3KBG A;  1HNX Q;  4DR1 Q;  4GKJ L;  2A1A A;  1VQD A;  4CGY B;  1WCM B;  2F0P A;  1KLG D;  5JJZ A;  3WOF A;  1SYC A;  4GN3 B;  1E1O A;  3HKZ G;  1DM0 B;  1UWV A;  2QDL A;  4JI0 L;  2X69 A;  3PGZ A;  5E3F A;  2EYM A;  2LSS A;  3RZO H;  4FXG C;  1YHB A;  1YNN C;  3NBH B;  3M7G A;  3TN2 A;  1TWG H;  1V1P B;  3U50 C;  4X62 L;  1HUN A;  1N34 Q;  3S15 H;  4X65 Q;  2PNH A;  5DM6 3;  1CQV A;  4K6D A;  1CKN A;  1LT4 D;  1SYG A;  4QMG A;  2SOB A;  1LT6 D;  1O7I A;  3FKI H;  1G8Z D;  2PI2 E;  4CJ1 B;  1IBL Q;  2OTL A;  2JA6 G;  2K04 A;  2ES2 A;  2JK8 A;  4A3I G;  2MUY A;  4C3H B;  3CRK C;  1BCP F;  3T13 A;  1SE3 A;  4XQQ A;  1K8M A;  2R93 B;  2EDG A;  4A3D B;  2RHS B;  3BYT B;  3HOV B;  1FNW A;  2A73 B;  2B29 A;  4B3T L;  4K2K A;  4YY3 Q;  5M3F B;  5M3M G;  1G2S A;  2H4O A;  4YY3 L;  2B2Y A;  2JA7 H;  1QVG A;  1UE5 A;  4N8F A;  1I94 Q;  4QY7 A;  1IW7 C;  1LO5 D;  4N8X 1;  1BVS A;  4OO1 H;  4JW0 A;  3U58 A;  3K6O A;  5C5L A;  1Z6H A;  4X66 L;  3S2H H;  4JI3 L;  4BY7 B;  3EBE A;  1VDZ A;  2RQX A;  5ELF A;  2IWH A;  3H3V H;  1E22 A;  2YU9 H;  1I94 L;  1HR0 L;  2MP1 A;  3TME A;  2F0W A;  5IE8 A;  3OHX C;  3J80 L;  3TRZ A;  5COY A;  1VQM A;  3QJY A;  3JAM c;  4JYA L;  1LAB A;  4RMF A;  3K80 C;  5CV4 A;  4Y52 H;  3DUZ A;  4PG3 A;  3J7Y W;  1JE4 A;  2CVR A;  3OMG A;  1BNZ A;  1ENF A;  3SE0 A;  1VQL A;  1CK1 A;  1Q1E A;  2WAQ G;  1HR0 Q;  2ZM6 L;  3MWY W;  4DV1 Q;  3MXN A;  2JXM B;  2GVB A;  2EYJ A;  2F0E A;  3DWP A;  1AH9 A;  2F0Q A;  2JA8 B;  4XIG S;  3F2D A;  2CH4 A;  5I4D A;  2OWO A;  4I7A A;  4RGM A;  4C3J G;  3A56 A;  3FKI B;  1SE8 A;  3S1N B;  4ABN A;  1II3 A;  1EIF A;  4J8Q A;  2Z4I A;  3UI2 A;  4HMJ A;  1SNC A;  2K32 A;  1YNN D;  2A6H C;  4POG A;  3EQL C;  4NW2 A;  3HOZ H;  4L63 B;  1Z9F A;  5IGB A;  3MAQ A;  1N33 L;  2ASB A;  4DK1 A;  1YI2 A;  4PQX A;  1N9W A;  4ALP A;  1STN A;  4DR5 L;  1STH A;  3HOW B;  4KN7 C;  1QJO A;  1IBL L;  2MQH A;  4BBR B;  4ZCK A;  2E5L L;  3OYY A;  1RTO A;  2D0O A;  3I4M G;  4JI2 L;  2VUM B;  4C56 C;  3HEJ A;  4TRD A;  3GTO H;  3NP8 A;  1HFG A;  4X65 L;  2PZW A;  1V1Q A;  1IXR A;  1V1P A;  1DGS A;  3I56 A;  1EQT A;  2M2L A;  4M8A A;  5FO9 B;  1NAP A;  5E1F A;  2L11 A;  2ZTC A;  2WB1 B;  1MSH A;  3D8G A;  3GTL H;  3S1Q B;  4A3E B;  2WIN B;  4R4O A;  3A0J A;  5IWA Q;  2E75 C;  1R9T B;  3ULL A;  3WDN A;  3KUP A;  3CQZ H;  4HJ9 A;  4CKB A;  3S1R B;  1GHJ A;  4YWM A;  5C3W A;  1V1O A;  1HZC A;  2XRS D;  3CC2 A;  4R8I A;  1I4Q A;  3H09 A;  1Q86 C;  1PA6 A;  2R3Z A;  1SN8 A;  2YTY A;  4DV4 L;  1K3B C;  5A2Q L;  1BDO A;  1D5Z C;  3OW2 A;  2N49 A;  2HIX A;  4YWK A;  1TY0 A;  2B2U C;  1ZYR D;  3I55 A;  1CUK A;  4N9T A;  3KF6 B;  3R2T A;  2RKS A;  1D5X C;  3L0O A;  4GNX C;  5DNF A;  3NTI A;  4XT1 B;  1EQQ A;  2NBF A;  2XRQ D;  4DR5 Q;  1EY5 A;  2QKI C;  1JJC B;  1MBY A;  4A3M B;  4H13 C;  1BCP B;  3K7U C;  2KEE A;  2R93 G;  2EYL A;  1I4P A;  1S72 A;  5C44 H;  4KJN A;  2F0K A;  4DAM A;  3J80 c;  4K8J A;  1EY4 A;  4KKS A;  5EBD A;  3BG3 A;  4A3K H;  4OX9 L;  2JA8 H;  2WP8 J;  5FLM H;  3GTK H;  1V8Q A;  1Y8O B;  4GLX A;  4DNT B;  1JB3 A;  4IUT A;  5EPL A;  1PH1 A;  3HKZ B;  4N9P A;  4BBS H;  2F0G A;  2RCN A;  3DWA A;  5J22 A;  2E5L Q;  1PV4 A;  2CKZ B;  4DAY B;  3HOX B;  1EZ6 A;  4LUZ A;  1BQQ T;  2LS0 1;  4IOA A;  1EEI D;  4DPG A;  2F0U A;  1PH8 A;  1JWU D;  4UP7 A;  2QGQ A;  2B2V C;  3BDC A;  1N33 Q;  1PHJ A;  2L15 A;  1Q81 C;  1VQB A;  4A3G G;  2NWG A;  4CDF C;  3A74 A;  3VR3 A;  1NR2 A;  4C3I G;  3NXW A;  4JI6 Q;  3S1R H;  3W3A A;  3BDL A;  2EPB A;  2IL8 A;  3STB C;  1B9N A;  3DLL A;  3PUW A;  4A3B G;  2NZ1 D;  4DV3 Q;  4B08 A;  2EY2 A;  1FR3 A;  4LF9 Q;  3K59 A;  3BU2 A;  2EY5 A;  5M3F G;  1X32 A;  1HTP A;  1PVO A;  2QW7 A;  1EL0 A;  1HRJ A;  1SYE A;  2B63 G;  4DV1 L;  4A93 H;  5HGQ A;  4V19 0;  1VF5 C;  4RKL A;  3MA2 B;  3E3X A;  3L3O C;  1WD1 A;  1TQO A;  1XNR Q;  1S4Z A;  3GV3 A;  4C3H H;  4LW1 A;  2Y0S B;  4JI4 L;  2BE5 C;  1PTO F;  1TS5 A;  1JOQ A;  4JI4 Q;  1WTQ A;  1NNX A;  4NMZ A;  4A3D H;  1F2Z A;  4LNQ A;  1DZ1 A;  4MIU A;  3U4V A;  5EPJ A;  2RDH A;  4O0A A;  1TWF B;  3S2D H;  1HXY D;  2A68 C;  4JK1 C;  3RR5 A;  2L12 A;  2KEC A;  5KRU A;  1X55 A;  1W2B A;  5BR8 L;  4QUC A;  4APV A;  1JIC A;  2WV6 D;  1Q3L A;  1T9H A;  3S14 B;  4OWW B;  1D7Q A;  1SFO H;  5ELN A;  3KLR A;  4GOP C;  1TWF H;  3HOZ G;  3VR4 A;  1WTV A;  2JA5 H;  1DXM A;  5CV7 A;  4L5S A;  2QIL A;  4A3C G;  3VYR A;  3L9A X;  3OWE B;  1F9Q A;  3AFQ A;  3GTJ B;  3ERQ A;  1QCB D;  1K0R A;  3BDO A;  3MXU A;  2UXD L;  2VL6 A;  1VQP A;  1JQY D;  1TT2 A;  2A68 D;  4IOC A;  3GV6 A;  2EYF A;  4GZY C;  2HUG A;  1IBK Q;  5DM7 3;  1S3O A;  1SNP A;  2QA4 A;  2A74 C;  4O42 A;  3O13 A;  3CC7 A;  1I50 B;  3S16 H;  1ET6 A;  2OCE A;  3HOW G;  3TBI B;  4K2L A;  1SYB A;  1U9R A;  2QEX A;  5M5W B;  4FDB A;  3R2I A;  3M4Q A;  5I2X A;  4RA8 A;  2F0V A;  1HZB A;  1H9M A;  2F0M A;  3NK9 A;  5GRO A;  3VR6 A;  3M3Y B;  5C4X G;  1EU3 A;  5I6Y A;  2LMC B;  1LTB D;  2MPM A;  3SEB A;  4RCN A;  1GUG A;  2JA7 B;  4IAL A;  4CDC C;  4UAI A;  4DV3 L;  5LMN W;  3FMC A;  1I4X A;  2VQF Q;  4DAP A;  4B3M Q;  4PMW A;  4X64 L;  2Y0S E;  4K5X A;  4BS9 A;  3CPW A;  4GOP B;  2I5L X;  4JV5 Q;  2K5D A;  4DR3 Q;  1PRT C;  4YCW A;  2K01 A;  5LL6 S;  1HZ9 A;  1HPC A;  1KNA A;  2EJM A;  4ZUJ A;  2KCM A;  2KOL A;  1ICF B;  4C3J H;  4JBK A;  1O78 A;  4XYQ A;  4GLA C;  3C3L A;  4A75 A;  3HP3 A;  1S5D D;  2KVM A;  3ZYY X;  2LXK A;  5IYC G;  3K57 A;  5C4Z A;  5FJ8 G;  1SMY C;  4LMQ D;  4FNF A;  3ERS X;  1Q8K A;  1I6V C;  2MO1 A;  2F0J A;  3QR8 A;  4LF4 Q;  2XNA C;  4MTK A;  1RDP D;  2P5Z X;  4A3M G;  4IUV A;  3RZD B;  3GP7 A;  1FGB D;  1P16 A;  4GN4 B;  1SJH D;  3ND8 A;  4AIM A;  1G51 A;  3PIP 3;  4LF8 L;  1EWI A;  2R7Z H;  1NR4 A;  1XPO A;  3CCS A;  1PFS A;  4OON A;  4HIK A;  3BZK A;  3VYT A;  1JJ2 A;  4A3C H;  1IYJ B;  1EZ8 A;  2DNE A;  3T4A C;  4OIK A;  2FHT A;  4RWS C;  2SNS A;  1XMQ Q;  1C48 A;  4JI6 L;  5LHY 1;  3TS0 A;  2ID0 A;  5IGD A;  3OMC A;  1ZYR C;  2D0P A;  1SRO A;  2I0Q A;  4NP5 A;  1BR9 A;  3E5S A;  1C0A A;  2WB1 G;  3KDF B;  1A3T A;  2F0D A;  1L0W A;  3QWN A;  5K5P A;  1Y1V G;  4DK3 C;  1TWG B;  3I4N G;  3J7A F;  3ICE A;  3HOV G;  2A69 C;  1VS0 A;  5C3E H;  2JA6 H;  3BVZ A;  1VQ8 A;  4M1U B;  4B3S L;  4DR3 L;  1Z7T A;  2KEN A;  3PUV A;  3NUC A;  1PH6 A;  1RCV D;  3CW2 C;  1QNU A;  3M4Y A;  2R61 A;  1NJI C;  3RLF A;  1V43 A;  2CW0 C;  1J9O A;  2NN6 I;  3R3O A;  2B63 H;  4KK7 A;  5M5X H;  3QO2 A;  1XMO Q;  4DNR B;  4FF4 A;  4OEM B;  4DV0 L;  3VA5 A;  1DOK A;  2R7F A;  3OIP A;  1EWH A;  3M9B A;  3BJU A;  4HJ7 A;  2Y0S G;  2F3I A;  3Q22 A;  3I72 A;  2WB1 E;  2UXB Q;  1CKM A;  4BY1 B;  3GTQ B;  1SJE D;  3QB3 A;  3SK5 A;  5C4J B;  3AU7 A;  1ET9 A;  2IY5 B;  5K36 H;  1VQ5 A;  5FKA C;  1B4O A;  2AUJ D;  1WCM G;  3ONA B;  1MGS A;  2FFK B;  3PO3 G;  3PQI A;  3N6R A;  1PZK D;  2DY7 A;  1KQS A;  2R92 H;  2VS1 A;  5KND A;  4WRD A;  3AB9 A;  2G9D A;  4DAV A;  2LKV A;  2EXD A;  1HA6 A;  5IYC H;  3CXC A;  1FNV A;  3RZD H;  4B9X A;  5CYU A;  3HOZ B;  3DM3 A;  3I4N H;  3NQI A;  4KTA A;  1BBU A;  3LWE A;  3T1H Q;  3GTP H;  4GNX A;  1PH4 A;  1I5F A;  2UUC L;  1J5E Q;  4JI1 Q;  2E2I H;  1STG A;  1FNU A;  4C3H G;  2NVQ B;  1WI5 A;  4KHP Q;  4LWC A;  1KLU D;  2KBN A;  5A35 A;  5FOB B;  1JJG A;  3E0J A;  4B3M L;  2JEA I;  4TVA B;  1F2L A;  2N55 A;  3FPP A;  4DR2 Q;  3M4O H;  3H15 A;  1JOO A;  5D65 A;  1FVI A;  3T1Y Q;  1GOZ A;  1X3E A;  1HA5 A;  1EOT A;  3P20 A;  3MZ5 A;  1NUC A;  2NVY B;  1FD7 D;  3D3R A;  1EU4 A;  2CQA A;  5IGE A;  5F2D A;  3AMU A;  4BBR G;  4A3F B;  1NMG A;  2CFM A;  1E1T A;  1PH9 A;  1U0L A;  3FRP B;  3PF5 A;  1XMO L;  4DR6 L;  4S3S A;  1H9K A;  2AUK A;  1IL8 A;  4BY7 G;  2F4I A;  3K58 A;  1GUS A;  2BA0 A;  4CDD C;  1ML0 D;  3QIA A;  2UUC Q;  3G71 A;  2XVS A;  3D4W A;  3Q23 A;  1QZG A;  2JA6 B;  1SYD A;  3IAY A;  4DU9 A;  1Y8N B;  1MIU A;  1VQ7 A;  1HFN A;  4DR7 Q;  3G7L A;  2HD3 A;  1K0S A;  1OXU A;  3HOU G;  1Z47 A;  4DV0 Q;  1WTO A;  3AEV A;  1XNQ Q;  2XSC A;  4X3T A;  4IPH A;  1K8A C;  5T1G A;  4CJ0 B;  2XGT A;  3S1Q H;  2JA8 G;  3E0E A;  2KQ3 A;  4AQY L;  3TP6 A;  1R9T H;  3GQB A;  3GTG H;  1A2T A;  1RL2 A;  2YTX A;  3PIO A;  5GAE C;  1C9O A;  4ZKB B;  2X6G A;  3S14 H;  2RSN A;  4JI0 Q;  2YTV A;  4LUV A;  1VQI A;  1Q90 A;  1HCZ A;  2D2C C;  2WKD A;  1UEB A;  2K5Q A;  2PQE A;  4LFC Q;  4XDX A;  1BUV T;  3URY A;  4KY5 A;  4JVZ A;  4AH6 A;  3PO2 G;  1SLJ A;  2DUD A;  4DR1 L;  1GVP A;  2HQL A;  3CCL A;  1Q82 C;  5IP9 G;  3CMA A;  4LF8 Q;  4NXN Q;  2CQO A;  2EE1 A;  4XYO A;  2D5D A;  1EYA A;  1SYF A;  5IGC A;  2RDF A;  4JI5 L;  1AN8 A;  3S1M H;  4DV2 Q;  1A3U A;  2KED A;  2E2J B;  5HGT A;  2A5H A;  2KUM A;  4P74 A;  3X3N A;  3H3V C;  3STB D;  5LMU L;  3E9H A;  3PIP A;  1ENA A;  1KDC A;  2NZO A;  3A55 A;  3KK7 A;  2WFW A;  1G91 A;  4R4I A;  1PDQ A;  5ISR A;  5HUR A;  4QCL A;  4A93 G;  2F0O A;  4EVO A;  3S17 H;  4GN5 A;  3AFP A;  1SR3 A;  3L2P A;  2B2W A;  1M90 C;  4G7O C;  4C3J B;  5KIX A;  5CV9 A;  4BY7 H;  3CME A;  5G3L F;  2JSO A;  4KHZ A;  1OXS C;  2ZTD A;  3SK4 A;  4JI7 Q;  1HH2 P;  5J39 A;  3GO5 A;  2JP1 A;  4HJ8 A;  3X3M A;  1WTP A;  4JBW A;  3KFU A;  1YHQ A;  4K5V A;  5C3E B;  2B2U A;  5IT9 E;  4OIJ A;  2Z9H A;  4RAU C;  3OOC A;  2RCF A;  3RUZ A;  1K73 C;  1PH2 A;  5D3D A;  2K5W A;  2RDG A;  1G2T A;  3NTH A;  2IJ0 A;  5LMU Q;  4R9W A;  3I4M B;  3FEW X;  2KCC A;  1Q8I A;  2B39 A;  4HSP A;  2L9H A;  1RD9 D;  1LTT D;  5CBA E;  4DA2 A;  1DCZ A;  4GKK L;  3E9I A;  3GTJ H;  3MXP A;  3PUZ A;  4U67 3;  4IFD G;  1SXT A;  2MHV A;  3BVM A;  1YJN A;  4PMB A;  2JN4 A;  4Y7N H;  1BF4 A;  2IX0 A;  1NTG A;  2RVL A;  1YZ6 A;  2JQO A;  2C35 B;  4BWG B;  3FHW A;  1EYG A;  1VQ9 A;  1S5F D;  3U9O A;  5FLX E;  4C3I B;  1X3F A;  1I3Q H;  4JCV E;  1E24 A;  1E2Z A;  3PUY A;  4EQ5 A;  2BCO A;  4QUF A;  2UUA L;  1F9S A;  1I4G A;  5KNC A;  4P75 A;  4WJW A;  3A5Z B;  3UDG A;  1M1K C;  1WCM H;  5M5X B;  4UPA A;  3S2D B;  1ASZ A;  4DV7 L;  3RN5 A;  4CBV A;  2EOT A;  4JOI A;  2RHQ B;  4KV6 A;  3RMH A;  1C8C A;  3HOY H;  3PCO B;  1UE1 A;  2V1C C;  3CQZ B;  3OSO A;  4IJL A;  3SGI A;  4X64 Q;  1XNQ L;  1EUJ A;  2D62 A;  2PO4 A;  5JOB A;  2TSS A;  2Q2U A;  2E76 C;  2F0F A;  1WTR A;  4NXN L;  1UE6 A;  1DOL A;  3DWQ A;  5EJW A;  1K9M C;  1LTR D;  4OO1 G;  1HQR D;  1GM5 A;  1W3S A;  1H9R A;  1PTO H;  2A19 A;  1TS4 A;  1CTM A;  1JC7 A;  5EKK A;  4A3E H;  4K5W A;  2I07 B;  2WII B;  3W1G A;  1U4M A;  2BH2 A;  1R4P B;  4UDU C;  4G57 A;  4LF5 L;  5CV6 A;  3V96 A;  3A5U A;  2GN5 A;  2NTS A;  1ILQ A;  4HR7 B;  1KL9 A;  2SEB D;  2K5V A;  1UEA B;  4JBJ A;  5JJK A;  1KHI A;  2R6G A;  3FDT A;  1SFO B;  1J5E L;  1B3Q A;  1TS2 A;  2Z1C A;  1V9P A;  2B2V A;  4L6T B;  1G6Z A;  3G4S A;  1CHQ D;  3K0Y A;  5ELE A;  4R4C A;  1AZQ A;  4X66 Q;  3RZO B;  1MJE A;  1XX8 A;  1B1Z A;  3K81 C;  3QG1 A;  2AKW B;  3I8Z A;  1QZH A;  4FXK C;  1N8R C;  1W6J A;  1EEF D;  1TS3 A;  2PMZ E;  2PYK A;  3KDF A;  2EVB A;  1T5E A;  1LTL A;  5JAV A;  2MO0 A;  3ER0 A;  3W5O A;  2H1E A;  1XNR L;  4TQU S;  1KC8 C;  5IYD G;  4UHV A;  2DNC A;  1JWM D;  4ULL A;  2E2I B;  4YWL A;  1U4P A;  1GHK A;  3MEF A;  1VQ6 A;  3MEH A;  2BH8 A;  1L1O B;  3D4D A;  2J0T D;  3CU7 A;  1RKN A;  1LTA D;  1Y8P B;  1NBW A;  1YJW A;  4IPC A;  1J6Q A;  3MTS A;  1B8A A;  4PV1 C;  5E4W C;  1TR5 A;  4RG1 A;  5M5Y H;  4IUN A;  1KXL A;  2KCT A;  2ZM6 Q;  2E2D C;  4Y7N B;  2MGS A;  2PCF B;  5GAG C;  4JBM A;  1FJG L;  5M9O A;  1XPU A;  2KHJ A;  3NEM A;  4P2C B;  3DMU A;  2N8N A;  1EWC A;  2DN8 A;  1YBY A;  4DR4 Q;  2VNU D;  1JCK B;  2K1B A;  4ZKC B;  1VQH A;  5M5Y B;  1LM0 A;  5CGK A;  4ZRZ A;  2K5H A;  4DV6 L;  1XTC D;  2K03 A;  1Q7Y C;  2KHI A;  5E4X A;  5LL6 X;  2C9O A;  4UP9 A;  4FP5 D;  2IHF A;  3H6M A;  3I90 A;  5DLQ E;  2N78 A;  1ONL A;  3GDE A;  4ODG A;  2EXZ A;  4LF6 Q;  1Q1B A;  4A3F G;  5EBC A;  5DEH A;  1S40 A;  4MHE A;  5LMN L;  4AYB B;  1PFN A;  5C4X B;  1U5K A;  2IPK D;  2PI2 A;  2NTT A;  2JA7 G;  1BBW A;  1IKL A;  3SK6 A;  3MFG A;  2BDO A;  3K8A A;  2K52 A;  1VQC A;  5C0X J;  5ELD A;  2L1B A;  2L0C A;  2CHB D;  5CR3 A;  1GUN A;  4A3L H;  3IKJ A;  4HCE A;  1CA6 A;  1KDB A;  1VQA A;  3S15 B;  2L4N A;  1CSQ A;  2NN6 H;  4NB3 A;  4OL7 A;  3A54 A;  1CZW A;  3P7J A;  1RHP A;  1EY7 A;  1QUQ A;  1TY2 A;  4LFA Q;  4KY7 A;  2JA5 G;  5FJ8 H;  4FXD A;  4JI2 Q;  3J81 c;  4CHT B;  3D6W A;  4TKO B;  4C1N K;  3JAM E;  3QOL A;  4GNX B;  4K0K L;  3NHH A;  1H95 A;  5C0X I;  3T56 B;  4K0K Q;  4KLK A;  2F0I A;  3DXJ C;  4LFC L;  1EOV A;  2Z4H A;  5IYD H;  1D5M C;  1BOS A;  1VQG A;  2ZXR A;  5CC4 A;  2WAQ E;  1VQE A;  3UE0 A;  5FO8 B;  4ZLT F;  3LWU A;  2EY6 A;  4F88 A;  4B3S Q;  4POF A;  4BY1 H;  2B2W C;  4A76 A;  3A8J E;  1TVX A;  2NVX H;  4OWX B;  2E8G A;  4HTH A;  1CKO A;  4HN7 A;  5CV5 A;  2PNR C;  4RKB A;  4YCV A;  3TP8 A;  3CCU A;  4ZAI A;  5IWA L;  1KTK A;  4U68 A;  3G6J B;  2B8F A;  4DV6 Q;  2JYO A;  2VQE Q;  4J15 A;  2DJF C;  4OO1 I;  2I5M X;  3TDQ A;  4AQY Q;  1ICW A;  4A3I B;  3T51 B;  1LLR D;  3HOY G;  1STE A;  1C7Y A;  4CKE A;  3V05 A;  3WOE A;  5CBE E;  2ZJR A;  1N36 Q;  2XIW A;  1PYW D;  5A2Q E;  4YIJ A;  1H9J A;  4ILW A;  2HQE A;  4Q5V A;  4QB4 A;  4CJ2 C;  3TZU A;  4EQP A;  5M3M B;  4J6H A;  3OTO Q;  1AE3 A;  2QDB A;  4IUP A;  3EN2 A;  2R7Z G;  2K6A A;  4OXP A;  1ESR A;  1K83 B;  4PZ8 A;  3KF8 B;  1XJV A;  2AQ1 B;  3HOX H;  1YIT A;  4IFD H;  1UAP A;  4IUU A;  2OQ0 A;  5IOC A;  3J7A 5;  3GTM B;  3BZD B;  4DR6 Q;  1PZJ D;  4BXX H;  2EZV A;  2NVQ H;  3KOJ A;  2XN9 C;  1UUP A;  2FJ2 A;  3KJP A;  3K5M A;  2K28 A;  3K5O A;  4R1J A;  2NVT B;  1EIY B;  4HSV A;  4QIW E;  5FK9 C;  4YHH L;  2HHH L;  3PO2 H;  3I4L A;  4QF4 A;  3T1Y L;  3G48 A;  3NE5 B;  4KD3 A;  3GTM H;  1WVL A;  2CWA A;  3BZC A;  2MFI A;  4JI8 Q;  4X6A H;  1PYB A;  1EFI D;  5GAH C;  4JV5 L;  1PYS B;  3J81 L;  1B53 A;  5EPK A;  3ITP A;  4OGQ C;  1BBX C;  2BA1 A;  5LMN Q;  3S17 B;  5BN4 A;  4G7H C;  2Q2H A;  1H9S B;  1O7L A;  2PPB C;  3A8I E;  1X54 A;  1VCI A;  4IO9 A;  2EJG C;  1Y1W G;  2HT1 A;  3U9S A;  2NZH A;  4B9W A;  1QE6 A;  3HFZ B;  3F2B A;  2HIV A;  2ZTE A;  1EYD A;  3HOU H;  4A3B H;  4HIM A;  4HED A;  3VDY A;  4ZUI A;  5JVH 3;  3CRL C;  1J8I A;  3VA7 A;  3FP9 A;  1PLF A;  4IJH A;  1QG7 A;  5JEA J;  3CKI B;  2F3W A;  3EJI A;  3H91 A;  1LV9 A;  2F3V A;  2B8G A;  2N3S A;  5EQ0 A;  4L5R C;  1SRU A;  3PMF A;  4XQJ A;  1EFW A;  3HOW H;  4JYA Q;  1SNQ A;  1N34 L;  1MJC A;  4RGO S;  4MN3 A;  4I65 A;  1LT3 D;  4KHP L;  4LF5 Q;  2Z6B A;  3HOU B;  3TZD A;  3LGJ A;  3TSS A;  4UP8 A;  1QOH A;  2NN6 G;  1X6O A;  1SEB D;  4K6L A;  1MD2 D;  1F2Y A;  1RJT A;  1B44 D;  2FMM A;  3EFX D;  3CC4 A;  3GTO B;  1X3P A;  3NBH A;  4KKU A;  4JI3 Q;  1PH5 A;  1I50 H;  5AFW A;  1O80 A;  2J7Z A;  5J1Z A;  3JAM i;  3HGB A;  2UU9 Q;  4FO2 A;  3F2U A;  3M7N A;  1L0Y B;  3Q0A A;  3LNN A;  1G6P A;  4RHR A;  1KRS A;  2AWN A;  4MZ9 A;  1YEZ A;  2ENB A;  1PRT B;  1NY4 A;  4UY8 C;  2D9U A;  1SNO A;  3UDX A;  2BOS A;  4R4Q A;  5AJ3 Q;  1YNJ C;  2F52 A;  3NEL A;  3PIO 3;  1A63 A;  3TS2 A;  5BN5 A;  1HHV A;  3M85 A;  1MKH A;  4H44 C;  5DAU A;  2V4D A;  1KRT A;  1KNE A;  5IOD A;  4HID A;  1IBM Q;  4L8J A;  2EY1 A;  1QB5 D;  1KAA A;  2O4X A;  4BBS B;  2VZA A;  3VR2 A;  2X6L A;  3J81 i;  4K14 A;  3PO2 B;  3CPF A;  4OEL B;  4ZYS A;  4F87 A;  1I3Q B;  1JOR A;  3PV0 A;  3E6Z X;  3H3V I;  2I46 A;  4C1N I;  3DHQ A;  4DF7 A;  1QNK A;  3OW7 A;  5JPM C;  2UUB Q;  3UDI A;  5KEE A;  2RF4 A;  3T16 A;  1TII D;  4G7Z C;  1KAW A;  4LF7 L;  1IYV A;  5M3F H;  3I7F A;  2SDF A;  3D4R A;  1HNX L;  4GKJ Q;  1F2M A;  3I70 A;  4K8I A;  4P73 A;  2EQS A;  2FMC A;  5EKL A;  4KY6 A;  3C1E A;  1HNZ L;  1HNW L;  4L5Q A;  4O1N A;  1CKN B;  2F0S A;  1B7Y B;  3CCE A;  5JJL A;  1CHP D;  1PZI D;  1VQN A;  1X3G A;  4A3F H;  4CDE C;  2OQK A;  2NUC A;  2Z6K A;  2LY7 A;  2EYO A;  2IT1 A;  3LX0 A;  2NYZ D;  1GD7 A;  4OWT B;  3D6C A;  2K75 A;  3S9W A;  3AYH B;  2B3G A;  3MC0 B;  2K50 A;  1HTL D;  5JVG 3;  1A0I A;  2CW0 D;  1JB7 A;  5M5W H;  1OXT A;  2M00 A;  4ME3 A;  1RF2 D;  1X56 A;  4I7Z C;  2A8V A;  1F9P A;  3JC6 6;  4NDX A;  4A3B B;  1DON A;  3P1H A;  2RBM A;  4DUZ L;  3H94 A;  4DR4 L;  1WYD A;  1IL2 A;  1ZXT A;  3EIV A;  5C5M A;  3CCR A;  2EYH A;  1AP0 A;  3B6Y A;  2A69 D;  4LF4 L;  3EVQ A;  1JMC A;  3A7A B;  1JT8 A;  4DV2 L;  1H9S A;  4H02 A;  1VQO A;  1KAB A;  5COR A;  2EIF A;  4PZ7 A;  4JG2 A;  1TKW B;  5C6A A;  1OXV A;  2UU9 L;  1CT1 D;  1D1K A;  3RNU A;  1Y1W B;  5E7N A;  4DK0 A;  4IUR A;  1EYC A;  4LF7 Q;  3KF6 A;  4A3I H;  3FVQ A;  1I4R A;  1LAC A;  2OF1 A;  1EIG A;  5IGF A;  2R92 G;  1WJJ A;  3CD6 A;  5AJ3 L;  1K8G A;  1E7Z A;  1JE5 A;  4KN4 C;  5IP7 H;  1A6X A;  1IW7 D;  1IYU A;  1GUO A;  5EAY A;  1X65 A;  4GLV B;  1S5C D;  3KYH C;  4AYB E;  1IZ6 A;  3TEH B;  1I6H B;  1FJG Q;  2AHO B;  5C4J H;  1PMR A;  4V0B A;  2YV5 A;  4JOI C;  3J7A V;  3KLS X;  2VQF L;  2J4X A;  5C3E G;  4B3R Q;  1MHW C;  4C2M H;  4DXF A;  2HHH Q;  5H1S E;  2XWB B;  2UXD Q;  3NTK A;  4A4I A;  1K83 H;  3KF8 A;  1OTC A;  4KD4 A;  5IYB H;  2FXQ A;  1TU2 B;  3PUX A;  4WOR A;  3I73 A;  2WKC A;  1ASY A;  1B3A A;  3H0G H;  5M3M H;  2UXC Q;  5C4H A;  5FLX c;  3C2P A;  4FF2 A;  2F4V L;  4KHV A;  4NPS A;  4BY1 G;  4JI5 Q;  1TWA B;  3ULP A;  2GA4 B;  4HAE A;  2B2T C;  1AW7 A;  5BN3 A;  3R93 A;  1YNX A;  4Z9C B;  2E74 C;  3CF5 A;  4A3K B;  1BKB A;  3I4M H;  4PZ6 A;  1Y1V H;  1XTD A;  4RHS A;  4QIW B;  1TWH H;  2OXP A;  4IQZ A;  1RIP A;  2K05 A;  1EY0 A;  4RFB A;  1A3V A;  3K7A H;  3C46 A;  5CV8 A;  1EQV A;  2OTJ A;  1VQK A;  1IKM A;  4DAY A;  3BYY B;  4LJZ C;  3I2Z A;  3KBX A;  5IP7 G;  2PMZ B;  3NQT A;  4J1M A;  5CMD A;  2OT2 A;  1SND A;  1L0X B;  1K8O A;  1PFB A;  3OIQ A;  2PZT A;  1QVC A;  3J81 E;  4F7X A;  4LK1 C;  2Q2T A;  4EQN A;  2AQ3 B;  3HRZ C;  3T1H L;  1WTH A;  2VB2 X;  4LUO A;  3CCV A;  1JOK A;  4X3S A;  1ENC A;  1A15 A;  1VQF A;  4DR7 L;  4X3K A;  1HR0 W;  2H5X A;  2VXW A;  2OEO A;  4TSS A;  4A3L G;  1YIJ A;  1SE2 A;  2LFN A;  3KLS A;  5GQO A;  3V2T A;  4A3M H;  2QEJ C;  5HY6 A;  1FGU A;  1WTX A;  2B2Y C;  1JR0 D;  4HMI A;  3F2C A;  3DEP A;  4KMU C;  3Q8D A;  4A3J H;  1GUT A;  1XWE A;  5C0X H;  3GTP B;  1PFM A;  1PTO C;  3A8K E;  1L2F A;  1QVF A;  4NXM L;  4ME5 A;  4IPD A;  1SBB B;  1TWH B;  3CHB D;  1QWY A;  4B3T Q;  2YU9 B;  4FYD A;  3GTK B;  3S24 A;  2R93 H;  2VW9 A;  4FF3 A;  4EX5 A;  1X3Q A;  3UDF A;  1AE2 A;  4AYB G;  4LFB Q;  2CH4 W;  3SHL A;  1D8L A;  1I4H A;  1T5X D;  3VR5 A;  3MHB A;  3M4O B;  4PNY A;  3J7Z C;  2NVX B;  1BCP D;  1STA A;  1D6E C;  3OPO A;  1BXT A;  1D2B A;  4ID6 A;  2EYP A;  2KCN A;  1DOM A;  2MJ8 A;  4JPB W;  4O2D A;  2F4V Q;  3K7A B;  1EY6 A;  4GKK Q;  4FF1 A;  1XMQ L;  1PXU A;  4DGZ A;  4HIO A;  4XT3 B;  3GTQ H;  1SAP A;  3D31 A;  4IPG A;  2E2J H;  2F1M A;  1EY8 A;  2ZJQ A;  1TWA H;  4H0L C;  3C1F A;  2LXJ A;  5IIF A;  2CCZ A;  2JA5 B;  3HKS A;  5ELO A;  3TP5 A;  1SMX A;  1GKH A;  1BO0 A;  3SVM A;  3FKI G;  1ZEQ X;  3CP0 A;  1UE7 A;  4HJ5 A;  4QJF A;  1LTI D;  1VQJ A;  4ZQ3 A;  3F8T A;  3HG9 A;  1PTO B;  4X62 Q;  2KA7 A;  1EQR A;  4IN3 A;  5FO7 B;  1O7Z A;  4R4T A;  1PRT D;  1NSN S;  3PSI A;  1TWC H;  5IY0 A;  2PQA A;  3NEN A;  3S1N H;  4IFD I;  1F77 A;  5KGU A;  3W1B A;  3IFT A;  3MXN B;  3BVG A;  4RGT A;  1L1O A;  2UUB L;  3ND9 A;  1EIH A;  3MFY A;  4RCO A;  1HUM A;  4LFB L;  5L37 A;  2JA9 A;  3NWT A;  4G4K A;  3DM1 A;  1O7Y A;  4CKC A;  3GTL B;  2HDM A;  1XPR A;  2Q8T A;  1NMF A;  1XYI A;  2NVT H;  1GXD C;  4BBS G;  2Z8L A;  2KJX A;  1ILP A;  4KJO A;  2N88 A;  1PRT F;  5I2Y A;  2RA4 A;  3MXG A;  4DN4 M;  1HZA A;  4A3J B;  4R8N A;  3A7L A;  4A3K G;  4A3G B;  1K28 A;  5JEA G;  3QOJ A;  4A3E G;  2A6H D;  4DV5 Q;  4QQB X;  3U4Z A;  4IUQ A;  2QF7 A;  3PO3 B;  4IZ8 A;  3NPP A;  4A3D G; 
#chains in the Genus database with same CATH homology
 3T1Y L;  4DV0 Q;  3G48 A;  4BXX G;  1NE3 A;  4IFD J;  3AEV A;  3GTM H;  1HZC A;  2CWA A;  3BZC A;  1XNQ Q;  4IPH A;  3CC2 A;  1YVC A;  1K8A C;  3HOX G;  2MFI A;  1Q86 C;  1PA6 A;  1SN8 A;  2YTY A;  4JI8 Q;  2XGT A;  3WWV A;  1PYB A;  4DV4 L;  4X6A H;  2AWO A;  5GAH C;  3S1Q H;  4JV5 L;  2JA8 G;  3E0E A;  1KD1 C;  1PYS B;  2MNA A;  4AQY L;  3OW2 A;  2N49 A;  1R9T H;  4LFA L;  2HIX A;  4YWK A;  1HNZ Q;  3CAM A;  3GTG H;  4C3I H;  1HNW Q;  1RL2 A;  2BA1 A;  5LMN Q;  3I55 A;  2YTX A;  3PIO A;  5GAE C;  1C9O A;  3RLN A;  2Q2H A;  1IBK L;  3S14 H;  1CUK A;  4LF6 L;  3KF6 B;  1X54 A;  3HOU G;  1VCI A;  2YTV A;  4LUV A;  4IO9 A;  4JI0 Q;  1VQI A;  3L0O A;  1Y1W G;  2HT1 A;  4GNX C;  2NZH A;  1UEB A;  4LFC Q;  1EQQ A;  3HFZ B;  3F2B A;  2HIV A;  2ZTE A;  4DR5 Q;  4AH6 A;  1JJC B;  3HOU H;  3PO2 G;  1SLJ A;  2AMC B;  1KIX A;  2DUD A;  4DR1 L;  4A3B H;  4HIM A;  3K7U C;  4DKA C;  1GVP A;  2HQL A;  1S72 A;  1Q82 C;  3CCL A;  2R93 G;  5C44 H;  4DAM A;  3J80 c;  5IP9 G;  3VDY A;  3CMA A;  4LF8 Q;  4NXN Q;  3PO2 H;  2CQO A;  4WJ3 M;  3KLW A;  3FP9 A;  4IJH A;  5JEA J;  4DR2 L;  4A3K H;  2N3S A;  3RN2 A;  4JI5 L;  4OX9 L;  4L5R C;  2JA8 H;  1SRU A;  2WP8 J;  4DV2 Q;  5FLM H;  1Q46 A;  1EFW A;  3GTK H;  3HOW H;  3S1M H;  4JYA Q;  1N34 L;  1MJC A;  4A3G H;  4GLX A;  4KHP L;  4LF5 Q;  4P74 A;  1FL0 A;  3LGJ A;  5FLM G;  1PH1 A;  3HOV H;  3STB D;  5LMU L;  4UP8 A;  2RCN A;  4BBS H;  2NN6 G;  3E9H A;  2E5L Q;  4LF8 L;  1X6O A;  3PIP A;  3L7Z C;  2NZO A;  1PV4 A;  2CKZ B;  4DAY B;  2WFW A;  1IBM L;  4R4I A;  1Y14 B;  2Q2I A;  4LUZ A;  3CC4 A;  4A93 G;  2K5N A;  3AQQ A;  3S17 H;  4JI3 Q;  3KJO A;  1PH5 A;  4GN5 A;  4IOA A;  3AFP A;  4DPG A;  1I50 H;  1SR3 A;  4UP7 A;  1PH8 A;  2QGQ A;  3HOY H;  3L2P A;  3J81 j;  1N33 Q;  3JAM i;  2L15 A;  1PHJ A;  1M90 C;  2UU9 Q;  4DK6 C;  1Q81 C;  1K3R A;  4GOP A;  3M7N A;  1VQB A;  4BY7 H;  3CME A;  4A3G G;  4KHZ A;  4NXM Q;  3A74 A;  1G6P A;  1OXS C;  2ZTD A;  3K0X A;  4JC0 A;  1KRS A;  2AWN A;  4MZ9 A;  1P8L A;  4DV7 Q;  1HH2 P;  4JI7 Q;  4JI6 Q;  3S1R H;  3GO5 A;  1TXY A;  1YEZ A;  4HJ8 A;  5K36 G;  1NY4 A;  4UY8 C;  3UE1 A;  3UDX A;  5C44 G;  4JBW A;  4R4Q A;  4DNI A;  5AJ3 Q;  2F52 A;  3STB C;  3NEL A;  3DLL A;  1YHQ A;  3PUW A;  3KFU A;  4A3B G;  1A63 A;  4DV3 Q;  5BR8 Q;  3CCQ A;  3TS2 A;  4YHH Q;  3OTO L;  4LF9 Q;  3M85 A;  1MKH A;  5GAD C;  3BU2 A;  1KRT A;  1K73 C;  1PH2 A;  5M3F G;  2VY3 A;  4HID A;  1PVO A;  1PH7 A;  1IBM Q;  2B63 G;  4DV1 L;  4A93 H;  5HGQ A;  1LYL A;  2VUM G;  5LMU Q;  4GKJ L;  2R7D A;  2VZA A;  4BA2 I;  4XTC S;  5IT9 c;  1XNR Q;  3HKZ E;  4C3H H;  3J81 i;  3GD7 A;  4LW1 A;  4JI4 L;  3CPF A;  4GKK L;  3E9I A;  3GTJ H;  3PUZ A;  4JI4 Q;  4IFD G;  3TQY A;  1YJN A;  3PV0 A;  4Y7N H;  1VQ4 A;  4JI1 L;  3H3V I;  4A3D H;  2IX0 A;  5J3B A;  4LNQ A;  2YYZ A;  1NTG A;  2IX1 A;  2VQE L;  3U4V A;  4QGU A;  1YZ6 A;  4O0A A;  2JQO A;  1HJP A;  2C35 B;  2UUB Q;  2VUM H;  3S2D H;  3UDI A;  3FHW A;  5IP9 H;  1EYG A;  2RF4 A;  1VQ9 A;  4BBR H;  4DV5 L;  1A8V A;  1KAW A;  3RR5 A;  4LF7 L;  1X3F A;  1I3Q H;  4JCV E;  1E24 A;  3I7F A;  3PUY A;  2JJQ A;  2XTI A;  5M3F H;  1X55 A;  2JE6 I;  1HNX L;  4GKJ Q;  2DGY A;  1W2B A;  5BR8 L;  4EQ5 A;  4APV A;  4P73 A;  2EQS A;  1N32 L;  2UUA L;  1T9H A;  2PQA B;  4P72 A;  4OWW B;  1D7Q A;  1A62 A;  1HNZ L;  1HNW L;  4P75 A;  3UDG A;  3A5Z B;  1SFO H;  4L5Q A;  5ELN A;  3IRB A;  1WCM H;  1M1K C;  4UPA A;  2I5H A;  1CKN B;  1TWF H;  4DV7 L;  4GOP C;  3CCE A;  1B7Y B;  3RN5 A;  1ASZ A;  4JI7 L;  3HOZ G;  5JJL A;  4JOI A;  2RHQ B;  4QL5 A;  4JI8 L;  3RLO A;  2JA5 H;  3PCO B;  1UE1 A;  2V1C C;  4IJL A;  3SGI A;  4L5S A;  1VQN A;  1X3G A;  2UXC L;  4A3F H;  4X64 Q;  1XNQ L;  1EUJ A;  2OQK A;  2D62 A;  4A3C G;  2Q2U A;  2Z6K A;  4A3J G;  4DUY Q;  2UUA Q;  4NXN L;  3AFQ A;  1UE6 A;  2IT1 A;  4KI0 A;  1K0R A;  1GD7 A;  1K9M C;  2UXB L;  4OWT B;  2K75 A;  4OO1 G;  3AYH B;  2B3G A;  2Z6K C;  5C4X H;  1GM5 A;  2K14 A;  2UXD L;  2K50 A;  1W3S A;  2VL6 A;  1A0I A;  2A19 A;  1VQP A;  4LF9 L;  2ZJP A;  4B3R L;  1JB7 A;  5M5W H;  4IOC A;  4A3E H;  1OXT A;  3W1G A;  4YCU A;  3M3Y H;  4ME3 A;  1IBK Q;  2BH2 A;  1X56 A;  1N36 L;  2A8V A;  3JC6 6;  4LF5 L;  1S3O A;  2QA4 A;  5C0X G;  1WOC A;  2ALY B;  4DUZ L;  3A5U A;  1WYD A;  1IL2 A;  4DR4 L;  2GN5 A;  2JEB I;  3EIV A;  3CCR A;  4P71 A;  3B6Y A;  1KL9 A;  3CCM A;  4BA1 I;  4LF4 L;  3CCJ A;  3CC7 A;  1JMC A;  2K5V A;  1JT8 A;  4DV2 L;  4H02 A;  1CSP A;  3G6E A;  3S16 H;  4JBJ A;  2OCE A;  1VQO A;  3HOW G;  1KHI A;  2EIF A;  5JJK A;  2R6G A;  4PZ7 A;  1J5E L;  4JG2 A;  3M4P A;  2QEX A;  1OXV A;  2UU9 L;  4FDB A;  1V9P A;  3M4Q A;  3RNU A;  3G4S A;  1B70 B;  1HZB A;  5E7N A;  5GRO A;  5C4X G;  4R4C A;  2ATW A;  1L1O C;  4MTN A;  4LF7 Q;  3KF6 A;  4A3I H;  1G29 1;  3F1Z A;  2GVA A;  4X66 Q;  1MJE A;  4MNO A;  3K81 C;  4WJ4 A;  1YHA A;  2AKW B;  5LMN W;  4DV3 L;  2R92 G;  1WJJ A;  1QZH A;  1LUZ A;  3CD6 A;  5AJ3 L;  2VQF Q;  1Y1W H;  1N8R C;  4DUY L;  1E7Z A;  1JE5 A;  1K8G A;  4B3M Q;  4PMW A;  4X64 L;  2Y0S E;  3KDF A;  2PMZ E;  5IP7 H;  3CPW A;  5EAY A;  4GOP B;  2I5L X;  4JV5 Q;  1LTL A;  2CWP A;  2MO0 A;  3ER0 A;  1X65 A;  4DR3 Q;  3W5O A;  1E3P A;  4DUZ Q;  4GLV B;  2NVY H;  4YCW A;  3KYH C;  4TQU S;  1IZ6 A;  3TEH B;  4AYB E;  1XNR L;  4DV4 Q;  1KC8 C;  1FJG Q;  2AHO B;  5C4J H;  1WFQ A;  5IYD G;  1HZ9 A;  2E2H H;  2YV5 A;  4JOI C;  1GO3 E;  4YWL A;  1YJ9 A;  2VQF L;  1N32 Q;  3MEF A;  2KCM A;  3H0G G;  5C3E G;  1VQ6 A;  2BH8 A;  5JJI A;  4B3R Q;  4C3J H;  2IHE A;  3PF4 A;  4C2M H;  1L1O B;  4JBK A;  2HHH Q;  5H1S E;  2UXD Q;  1QUQ B;  1NBW A;  1YJW A;  4IPC A;  1I6H H;  1J6Q A;  2Z0S A;  4GLA C;  4A4I A;  4A75 A;  1K83 H;  1OTC A;  1B8A A;  4RG1 A;  5M5Y H;  1KXL A;  2KCT A;  5IYB H;  2LXK A;  4L5T A;  2FXQ A;  3ULJ A;  5IYC G;  2ZM6 Q;  3PUX A;  1ASY A;  5FJ8 G;  3H0G H;  5M3M H;  3ERS X;  5GAG C;  1FJG L;  4HJA A;  4JBM A;  2UXC Q;  1Q12 A;  1Q8K A;  1XPU A;  2MO1 A;  3I4O A;  1OXX K;  2KHJ A;  3NEM A;  5FLX c;  1PH3 A;  4LF4 Q;  3D0F A;  3J80 i;  3ZJY C;  2N8N A;  2F4V L;  3TRE A;  4NPS A;  1YBY A;  4BY1 G;  4A3M G;  4JI5 Q;  4OX9 Q;  3PO3 H;  4DR4 Q;  2VNU D;  3I4M H;  3ULP A;  1P16 A;  4GN4 B;  1VQH A;  5IYB G;  1YNX A;  4AIM A;  1LM0 A;  1G51 A;  4GS3 A;  3CF5 A;  4DV6 L;  2K4K A;  2K5H A;  1BKB A;  1EWI A;  1X9N A;  4PZ6 A;  1HNX Q;  4DR1 Q;  1Y1V H;  2KHI A;  1XPO A;  1Q7Y C;  3CCS A;  1XTD A;  1VQD A;  2A1A A;  1PFS A;  1TWH H;  4OON A;  4UP9 A;  2IHF A;  4HIK A;  1RIP A;  3BZK A;  2N78 A;  5DLQ E;  3GDE A;  4GN3 B;  3K7A H;  1JJ2 A;  4A3C H;  1E1O A;  1IYJ B;  3HKZ G;  1UWV A;  4LF6 Q;  1Q1B A;  4A3F G;  4JI0 L;  1S40 A;  5LMN L;  2OTJ A;  3PGZ A;  1VQK A;  1XMQ Q;  2LSS A;  4JI6 L;  3RZO H;  1YHB A;  3NBH B;  3TS0 A;  2ID0 A;  1TWG H;  3U50 C;  4X62 L;  1U5K A;  3I2Z A;  5IP7 G;  2PI2 A;  1N34 Q;  2D0P A;  2JA7 G;  1SRO A;  2PNH A;  4X65 Q;  2I0Q A;  3S15 H;  1BBW A;  1CKN A;  1QVC A;  1C0A A;  3K8A A;  2K52 A;  1O7I A;  1VQC A;  3FKI H;  5C0X J;  2Q2T A;  2PI2 E;  3T1H L;  1IBL Q;  2OTL A;  2WB1 G;  3KDF B;  1L0W A;  4LUO A;  2ES2 A;  2JA6 G;  2JK8 A;  4A3I G;  3CCV A;  4A3L H;  1VQF A;  1Y1V G;  4DR7 L;  4DK3 C;  3I4N G;  1HR0 W;  2H5X A;  1VQA A;  3ICE A;  1CSQ A;  4A3L G;  3HOV G;  1YIJ A;  2RHS B;  5GQO A;  4NB3 A;  1VS0 A;  4A3M H;  5C3E H;  5HY6 A;  2JA6 H;  1FGU A;  2B29 A;  3F2C A;  4B3T L;  1VQ8 A;  1QUQ A;  3Q8D A;  4A3J H;  4LFA Q;  4B3S L;  4YY3 Q;  4DR3 L;  2KEN A;  3PUV A;  1PH6 A;  3CW2 C;  5M3M G;  4YY3 L;  2JA5 G;  1L2F A;  5FJ8 H;  1QVF A;  1NJI C;  4NXM L;  3RLF A;  4IPD A;  2JA7 H;  1V43 A;  1QVG A;  4B3T Q;  1UE5 A;  2NN6 I;  2B63 H;  1I94 Q;  3S24 A;  5M5X H;  4QY7 A;  4JI2 Q;  1XMO Q;  2R93 H;  3J81 c;  2VW9 A;  4EX5 A;  4DV0 L;  3UDF A;  1AE2 A;  4AYB G;  4LFB Q;  1D8L A;  1BVS A;  3U58 A;  2R7F A;  4X66 L;  4GNX B;  3S2H H;  4K0K L;  3M9B A;  3BJU A;  4JI3 L;  2Y0S G;  5C0X I;  4HJ7 A;  1H95 A;  2F3I A;  4K0K Q;  3EBE A;  2R7Z H;  4KLK A;  2WB1 E;  2UXB Q;  1CKM A;  4LFC L;  3H3V H;  1E22 A;  1EOV A;  5IYD H;  3J7Z C;  1I94 L;  2YU9 H;  1HR0 L;  1VQG A;  2IY5 B;  5IE8 A;  2WAQ E;  1VQ5 A;  1VQE A;  4O2D A;  3TRZ A;  1WCM G;  2F4V Q;  3UE0 A;  1VQM A;  4GKK Q;  3JAM c;  4JYA L;  3PO3 G;  4RMF A;  4B3S Q;  4POF A;  4BY1 H;  3K80 C;  4A76 A;  4Y52 H;  4PG3 A;  2NVX H;  1VQL A;  1XMQ L;  1KQS A;  4OWX B;  2E8G A;  2R92 H;  4HIO A;  1Q1E A;  2WAQ G;  2VS1 A;  1HR0 Q;  2ZM6 L;  3GTQ H;  1CKO A;  4DV1 Q;  3D31 A;  2GVB A;  2EXD A;  4IPG A;  2E2J H;  4YHH L;  4YCV A;  5IYC H;  3CXC A;  3CCU A;  2ZJQ A;  1AH9 A;  1TWA H;  3RZD H;  5IWA L;  4XIG S;  2LXJ A;  3F2D A;  3DM3 A;  2CCZ A;  3I4N H;  2OWO A;  1BBU A;  3T1H Q;  3GTP H;  4GNX A;  4DV6 Q;  1I5F A;  1PH4 A;  3HKS A;  5ELO A;  2VQE Q;  4J15 A;  1SMX A;  2UUC L;  1GKH A;  1J5E Q;  4OO1 I;  4JI1 Q;  2E2I H;  1SE8 A;  3FKI G;  2I5M X;  3CP0 A;  1EIF A;  1UE7 A;  1WI5 A;  4HJ5 A;  4QJF A;  4AQY Q;  4KHP Q;  4LWC A;  1VQJ A;  2KBN A;  3F8T A;  4POG A;  4X62 Q;  3HOY G;  1JJG A;  1EQR A;  1C7Y A;  3HOZ H;  2ZJR A;  1Z9F A;  4R4T A;  4TVA B;  4B3M L;  2JEA I;  1N36 Q;  3PSI A;  4DR2 Q;  3M4O H;  3H15 A;  1TWC H;  1N33 L;  1FVI A;  3T1Y Q;  1X3E A;  2ASB A;  5IY0 A;  1YI2 A;  2PQA A;  3NEN A;  3S1N H;  4IFD I;  1N9W A;  3W1B A;  4ALP A;  3MXN B;  4DR5 L;  1L1O A;  2UUB L;  3OTO Q;  4BBR G;  1AE3 A;  1IBL L;  2MQH A;  4LFB L;  2JA9 A;  3EN2 A;  2E5L L;  3OYY A;  1NMG A;  2CFM A;  2D0O A;  3I4M G;  1E1T A;  1PH9 A;  2R7Z G;  1U0L A;  3PF5 A;  4OXP A;  1XMO L;  4JI2 L;  1XPR A;  4DR6 L;  4PZ8 A;  1NMF A;  2NVT H;  4BBS G;  3GTO H;  3KF8 B;  4X65 L;  1XJV A;  3HOX H;  4BY7 G;  1YIT A;  1V1Q A;  1IXR A;  1DGS A;  3I56 A;  2OQ0 A;  3J7A 5;  4DR6 Q;  2BA0 A;  4BXX H;  2NVQ H;  1HZA A;  2ZTC A;  3KOJ A;  2UUC Q;  3G71 A;  4A3K G;  1QZG A;  3GTL H;  5JEA G;  3KJP A;  1MIU A;  4R4O A;  4A3E G;  3A0J A;  5IWA Q;  1VQ7 A;  4DR7 Q;  4R1J A;  3ULL A;  3CQZ H;  4DV5 Q;  1EIY B;  3U4Z A;  4HJ9 A;  4QQB X;  4YWM A;  1OXU A;  4QIW E;  2HHH L;  4A3D G;  1Z47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...