3I3CA

Crystal structural of cbx5 chromo shadow domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
57
Chain Sequence
b'NDIARGFERGLEPEKIIGATDDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 5
publication title Crystal Structural of CBX5 Chromo Shadow Domain
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 57
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i3cA00
2K04A 3MWYW 2B2TC 1G91A 1EQTA 2KECA 2FHTA 1PFMA 2FMMA 1B53A 2KOLA 3GV3A 5D65A 1DOKA 2B2WC 1ZXTA 2DY8A 5EPLA 5T1IA 3MTSA 4QUCA 2SDFA 1F9SA 5EQ0A 1KNAA 1MSGA 1JICA 5COYA 1G2TA 3LWEA 1RODA 5CBEE 1G2SA 1CA6A 1ESRA 1B2TA 1NAPA 3TN2A 3Q6SA 1RTNA 3KBXA 2B2YC 1KNEA 2IL8A 1PLFA 4X3TA 2NZ1D 1IL8A 3G7LA 1DONA 1VMPA 5CBAE 1AZPA 2N55A 4XT3B 1MI2A 1O7ZA 1C8CA 2B2VC 4RAUC 3IFDA 1F9QA 5E4XA 1IKLA 1M8AA 1SDFA 2J7ZA 1NR2A 2KVMA 1Q3LA 2FJ2A 2K05A 1QE6A 4ZKCB 1WD0A 1ILPA 2N88A 4MN3A 2B2UC 2R3ZA 4HAEA 5JJZA 3TZDA 1WTXA 2H1EA 2MP1A 4LMQD 1AP0A 4UAIA 4HEDA 1MSHA 1S4ZA 1SSOA 2HUGA 3KUPA 2X69A 4R8IA 1CA5A 2EOTA 4X3UA 1J9OA 5E4WC 5EPJA 4CJ0B 1TVXA 2HCCA 2FINB 2RSNA 4IUVA 1BF4A 2XIWA 4ZKBB 1XX8A 3D6WA 4RWSC 5CMDA 4CJ2C 2L9HA 1CM9A 2CVRA 3FDTA 1RHPA 3DEPA 2MGSA 2L11A 2HDMA 4IUUA 4HCSA 1WVLA 2RSOA 1NCVA 3F2UA 1HFNA 2X6GA 1X32A 2L12A 2L4NA 1O80A 4ZLTF 2M2LA 3FPUB 4DN4M 2K03A 3ONAB 4QUFA 4MHEA 1GUWA 2HDLA 2Q8RE 1DOLA 1WD1A 4IURA 4O42A 1A15A 2K28A 5T1GA 3N52A 1HUNA 2K01A 1RJTA 2HCIA 5AFWA 1SAPA 1WTPA 4R9WA 1ICWA 2VXWA 1PFNA 3H91A 1O7YA 4U68A 1HHVA 4OIKA 4XT1B 1U4LA 2DY7A 5EPKA 1MGSA 3QO2A 1DOMA 1XYIA 2X6LA 5CORA 1PFBA 4XDXA 2MPMA 2NYZD 1DZ1A 3I3CA 4IUPA 1F2LA 1BNZA 1HFGA 2MJ8A 1BO0A 1U4MA 1U4PA 1EIGA 2FFKB 4NW2A 2B2TA 5DNFA 3DM1A 4IUTA 1G6ZA 2JYOA 1HUMA 4OIJA 2KEEA 4CJ1B 1AZQA 1IKMA 1X3QA 4ZAIA 1EL0A 1HA6A 1QNKA 3I90A 1WTRA 1U4RA 1F9PA 2B2WA 2EE1A 2NWGA 2Q8TA 1F9RA 2KEDA 4RA8A 1WTOA 1BBXC 3I91A 1E0BA 3IL8A 5D14A 3I8ZA 5EJWA 3UI2A 1WTWA 1QG7A 2D9UA 4X3SA 2K1BA 1NR4A 1RTOA 2B2YA 4IUQA 1J8IA 1VMCA 5EKIA 1B50A 4ZK9B 4HSVA 1ILQA 3HP3A 3GV6A 1ML0D 1EOTA 3P7JA 1WTVA 2JP1A 2B2VA 2KUMA 2L1BA 2RVLA 3R93A 1B4OA 1LV9A 2EPBA 2BDNA 3SVMA 1B3AA 3DEOA 1EIHA 1HRJA 1JE4A 1X3PA 1WTQA 1PDQA 2B2UA 2RA4A 4X3KA
chains in the Genus database with same CATH superfamily
1Z47A 4TRDA 2NVQH 4TQUS 4A3DB 2KOLA 4I7ZC 5D65A 2NB0A 1UEBA 1W3SA 3G71A 1NNXA 1TR5A 5COYA 4MNOA 1B2TA 2B63B 4L8JA 2B2YC 2VL6A 1V1PB 2F0QA 4C3JG 1G8ZD 1KQSA 1O7ZA 1JC7A 4JI8Q 1C8CA 2UU9L 1BQQT 1F9QA 5JJKA 2R92B 2OCEA 5M3FH 4YCVA 2DN8A 4LFAQ 1ILPA 3H0GH 1EYCA 1HQMC 2F1MA 2HHHL 1MSHA 1MD2D 5E4WC 1Q86C 4A93B 4PNYA 2CVRA 1HA5A 2WFWA 4YY3L 4JBKA 2HDMA 1JOKA 2HT1A 4JI5Q 2RCFA 5CC4A 4LF6L 3W1GA 3OMCA 1GVPA 2NVXH 4YWMA 2E2IB 1PYBA 4OWXB 5M3MH 3VA7A 2O5JC 3N52A 1SAPA 5C0XG 1SNMA 4BA2I 1TKWB 3V2TA 2E2JH 1HHVA 1K28A 2D5DA 4O2DA 5DM73 4EQNA 5IGCA 1LT5D 2NVYH 4NB3A 3RLFA 4RG1A 1CHQD 2YTVA 3NXWA 4A4IA 5I6WA 4DUZL 1A63A 4JVZA 2VQEQ 4L63B 3I4NB 1DZ1A 1VQ8A 3BJUA 1EOVA 1KTKA 2J0TD 5ELNA 3I90A 1U4RA 3T13A 2K5WA 2NWGA 5CYUA 5CV6A 1QVCA 1L1OA 4KD4A 5K5PA 1WTOA 1VQCA 2F0MA 3J7AF 3S1NH 3MXGA 2CWAA 3RZDB 1RTOA 3SK4A 3P7JA 1TY2A 2D0OA 4CDCC 2JP1A 3HOXH 1B4OA 3FKIB 1NSNS 4C56C 5M5WH 4NP5A 1JE4A 3R2TA 4A3GH 1SYCA 1K8GA 4Q0FA 1EFWA 4KK7A 1IBMQ 3MWYW 4RCOA 3SHLA 2CW0D 3CMAA 1YI2A 1B53A 3P20A 4EQPA 5DLQE 2QEXA 2OQKA 3PO2H 1KNEA 2F0PA 3J81E 4P75A 5KNDA 1JWMD 3M7GA 3UDFA 1TWFH 3NPPA 4FO2A 3KK7A 3DLLA 1M8AA 2WV6D 5JVH3 1NR2A 1S5ED 2I5MX 5M3FG 3SK8A 4GKKQ 4K0KL 1N32Q 1LO5D 1FNUA 1Y8PB 5LMNL 2QDBA 3NWSA 1VQKA 2YTXA 2EQSA 1F2ZA 3GTPB 4RWSC 3Q0AA 4RGOS 4JI0L 1TQOA 1M90C 4FDBA 1CK1A 3I7FA 1TWHB 2D2CC 1DCZA 4B9XA 1N36L 1STNA 3SK6A 2UXDL 2ATWA 2CW0C 2F0WA 1QZHA 2QA4A 3S16H 1BOSA 4ID6A 1HNZL 1SYEA 4N9PA 1IL2A 3I70A 1GM5A 4LF7L 2LXJA 1N8RC 3L9AX 2BH8A 2L15A 2WACA 1MGSA 1UEAB 5G3LD 4R4QA 3A56A 2I46A 2R7FA 4LF9Q 3AMUA 3GTQH 1SYBA 4KV6A 4A3KB 4JI3Q 1Z6HA 3E0JA 1JMCA 2MJ8A 1OO9B 2WAQB 4DGZA 1CZWA 2FMCA 3J80c 3CP0A 4JI1L 1VQPA 4JI4Q 1TWGH 4LF5Q 1HA6A 1O7LA 1Y8NB 3J81L 2F0FA 1VQIA 4NXNL 2Q8TA 1JCKB 1EIFA 2KHIA 4LAAA 1RF2D 1E0BA 2A69D 5IT9L 4RH6A 5I9OA 5CR3A 1Q46A 5TSSA 5IP9G 2E2HH 3ZJYC 2BE5D 2F0SA 1WTVA 4U673 4QF4A 2N78A 2KHSA 3DXJC 1W6JA 1B3AA 3GTGH 4S3SA 2F03A 3ITPA 4A3GG 1KHIA 2R61A 4R4IA 1PDQA 2RA4A 1L0YB 1SNPA 1QOHA 1S40A 3GV3A 1PZID 2DY8A 1ZXTA 2C5CA 1I94Q 2OEOA 4DR6Q 1HNWL 2K5VA 4KI0A 3NUCA 1Q1BA 4V0BA 4XYQA 5AJ3L 4J1MA 5KYIA 3Q23A 3PO2G 1STBA 3MC0B 4C3HH 2UUAL 3DHQA 4KHPL 1KLGD 1EWHA 3JAME 1GJXA 3UE1A 4JI2L 1ET9A 4ZRZA 2E74C 4RGMA 3TDQA 5LL6X 1SSOA 3QR8A 2HUGA 3URYA 3G6EA 3MAQA 1WCMB 1PZKD 2BE5C 2DGYA 4BXXH 1KDAA 3X3NA 3FDTA 5KIXA 1KL9A 4WRDA 5BR8L 5A2QE 5I6YA 3BU2A 3QB3A 1PMRA 3EN2A 3CRLC 3FRPB 2NZOA 2PI2E 4LFBL 1SN8A 4HSPA 4JG2A 1VF5C 4N8FA 2O4XA 2M9VA 1XMQL 4GKJQ 4A3JB 2K5QA 1XTCD 2K01A 2HCIA 2IT1A 1WTPA 2F0EA 2Z6BA 1SE8A 1HZ9A 3L0OA 2DY7A 1PHJA 3M4YA 4C3IH 1Y8OB 4R4TA 5DM63 3J7ZC 1AW7A 4GOPB 3KLSA 3D3RA 2NYZD 1KRSA 1HPCA 3UDGA 4A3FH 2PMZE 1EZ8A 2B2TA 3OTOQ 4HR7B 4I65A 1C0AA 3KOJA 3MXUA 4B3SQ 2F0TA 2JA8H 4AQYL 4JPBW 1HXYD 1X6OA 1SEBD 4LUZA 1H9KA 3EIVA 2Y0SE 4NKLA 1KC8C 4PV1C 2JA7B 3K0XA 3GTOB 4OO1I 4LUOA 1I6HH 4A75A 1PRTF 2D62A 4XQNA 3BG3A 1AE2A 2EY2A 4P73A 3HKZB 4JYAL 1LTRD 1BKBA 3BDLA 2LXKA 3QOJA 3GTJH 5A2QL 4PQXA 4QJFA 4DV3Q 1DOKA 5T1IA 1MJEA 5FLMG 5IE8A 2N8NA 2XRSD 5CBEE 3DWAA 3HEJA 2BH2A 1A2TA 5CV4A 1CZGA 3PIPA 1E2WA 1UE7A 4M1UB 4C3HG 1MKHA 5JAVA 4E6IA 3SR1A 1VMPA 5CBAE 2K4KA 1PRTD 1EWIA 4X64L 1CQFA 5FK9C 4UP8A 1JWUD 5C4XH 3HOWH 1LT3D 1IW7D 1PH1A 2PW7A 4IFDG 4X66L 2F0HA 4HMIA 4OGQC 4H13C 4RKLA 5CGKA 4BXXG 1TVXA 1Q1EA 4OO1H 2EYMA 1K73C 2DJGC 1NMGA 2ASBA 3SGIA 1YNXA 2JEBI 1CM9A 1E3PA 5IYDG 1RHPA 2PQAB 1H9JA 3MFGA 4KY6A 4DV6L 3F2UA 3X3MA 3S15B 4OX9L 1KIXA 2Q8IB 2EYHA 3M3YB 1PH7A 1EQQA 4IUNA 4QGUA 2ZTCA 1XPUA 1UUPA 3OIPA 3A8JE 3A7AB 4YWKA 1C7YA 2Q2HA 1P8LA 2K28A 4R4OA 3S14H 5IGGA 3KF6B 2ZTDA 1XWEA 5CV7A 4AYBB 5EPKA 1H9RA 4DR5Q 3MVVA 5C44H 1BCPF 4A3LH 1PFBA 4A3CH 4WJWA 1F2LA 3E0EA 1CFMA 4A3FG 1FYCA 1IW7C 3IAYA 4QQBX 2A19A 5LMUQ 3S2HH 2B63H 1ICFB 2KEDA 2JA8G 4HJ8A 1PZJD 4JOIC 2UUBQ 3UI2A 1WTWA 1QVFA 1E24A 3KDFB 1NR4A 1HR0Q 3CMEA 4UP9A 4DNIA 4B3RQ 1ILQA 4H02A 3C2PA 1FNVA 2YYZA 5KNCA 4A93H 2JA5H 1QJOA 2Q2UA 3PF5A 2B2UA 2PO4A 4NXMQ 1A3UA 4HTHA 3I55A 2K33A 3HOZB 1EQTA 3T1HL 2NZHA 4DUYQ 1Q8KA 4MTNA 4UDUC 3A5UA 2KCNA 4R1JA 3HOUB 1Y14B 1KNAA 4HIMA 1KD1C 4LWCA 1ENCA 2K7VA 1YHBA 3KJPA 2BCOA 3OIQA 1KXLA 1GKHA 1OXTA 4FXKC 1IKLA 3U9OA 2K05A 4QMGA 2ZM6L 3HOWG 1FGBD 4Z9CB 2R3ZA 3SEBA 5EAYA 1WTXA 1WFQA 1STEA 5C0XJ 4KLKA 5EPJA 4CJ0B 3M9BA 4QY7A 2HHHQ 4OO1G 1I4HA 4KN7C 1HNXQ 1I3QH 3I4MH 1T5EA 1X65A 3EA6A 3PUXA 3D4DA 5C0XI 1II3A 2H4OA 3U58A 2UXCL 3A54A 4B3ML 2MHVA 4UPAA 2QF7A 4QUFA 1YITA 2ZTEA 1OTCA 2Q2IA 4IPCA 5J3BA 4O42A 4HJAA 4L5RC 2PW5A 4DK3C 5E7NA 5IP7H 2PZTA 2EXZA 2CH4W 1TT2A 3TZUA 2EXDA 4BBSB 1NTGA 3BZKA 1L1OB 4XQQA 1NUCA 5C44G 2JN4A 1D1IA 4A3CG 1Y1VB 4DUZQ 1XPOA 1HCZA 2NN6G 4A3DG 1YJWA 1U4PA 2F0UA 2ID0A 1BXTA 3IKJA 2ZXPA 3K58A 5I9PA 1HJPA 2B63G 3ERSX 1HZCA 1GHJA 1CKOA 3W5OA 2PQAA 2DJFC 5C0XH 4FF2A 2ALYB 1J8IA 5EKLA 1B8AA 2F0VA 2L1BA 4QIWB 2RDHA 4Y7NB 1L0WA 1AFPA 3K7AB 1LTTD 3V96A 5KGUA 2F4IA 1S5CD 1J6QA 4A93G 2RCNA 3U9SA 2JA5G 1Q81C 3J81i 3G48A 2K5HA 5HGQA 4LUVA 1G91A 5FKAC 2KECA 4DAMA 2JEAI 1I50B 3H09A 2B2WC 3HS0C 2I0QA 1N33Q 5E3FA 2K32A 1QZGA 1XNQL 1BCPB 5GQOA 3VR3A 2XRQD 4EGVA 3TN2A 2IL8A 1LYLA 1PLFA 1PXUA 3RUZA 1UAPA 4P72A 3GTMH 3L7ZC 5HGTA 1SMYD 4G7HC 3KLSX 4LF4Q 1NY4A 2FJ2A 4JV5Q 5JEAJ 1EYGA 4MN3A 1AEXA 3VR6A 1X3FA 2AHOB 1KDBA 3NBHB 3QJYA 1SFOH 3A7LA 4UAIA 1X56A 3A0JA 3I4NG 3PIOA 3RN2A 1AP0A 4A3KH 2PZUA 3RMHA 5JOBA 1VQBA 2L9HA 5JJLA 2YU9H 3I4MG 2G9DA 3Q8DA 1WVLA 4IN3A 3KF8A 3QOLA 2L4NA 1JR0D 3E5SA 3EROA 2QCPX 3ERQA 1GUWA 1SE2A 3HOVH 2A68D 2KA7A 5M9OA 4GNXA 1S72A 2UUCQ 1T9HA 4PZ8A 1HNZQ 4DV2L 5IP7G 1RIPA 1LTSD 2B8FA 3FKIG 1O7YA 4U68A 3CQZH 3E9IA 3GTKH 1YNND 1A0IA 4FNFA 1SMYC 4DR4Q 1R4QB 2WP8J 4G7OC 1K8OA 3I3CA 5IYBG 2ZXRA 3Q22A 4JI6L 1PV4A 1VQEA 3NWTA 4PZ7A 4JI7Q 1JT8A 1PH9A 5JEAH 4OEMB 2MNAA 1F9PA 3CD6A 4UP7A 3WOFA 1B9MA 1ZEQX 4DK0A 1CKNA 4EX5A 4CDFC 1V9PA 3LGJA 3K8AA 5D3IB 2J4XA 3J7YW 3ICEA 2HIVA 4H0LC 3LWUA 1IYVA 2I5HA 3LNNA 1WCMH 3T56B 5C5MA 4LF8Q 2A68C 4IPHA 2RHQB 4CDDC 2R93H 4X3KA 3T4AC 3TS2A 3G6JB 3JAMi 3A8KE 2R7ZB 1DJRD 1B44D 1OXXK 5ELDA 4YCWA 4KMUC 2SDFA 2OWOA 1RODA 3S1RB 1A62A 5IP9H 1IHZA 3NEMA 1YEZA 3GQBA 3AFPA 2VQFL 1S5BD 1U9RA 4B3TL 3VDYA 3A55A 4RGTA 3K0YA 4A3JH 1F77A 4RGNA 3C1FA 3I2ZA 1SDFA 2EJGC 2KENA 4DV1L 4IQZA 2UXBL 3CC7A 3Q24A 2L5TA 1UWVA 4DR3L 2O5IC 4HEDA 1HTLD 4X6AH 4A3KG 5IWAQ 1XX8A 3GP7A 1I4GA 4LFCL 2VUMB 3HRZC 3S24A 1X3GA 4QL5A 2JXMB 1HFNA 1K83B 1EQRA 3BZCA 4XTCS 4DV7Q 3U4VA 4DV0Q 2IX3A 2A6ED 1SXTA 4DV4L 3HOVG 1CUKA 1N9WA 5F2DA 2Z6KC 3E9HA 3OWFA 5NUCA 5AFWA 5T1GA 1XMOQ 2WB1E 3OW2A 3S17B 3H91A 5IGFA 3DMUA 5GAHC 1IXRA 4BBRH 1XJVA 4UHVA 3CPFA 1TWCB 1VQDA 2K50A 4BY7B 2MO0A 2PI2A 3NBHA 2PNRC 3RZOH 4K6LA 1YJ9A 2KEEA 4K2LA 5JEAG 3MEFA 3PO3H 2F3WA 1A3TA 1DYQA 4ULLA 4DKAC 3F2BA 5C3XA 5IT9c 1VQMA 1PYSB 2GA4B 2EYLA 3FP9A 4F8MA 1VQJA 2HQEA 4L5TA 3K59A 3I4OA 4JI8L 1UE5A 2XTIA 2KUMA 2B2VA 1X3EA 2A6EC 2EYFA 3SVMA 4LFAL 4DR7Q 4ZCKA 1WCMG 4KY5A 5DEHA 2R93G 1SMXA 4IFDJ 3G4SA 2XWBB 1OXUA 2LFNA 4R8NA 4K5WA 1P16A 4DK1A 5J22A 4HN7A 4JI5L 1NAPA 2NVQB 3KBXA 4IFDI 4X3TA 1NE3A 3G7LA 5HY6A 4A3JG 4IOAA 1G51A 4HCEA 1S3OA 2LSSA 2CKZB 4OHJA 2SNSA 2NTTA 2ENBA 1SBBB 4O0AA 1WD0A 1EUJA 1EYAA 5BN4A 1VQAA 4HMJA 1J5EQ 2XVSA 5M3FB 2AUKA 2TSSA 4N9TA 1VQ4A 1IYJB 1B7YB 5FLMH 3H0GB 3TQYA 2VQEL 1EU4A 2MGSA 4ALPA 3S2DH 3NHHA 1SYDA 4KJNA 2JA9A 1HH2P 1BUVT 2E5LQ 5KNBA 4PMBA 2HIXA 2P5ZX 2BA1A 3PSIA 1IBLQ 1ASZA 4X65Q 2A69C 5GROA 4EQ5A 4DFAA 3TRZA 4IFDH 2AWOA 2I5LX 1XPRA 1U4LA 2NVXB 3QO2A 5GAEC 1K8AC 3MXNA 5M3MB 3HKZG 5ELEA 4BBRG 1LABA 1YHAA 5IYDH 3HOZH 3EJIA 2YTYA 3M4OH 2K52A 1EQVA 2CCZA 2ZJRA 2E2JB 4YHHQ 2NVYB 1IBML 4A3IB 2FFKB 1VQHA 4WJ3M 3OOCA 4C1NI 3JC66 3PO3G 1EY8A 1BBUA 3I91A 1A8VA 1PH5A 2DNCA 2K1BA 3EFXD 2B2YA 2H5XA 1STHA 5EKIA 1B50A 1JQYD 4EQOA 1U0LA 1EOTA 1Y1WB 1JB3A 2C9OA 1QB5D 2ZJPA 3S1NB 1B70B 4GKKL 1N32L 1FGUA 1G6PA 4K8IA 1EIHA 4P2CB 3S1QH 4CGYB 4DAPA 1FJGQ 3HOXB 1SE3A 2K04A 1E2ZA 4RKBA 1PFMA 4G4KA 1EYDA 2A74C 2AQ3B 1ET6A 1RKNA 5C4JH 3JAML 4CBVA 2NTSA 5M5XH 2VS1A 5IIFA 4N8X1 5C5LA 4ZYSA 5C4HA 2K5DA 4OWWB 1W2BA 2N55A 3IFTA 4DV5Q 5C3EH 2J7ZA 1QE6A 2AKWB 3BVGA 2F3VA 1C4QA 1UE1A 3RD4A 4F7XA 2NVTH 4RHRA 1TWFB 4BY1B 5IYCG 2OTJA 2TMPA 1RCVD 2GN5A 1B9NA 3SXHA 2SEBD 1YHQA 4LF9L 4JI3L 3FPPA 4JC0A 2DUDA 3NK9A 3BDOA 2F0IA 1TXYA 2EYOA 4C2MB 4JI4L 3AYHB 2M2LA 4DN4M 1TWAH 2PYKA 4LF5L 4K2KA 3ONAB 3I4LA 5CV8A 3E3XA 2HDLA 4B3MQ 3GTLH 1STYA 3P75A 1WOCA 1QILA 3KLRA 2MQHA 1GXDC 2WB1G 2NN6I 3T1YQ 4Y7NH 3K7AH 2ZXOA 4R4CA 3S16B 1D5ZC 1MJCA 1GD7A 2X6LA 4LJZC 1BDOA 2EVBA 2WKCA 3HOZG 3KYHC 3R3OA 4XDXA 3VYTA 2MUYA 1VQ6A 2XNAC 4BA1I 1VQOA 1YBYA 3HOUG 3SK5A 5DNFA 1R9TH 1K3RA 2JYOA 1GO3E 3GTQB 5DAUA 1Q8IA 4DR6L 1YIJA 5FJ8G 4A3EH 1CTMA 1JWSD 1NBWA 1TWGB 1LLRD 1PRTC 1QUQA 5C4ZA 3J81j 3UDXA 4DR2Q 3TMEA 4BWGB 2NN6H 2LMCB 5FO8B 4A3DH 5JVG3 3B6YA 1X3PA 3D6CA 1QCBD 4DR1L 4BS9A 4ODGA 1IKMA 1MBYA 2F0NA 2IJ0A 1WJJA 1N34Q 1HR0W 3GTGB 3K5MA 2F4VQ 5JPMC 3DM3A 1L1OC 1G2TA 2WKDA 1MSGA 2MO1A 3NQIA 2R92H 1BCPD 4JBJA 4IO9A 2KHJA 3CPWA 1CQVA 1VQFA 4FP5D 3BVZA 5BN5A 3IFDA 4A3BB 4RCNA 4YIJA 5E4XA 5C3EG 1JORA 1H9SA 3CCVA 4GKJL 3KF8B 3KBGA 4L5SA 1GUTA 1STAA 5JJZA 2H1EA 2MP1A 4LMQD 3F2CA 3K7UC 3KUPA 1Y1VG 3WOEA 3PF4A 3ER0A 5IY0A 4GNXB 3CKIB 5GADC 5C6AA 1C9OA 3NE5B 4FF1A 1D6EC 1UE6A 2E2IH 4XIGS 3L2PA 1O80A 3OTOL 4V190 1V43A 1F2MA 1QWYA 4C1NK 1E2VA 4AH6A 4Y52H 2K03A 4B3SL 3MZ5A 1TU2B 2UU9Q 3LX0A 5LL6S 3VR5A 5IOCA 1WD1A 1IZ6A 4DAVA 4L6TB 2JA6B 2LKVA 1I4RA 2EZVA 1BCPC 3I4NH 2VXWA 1PFNA 4L5QA 3NSWA 4XT1B 3TREA 4K5XA 3VYUA 3CW2C 3U50C 1YVCA 2WAQE 4HIOA 1PA6A 3WDNA 1CKNB 3HOYB 4GLVB 5KRUA 4YY3Q 2N3SA 1HFGA 1BO0A 1U4MA 4M8AA 2CH4A 3H3VI 4C3IB 3RLNA 4LF6Q 3GO5A 3TP6A 2PQEA 4J15A 3RZDH 1X3QA 4DV3L 1FNWA 3K6OA 4NMZA 2K75A 1WTRA 1PH3A 5ISRA 2F0LA 1X55A 2PZWA 2VY3A 3I8ZA 4WFN3 3CXCA 4A3EG 3FKIH 2GVBA 5FLXc 2JA8B 1PTOF 2QEJC 3UE0A 1C48A 1MIUA 2RVLA 1Q12A 5IYBH 2EYJA 3DEOA 4ZUJA 1WI5A 1SLJA 1H9MA 2XN9C 3PUWA 3NTHA 5FOBB 4ME5A 1I6HB 2FMMA 2F0JA 3S1MB 5LHY1 1OXSC 1SROA 2CFMA 3MEHA 3UDIA 3D31A 4HJ7A 1EY9A 4GN5A 3H3VH 2R92G 1SNDA 2KQ3A 3EBEA 3GTJB 3RN5A 1DONA 2C35B 4MZ9A 5FO9B 3NENA 1JE5A 3GDEA 4G7ZC 1Q3LA 1SJED 4FVMA 4ZKCB 1WYDA 3GTPH 2QILA 1I6VC 4GLXA 2UXBQ 1YZ6A 4H44C 4HAEA 2EJFC 4A3MB 3I56A 1S4ZA 1VQNA 4DR5L 4DR3Q 4UY8C 1TWHH 2RSNA 2FINB 5C4XB 1EU3A 4PMCA 2KCMA 3R2IA 5CMDA 2CQAA 1ZKOA 2A6HD 2B29A 4KHZA 4I7AA 3DEPA 3QIAA 2L11A 4EVOA 3PCOB 3CRKC 2X6GA 4ZLTF 3FPUB 5LMUL 5I2YA 3M7NA 3STBD 1EY0A 2UUBL 1Q82C 2NUCA 3K57A 4K0KQ 1HUNA 1VF7A 1VQGA 1HR0L 3MXPA 4B3RL 2AUJD 1GUGA 2Z9HA 1CSPA 5LMNQ 4IZ8A 2F0KA 1SYGA 3T16A 1XNRL 4K14A 3RR5A 4K5VA 3S14B 4JI0Q 1LUZA 2R7ZG 4NXML 3J80i 3W3AA 1B3QA 2RDGA 3TS0A 1WTHA 3FMCA 3KLWA 1Z7TA 1D8LA 5EKKA 4DUYL 1W6KA 1N36Q 1EL0A 3FVQA 2UXDQ 2PMZB 2F3IA 3OHXC 3TP8A 2MFIA 2A6HC 1SNCA 1F2YA 1D5XC 4OELB 3BS1A 3VYSA 4DU9A 3S2HB 4LF7Q 1IYUA 2R7DA 3HKZE 3H3VC 4OL7A 4JCVE 3STBC 1ZYRD 2Y0SB 4X62L 3BYYB 1RD9D 1LTGD 1L0XB 1I4PA 2B2TC 2VUMG 4JI1Q 2RF4A 4TVAB 3RLOA 2VW9A 1HNXL 2JA5B 1TY0A 4NXNQ 1F9SA 1K9MC 3PIP3 1HZBA 4KD3A 4KN4C 2IX0A 2QDLA 1RTNA 1GUOA 1BVSA 4J8QA 5A35A 2VB3X 1AZPA 4XT3B 1CHPD 1JJCB 4O1NA 1EY6A 5IGBA 1EWCA 1E7ZA 1A6XA 2AQ2B 1IBKL 1VQLA 4LNQA 4APVA 3V05A 5IODA 4GZYC 2QKIC 4GN4B 4BY7G 2EOTA 4IJHA 1YJNA 3D8GA 1VS0A 1YNNC 1Q7YC 1LACA 5KEEA 4A3IH 4CJ2C 1PTOB 5EBCA 2AQ1B 3HFZB 1HNWQ 1ZYRC 3CCEA 1YNJD 3EQLC 2EDGA 5AJ3Q 3H15A 3FHWA 1S5DD 3QG1A 3MXNB 2UUAQ 1I3QB 3I4MB 4KHPQ 1QNUA 3SDZA 4JI2Q 1ESFA 4JOIA 4C3JB 4AYBE 1Y1WH 3CCRA 3BDCA 3OMGA 3MA2B 1TS4A 2F0OA 2IY5B 2WAQG 2ZJQA 3OW7A 4MTKA 2V1CC 3TEHB 4B9WA 1EY4A 2IX1A 3CU7A 4QCLA 5BR8Q 4ME3A 2JQOA 3O13A 2EY6A 3DM1A 1GUNA 1HUMA 4CJ1B 2F52A 2RHSB 2SOBA 1FD7D 4LFBQ 1N33L 1KAWA 4RA8A 1ASYA 2RDFA 1RDPD 3OPOA 1NMFA 2LS01 5ELFA 1XMQQ 2JA7H 2FXQA 3GTOH 1YNJC 2XSCA 1KRTA 3EVQA 1PH4A 4HSVA 1JJ2A 3HP3A 2JSOA 3GV6A 3L3OC 4RFBA 3R93A 2E8GA 4YCUA 1KAAA 5IT9E 4BY1H 4LF4L 4JV5L 4IJLA 4NPSA 3U4ZA 1AH9A 1SR3A 4DA2A 4IOCA 3H0GG 3VR2A 2OXPA 1DXMA 4IPGA 4DAYA 2KCTA 3I73A 3J81c 5M5YB 4FYDA 2AMCB 1Z9FA 3P1HA 4YWLA 5EQ0A 4C2MH 4AQYQ 3RNUA 3J80E 1S5FD 1PH2A 2JJQA 2IPKD 3WWVA 5G3LF 1IL8A 1V1QA 1L2FA 1MI2A 3F2DA 1JOQA 2WINB 2B39A 4OONA 5JJIA 2ES2A 5GAGC 2UUCL 2XGTA 2N88A 4KY7A 1CT1D 2R6GA 2B2UC 1VCIA 4POGA 1TS2A 5ELBA 2VZAA 3TZDA 5M3MG 3GTMB 4JYAQ 3C1EA 5KYLA 1HZAA 1UNSA 4K8JA 1J9OA 1V1PA 3S15H 1D2BA 2XIWA 4DR4L 3D6WA 4B08A 4A3IG 4GOPC 2IW3A 3D4WA 3ZYYX 1SFOB 2HD3A 1A3VA 1SRUA 3M3YH 1LTAD 4IUUA 4HCSA 2RSOA 1NCVA 3SE0A 1X32A 2N49A 3DUZA 5ELOA 2VNUD 4JI7L 3MFYA 2YU9B 4XYOA 5JPNC 4X64Q 2Q8RE 4RMFA 1V8QA 2G5DA 1Y1WG 5IYCH 1ICWA 2XWJB 4ILWA 2Z1CA 4X66Q 3HOVB 2KCCA 4F88A 3D4RA 4JBWA 1KDCA 4KKUA 3HOXG 3C46A 3M85A 4IUPA 4LF8L 1BNZA 3CQZB 4TKOB 4PZ6A 1VQ7A 2EYPA 5J1ZA 4DV6Q 1X54A 3GTKB 1QUQB 4GS3A 3D0FA 4OX9Q 1JOOA 3J80L 1RL2A 1AZQA 1GHKA 4HIDA 4LK1C 1U5KA 2KJXA 5BN3A 2EE1A 2B2WA 1ENFA 1BBXC 5D14A 1TIID 2JA7G 2D9UA 4A3BH 4QIWE 3K5OA 5CV9A 4BY1G 1LV9A 2EPBA 2F0GA 5HURA 5J39A 3IRBA 3VR4A 2SNMA 2EJMA 1BR9A 2EY5A 3HOUH 3T51B 2DNEA 4DR1Q 1EY5A 3ND9A 5IWAL 1M4VA 1H9SB 3K80C 3A5ZB 3TP5A 3CCJA 3F8TA 5FJ8H 3JAMc 2IHEA 2OTLA 2I07B 4DNTB 2R93B 1EY7A 4NDXA 4CKCA 3VA5A 1CA6A 2JK8A 1KABA 2PPBC 3PGZA 1QVGA 4DV7L 4DV0L 2JA6H 1DD2A 4QB4A 3ND8A 2KVMA 1HQRD 1K8MA 1JB7A 1B1ZA 2A73B 3OWEB 2B8GA 2ICEC 3PIO3 1XMOL 2ICIA 5FO7B 5I4DA 3HOYH 3DWQA 5M5WB 2RQXA 4X3UA 4A3GB 3T1HQ 4IUVA 2VB2X 2G9HD 4JK1C 1JJGA 2OF1A 1FVIA 1VDZA 1SJHD 3HKSA 2L12A 4POFA 1SNOA 1DM0B 1AE3A 3TP7A 3W2DA 3PO2B 1HTPA 1EIYB 1SNQA 4DXFA 4AYBG 4LW1A 4BBSH 2Q2TA 2ZM6Q 3I72A 5EBDA 3BZDB 1RJTA 1FR3A 1Y1VH 4DPGA 4MIUA 2OQ0A 3HG9A 3NP8A 3A74A 3R8BA 1DOMA 1XYIA 3NQTA 2E75C 4DR7L 4H7BA 4A76A 3C3LA 2YV5A 3S1MH 4IPDA 4NW2A 4BBRB 4J6HA 4HJ5A 2UXCQ 4CDEC 2F0DA 4G57A 3IL8A 5EJWA 1D7QA 3BVMA 4GNXC 3RZOB 5EGTA 1QG7A 2EIFA 1LTID 4DNRB 4A3BG 5IGEA 1KLUD 4OWTB 4KHVA 1VMCA 3PO3B 3KJOA 2KBNA 3J7A5 1LTLA 4A3MH 2BDNA 1I50H 3TBIB 4ABNA 1HRJA 1D1KA 2K5NA 1J5EL 5ELCA 1I94L 1TS5A 1NJIC 4WJ4A 5C3WA 5IGDA 1JICA 3LWEA 2L55A 4ZQ3A 1ESRA 4K6DA 3Q6SA 4PMWA 2IWHA 3ULPA 2NZ1D 2E5LL 4IALA 3N6RA 5I2XA 2JA6G 3MHBA 3HZXA 1PVOA 4RAUC 3CHBD 1IBLL 3VYRA 2M00A 2E2HB 4X65L 2K6AA 1LT4D 2L0CA 2Z6KA 3ULLA 1EEID 1TS3A 4F87A 3HOYG 2BA0A 2IHFA 4R8IA 2EY1A 3CCLA 2V4DA 2Z0SA 2HCCA 2A8VA 1BF4A 4CHTB 3J7AV 4ZKBB 1DGSA 3CCQA 4C3IG 1ONLA 3TSSA 2Z8LA 3CCMA 3AB9A 1XNQQ 3E6ZX 4YHHL 5D3DA 2WIIB 2E2DC 3CC2A 3W1BA 2Z4HA 1Q90A 2NBFA 3S2DB 4BBSG 2GVAA 3NTIA 4C3HB 1DOLA 2CQOA 1A2UA 1STGA 1A15A 5L37A 3AQQA 4AIMA 1I4XA 4R9WA 4DK6C 1VQ5A 4OIKA 1H95A 3S9WA 2A1AA 1E1OA 2CHBD 2O2LD 2WB1B 4KTAA 5CORA 3K5NA 2MPMA 1XNRQ 2Z4IA 2RBMA 1FJGL 1XXGA 2BOSA 1EZ6A 1X9NA 4OIJA 4HJ9A 1E1TA 3QWNA 3M4OB 1O7IA 1QNKA 1R4PB 1LM0A 3T53B 3PUYA 1F9RA 3H6MA 1E22A 1PH6A 4GOPA 1K0RA 5K36H 4X3SA 1CI3M 4DV2Q 3DWPA 4ZK9B 1K3BC 3OYYA 1ML0D 4DV5L 1AN8A 3F1ZA 3OSOA 1I5FA 2OT2A 3K81C 3CF5A 4A3MG 3FEWX 1MHWC 2R7ZH 4HIKA 4TSSA 2RKSA 4XQJA 1WTQA 5C4XG 4X62Q 5FLXE 4JI6Q 3S1RH 4DF7A 1PTOH 3HGBA 1EFID 4CKEA 1GOZA 1BBWA 2FHTA 2ZT9C 4A3FB 3CC4A 3S1QB 3NTKA 5EPLA 3MTSA 4KJOA 4QUCA 1XTDA 2PCFB 3NELA 3M4QA 2AWNA 4ZUIA 1G2SA 4CKBA 1I4QA 3ULJA 1PRTB 1T5XD 4C3JH 4KKTA 5C4JB 5E1FA 5CV5A 1EEFD 1G291 5M5XB 2B2VC 4FXGC 3K5LA 2QW7A 1O78A 4GN3B 2K14A 4KKSA 3T1YL 3A8IE 4RHSA 4FF3A 2VUMH 1CKMA 2PNHA 1IBKQ 4JW0A 5C3EB 1CA5A 3PMFA 2X69A 4OXPA 5H1SE 1M1KC 4WORA 1K0SA 2CWPA 1K83H 3NBIA 2NVTB 4A3LG 3H94A 1PTOD 1LT6D 1D5MC 3PUZA 4FXDA 1PFSA 4P71A 2E76C 2VQFQ 4B3TQ 1LTBD 3BYTB 2LY7A 3S17H 4MHEA 4PG3A 2BDOA 2A5HA 3KFUA 4DV1Q 4IURA 3PUVA 1TWAB 1TWCH 4BY7H 1FL0A 1GUSA 3PQIA 2Y0SG 3HOWB 3GTLB 4DR2L 1Y69U 5FLXL 3PV0A 4LFCQ 5M5YH 4Q5VA 4JBMA 4P74A 1ENAA 1SE4A 1EIGA 1V1OA 1N34L 4IUTA 1G6ZA 3AEVA 3GD7A 2F4VL 3KF6A 4ZAIA 5LMNW 2QGQA 4DV4Q 3CAMA 4XXEA 1PTOC 1R9TB 1OXVA 5K36G 3CCSA 4DAYB 4IUQA 4GLAC 1PH8A 4DXGA 1PYWD 4A3EB 2B3GA 1VQ9A 3AU7A 3AFQA 1CSQA 2JE6I 2D0PA 3M4PA 4FF4A 3CCUA 5C44B 2HQLA 3KDFA 1SYFA
chains in the Genus database with same CATH topology
1Z47A 4TRDA 4TQUS 4A3DB 2KOLA 4I7ZC 5D65A 2NB0A 1TR5A 5COYA 1B2TA 2B63B 4L8JA 2B2YC 1V1PB 2F0QA 4C3JG 1G8ZD 1O7ZA 1JC7A 1C8CA 1BQQT 1F9QA 2R92B 2DN8A 1ILPA 1EYCA 1HQMC 2F1MA 1MSHA 1MD2D 5E4WC 4A93B 4PNYA 2CVRA 1HA5A 2HDMA 1JOKA 5CC4A 3OMCA 2E2IB 3VA7A 2O5JC 3N52A 1SAPA 5C0XG 1SNMA 4BA2I 1TKWB 3V2TA 1HHVA 2D5DA 5DM73 4EQNA 5IGCA 1LT5D 3RLFA 1CHQD 3NXWA 5I6WA 4L63B 3I4NB 1DZ1A 1KTKA 2J0TD 3I90A 1U4RA 3T13A 2K5WA 2NWGA 5CYUA 5CV6A 1WTOA 4KD4A 5K5PA 2F0MA 3J7AF 3MXGA 3RZDB 1RTOA 3SK4A 3P7JA 1TY2A 2JP1A 1B4OA 3FKIB 1NSNS 4C56C 4NP5A 1JE4A 3R2TA 1SYCA 4Q0FA 4KK7A 3MWYW 4RCOA 3SHLA 2CW0D 1B53A 3P20A 4EQPA 1KNEA 2F0PA 3J81E 5KNDA 1JWMD 3M7GA 3NPPA 4FO2A 3KK7A 1M8AA 2WV6D 5JVH3 1NR2A 1S5ED 3SK8A 1LO5D 1FNUA 1Y8PB 2QDBA 3NWSA 1F2ZA 3GTPB 4RWSC 3Q0AA 4RGOS 1TQOA 1CK1A 1TWHB 2D2CC 1DCZA 4B9XA 1STNA 3SK6A 2CW0C 2F0WA 1BOSA 4ID6A 1SYEA 4N9PA 3I70A 3L9AX 2WACA 1MGSA 1UEAB 5G3LD 3A56A 2I46A 3AMUA 1SYBA 4KV6A 4A3KB 1Z6HA 3E0JA 2MJ8A 1OO9B 2WAQB 4DGZA 1CZWA 2FMCA 1HA6A 1O7LA 1Y8NB 3J81L 2F0FA 2Q8TA 1JCKB 4LAAA 1RF2D 1E0BA 2A69D 5IT9L 4RH6A 5I9OA 5CR3A 5TSSA 2BE5D 2F0SA 1WTVA 4U673 4QF4A 2KHSA 3DXJC 1W6JA 1B3AA 4S3SA 2F03A 3ITPA 2R61A 1PDQA 2RA4A 1L0YB 1SNPA 1QOHA 3GV3A 1PZID 2DY8A 1ZXTA 2C5CA 2OEOA 4KI0A 3NUCA 1Q1BA 4V0BA 4XYQA 4J1MA 5KYIA 3Q23A 1STBA 3MC0B 3DHQA 1KLGD 1EWHA 3JAME 1GJXA 1ET9A 4ZRZA 2E74C 4RGMA 3TDQA 5LL6X 1SSOA 2HUGA 3URYA 3MAQA 1WCMB 1PZKD 2BE5C 1KDAA 3X3NA 3FDTA 5KIXA 4WRDA 5A2QE 5I6YA 3QB3A 1PMRA 3CRLC 3FRPB 4HSPA 1VF5C 2O4XA 2M9VA 4A3JB 2K5QA 1XTCD 2K01A 2HCIA 2IT1A 1WTPA 2F0EA 2DY7A 3M4YA 5DM63 1Y8OB 1AW7A 3KLSA 3D3RA 2NYZD 1HPCA 1EZ8A 2B2TA 4HR7B 4I65A 3MXUA 2F0TA 1HXYD 1SEBD 1H9KA 4NKLA 4PV1C 2JA7B 3GTOB 4OO1I 1PRTF 2D62A 4XQNA 3BG3A 2EY2A 3HKZB 1LTRD 3BDLA 3QOJA 5A2QL 4PQXA 1DOKA 5T1IA 2XRSD 5CBEE 3DWAA 3HEJA 1A2TA 5CV4A 1CZGA 1E2WA 4M1UB 4C3HG 5JAVA 4E6IA 3SR1A 1VMPA 5CBAE 1PRTD 1CQFA 5FK9C 1JWUD 1LT3D 1IW7D 2PW7A 4IFDG 2F0HA 4HMIA 4OGQC 4H13C 4RKLA 5CGKA 1TVXA 1Q1EA 4OO1H 2EYMA 2JEBI 1CM9A 1RHPA 1H9JA 3MFGA 4KY6A 3F2UA 3X3MA 3S15B 2Q8IB 2EYHA 3M3YB 4IUNA 1UUPA 3OIPA 3A8JE 3A7AB 2K28A 5IGGA 1XWEA 5CV7A 4AYBB 5EPKA 1H9RA 3MVVA 1BCPF 1PFBA 4WJWA 1F2LA 1CFMA 1FYCA 1IW7C 3IAYA 2KEDA 1PZJD 3UI2A 1WTWA 1NR4A 1ILQA 3C2PA 1FNVA 2YYZA 5KNCA 1QJOA 2B2UA 2PO4A 1A3UA 4HTHA 3HOZB 2K33A 1EQTA 4UDUC 2KCNA 3HOUB 1KNAA 1ENCA 2K7VA 2BCOA 3OIQA 1OXTA 4FXKC 1IKLA 3U9OA 2K05A 4QMGA 1FGBD 4Z9CB 2R3ZA 3SEBA 1WTXA 1STEA 5C0XJ 5EPJA 4CJ0B 4OO1G 1I4HA 4KN7C 1T5EA 3EA6A 3PUXA 3D4DA 5C0XI 1II3A 2H4OA 3A54A 2MHVA 2QF7A 4QUFA 4O42A 2PW5A 2PZTA 2EXZA 1TT2A 3TZUA 4BBSB 4XQQA 1NUCA 1D1IA 1Y1VB 1HCZA 2NN6G 1U4PA 2F0UA 2ID0A 1BXTA 3IKJA 2ZXPA 3K58A 5I9PA 1GHJA 5C0XH 4FF2A 1J8IA 5EKLA 2F0VA 2L1BA 4QIWB 2RDHA 4Y7NB 1AFPA 3K7AB 1LTTD 3V96A 5KGUA 2F4IA 1S5CD 3U9SA 1G91A 5FKAC 2KECA 2JEAI 1I50B 3H09A 2B2WC 3HS0C 5E3FA 2K32A 1BCPB 3VR3A 2XRQD 4EGVA 3TN2A 2IL8A 1PLFA 1PXUA 3RUZA 1UAPA 3L7ZC 5HGTA 1SMYD 4G7HC 3KLSX 2FJ2A 5JEAJ 4MN3A 1AEXA 3VR6A 1KDBA 3QJYA 1AP0A 3A7LA 4UAIA 2PZUA 3RMHA 5JOBA 2L9HA 2G9DA 1WVLA 4IN3A 3KF8A 3QOLA 2L4NA 1JR0D 3E5SA 3EROA 2QCPX 3ERQA 1GUWA 1SE2A 2A68D 2KA7A 5M9OA 1LTSD 2B8FA 1O7YA 4U68A 1YNND 4FNFA 1SMYC 1R4QB 2WP8J 4G7OC 1K8OA 3I3CA 2ZXRA 3Q22A 3NWTA 5JEAH 1F9PA 3WOFA 1B9MA 1ZEQX 4DK0A 5D3IB 2J4XA 3J7YW 4H0LC 3LWUA 1IYVA 3LNNA 3T56B 5C5MA 2A68C 4X3KA 3T4AC 3G6JB 3A8KE 2R7ZB 1DJRD 1B44D 1OXXK 5ELDA 4KMUC 2SDFA 1RODA 3S1RB 1IHZA 3GQBA 1S5BD 1U9RA 3A55A 4RGTA 3K0YA 1F77A 4RGNA 3C1FA 1SDFA 2EJGC 4IQZA 3Q24A 2L5TA 2O5IC 4HEDA 1HTLD 1XX8A 3GP7A 1I4GA 2VUMB 3HRZC 2JXMB 1HFNA 1K83B 4XTCS 2IX3A 2A6ED 1SXTA 5F2DA 5NUCA 5T1GA 3OWFA 5AFWA 3S17B 3H91A 5IGFA 3DMUA 1TWCB 4BY7B 3NBHA 2PNRC 4K6LA 2KEEA 4K2LA 5JEAG 2F3WA 1A3TA 1DYQA 4ULLA 5C3XA 2GA4B 2EYLA 4F8MA 2HQEA 3K59A 2KUMA 2B2VA 2A6EC 2EYFA 3SVMA 5DEHA 4KY5A 4IFDJ 2XWBB 1OXUA 2LFNA 4R8NA 4K5WA 4DK1A 5J22A 4HN7A 1NAPA 2NVQB 3KBXA 4IFDI 4X3TA 3G7LA 4HCEA 4OHJA 2SNSA 2NTTA 2ENBA 1SBBB 1WD0A 1EYAA 5BN4A 4HMJA 2XVSA 5M3FB 2AUKA 2TSSA 4N9TA 3H0GB 1EU4A 2MGSA 3NHHA 1SYDA 4KJNA 1BUVT 5KNBA 4PMBA 2BA1A 2A69C 4DFAA 4IFDH 2AWOA 1U4LA 2NVXB 3QO2A 3MXNA 5M3MB 5ELEA 1LABA 3EJIA 1EQVA 2E2JB 2NVYB 4A3IB 2FFKB 3OOCA 4C1NI 1EY8A 3I91A 2DNCA 2K1BA 3EFXD 2B2YA 1STHA 5EKIA 1B50A 1JQYD 4EQOA 1EOTA 1Y1WB 1JB3A 2C9OA 1QB5D 3S1NB 4K8IA 1EIHA 4P2CB 4CGYB 4DAPA 3HOXB 1SE3A 2K04A 1E2ZA 4RKBA 1PFMA 4G4KA 1EYDA 2A74C 2AQ3B 1ET6A 1RKNA 3JAML 4CBVA 2NTSA 5IIFA 5C5LA 4ZYSA 5C4HA 2K5DA 2N55A 3IFTA 2J7ZA 1QE6A 3BVGA 2F3VA 1C4QA 4F7XA 3RD4A 4RHRA 1TWFB 4BY1B 2TMPA 1RCVD 1B9NA 3SXHA 2SEBD 3FPPA 3NK9A 3BDOA 2F0IA 2EYOA 4C2MB 2M2LA 4DN4M 2PYKA 4K2KA 3ONAB 3I4LA 2HDLA 1STYA 3P75A 1QILA 3KLRA 1GXDC 2NN6I 2ZXOA 3S16B 1D5ZC 2X6LA 4LJZC 1BDOA 2EVBA 2WKCA 4XDXA 3R3OA 3VYTA 2MUYA 2XNAC 4BA1I 3SK5A 5DNFA 2JYOA 3GTQB 5DAUA 1Q8IA 1CTMA 1JWSD 1TWGB 1LLRD 1PRTC 5C4ZA 3TMEA 4BWGB 2NN6H 2LMCB 5FO8B 5JVG3 1X3PA 3D6CA 1QCBD 4BS9A 4ODGA 1IKMA 1MBYA 2F0NA 2IJ0A 3GTGB 3K5MA 5JPMC 1G2TA 2WKDA 1MSGA 3NQIA 1BCPD 1CQVA 4FP5D 3BVZA 5BN5A 3IFDA 4A3BB 4RCNA 4YIJA 5E4XA 1JORA 1H9SA 3KBGA 1GUTA 1STAA 5JJZA 2H1EA 2MP1A 4LMQD 3KUPA 3WOEA 3CKIB 5C6AA 3NE5B 4FF1A 1D6EC 4XIGS 1O80A 4V190 1V43A 1F2MA 1QWYA 4C1NK 1E2VA 2K03A 3MZ5A 1TU2B 3LX0A 5LL6S 3VR5A 5IOCA 1WD1A 4DAVA 2JA6B 4L6TB 2LKVA 1I4RA 2EZVA 1BCPC 2VXWA 1PFNA 3NSWA 4XT1B 4K5XA 3VYUA 3HOYB 3WDNA 5KRUA 1HFGA 1BO0A 1U4MA 4M8AA 4C3IB 3GO5A 3TP6A 2PQEA 1X3QA 1FNWA 3K6OA 4NMZA 1WTRA 5ISRA 2F0LA 2PZWA 3I8ZA 4WFN3 2JA8B 1PTOF 2QEJC 1C48A 2RVLA 1Q12A 2EYJA 3DEOA 4ZUJA 1H9MA 2XN9C 3PUWA 3NTHA 5FOBB 4ME5A 1I6HB 2FMMA 2F0JA 3S1MB 5LHY1 1OXSC 3MEHA 3D31A 1EY9A 1SNDA 2KQ3A 3GTJB 1DONA 5FO9B 4G7ZC 1Q3LA 1SJED 4FVMA 4ZKCB 2QILA 1I6VC 4H44C 4HAEA 2EJFC 4A3MB 1S4ZA 2RSNA 2FINB 5C4XB 1EU3A 4PMCA 3R2IA 5CMDA 2CQAA 1ZKOA 2A6HD 4KHZA 3DEPA 3QIAA 2L11A 4EVOA 3CRKC 2X6GA 4ZLTF 3FPUB 5I2YA 3M7NA 1EY0A 2NUCA 3K57A 1HUNA 1VF7A 3MXPA 2AUJD 1GUGA 4IZ8A 2F0KA 1SYGA 3T16A 4K14A 4K5VA 3S14B 3W3AA 2RDGA 3FMCA 1Z7TA 5EKKA 1W6KA 1EL0A 3FVQA 2PMZB 3OHXC 3TP8A 2A6HC 1SNCA 1F2YA 1D5XC 3BS1A 3VYSA 4DU9A 3S2HB 1IYUA 3H3VC 4OL7A 1ZYRD 2Y0SB 3BYYB 1RD9D 1LTGD 1L0XB 1I4PA 2B2TC 2JA5B 1TY0A 1F9SA 3PIP3 4KD3A 4KN4C 2IX0A 1RTNA 1GUOA 4J8QA 5A35A 2VB3X 1AZPA 4XT3B 1CHPD 4O1NA 1EY6A 5IGBA 1EWCA 1A6XA 2AQ2B 3V05A 5IODA 4GZYC 2QKIC 2EOTA 3D8GA 1YNNC 1LACA 5KEEA 4CJ2C 1PTOB 5EBCA 2AQ1B 1ZYRC 1YNJD 3EQLC 2EDGA 1S5DD 3QG1A 1I3QB 3I4MB 1QNUA 3SDZA 1ESFA 4C3JB 3BDCA 3OMGA 3MA2B 1TS4A 2F0OA 3OW7A 4B9WA 1EY4A 2IX1A 3CU7A 4QCLA 3O13A 2EY6A 3DM1A 1GUNA 1HUMA 4CJ1B 2SOBA 1FD7D 4RA8A 2RDFA 1RDPD 3OPOA 2LS01 5ELFA 1YNJC 2XSCA 3EVQA 4HSVA 3HP3A 2JSOA 3GV6A 3L3OC 4RFBA 3R93A 5IT9E 1KAAA 4DA2A 3VR2A 2OXPA 1DXMA 4DAYA 3I73A 5M5YB 4FYDA 3P1HA 5EQ0A 3J80E 1S5FD 2IPKD 5G3LF 1IL8A 1MI2A 1JOQA 2WINB 2B39A 2N88A 4KY7A 1CT1D 2R6GA 2B2UC 1VCIA 3GTMB 1TS2A 5ELBA 3TZDA 3C1EA 5KYLA 1UNSA 4K8JA 1J9OA 1V1PA 1D2BA 2XIWA 3D6WA 4B08A 2IW3A 3D4WA 3ZYYX 1SFOB 1A3VA 1LTAD 4IUUA 4HCSA 2RSOA 1NCVA 3SE0A 1X32A 3DUZA 2VNUD 3MFYA 2YU9B 4XYOA 5JPNC 2Q8RE 1V8QA 1ICWA 2XWJB 4ILWA 2Z1CA 3HOVB 2KCCA 4F88A 3D4RA 4JBWA 1KDCA 4KKUA 3C46A 3M85A 4IUPA 1BNZA 3CQZB 4TKOB 2EYPA 5J1ZA 3GTKB 1JOOA 3J80L 1AZQA 1GHKA 4LK1C 2KJXA 5BN3A 2EE1A 2B2WA 1ENFA 1BBXC 5D14A 1TIID 2D9UA 3K5OA 5CV9A 1LV9A 2EPBA 2F0GA 5HURA 5J39A 3VR4A 2SNMA 2EJMA 1BR9A 2EY5A 3T51B 2DNEA 1EY5A 3ND9A 1M4VA 1H9SB 3TP5A 2R93B 2I07B 4DNTB 1EY7A 4NDXA 4CKCA 3VA5A 1CA6A 1KABA 2PPBC 1DD2A 4QB4A 3ND8A 2KVMA 1HQRD 1K8MA 1B1ZA 2A73B 3OWEB 2B8GA 2ICEC 3PIO3 2ICIA 5I4DA 5FO7B 3DWQA 5M5WB 2RQXA 4X3UA 4A3GB 4IUVA 2VB2X 2G9HD 4JK1C 2OF1A 1VDZA 1SJHD 2L12A 1SNOA 1DM0B 3TP7A 3W2DA 3PO2B 1HTPA 1SNQA 4DXFA 3I72A 5EBDA 3BZDB 1RJTA 1FR3A 4MIUA 3HG9A 3NP8A 3R8BA 1DOMA 1XYIA 3NQTA 2E75C 4H7BA 3C3LA 4NW2A 4BBRB 4J6HA 2F0DA 4G57A 3IL8A 5EJWA 3BVMA 3RZOB 5EGTA 1QG7A 4DNRB 1LTID 5IGEA 1KLUD 4KHVA 1VMCA 3PO3B 2BDNA 3TBIB 4ABNA 1HRJA 1D1KA 5ELCA 1TS5A 5C3WA 5IGDA 1JICA 3LWEA 2L55A 4ZQ3A 1ESRA 4K6DA 3Q6SA 4PMWA 2IWHA 2NZ1D 4IALA 3N6RA 5I2XA 3MHBA 3HZXA 4RAUC 3CHBD 3VYRA 2M00A 2E2HB 2K6AA 1LT4D 2L0CA 1EEID 1TS3A 4F87A 2BA0A 4R8IA 2EY1A 2V4DA 2HCCA 1BF4A 4CHTB 3J7AV 4ZKBB 4C3IG 1ONLA 3TSSA 2Z8LA 3AB9A 3E6ZX 5D3DA 2WIIB 2E2DC 2Z4HA 1Q90A 2NBFA 3S2DB 4C3HB 3NTIA 1DOLA 1A2UA 1STGA 1A15A 1I4XA 4R9WA 4OIKA 3S9WA 2CHBD 2WB1B 2O2LD 4KTAA 5CORA 3K5NA 2MPMA 2Z4IA 2RBMA 1XXGA 2BOSA 1EZ6A 4OIJA 3QWNA 3M4OB 1QNKA 1R4PB 3T53B 3PUYA 1F9RA 3H6MA 5K36H 4X3SA 1CI3M 3DWPA 4ZK9B 1ML0D 1AN8A 3OSOA 2OT2A 3FEWX 4TSSA 2RKSA 4XQJA 1WTQA 5FLXE 4DF7A 1PTOH 3HGBA 1EFID 4CKEA 1GOZA 2FHTA 2ZT9C 4A3FB 3S1QB 3NTKA 5EPLA 3MTSA 4KJOA 4QUCA 2PCFB 2AWNA 4ZUIA 1G2SA 4CKBA 1I4QA 1PRTB 1T5XD 5C4JB 4KKTA 5E1FA 5CV5A 1EEFD 1G291 5M5XB 2B2VC 4FXGC 3K5LA 1O78A 4KKSA 3A8IE 4RHSA 4FF3A 5C3EB 1CA5A 3PMFA 2X69A 4WORA 3NBIA 2NVTB 3H94A 1PTOD 1LT6D 1D5MC 3PUZA 4FXDA 2E76C 1LTBD 3BYTB 2LY7A 4MHEA 2BDOA 2A5HA 4IURA 3PUVA 1TWAB 1GUSA 3HOWB 3GTLB 1Y69U 5FLXL 3PV0A 4Q5VA 1ENAA 1SE4A 1EIGA 1V1OA 4IUTA 1G6ZA 3GD7A 4ZAIA 4XXEA 1PTOC 1R9TB 1OXVA 5K36G 4IUQA 4DXGA 1PYWD 4A3EB 3AU7A 2JE6I 4FF4A 5C44B 5CV8A 1SYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K04 A;  3MWY W;  2B2T C;  1G91 A;  1EQT A;  2KEC A;  2FHT A;  1PFM A;  2FMM A;  1B53 A;  2KOL A;  3GV3 A;  5D65 A;  1DOK A;  2B2W C;  1ZXT A;  2DY8 A;  5EPL A;  5T1I A;  3MTS A;  4QUC A;  2SDF A;  1F9S A;  5EQ0 A;  1KNA A;  1MSG A;  1JIC A;  5COY A;  1G2T A;  3LWE A;  1ROD A;  5CBE E;  1G2S A;  1CA6 A;  1ESR A;  1B2T A;  1NAP A;  3TN2 A;  3Q6S A;  1RTN A;  3KBX A;  2B2Y C;  1KNE A;  2IL8 A;  1PLF A;  4X3T A;  2NZ1 D;  1IL8 A;  3G7L A;  1DON A;  1VMP A;  5CBA E;  1AZP A;  2N55 A;  4XT3 B;  1MI2 A;  1O7Z A;  1C8C A;  2B2V C;  4RAU C;  3IFD A;  1F9Q A;  5E4X A;  1IKL A;  1M8A A;  1SDF A;  2J7Z A;  1NR2 A;  2KVM A;  1Q3L A;  2FJ2 A;  2K05 A;  1QE6 A;  4ZKC B;  1WD0 A;  1ILP A;  2N88 A;  4MN3 A;  2B2U C;  2R3Z A;  4HAE A;  5JJZ A;  3TZD A;  1WTX A;  2H1E A;  2MP1 A;  4LMQ D;  1AP0 A;  4UAI A;  4HED A;  1MSH A;  1S4Z A;  1SSO A;  2HUG A;  3KUP A;  2X69 A;  4R8I A;  1CA5 A;  2EOT A;  4X3U A;  1J9O A;  5E4W C;  5EPJ A;  4CJ0 B;  1TVX A;  2HCC A;  2FIN B;  2RSN A;  4IUV A;  1BF4 A;  2XIW A;  4ZKB B;  1XX8 A;  3D6W A;  4RWS C;  5CMD A;  4CJ2 C;  2L9H A;  1CM9 A;  2CVR A;  3FDT A;  1RHP A;  3DEP A;  2MGS A;  2L11 A;  2HDM A;  4IUU A;  4HCS A;  1WVL A;  2RSO A;  1NCV A;  3F2U A;  1HFN A;  2X6G A;  1X32 A;  2L12 A;  2L4N A;  1O80 A;  4ZLT F;  2M2L A;  3FPU B;  4DN4 M;  2K03 A;  3ONA B;  4QUF A;  4MHE A;  1GUW A;  2HDL A;  2Q8R E;  1DOL A;  1WD1 A;  4IUR A;  4O42 A;  1A15 A;  2K28 A;  5T1G A;  3N52 A;  1HUN A;  2K01 A;  1RJT A;  2HCI A;  5AFW A;  1SAP A;  1WTP A;  4R9W A;  1ICW A;  2VXW A;  1PFN A;  3H91 A;  1O7Y A;  4U68 A;  1HHV A;  4OIK A;  4XT1 B;  1U4L A;  2DY7 A;  5EPK A;  1MGS A;  3QO2 A;  1DOM A;  1XYI A;  2X6L A;  5COR A;  1PFB A;  4XDX A;  2MPM A;  2NYZ D;  1DZ1 A;  3I3C A;  4IUP A;  1F2L A;  1BNZ A;  1HFG A;  2MJ8 A;  1BO0 A;  1U4M A;  1U4P A;  1EIG A;  2FFK B;  4NW2 A;  2B2T A;  5DNF A;  3DM1 A;  4IUT A;  1G6Z A;  2JYO A;  1HUM A;  4OIJ A;  2KEE A;  4CJ1 B;  1AZQ A;  1IKM A;  1X3Q A;  4ZAI A;  1EL0 A;  1HA6 A;  1QNK A;  3I90 A;  1WTR A;  1U4R A;  1F9P A;  2B2W A;  2EE1 A;  2NWG A;  2Q8T A;  1F9R A;  2KED A;  4RA8 A;  1WTO A;  1BBX C;  3I91 A;  1E0B A;  3IL8 A;  5D14 A;  3I8Z A;  5EJW A;  3UI2 A;  1WTW A;  1QG7 A;  2D9U A;  4X3S A;  2K1B A;  1NR4 A;  1RTO A;  2B2Y A;  4IUQ A;  1J8I A;  1VMC A;  5EKI A;  1B50 A;  4ZK9 B;  4HSV A;  1ILQ A;  3HP3 A;  3GV6 A;  1ML0 D;  1EOT A;  3P7J A;  1WTV A;  2JP1 A;  2B2V A;  2KUM A;  2L1B A;  2RVL A;  3R93 A;  1B4O A;  1LV9 A;  2EPB A;  2BDN A;  3SVM A;  1B3A A;  3DEO A;  1EIH A;  1HRJ A;  1JE4 A;  1X3P A;  1WTQ A;  1PDQ A;  2B2U A;  2RA4 A;  4X3K A; 
#chains in the Genus database with same CATH topology
 1Z47 A;  4TRD A;  2NVQ H;  4TQU S;  4A3D B;  2KOL A;  4I7Z C;  5D65 A;  2NB0 A;  1UEB A;  1W3S A;  3G71 A;  1NNX A;  1TR5 A;  5COY A;  4MNO A;  1B2T A;  2B63 B;  4L8J A;  2B2Y C;  2VL6 A;  1V1P B;  2F0Q A;  4C3J G;  1G8Z D;  1KQS A;  1O7Z A;  1JC7 A;  4JI8 Q;  1C8C A;  2UU9 L;  1BQQ T;  1F9Q A;  5JJK A;  2R92 B;  2OCE A;  5M3F H;  4YCV A;  2DN8 A;  4LFA Q;  1ILP A;  3H0G H;  1EYC A;  1HQM C;  2F1M A;  2HHH L;  1MSH A;  1MD2 D;  5E4W C;  1Q86 C;  4A93 B;  4PNY A;  2CVR A;  1HA5 A;  2WFW A;  4YY3 L;  4JBK A;  2HDM A;  1JOK A;  2HT1 A;  4JI5 Q;  2RCF A;  5CC4 A;  4LF6 L;  3W1G A;  3OMC A;  1GVP A;  2NVX H;  4YWM A;  2E2I B;  1PYB A;  4OWX B;  5M3M H;  3VA7 A;  2O5J C;  3N52 A;  1SAP A;  5C0X G;  1SNM A;  4BA2 I;  1TKW B;  3V2T A;  2E2J H;  1HHV A;  1K28 A;  2D5D A;  4O2D A;  5DM7 3;  4EQN A;  5IGC A;  1LT5 D;  2NVY H;  4NB3 A;  3RLF A;  4RG1 A;  1CHQ D;  2YTV A;  3NXW A;  4A4I A;  5I6W A;  4DUZ L;  1A63 A;  4JVZ A;  2VQE Q;  4L63 B;  3I4N B;  1DZ1 A;  1VQ8 A;  3BJU A;  1EOV A;  1KTK A;  2J0T D;  5ELN A;  3I90 A;  1U4R A;  3T13 A;  2K5W A;  2NWG A;  5CYU A;  5CV6 A;  1QVC A;  1L1O A;  4KD4 A;  5K5P A;  1WTO A;  1VQC A;  2F0M A;  3J7A F;  3S1N H;  3MXG A;  2CWA A;  3RZD B;  1RTO A;  3SK4 A;  3P7J A;  1TY2 A;  2D0O A;  4CDC C;  2JP1 A;  3HOX H;  1B4O A;  3FKI B;  1NSN S;  4C56 C;  5M5W H;  4NP5 A;  1JE4 A;  3R2T A;  4A3G H;  1SYC A;  1K8G A;  4Q0F A;  1EFW A;  4KK7 A;  1IBM Q;  3MWY W;  4RCO A;  3SHL A;  2CW0 D;  3CMA A;  1YI2 A;  1B53 A;  3P20 A;  4EQP A;  5DLQ E;  2QEX A;  2OQK A;  3PO2 H;  1KNE A;  2F0P A;  3J81 E;  4P75 A;  5KND A;  1JWM D;  3M7G A;  3UDF A;  1TWF H;  3NPP A;  4FO2 A;  3KK7 A;  3DLL A;  1M8A A;  2WV6 D;  5JVH 3;  1NR2 A;  1S5E D;  2I5M X;  5M3F G;  3SK8 A;  4GKK Q;  4K0K L;  1N32 Q;  1LO5 D;  1FNU A;  1Y8P B;  5LMN L;  2QDB A;  3NWS A;  1VQK A;  2YTX A;  2EQS A;  1F2Z A;  3GTP B;  4RWS C;  3Q0A A;  4RGO S;  4JI0 L;  1TQO A;  1M90 C;  4FDB A;  1CK1 A;  3I7F A;  1TWH B;  2D2C C;  1DCZ A;  4B9X A;  1N36 L;  1STN A;  3SK6 A;  2UXD L;  2ATW A;  2CW0 C;  2F0W A;  1QZH A;  2QA4 A;  3S16 H;  1BOS A;  4ID6 A;  1HNZ L;  1SYE A;  4N9P A;  1IL2 A;  3I70 A;  1GM5 A;  4LF7 L;  2LXJ A;  1N8R C;  3L9A X;  2BH8 A;  2L15 A;  2WAC A;  1MGS A;  1UEA B;  5G3L D;  4R4Q A;  3A56 A;  2I46 A;  2R7F A;  4LF9 Q;  3AMU A;  3GTQ H;  1SYB A;  4KV6 A;  4A3K B;  4JI3 Q;  1Z6H A;  3E0J A;  1JMC A;  2MJ8 A;  1OO9 B;  2WAQ B;  4DGZ A;  1CZW A;  2FMC A;  3J80 c;  3CP0 A;  4JI1 L;  1VQP A;  4JI4 Q;  1TWG H;  4LF5 Q;  1HA6 A;  1O7L A;  1Y8N B;  3J81 L;  2F0F A;  1VQI A;  4NXN L;  2Q8T A;  1JCK B;  1EIF A;  2KHI A;  4LAA A;  1RF2 D;  1E0B A;  2A69 D;  5IT9 L;  4RH6 A;  5I9O A;  5CR3 A;  1Q46 A;  5TSS A;  5IP9 G;  2E2H H;  3ZJY C;  2BE5 D;  2F0S A;  1WTV A;  4U67 3;  4QF4 A;  2N78 A;  2KHS A;  3DXJ C;  1W6J A;  1B3A A;  3GTG H;  4S3S A;  2F03 A;  3ITP A;  4A3G G;  1KHI A;  2R61 A;  4R4I A;  1PDQ A;  2RA4 A;  1L0Y B;  1SNP A;  1QOH A;  1S40 A;  3GV3 A;  1PZI D;  2DY8 A;  1ZXT A;  2C5C A;  1I94 Q;  2OEO A;  4DR6 Q;  1HNW L;  2K5V A;  4KI0 A;  3NUC A;  1Q1B A;  4V0B A;  4XYQ A;  5AJ3 L;  4J1M A;  5KYI A;  3Q23 A;  3PO2 G;  1STB A;  3MC0 B;  4C3H H;  2UUA L;  3DHQ A;  4KHP L;  1KLG D;  1EWH A;  3JAM E;  1GJX A;  3UE1 A;  4JI2 L;  1ET9 A;  4ZRZ A;  2E74 C;  4RGM A;  3TDQ A;  5LL6 X;  1SSO A;  3QR8 A;  2HUG A;  3URY A;  3G6E A;  3MAQ A;  1WCM B;  1PZK D;  2BE5 C;  2DGY A;  4BXX H;  1KDA A;  3X3N A;  3FDT A;  5KIX A;  1KL9 A;  4WRD A;  5BR8 L;  5A2Q E;  5I6Y A;  3BU2 A;  3QB3 A;  1PMR A;  3EN2 A;  3CRL C;  3FRP B;  2NZO A;  2PI2 E;  4LFB L;  1SN8 A;  4HSP A;  4JG2 A;  1VF5 C;  4N8F A;  2O4X A;  2M9V A;  1XMQ L;  4GKJ Q;  4A3J B;  2K5Q A;  1XTC D;  2K01 A;  2HCI A;  2IT1 A;  1WTP A;  2F0E A;  2Z6B A;  1SE8 A;  1HZ9 A;  3L0O A;  2DY7 A;  1PHJ A;  3M4Y A;  4C3I H;  1Y8O B;  4R4T A;  5DM6 3;  3J7Z C;  1AW7 A;  4GOP B;  3KLS A;  3D3R A;  2NYZ D;  1KRS A;  1HPC A;  3UDG A;  4A3F H;  2PMZ E;  1EZ8 A;  2B2T A;  3OTO Q;  4HR7 B;  4I65 A;  1C0A A;  3KOJ A;  3MXU A;  4B3S Q;  2F0T A;  2JA8 H;  4AQY L;  4JPB W;  1HXY D;  1X6O A;  1SEB D;  4LUZ A;  1H9K A;  3EIV A;  2Y0S E;  4NKL A;  1KC8 C;  4PV1 C;  2JA7 B;  3K0X A;  3GTO B;  4OO1 I;  4LUO A;  1I6H H;  4A75 A;  1PRT F;  2D62 A;  4XQN A;  3BG3 A;  1AE2 A;  2EY2 A;  4P73 A;  3HKZ B;  4JYA L;  1LTR D;  1BKB A;  3BDL A;  2LXK A;  3QOJ A;  3GTJ H;  5A2Q L;  4PQX A;  4QJF A;  4DV3 Q;  1DOK A;  5T1I A;  1MJE A;  5FLM G;  5IE8 A;  2N8N A;  2XRS D;  5CBE E;  3DWA A;  3HEJ A;  2BH2 A;  1A2T A;  5CV4 A;  1CZG A;  3PIP A;  1E2W A;  1UE7 A;  4M1U B;  4C3H G;  1MKH A;  5JAV A;  4E6I A;  3SR1 A;  1VMP A;  5CBA E;  2K4K A;  1PRT D;  1EWI A;  4X64 L;  1CQF A;  5FK9 C;  4UP8 A;  1JWU D;  5C4X H;  3HOW H;  1LT3 D;  1IW7 D;  1PH1 A;  2PW7 A;  4IFD G;  4X66 L;  2F0H A;  4HMI A;  4OGQ C;  4H13 C;  4RKL A;  5CGK A;  4BXX G;  1TVX A;  1Q1E A;  4OO1 H;  2EYM A;  1K73 C;  2DJG C;  1NMG A;  2ASB A;  3SGI A;  1YNX A;  2JEB I;  1CM9 A;  1E3P A;  5IYD G;  1RHP A;  2PQA B;  1H9J A;  3MFG A;  4KY6 A;  4DV6 L;  3F2U A;  3X3M A;  3S15 B;  4OX9 L;  1KIX A;  2Q8I B;  2EYH A;  3M3Y B;  1PH7 A;  1EQQ A;  4IUN A;  4QGU A;  2ZTC A;  1XPU A;  1UUP A;  3OIP A;  3A8J E;  3A7A B;  4YWK A;  1C7Y A;  2Q2H A;  1P8L A;  2K28 A;  4R4O A;  3S14 H;  5IGG A;  3KF6 B;  2ZTD A;  1XWE A;  5CV7 A;  4AYB B;  5EPK A;  1H9R A;  4DR5 Q;  3MVV A;  5C44 H;  1BCP F;  4A3L H;  1PFB A;  4A3C H;  4WJW A;  1F2L A;  3E0E A;  1CFM A;  4A3F G;  1FYC A;  1IW7 C;  3IAY A;  4QQB X;  2A19 A;  5LMU Q;  3S2H H;  2B63 H;  1ICF B;  2KED A;  2JA8 G;  4HJ8 A;  1PZJ D;  4JOI C;  2UUB Q;  3UI2 A;  1WTW A;  1QVF A;  1E24 A;  3KDF B;  1NR4 A;  1HR0 Q;  3CME A;  4UP9 A;  4DNI A;  4B3R Q;  1ILQ A;  4H02 A;  3C2P A;  1FNV A;  2YYZ A;  5KNC A;  4A93 H;  2JA5 H;  1QJO A;  2Q2U A;  3PF5 A;  2B2U A;  2PO4 A;  4NXM Q;  1A3U A;  4HTH A;  3I55 A;  2K33 A;  3HOZ B;  1EQT A;  3T1H L;  2NZH A;  4DUY Q;  1Q8K A;  4MTN A;  4UDU C;  3A5U A;  2KCN A;  4R1J A;  3HOU B;  1Y14 B;  1KNA A;  4HIM A;  1KD1 C;  4LWC A;  1ENC A;  2K7V A;  1YHB A;  3KJP A;  2BCO A;  3OIQ A;  1KXL A;  1GKH A;  1OXT A;  4FXK C;  1IKL A;  3U9O A;  2K05 A;  4QMG A;  2ZM6 L;  3HOW G;  1FGB D;  4Z9C B;  2R3Z A;  3SEB A;  5EAY A;  1WTX A;  1WFQ A;  1STE A;  5C0X J;  4KLK A;  5EPJ A;  4CJ0 B;  3M9B A;  4QY7 A;  2HHH Q;  4OO1 G;  1I4H A;  4KN7 C;  1HNX Q;  1I3Q H;  3I4M H;  1T5E A;  1X65 A;  3EA6 A;  3PUX A;  3D4D A;  5C0X I;  1II3 A;  2H4O A;  3U58 A;  2UXC L;  3A54 A;  4B3M L;  2MHV A;  4UPA A;  2QF7 A;  4QUF A;  1YIT A;  2ZTE A;  1OTC A;  2Q2I A;  4IPC A;  5J3B A;  4O42 A;  4HJA A;  4L5R C;  2PW5 A;  4DK3 C;  5E7N A;  5IP7 H;  2PZT A;  2EXZ A;  2CH4 W;  1TT2 A;  3TZU A;  2EXD A;  4BBS B;  1NTG A;  3BZK A;  1L1O B;  4XQQ A;  1NUC A;  5C44 G;  2JN4 A;  1D1I A;  4A3C G;  1Y1V B;  4DUZ Q;  1XPO A;  1HCZ A;  2NN6 G;  4A3D G;  1YJW A;  1U4P A;  2F0U A;  2ID0 A;  1BXT A;  3IKJ A;  2ZXP A;  3K58 A;  5I9P A;  1HJP A;  2B63 G;  3ERS X;  1HZC A;  1GHJ A;  1CKO A;  3W5O A;  2PQA A;  2DJF C;  5C0X H;  4FF2 A;  2ALY B;  1J8I A;  5EKL A;  1B8A A;  2F0V A;  2L1B A;  4QIW B;  2RDH A;  4Y7N B;  1L0W A;  1AFP A;  3K7A B;  1LTT D;  3V96 A;  5KGU A;  2F4I A;  1S5C D;  1J6Q A;  4A93 G;  2RCN A;  3U9S A;  2JA5 G;  1Q81 C;  3J81 i;  3G48 A;  2K5H A;  5HGQ A;  4LUV A;  1G91 A;  5FKA C;  2KEC A;  4DAM A;  2JEA I;  1I50 B;  3H09 A;  2B2W C;  3HS0 C;  2I0Q A;  1N33 Q;  5E3F A;  2K32 A;  1QZG A;  1XNQ L;  1BCP B;  5GQO A;  3VR3 A;  2XRQ D;  4EGV A;  3TN2 A;  2IL8 A;  1LYL A;  1PLF A;  1PXU A;  3RUZ A;  1UAP A;  4P72 A;  3GTM H;  3L7Z C;  5HGT A;  1SMY D;  4G7H C;  3KLS X;  4LF4 Q;  1NY4 A;  2FJ2 A;  4JV5 Q;  5JEA J;  1EYG A;  4MN3 A;  1AEX A;  3VR6 A;  1X3F A;  2AHO B;  1KDB A;  3NBH B;  3QJY A;  1SFO H;  3A7L A;  4UAI A;  1X56 A;  3A0J A;  3I4N G;  3PIO A;  3RN2 A;  1AP0 A;  4A3K H;  2PZU A;  3RMH A;  5JOB A;  1VQB A;  2L9H A;  5JJL A;  2YU9 H;  3I4M G;  2G9D A;  3Q8D A;  1WVL A;  4IN3 A;  3KF8 A;  3QOL A;  2L4N A;  1JR0 D;  3E5S A;  3ERO A;  2QCP X;  3ERQ A;  1GUW A;  1SE2 A;  3HOV H;  2A68 D;  2KA7 A;  5M9O A;  4GNX A;  1S72 A;  2UUC Q;  1T9H A;  4PZ8 A;  1HNZ Q;  4DV2 L;  5IP7 G;  1RIP A;  1LTS D;  2B8F A;  3FKI G;  1O7Y A;  4U68 A;  3CQZ H;  3E9I A;  3GTK H;  1YNN D;  1A0I A;  4FNF A;  1SMY C;  4DR4 Q;  1R4Q B;  2WP8 J;  4G7O C;  1K8O A;  3I3C A;  5IYB G;  2ZXR A;  3Q22 A;  4JI6 L;  1PV4 A;  1VQE A;  3NWT A;  4PZ7 A;  4JI7 Q;  1JT8 A;  1PH9 A;  5JEA H;  4OEM B;  2MNA A;  1F9P A;  3CD6 A;  4UP7 A;  3WOF A;  1B9M A;  1ZEQ X;  4DK0 A;  1CKN A;  4EX5 A;  4CDF C;  1V9P A;  3LGJ A;  3K8A A;  5D3I B;  2J4X A;  3J7Y W;  3ICE A;  2HIV A;  4H0L C;  3LWU A;  1IYV A;  2I5H A;  3LNN A;  1WCM H;  3T56 B;  5C5M A;  4LF8 Q;  2A68 C;  4IPH A;  2RHQ B;  4CDD C;  2R93 H;  4X3K A;  3T4A C;  3TS2 A;  3G6J B;  3JAM i;  3A8K E;  2R7Z B;  1DJR D;  1B44 D;  1OXX K;  5ELD A;  4YCW A;  4KMU C;  2SDF A;  2OWO A;  1ROD A;  3S1R B;  1A62 A;  5IP9 H;  1IHZ A;  3NEM A;  1YEZ A;  3GQB A;  3AFP A;  2VQF L;  1S5B D;  1U9R A;  4B3T L;  3VDY A;  3A55 A;  4RGT A;  3K0Y A;  4A3J H;  1F77 A;  4RGN A;  3C1F A;  3I2Z A;  1SDF A;  2EJG C;  2KEN A;  4DV1 L;  4IQZ A;  2UXB L;  3CC7 A;  3Q24 A;  2L5T A;  1UWV A;  4DR3 L;  2O5I C;  4HED A;  1HTL D;  4X6A H;  4A3K G;  5IWA Q;  1XX8 A;  3GP7 A;  1I4G A;  4LFC L;  2VUM B;  3HRZ C;  3S24 A;  1X3G A;  4QL5 A;  2JXM B;  1HFN A;  1K83 B;  1EQR A;  3BZC A;  4XTC S;  4DV7 Q;  3U4V A;  4DV0 Q;  2IX3 A;  2A6E D;  1SXT A;  4DV4 L;  3HOV G;  1CUK A;  1N9W A;  5F2D A;  2Z6K C;  3E9H A;  3OWF A;  5NUC A;  5AFW A;  5T1G A;  1XMO Q;  2WB1 E;  3OW2 A;  3S17 B;  3H91 A;  5IGF A;  3DMU A;  5GAH C;  1IXR A;  4BBR H;  1XJV A;  4UHV A;  3CPF A;  1TWC B;  1VQD A;  2K50 A;  4BY7 B;  2MO0 A;  2PI2 A;  3NBH A;  2PNR C;  3RZO H;  4K6L A;  1YJ9 A;  2KEE A;  4K2L A;  5JEA G;  3MEF A;  3PO3 H;  2F3W A;  1A3T A;  1DYQ A;  4ULL A;  4DKA C;  3F2B A;  5C3X A;  5IT9 c;  1VQM A;  1PYS B;  2GA4 B;  2EYL A;  3FP9 A;  4F8M A;  1VQJ A;  2HQE A;  4L5T A;  3K59 A;  3I4O A;  4JI8 L;  1UE5 A;  2XTI A;  2KUM A;  2B2V A;  1X3E A;  2A6E C;  2EYF A;  3SVM A;  4LFA L;  4DR7 Q;  4ZCK A;  1WCM G;  4KY5 A;  5DEH A;  2R93 G;  1SMX A;  4IFD J;  3G4S A;  2XWB B;  1OXU A;  2LFN A;  4R8N A;  4K5W A;  1P16 A;  4DK1 A;  5J22 A;  4HN7 A;  4JI5 L;  1NAP A;  2NVQ B;  3KBX A;  4IFD I;  4X3T A;  1NE3 A;  3G7L A;  5HY6 A;  4A3J G;  4IOA A;  1G51 A;  4HCE A;  1S3O A;  2LSS A;  2CKZ B;  4OHJ A;  2SNS A;  2NTT A;  2ENB A;  1SBB B;  4O0A A;  1WD0 A;  1EUJ A;  1EYA A;  5BN4 A;  1VQA A;  4HMJ A;  1J5E Q;  2XVS A;  5M3F B;  2AUK A;  2TSS A;  4N9T A;  1VQ4 A;  1IYJ B;  1B7Y B;  5FLM H;  3H0G B;  3TQY A;  2VQE L;  1EU4 A;  2MGS A;  4ALP A;  3S2D H;  3NHH A;  1SYD A;  4KJN A;  2JA9 A;  1HH2 P;  1BUV T;  2E5L Q;  5KNB A;  4PMB A;  2HIX A;  2P5Z X;  2BA1 A;  3PSI A;  1IBL Q;  1ASZ A;  4X65 Q;  2A69 C;  5GRO A;  4EQ5 A;  4DFA A;  3TRZ A;  4IFD H;  2AWO A;  2I5L X;  1XPR A;  1U4L A;  2NVX B;  3QO2 A;  5GAE C;  1K8A C;  3MXN A;  5M3M B;  3HKZ G;  5ELE A;  4BBR G;  1LAB A;  1YHA A;  5IYD H;  3HOZ H;  3EJI A;  2YTY A;  3M4O H;  2K52 A;  1EQV A;  2CCZ A;  2ZJR A;  2E2J B;  4YHH Q;  2NVY B;  1IBM L;  4A3I B;  2FFK B;  1VQH A;  4WJ3 M;  3OOC A;  4C1N I;  3JC6 6;  3PO3 G;  1EY8 A;  1BBU A;  3I91 A;  1A8V A;  1PH5 A;  2DNC A;  2K1B A;  3EFX D;  2B2Y A;  2H5X A;  1STH A;  5EKI A;  1B50 A;  1JQY D;  4EQO A;  1U0L A;  1EOT A;  1Y1W B;  1JB3 A;  2C9O A;  1QB5 D;  2ZJP A;  3S1N B;  1B70 B;  4GKK L;  1N32 L;  1FGU A;  1G6P A;  4K8I A;  1EIH A;  4P2C B;  3S1Q H;  4CGY B;  4DAP A;  1FJG Q;  3HOX B;  1SE3 A;  2K04 A;  1E2Z A;  4RKB A;  1PFM A;  4G4K A;  1EYD A;  2A74 C;  2AQ3 B;  1ET6 A;  1RKN A;  5C4J H;  3JAM L;  4CBV A;  2NTS A;  5M5X H;  2VS1 A;  5IIF A;  4N8X 1;  5C5L A;  4ZYS A;  5C4H A;  2K5D A;  4OWW B;  1W2B A;  2N55 A;  3IFT A;  4DV5 Q;  5C3E H;  2J7Z A;  1QE6 A;  2AKW B;  3BVG A;  2F3V A;  1C4Q A;  1UE1 A;  3RD4 A;  4F7X A;  2NVT H;  4RHR A;  1TWF B;  4BY1 B;  5IYC G;  2OTJ A;  2TMP A;  1RCV D;  2GN5 A;  1B9N A;  3SXH A;  2SEB D;  1YHQ A;  4LF9 L;  4JI3 L;  3FPP A;  4JC0 A;  2DUD A;  3NK9 A;  3BDO A;  2F0I A;  1TXY A;  2EYO A;  4C2M B;  4JI4 L;  3AYH B;  2M2L A;  4DN4 M;  1TWA H;  2PYK A;  4LF5 L;  4K2K A;  3ONA B;  3I4L A;  5CV8 A;  3E3X A;  2HDL A;  4B3M Q;  3GTL H;  1STY A;  3P75 A;  1WOC A;  1QIL A;  3KLR A;  2MQH A;  1GXD C;  2WB1 G;  2NN6 I;  3T1Y Q;  4Y7N H;  3K7A H;  2ZXO A;  4R4C A;  3S16 B;  1D5Z C;  1MJC A;  1GD7 A;  2X6L A;  4LJZ C;  1BDO A;  2EVB A;  2WKC A;  3HOZ G;  3KYH C;  3R3O A;  4XDX A;  3VYT A;  2MUY A;  1VQ6 A;  2XNA C;  4BA1 I;  1VQO A;  1YBY A;  3HOU G;  3SK5 A;  5DNF A;  1R9T H;  1K3R A;  2JYO A;  1GO3 E;  3GTQ B;  5DAU A;  1Q8I A;  4DR6 L;  1YIJ A;  5FJ8 G;  4A3E H;  1CTM A;  1JWS D;  1NBW A;  1TWG B;  1LLR D;  1PRT C;  1QUQ A;  5C4Z A;  3J81 j;  3UDX A;  4DR2 Q;  3TME A;  4BWG B;  2NN6 H;  2LMC B;  5FO8 B;  4A3D H;  5JVG 3;  3B6Y A;  1X3P A;  3D6C A;  1QCB D;  4DR1 L;  4BS9 A;  4ODG A;  1IKM A;  1MBY A;  2F0N A;  2IJ0 A;  1WJJ A;  1N34 Q;  1HR0 W;  3GTG B;  3K5M A;  2F4V Q;  5JPM C;  3DM3 A;  1L1O C;  1G2T A;  2WKD A;  1MSG A;  2MO1 A;  3NQI A;  2R92 H;  1BCP D;  4JBJ A;  4IO9 A;  2KHJ A;  3CPW A;  1CQV A;  1VQF A;  4FP5 D;  3BVZ A;  5BN5 A;  3IFD A;  4A3B B;  4RCN A;  4YIJ A;  5E4X A;  5C3E G;  1JOR A;  1H9S A;  3CCV A;  4GKJ L;  3KF8 B;  3KBG A;  4L5S A;  1GUT A;  1STA A;  5JJZ A;  2H1E A;  2MP1 A;  4LMQ D;  3F2C A;  3K7U C;  3KUP A;  1Y1V G;  3WOE A;  3PF4 A;  3ER0 A;  5IY0 A;  4GNX B;  3CKI B;  5GAD C;  5C6A A;  1C9O A;  3NE5 B;  4FF1 A;  1D6E C;  1UE6 A;  2E2I H;  4XIG S;  3L2P A;  1O80 A;  3OTO L;  4V19 0;  1V43 A;  1F2M A;  1QWY A;  4C1N K;  1E2V A;  4AH6 A;  4Y52 H;  2K03 A;  4B3S L;  3MZ5 A;  1TU2 B;  2UU9 Q;  3LX0 A;  5LL6 S;  3VR5 A;  5IOC A;  1WD1 A;  1IZ6 A;  4DAV A;  4L6T B;  2JA6 B;  2LKV A;  1I4R A;  2EZV A;  1BCP C;  3I4N H;  2VXW A;  1PFN A;  4L5Q A;  3NSW A;  4XT1 B;  3TRE A;  4K5X A;  3VYU A;  3CW2 C;  3U50 C;  1YVC A;  2WAQ E;  4HIO A;  1PA6 A;  3WDN A;  1CKN B;  3HOY B;  4GLV B;  5KRU A;  4YY3 Q;  2N3S A;  1HFG A;  1BO0 A;  1U4M A;  4M8A A;  2CH4 A;  3H3V I;  4C3I B;  3RLN A;  4LF6 Q;  3GO5 A;  3TP6 A;  2PQE A;  4J15 A;  3RZD H;  1X3Q A;  4DV3 L;  1FNW A;  3K6O A;  4NMZ A;  2K75 A;  1WTR A;  1PH3 A;  5ISR A;  2F0L A;  1X55 A;  2PZW A;  2VY3 A;  3I8Z A;  4WFN 3;  3CXC A;  4A3E G;  3FKI H;  2GVB A;  5FLX c;  2JA8 B;  1PTO F;  2QEJ C;  3UE0 A;  1C48 A;  1MIU A;  2RVL A;  1Q12 A;  5IYB H;  2EYJ A;  3DEO A;  4ZUJ A;  1WI5 A;  1SLJ A;  1H9M A;  2XN9 C;  3PUW A;  3NTH A;  5FOB B;  4ME5 A;  1I6H B;  2FMM A;  2F0J A;  3S1M B;  5LHY 1;  1OXS C;  1SRO A;  2CFM A;  3MEH A;  3UDI A;  3D31 A;  4HJ7 A;  1EY9 A;  4GN5 A;  3H3V H;  2R92 G;  1SND A;  2KQ3 A;  3EBE A;  3GTJ B;  3RN5 A;  1DON A;  2C35 B;  4MZ9 A;  5FO9 B;  3NEN A;  1JE5 A;  3GDE A;  4G7Z C;  1Q3L A;  1SJE D;  4FVM A;  4ZKC B;  1WYD A;  3GTP H;  2QIL A;  1I6V C;  4GLX A;  2UXB Q;  1YZ6 A;  4H44 C;  4HAE A;  2EJF C;  4A3M B;  3I56 A;  1S4Z A;  1VQN A;  4DR5 L;  4DR3 Q;  4UY8 C;  1TWH H;  2RSN A;  2FIN B;  5C4X B;  1EU3 A;  4PMC A;  2KCM A;  3R2I A;  5CMD A;  2CQA A;  1ZKO A;  2A6H D;  2B29 A;  4KHZ A;  4I7A A;  3DEP A;  3QIA A;  2L11 A;  4EVO A;  3PCO B;  3CRK C;  2X6G A;  4ZLT F;  3FPU B;  5LMU L;  5I2Y A;  3M7N A;  3STB D;  1EY0 A;  2UUB L;  1Q82 C;  2NUC A;  3K57 A;  4K0K Q;  1HUN A;  1VF7 A;  1VQG A;  1HR0 L;  3MXP A;  4B3R L;  2AUJ D;  1GUG A;  2Z9H A;  1CSP A;  5LMN Q;  4IZ8 A;  2F0K A;  1SYG A;  3T16 A;  1XNR L;  4K14 A;  3RR5 A;  4K5V A;  3S14 B;  4JI0 Q;  1LUZ A;  2R7Z G;  4NXM L;  3J80 i;  3W3A A;  1B3Q A;  2RDG A;  3TS0 A;  1WTH A;  3FMC A;  3KLW A;  1Z7T A;  1D8L A;  5EKK A;  4DUY L;  1W6K A;  1N36 Q;  1EL0 A;  3FVQ A;  2UXD Q;  2PMZ B;  2F3I A;  3OHX C;  3TP8 A;  2MFI A;  2A6H C;  1SNC A;  1F2Y A;  1D5X C;  4OEL B;  3BS1 A;  3VYS A;  4DU9 A;  3S2H B;  4LF7 Q;  1IYU A;  2R7D A;  3HKZ E;  3H3V C;  4OL7 A;  4JCV E;  3STB C;  1ZYR D;  2Y0S B;  4X62 L;  3BYY B;  1RD9 D;  1LTG D;  1L0X B;  1I4P A;  2B2T C;  2VUM G;  4JI1 Q;  2RF4 A;  4TVA B;  3RLO A;  2VW9 A;  1HNX L;  2JA5 B;  1TY0 A;  4NXN Q;  1F9S A;  1K9M C;  3PIP 3;  1HZB A;  4KD3 A;  4KN4 C;  2IX0 A;  2QDL A;  1RTN A;  1GUO A;  1BVS A;  4J8Q A;  5A35 A;  2VB3 X;  1AZP A;  4XT3 B;  1CHP D;  1JJC B;  4O1N A;  1EY6 A;  5IGB A;  1EWC A;  1E7Z A;  1A6X A;  2AQ2 B;  1IBK L;  1VQL A;  4LNQ A;  4APV A;  3V05 A;  5IOD A;  4GZY C;  2QKI C;  4GN4 B;  4BY7 G;  2EOT A;  4IJH A;  1YJN A;  3D8G A;  1VS0 A;  1YNN C;  1Q7Y C;  1LAC A;  5KEE A;  4A3I H;  4CJ2 C;  1PTO B;  5EBC A;  2AQ1 B;  3HFZ B;  1HNW Q;  1ZYR C;  3CCE A;  1YNJ D;  3EQL C;  2EDG A;  5AJ3 Q;  3H15 A;  3FHW A;  1S5D D;  3QG1 A;  3MXN B;  2UUA Q;  1I3Q B;  3I4M B;  4KHP Q;  1QNU A;  3SDZ A;  4JI2 Q;  1ESF A;  4JOI A;  4C3J B;  4AYB E;  1Y1W H;  3CCR A;  3BDC A;  3OMG A;  3MA2 B;  1TS4 A;  2F0O A;  2IY5 B;  2WAQ G;  2ZJQ A;  3OW7 A;  4MTK A;  2V1C C;  3TEH B;  4B9W A;  1EY4 A;  2IX1 A;  3CU7 A;  4QCL A;  5BR8 Q;  4ME3 A;  2JQO A;  3O13 A;  2EY6 A;  3DM1 A;  1GUN A;  1HUM A;  4CJ1 B;  2F52 A;  2RHS B;  2SOB A;  1FD7 D;  4LFB Q;  1N33 L;  1KAW A;  4RA8 A;  1ASY A;  2RDF A;  1RDP D;  3OPO A;  1NMF A;  2LS0 1;  5ELF A;  1XMQ Q;  2JA7 H;  2FXQ A;  3GTO H;  1YNJ C;  2XSC A;  1KRT A;  3EVQ A;  1PH4 A;  4HSV A;  1JJ2 A;  3HP3 A;  2JSO A;  3GV6 A;  3L3O C;  4RFB A;  3R93 A;  2E8G A;  4YCU A;  1KAA A;  5IT9 E;  4BY1 H;  4LF4 L;  4JV5 L;  4IJL A;  4NPS A;  3U4Z A;  1AH9 A;  1SR3 A;  4DA2 A;  4IOC A;  3H0G G;  3VR2 A;  2OXP A;  1DXM A;  4IPG A;  4DAY A;  2KCT A;  3I73 A;  3J81 c;  5M5Y B;  4FYD A;  2AMC B;  1Z9F A;  3P1H A;  4YWL A;  5EQ0 A;  4C2M H;  4AQY Q;  3RNU A;  3J80 E;  1S5F D;  1PH2 A;  2JJQ A;  2IPK D;  3WWV A;  5G3L F;  1IL8 A;  1V1Q A;  1L2F A;  1MI2 A;  3F2D A;  1JOQ A;  2WIN B;  2B39 A;  4OON A;  5JJI A;  2ES2 A;  5GAG C;  2UUC L;  2XGT A;  2N88 A;  4KY7 A;  1CT1 D;  2R6G A;  2B2U C;  1VCI A;  4POG A;  1TS2 A;  5ELB A;  2VZA A;  3TZD A;  5M3M G;  3GTM B;  4JYA Q;  3C1E A;  5KYL A;  1HZA A;  1UNS A;  4K8J A;  1J9O A;  1V1P A;  3S15 H;  1D2B A;  2XIW A;  4DR4 L;  3D6W A;  4B08 A;  4A3I G;  4GOP C;  2IW3 A;  3D4W A;  3ZYY X;  1SFO B;  2HD3 A;  1A3V A;  1SRU A;  3M3Y H;  1LTA D;  4IUU A;  4HCS A;  2RSO A;  1NCV A;  3SE0 A;  1X32 A;  2N49 A;  3DUZ A;  5ELO A;  2VNU D;  4JI7 L;  3MFY A;  2YU9 B;  4XYO A;  5JPN C;  4X64 Q;  2Q8R E;  4RMF A;  1V8Q A;  2G5D A;  1Y1W G;  5IYC H;  1ICW A;  2XWJ B;  4ILW A;  2Z1C A;  4X66 Q;  3HOV B;  2KCC A;  4F88 A;  3D4R A;  4JBW A;  1KDC A;  4KKU A;  3HOX G;  3C46 A;  3M85 A;  4IUP A;  4LF8 L;  1BNZ A;  3CQZ B;  4TKO B;  4PZ6 A;  1VQ7 A;  2EYP A;  5J1Z A;  4DV6 Q;  1X54 A;  3GTK B;  1QUQ B;  4GS3 A;  3D0F A;  4OX9 Q;  1JOO A;  3J80 L;  1RL2 A;  1AZQ A;  1GHK A;  4HID A;  4LK1 C;  1U5K A;  2KJX A;  5BN3 A;  2EE1 A;  2B2W A;  1ENF A;  1BBX C;  5D14 A;  1TII D;  2JA7 G;  2D9U A;  4A3B H;  4QIW E;  3K5O A;  5CV9 A;  4BY1 G;  1LV9 A;  2EPB A;  2F0G A;  5HUR A;  5J39 A;  3IRB A;  3VR4 A;  2SNM A;  2EJM A;  1BR9 A;  2EY5 A;  3HOU H;  3T51 B;  2DNE A;  4DR1 Q;  1EY5 A;  3ND9 A;  5IWA L;  1M4V A;  1H9S B;  3K80 C;  3A5Z B;  3TP5 A;  3CCJ A;  3F8T A;  5FJ8 H;  3JAM c;  2IHE A;  2OTL A;  2I07 B;  4DNT B;  2R93 B;  1EY7 A;  4NDX A;  4CKC A;  3VA5 A;  1CA6 A;  2JK8 A;  1KAB A;  2PPB C;  3PGZ A;  1QVG A;  4DV7 L;  4DV0 L;  2JA6 H;  1DD2 A;  4QB4 A;  3ND8 A;  2KVM A;  1HQR D;  1K8M A;  1JB7 A;  1B1Z A;  2A73 B;  3OWE B;  2B8G A;  2ICE C;  3PIO 3;  1XMO L;  2ICI A;  5FO7 B;  5I4D A;  3HOY H;  3DWQ A;  5M5W B;  2RQX A;  4X3U A;  4A3G B;  3T1H Q;  4IUV A;  2VB2 X;  2G9H D;  4JK1 C;  1JJG A;  2OF1 A;  1FVI A;  1VDZ A;  1SJH D;  3HKS A;  2L12 A;  4POF A;  1SNO A;  1DM0 B;  1AE3 A;  3TP7 A;  3W2D A;  3PO2 B;  1HTP A;  1EIY B;  1SNQ A;  4DXF A;  4AYB G;  4LW1 A;  4BBS H;  2Q2T A;  2ZM6 Q;  3I72 A;  5EBD A;  3BZD B;  1RJT A;  1FR3 A;  1Y1V H;  4DPG A;  4MIU A;  2OQ0 A;  3HG9 A;  3NP8 A;  3A74 A;  3R8B A;  1DOM A;  1XYI A;  3NQT A;  2E75 C;  4DR7 L;  4H7B A;  4A76 A;  3C3L A;  2YV5 A;  3S1M H;  4IPD A;  4NW2 A;  4BBR B;  4J6H A;  4HJ5 A;  2UXC Q;  4CDE C;  2F0D A;  4G57 A;  3IL8 A;  5EJW A;  1D7Q A;  3BVM A;  4GNX C;  3RZO B;  5EGT A;  1QG7 A;  2EIF A;  1LTI D;  4DNR B;  4A3B G;  5IGE A;  1KLU D;  4OWT B;  4KHV A;  1VMC A;  3PO3 B;  3KJO A;  2KBN A;  3J7A 5;  1LTL A;  4A3M H;  2BDN A;  1I50 H;  3TBI B;  4ABN A;  1HRJ A;  1D1K A;  2K5N A;  1J5E L;  5ELC A;  1I94 L;  1TS5 A;  1NJI C;  4WJ4 A;  5C3W A;  5IGD A;  1JIC A;  3LWE A;  2L55 A;  4ZQ3 A;  1ESR A;  4K6D A;  3Q6S A;  4PMW A;  2IWH A;  3ULP A;  2NZ1 D;  2E5L L;  4IAL A;  3N6R A;  5I2X A;  2JA6 G;  3MHB A;  3HZX A;  1PVO A;  4RAU C;  3CHB D;  1IBL L;  3VYR A;  2M00 A;  2E2H B;  4X65 L;  2K6A A;  1LT4 D;  2L0C A;  2Z6K A;  3ULL A;  1EEI D;  1TS3 A;  4F87 A;  3HOY G;  2BA0 A;  2IHF A;  4R8I A;  2EY1 A;  3CCL A;  2V4D A;  2Z0S A;  2HCC A;  2A8V A;  1BF4 A;  4CHT B;  3J7A V;  4ZKB B;  1DGS A;  3CCQ A;  4C3I G;  1ONL A;  3TSS A;  2Z8L A;  3CCM A;  3AB9 A;  1XNQ Q;  3E6Z X;  4YHH L;  5D3D A;  2WII B;  2E2D C;  3CC2 A;  3W1B A;  2Z4H A;  1Q90 A;  2NBF A;  3S2D B;  4BBS G;  2GVA A;  3NTI A;  4C3H B;  1DOL A;  2CQO A;  1A2U A;  1STG A;  1A15 A;  5L37 A;  3AQQ A;  4AIM A;  1I4X A;  4R9W A;  4DK6 C;  1VQ5 A;  4OIK A;  1H95 A;  3S9W A;  2A1A A;  1E1O A;  2CHB D;  2O2L D;  2WB1 B;  4KTA A;  5COR A;  3K5N A;  2MPM A;  1XNR Q;  2Z4I A;  2RBM A;  1FJG L;  1XXG A;  2BOS A;  1EZ6 A;  1X9N A;  4OIJ A;  4HJ9 A;  1E1T A;  3QWN A;  3M4O B;  1O7I A;  1QNK A;  1R4P B;  1LM0 A;  3T53 B;  3PUY A;  1F9R A;  3H6M A;  1E22 A;  1PH6 A;  4GOP A;  1K0R A;  5K36 H;  4X3S A;  1CI3 M;  4DV2 Q;  3DWP A;  4ZK9 B;  1K3B C;  3OYY A;  1ML0 D;  4DV5 L;  1AN8 A;  3F1Z A;  3OSO A;  1I5F A;  2OT2 A;  3K81 C;  3CF5 A;  4A3M G;  3FEW X;  1MHW C;  2R7Z H;  4HIK A;  4TSS A;  2RKS A;  4XQJ A;  1WTQ A;  5C4X G;  4X62 Q;  5FLX E;  4JI6 Q;  3S1R H;  4DF7 A;  1PTO H;  3HGB A;  1EFI D;  4CKE A;  1GOZ A;  1BBW A;  2FHT A;  2ZT9 C;  4A3F B;  3CC4 A;  3S1Q B;  3NTK A;  5EPL A;  3MTS A;  4KJO A;  4QUC A;  1XTD A;  2PCF B;  3NEL A;  3M4Q A;  2AWN A;  4ZUI A;  1G2S A;  4CKB A;  1I4Q A;  3ULJ A;  1PRT B;  1T5X D;  4C3J H;  4KKT A;  5C4J B;  5E1F A;  5CV5 A;  1EEF D;  1G29 1;  5M5X B;  2B2V C;  4FXG C;  3K5L A;  2QW7 A;  1O78 A;  4GN3 B;  2K14 A;  4KKS A;  3T1Y L;  3A8I E;  4RHS A;  4FF3 A;  2VUM H;  1CKM A;  2PNH A;  1IBK Q;  4JW0 A;  5C3E B;  1CA5 A;  3PMF A;  2X69 A;  4OXP A;  5H1S E;  1M1K C;  4WOR A;  1K0S A;  2CWP A;  1K83 H;  3NBI A;  2NVT B;  4A3L G;  3H94 A;  1PTO D;  1LT6 D;  1D5M C;  3PUZ A;  4FXD A;  1PFS A;  4P71 A;  2E76 C;  2VQF Q;  4B3T Q;  1LTB D;  3BYT B;  2LY7 A;  3S17 H;  4MHE A;  4PG3 A;  2BDO A;  2A5H A;  3KFU A;  4DV1 Q;  4IUR A;  3PUV A;  1TWA B;  1TWC H;  4BY7 H;  1FL0 A;  1GUS A;  3PQI A;  2Y0S G;  3HOW B;  3GTL B;  4DR2 L;  1Y69 U;  5FLX L;  3PV0 A;  4LFC Q;  5M5Y H;  4Q5V A;  4JBM A;  4P74 A;  1ENA A;  1SE4 A;  1EIG A;  1V1O A;  1N34 L;  4IUT A;  1G6Z A;  3AEV A;  3GD7 A;  2F4V L;  3KF6 A;  4ZAI A;  5LMN W;  2QGQ A;  4DV4 Q;  3CAM A;  4XXE A;  1PTO C;  1R9T B;  1OXV A;  5K36 G;  3CCS A;  4DAY B;  4IUQ A;  4GLA C;  1PH8 A;  4DXG A;  1PYW D;  4A3E B;  2B3G A;  1VQ9 A;  3AU7 A;  3AFQ A;  1CSQ A;  2JE6 I;  2D0P A;  3M4P A;  4FF4 A;  3CCU A;  5C44 B;  2HQL A;  3KDF A;  1SYF A; 
#chains in the Genus database with same CATH homology
 1Z47 A;  4TRD A;  4TQU S;  4A3D B;  2KOL A;  4I7Z C;  5D65 A;  2NB0 A;  1TR5 A;  5COY A;  1B2T A;  2B63 B;  4L8J A;  2B2Y C;  1V1P B;  2F0Q A;  4C3J G;  1G8Z D;  1O7Z A;  1JC7 A;  1C8C A;  1BQQ T;  1F9Q A;  2R92 B;  2DN8 A;  1ILP A;  1EYC A;  1HQM C;  2F1M A;  1MSH A;  1MD2 D;  5E4W C;  4A93 B;  4PNY A;  2CVR A;  1HA5 A;  2HDM A;  1JOK A;  5CC4 A;  3OMC A;  2E2I B;  3VA7 A;  2O5J C;  3N52 A;  1SAP A;  5C0X G;  1SNM A;  4BA2 I;  1TKW B;  3V2T A;  1HHV A;  2D5D A;  5DM7 3;  4EQN A;  5IGC A;  1LT5 D;  3RLF A;  1CHQ D;  3NXW A;  5I6W A;  4L63 B;  3I4N B;  1DZ1 A;  1KTK A;  2J0T D;  3I90 A;  1U4R A;  3T13 A;  2K5W A;  2NWG A;  5CYU A;  5CV6 A;  1WTO A;  4KD4 A;  5K5P A;  2F0M A;  3J7A F;  3MXG A;  3RZD B;  1RTO A;  3SK4 A;  3P7J A;  1TY2 A;  2JP1 A;  1B4O A;  3FKI B;  1NSN S;  4C56 C;  4NP5 A;  1JE4 A;  3R2T A;  1SYC A;  4Q0F A;  4KK7 A;  3MWY W;  4RCO A;  3SHL A;  2CW0 D;  1B53 A;  3P20 A;  4EQP A;  1KNE A;  2F0P A;  3J81 E;  5KND A;  1JWM D;  3M7G A;  3NPP A;  4FO2 A;  3KK7 A;  1M8A A;  2WV6 D;  5JVH 3;  1NR2 A;  1S5E D;  3SK8 A;  1LO5 D;  1FNU A;  1Y8P B;  2QDB A;  3NWS A;  1F2Z A;  3GTP B;  4RWS C;  3Q0A A;  4RGO S;  1TQO A;  1CK1 A;  1TWH B;  2D2C C;  1DCZ A;  4B9X A;  1STN A;  3SK6 A;  2CW0 C;  2F0W A;  1BOS A;  4ID6 A;  1SYE A;  4N9P A;  3I70 A;  3L9A X;  2WAC A;  1MGS A;  1UEA B;  5G3L D;  3A56 A;  2I46 A;  3AMU A;  1SYB A;  4KV6 A;  4A3K B;  1Z6H A;  3E0J A;  2MJ8 A;  1OO9 B;  2WAQ B;  4DGZ A;  1CZW A;  2FMC A;  1HA6 A;  1O7L A;  1Y8N B;  3J81 L;  2F0F A;  2Q8T A;  1JCK B;  4LAA A;  1RF2 D;  1E0B A;  2A69 D;  5IT9 L;  4RH6 A;  5I9O A;  5CR3 A;  5TSS A;  2BE5 D;  2F0S A;  1WTV A;  4U67 3;  4QF4 A;  2KHS A;  3DXJ C;  1W6J A;  1B3A A;  4S3S A;  2F03 A;  3ITP A;  2R61 A;  1PDQ A;  2RA4 A;  1L0Y B;  1SNP A;  1QOH A;  3GV3 A;  1PZI D;  2DY8 A;  1ZXT A;  2C5C A;  2OEO A;  4KI0 A;  3NUC A;  1Q1B A;  4V0B A;  4XYQ A;  4J1M A;  5KYI A;  3Q23 A;  1STB A;  3MC0 B;  3DHQ A;  1KLG D;  1EWH A;  3JAM E;  1GJX A;  1ET9 A;  4ZRZ A;  2E74 C;  4RGM A;  3TDQ A;  5LL6 X;  1SSO A;  2HUG A;  3URY A;  3MAQ A;  1WCM B;  1PZK D;  2BE5 C;  1KDA A;  3X3N A;  3FDT A;  5KIX A;  4WRD A;  5A2Q E;  5I6Y A;  3QB3 A;  1PMR A;  3CRL C;  3FRP B;  4HSP A;  1VF5 C;  2O4X A;  2M9V A;  4A3J B;  2K5Q A;  1XTC D;  2K01 A;  2HCI A;  2IT1 A;  1WTP A;  2F0E A;  2DY7 A;  3M4Y A;  5DM6 3;  1Y8O B;  1AW7 A;  3KLS A;  3D3R A;  2NYZ D;  1HPC A;  1EZ8 A;  2B2T A;  4HR7 B;  4I65 A;  3MXU A;  2F0T A;  1HXY D;  1SEB D;  1H9K A;  4NKL A;  4PV1 C;  2JA7 B;  3GTO B;  4OO1 I;  1PRT F;  2D62 A;  4XQN A;  3BG3 A;  2EY2 A;  3HKZ B;  1LTR D;  3BDL A;  3QOJ A;  5A2Q L;  4PQX A;  1DOK A;  5T1I A;  2XRS D;  5CBE E;  3DWA A;  3HEJ A;  1A2T A;  5CV4 A;  1CZG A;  1E2W A;  4M1U B;  4C3H G;  5JAV A;  4E6I A;  3SR1 A;  1VMP A;  5CBA E;  1PRT D;  1CQF A;  5FK9 C;  1JWU D;  1LT3 D;  1IW7 D;  2PW7 A;  4IFD G;  2F0H A;  4HMI A;  4OGQ C;  4H13 C;  4RKL A;  5CGK A;  1TVX A;  1Q1E A;  4OO1 H;  2EYM A;  2JEB I;  1CM9 A;  1RHP A;  1H9J A;  3MFG A;  4KY6 A;  3F2U A;  3X3M A;  3S15 B;  2Q8I B;  2EYH A;  3M3Y B;  4IUN A;  1UUP A;  3OIP A;  3A8J E;  3A7A B;  2K28 A;  5IGG A;  1XWE A;  5CV7 A;  4AYB B;  5EPK A;  1H9R A;  3MVV A;  1BCP F;  1PFB A;  4WJW A;  1F2L A;  1CFM A;  1FYC A;  1IW7 C;  3IAY A;  2KED A;  1PZJ D;  3UI2 A;  1WTW A;  1NR4 A;  1ILQ A;  3C2P A;  1FNV A;  2YYZ A;  5KNC A;  1QJO A;  2B2U A;  2PO4 A;  1A3U A;  4HTH A;  3HOZ B;  2K33 A;  1EQT A;  4UDU C;  2KCN A;  3HOU B;  1KNA A;  1ENC A;  2K7V A;  2BCO A;  3OIQ A;  1OXT A;  4FXK C;  1IKL A;  3U9O A;  2K05 A;  4QMG A;  1FGB D;  4Z9C B;  2R3Z A;  3SEB A;  1WTX A;  1STE A;  5C0X J;  5EPJ A;  4CJ0 B;  4OO1 G;  1I4H A;  4KN7 C;  1T5E A;  3EA6 A;  3PUX A;  3D4D A;  5C0X I;  1II3 A;  2H4O A;  3A54 A;  2MHV A;  2QF7 A;  4QUF A;  4O42 A;  2PW5 A;  2PZT A;  2EXZ A;  1TT2 A;  3TZU A;  4BBS B;  4XQQ A;  1NUC A;  1D1I A;  1Y1V B;  1HCZ A;  2NN6 G;  1U4P A;  2F0U A;  2ID0 A;  1BXT A;  3IKJ A;  2ZXP A;  3K58 A;  5I9P A;  1GHJ A;  5C0X H;  4FF2 A;  1J8I A;  5EKL A;  2F0V A;  2L1B A;  4QIW B;  2RDH A;  4Y7N B;  1AFP A;  3K7A B;  1LTT D;  3V96 A;  5KGU A;  2F4I A;  1S5C D;  3U9S A;  1G91 A;  5FKA C;  2KEC A;  2JEA I;  1I50 B;  3H09 A;  2B2W C;  3HS0 C;  5E3F A;  2K32 A;  1BCP B;  3VR3 A;  2XRQ D;  4EGV A;  3TN2 A;  2IL8 A;  1PLF A;  1PXU A;  3RUZ A;  1UAP A;  3L7Z C;  5HGT A;  1SMY D;  4G7H C;  3KLS X;  2FJ2 A;  5JEA J;  4MN3 A;  1AEX A;  3VR6 A;  1KDB A;  3QJY A;  1AP0 A;  3A7L A;  4UAI A;  2PZU A;  3RMH A;  5JOB A;  2L9H A;  2G9D A;  1WVL A;  4IN3 A;  3KF8 A;  3QOL A;  2L4N A;  1JR0 D;  3E5S A;  3ERO A;  2QCP X;  3ERQ A;  1GUW A;  1SE2 A;  2A68 D;  2KA7 A;  5M9O A;  1LTS D;  2B8F A;  1O7Y A;  4U68 A;  1YNN D;  4FNF A;  1SMY C;  1R4Q B;  2WP8 J;  4G7O C;  1K8O A;  3I3C A;  2ZXR A;  3Q22 A;  3NWT A;  5JEA H;  1F9P A;  3WOF A;  1B9M A;  1ZEQ X;  4DK0 A;  5D3I B;  2J4X A;  3J7Y W;  4H0L C;  3LWU A;  1IYV A;  3LNN A;  3T56 B;  5C5M A;  2A68 C;  4X3K A;  3T4A C;  3G6J B;  3A8K E;  2R7Z B;  1DJR D;  1B44 D;  1OXX K;  5ELD A;  4KMU C;  2SDF A;  1ROD A;  3S1R B;  1IHZ A;  3GQB A;  1S5B D;  1U9R A;  3A55 A;  4RGT A;  3K0Y A;  1F77 A;  4RGN A;  3C1F A;  1SDF A;  2EJG C;  4IQZ A;  3Q24 A;  2L5T A;  2O5I C;  4HED A;  1HTL D;  1XX8 A;  3GP7 A;  1I4G A;  2VUM B;  3HRZ C;  2JXM B;  1HFN A;  1K83 B;  4XTC S;  2IX3 A;  2A6E D;  1SXT A;  5F2D A;  5NUC A;  5T1G A;  3OWF A;  5AFW A;  3S17 B;  3H91 A;  5IGF A;  3DMU A;  1TWC B;  4BY7 B;  3NBH A;  2PNR C;  4K6L A;  2KEE A;  4K2L A;  5JEA G;  2F3W A;  1A3T A;  1DYQ A;  4ULL A;  5C3X A;  2GA4 B;  2EYL A;  4F8M A;  2HQE A;  3K59 A;  2KUM A;  2B2V A;  2A6E C;  2EYF A;  3SVM A;  5DEH A;  4KY5 A;  4IFD J;  2XWB B;  1OXU A;  2LFN A;  4R8N A;  4K5W A;  4DK1 A;  5J22 A;  4HN7 A;  1NAP A;  2NVQ B;  3KBX A;  4IFD I;  4X3T A;  3G7L A;  4HCE A;  4OHJ A;  2SNS A;  2NTT A;  2ENB A;  1SBB B;  1WD0 A;  1EYA A;  5BN4 A;  4HMJ A;  2XVS A;  5M3F B;  2AUK A;  2TSS A;  4N9T A;  3H0G B;  1EU4 A;  2MGS A;  3NHH A;  1SYD A;  4KJN A;  1BUV T;  5KNB A;  4PMB A;  2BA1 A;  2A69 C;  4DFA A;  4IFD H;  2AWO A;  1U4L A;  2NVX B;  3QO2 A;  3MXN A;  5M3M B;  5ELE A;  1LAB A;  3EJI A;  1EQV A;  2E2J B;  2NVY B;  4A3I B;  2FFK B;  3OOC A;  4C1N I;  1EY8 A;  3I91 A;  2DNC A;  2K1B A;  3EFX D;  2B2Y A;  1STH A;  5EKI A;  1B50 A;  1JQY D;  4EQO A;  1EOT A;  1Y1W B;  1JB3 A;  2C9O A;  1QB5 D;  3S1N B;  4K8I A;  1EIH A;  4P2C B;  4CGY B;  4DAP A;  3HOX B;  1SE3 A;  2K04 A;  1E2Z A;  4RKB A;  1PFM A;  4G4K A;  1EYD A;  2A74 C;  2AQ3 B;  1ET6 A;  1RKN A;  3JAM L;  4CBV A;  2NTS A;  5IIF A;  5C5L A;  4ZYS A;  5C4H A;  2K5D A;  2N55 A;  3IFT A;  2J7Z A;  1QE6 A;  3BVG A;  2F3V A;  1C4Q A;  4F7X A;  3RD4 A;  4RHR A;  1TWF B;  4BY1 B;  2TMP A;  1RCV D;  1B9N A;  3SXH A;  2SEB D;  3FPP A;  3NK9 A;  3BDO A;  2F0I A;  2EYO A;  4C2M B;  2M2L A;  4DN4 M;  2PYK A;  4K2K A;  3ONA B;  3I4L A;  2HDL A;  1STY A;  3P75 A;  1QIL A;  3KLR A;  1GXD C;  2NN6 I;  2ZXO A;  3S16 B;  1D5Z C;  2X6L A;  4LJZ C;  1BDO A;  2EVB A;  2WKC A;  4XDX A;  3R3O A;  3VYT A;  2MUY A;  2XNA C;  4BA1 I;  3SK5 A;  5DNF A;  2JYO A;  3GTQ B;  5DAU A;  1Q8I A;  1CTM A;  1JWS D;  1TWG B;  1LLR D;  1PRT C;  5C4Z A;  3TME A;  4BWG B;  2NN6 H;  2LMC B;  5FO8 B;  5JVG 3;  1X3P A;  3D6C A;  1QCB D;  4BS9 A;  4ODG A;  1IKM A;  1MBY A;  2F0N A;  2IJ0 A;  3GTG B;  3K5M A;  5JPM C;  1G2T A;  2WKD A;  1MSG A;  3NQI A;  1BCP D;  1CQV A;  4FP5 D;  3BVZ A;  5BN5 A;  3IFD A;  4A3B B;  4RCN A;  4YIJ A;  5E4X A;  1JOR A;  1H9S A;  3KBG A;  1GUT A;  1STA A;  5JJZ A;  2H1E A;  2MP1 A;  4LMQ D;  3KUP A;  3WOE A;  3CKI B;  5C6A A;  3NE5 B;  4FF1 A;  1D6E C;  4XIG S;  1O80 A;  4V19 0;  1V43 A;  1F2M A;  1QWY A;  4C1N K;  1E2V A;  2K03 A;  3MZ5 A;  1TU2 B;  3LX0 A;  5LL6 S;  3VR5 A;  5IOC A;  1WD1 A;  4DAV A;  2JA6 B;  4L6T B;  2LKV A;  1I4R A;  2EZV A;  1BCP C;  2VXW A;  1PFN A;  3NSW A;  4XT1 B;  4K5X A;  3VYU A;  3HOY B;  3WDN A;  5KRU A;  1HFG A;  1BO0 A;  1U4M A;  4M8A A;  4C3I B;  3GO5 A;  3TP6 A;  2PQE A;  1X3Q A;  1FNW A;  3K6O A;  4NMZ A;  1WTR A;  5ISR A;  2F0L A;  2PZW A;  3I8Z A;  4WFN 3;  2JA8 B;  1PTO F;  2QEJ C;  1C48 A;  2RVL A;  1Q12 A;  2EYJ A;  3DEO A;  4ZUJ A;  1H9M A;  2XN9 C;  3PUW A;  3NTH A;  5FOB B;  4ME5 A;  1I6H B;  2FMM A;  2F0J A;  3S1M B;  5LHY 1;  1OXS C;  3MEH A;  3D31 A;  1EY9 A;  1SND A;  2KQ3 A;  3GTJ B;  1DON A;  5FO9 B;  4G7Z C;  1Q3L A;  1SJE D;  4FVM A;  4ZKC B;  2QIL A;  1I6V C;  4H44 C;  4HAE A;  2EJF C;  4A3M B;  1S4Z A;  2RSN A;  2FIN B;  5C4X B;  1EU3 A;  4PMC A;  3R2I A;  5CMD A;  2CQA A;  1ZKO A;  2A6H D;  4KHZ A;  3DEP A;  3QIA A;  2L11 A;  4EVO A;  3CRK C;  2X6G A;  4ZLT F;  3FPU B;  5I2Y A;  3M7N A;  1EY0 A;  2NUC A;  3K57 A;  1HUN A;  1VF7 A;  3MXP A;  2AUJ D;  1GUG A;  4IZ8 A;  2F0K A;  1SYG A;  3T16 A;  4K14 A;  4K5V A;  3S14 B;  3W3A A;  2RDG A;  3FMC A;  1Z7T A;  5EKK A;  1W6K A;  1EL0 A;  3FVQ A;  2PMZ B;  3OHX C;  3TP8 A;  2A6H C;  1SNC A;  1F2Y A;  1D5X C;  3BS1 A;  3VYS A;  4DU9 A;  3S2H B;  1IYU A;  3H3V C;  4OL7 A;  1ZYR D;  2Y0S B;  3BYY B;  1RD9 D;  1LTG D;  1L0X B;  1I4P A;  2B2T C;  2JA5 B;  1TY0 A;  1F9S A;  3PIP 3;  4KD3 A;  4KN4 C;  2IX0 A;  1RTN A;  1GUO A;  4J8Q A;  5A35 A;  2VB3 X;  1AZP A;  4XT3 B;  1CHP D;  4O1N A;  1EY6 A;  5IGB A;  1EWC A;  1A6X A;  2AQ2 B;  3V05 A;  5IOD A;  4GZY C;  2QKI C;  2EOT A;  3D8G A;  1YNN C;  1LAC A;  5KEE A;  4CJ2 C;  1PTO B;  5EBC A;  2AQ1 B;  1ZYR C;  1YNJ D;  3EQL C;  2EDG A;  1S5D D;  3QG1 A;  1I3Q B;  3I4M B;  1QNU A;  3SDZ A;  1ESF A;  4C3J B;  3BDC A;  3OMG A;  3MA2 B;  1TS4 A;  2F0O A;  3OW7 A;  4B9W A;  1EY4 A;  2IX1 A;  3CU7 A;  4QCL A;  3O13 A;  2EY6 A;  3DM1 A;  1GUN A;  1HUM A;  4CJ1 B;  2SOB A;  1FD7 D;  4RA8 A;  2RDF A;  1RDP D;  3OPO A;  2LS0 1;  5ELF A;  1YNJ C;  2XSC A;  3EVQ A;  4HSV A;  3HP3 A;  2JSO A;  3GV6 A;  3L3O C;  4RFB A;  3R93 A;  5IT9 E;  1KAA A;  4DA2 A;  3VR2 A;  2OXP A;  1DXM A;  4DAY A;  3I73 A;  5M5Y B;  4FYD A;  3P1H A;  5EQ0 A;  3J80 E;  1S5F D;  2IPK D;  5G3L F;  1IL8 A;  1MI2 A;  1JOQ A;  2WIN B;  2B39 A;  2N88 A;  4KY7 A;  1CT1 D;  2R6G A;  2B2U C;  1VCI A;  3GTM B;  1TS2 A;  5ELB A;  3TZD A;  3C1E A;  5KYL A;  1UNS A;  4K8J A;  1J9O A;  1V1P A;  1D2B A;  2XIW A;  3D6W A;  4B08 A;  2IW3 A;  3D4W A;  3ZYY X;  1SFO B;  1A3V A;  1LTA D;  4IUU A;  4HCS A;  2RSO A;  1NCV A;  3SE0 A;  1X32 A;  3DUZ A;  2VNU D;  3MFY A;  2YU9 B;  4XYO A;  5JPN C;  2Q8R E;  1V8Q A;  1ICW A;  2XWJ B;  4ILW A;  2Z1C A;  3HOV B;  2KCC A;  4F88 A;  3D4R A;  4JBW A;  1KDC A;  4KKU A;  3C46 A;  3M85 A;  4IUP A;  1BNZ A;  3CQZ B;  4TKO B;  2EYP A;  5J1Z A;  3GTK B;  1JOO A;  3J80 L;  1AZQ A;  1GHK A;  4LK1 C;  2KJX A;  5BN3 A;  2EE1 A;  2B2W A;  1ENF A;  1BBX C;  5D14 A;  1TII D;  2D9U A;  3K5O A;  5CV9 A;  1LV9 A;  2EPB A;  2F0G A;  5HUR A;  5J39 A;  3VR4 A;  2SNM A;  2EJM A;  1BR9 A;  2EY5 A;  3T51 B;  2DNE A;  1EY5 A;  3ND9 A;  1M4V A;  1H9S B;  3TP5 A;  2R93 B;  2I07 B;  4DNT B;  1EY7 A;  4NDX A;  4CKC A;  3VA5 A;  1CA6 A;  1KAB A;  2PPB C;  1DD2 A;  4QB4 A;  3ND8 A;  2KVM A;  1HQR D;  1K8M A;  1B1Z A;  2A73 B;  3OWE B;  2B8G A;  2ICE C;  3PIO 3;  2ICI A;  5I4D A;  5FO7 B;  3DWQ A;  5M5W B;  2RQX A;  4X3U A;  4A3G B;  4IUV A;  2VB2 X;  2G9H D;  4JK1 C;  2OF1 A;  1VDZ A;  1SJH D;  2L12 A;  1SNO A;  1DM0 B;  3TP7 A;  3W2D A;  3PO2 B;  1HTP A;  1SNQ A;  4DXF A;  3I72 A;  5EBD A;  3BZD B;  1RJT A;  1FR3 A;  4MIU A;  3HG9 A;  3NP8 A;  3R8B A;  1DOM A;  1XYI A;  3NQT A;  2E75 C;  4H7B A;  3C3L A;  4NW2 A;  4BBR B;  4J6H A;  2F0D A;  4G57 A;  3IL8 A;  5EJW A;  3BVM A;  3RZO B;  5EGT A;  1QG7 A;  4DNR B;  1LTI D;  5IGE A;  1KLU D;  4KHV A;  1VMC A;  3PO3 B;  2BDN A;  3TBI B;  4ABN A;  1HRJ A;  1D1K A;  5ELC A;  1TS5 A;  5C3W A;  5IGD A;  1JIC A;  3LWE A;  2L55 A;  4ZQ3 A;  1ESR A;  4K6D A;  3Q6S A;  4PMW A;  2IWH A;  2NZ1 D;  4IAL A;  3N6R A;  5I2X A;  3MHB A;  3HZX A;  4RAU C;  3CHB D;  3VYR A;  2M00 A;  2E2H B;  2K6A A;  1LT4 D;  2L0C A;  1EEI D;  1TS3 A;  4F87 A;  2BA0 A;  4R8I A;  2EY1 A;  2V4D A;  2HCC A;  1BF4 A;  4CHT B;  3J7A V;  4ZKB B;  4C3I G;  1ONL A;  3TSS A;  2Z8L A;  3AB9 A;  3E6Z X;  5D3D A;  2WII B;  2E2D C;  2Z4H A;  1Q90 A;  2NBF A;  3S2D B;  4C3H B;  3NTI A;  1DOL A;  1A2U A;  1STG A;  1A15 A;  1I4X A;  4R9W A;  4OIK A;  3S9W A;  2CHB D;  2WB1 B;  2O2L D;  4KTA A;  5COR A;  3K5N A;  2MPM A;  2Z4I A;  2RBM A;  1XXG A;  2BOS A;  1EZ6 A;  4OIJ A;  3QWN A;  3M4O B;  1QNK A;  1R4P B;  3T53 B;  3PUY A;  1F9R A;  3H6M A;  5K36 H;  4X3S A;  1CI3 M;  3DWP A;  4ZK9 B;  1ML0 D;  1AN8 A;  3OSO A;  2OT2 A;  3FEW X;  4TSS A;  2RKS A;  4XQJ A;  1WTQ A;  5FLX E;  4DF7 A;  1PTO H;  3HGB A;  1EFI D;  4CKE A;  1GOZ A;  2FHT A;  2ZT9 C;  4A3F B;  3S1Q B;  3NTK A;  5EPL A;  3MTS A;  4KJO A;  4QUC A;  2PCF B;  2AWN A;  4ZUI A;  1G2S A;  4CKB A;  1I4Q A;  1PRT B;  1T5X D;  5C4J B;  4KKT A;  5E1F A;  5CV5 A;  1EEF D;  1G29 1;  5M5X B;  2B2V C;  4FXG C;  3K5L A;  1O78 A;  4KKS A;  3A8I E;  4RHS A;  4FF3 A;  5C3E B;  1CA5 A;  3PMF A;  2X69 A;  4WOR A;  3NBI A;  2NVT B;  3H94 A;  1PTO D;  1LT6 D;  1D5M C;  3PUZ A;  4FXD A;  2E76 C;  1LTB D;  3BYT B;  2LY7 A;  4MHE A;  2BDO A;  2A5H A;  4IUR A;  3PUV A;  1TWA B;  1GUS A;  3HOW B;  3GTL B;  1Y69 U;  5FLX L;  3PV0 A;  4Q5V A;  1ENA A;  1SE4 A;  1EIG A;  1V1O A;  4IUT A;  1G6Z A;  3GD7 A;  4ZAI A;  4XXE A;  1PTO C;  1R9T B;  1OXV A;  5K36 G;  4IUQ A;  4DXG A;  1PYW D;  4A3E B;  3AU7 A;  2JE6 I;  4FF4 A;  5C44 B;  5CV8 A;  1SYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...