3I3CA

Crystal structural of cbx5 chromo shadow domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
57
Chain Sequence
NDIARGFERGLEPEKIIGATDDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 5
publication title Crystal Structural of CBX5 Chromo Shadow Domain
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 13
structure length 57
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i3cA00
2L1BA 1F9SA 2L4NA 1WVLA 2JYOA 4IUPA 1BO0A 2B2TA 2Q8RE 2RSOA 1DONA 1VMCA 5E4WC 5JJZA 2HCCA 1NR2A 1SDFA 1BBXC 1G2TA 3I3CA 1WTQA 3TZDA 4RA8A 1X3QA 1X32A 3DEPA 2VXWA 2N55A 2Q8TA 1VMPA 5D14A 3GV6A 2NWGA 1IKLA 4ZAIA 2HDMA 1QNKA 3GV3A 2H1EA 1ICWA 1O80A 2FINB 1F9QA 1NAPA 4ZKCB 5CMDA 1AP0A 4CJ0B 1RODA 1E0BA 2K04A 2MPMA 1U4MA 3LWEA 3ONAB 5E4XA 1BNZA 4U68A 2DY7A 2NYZD 1A15A 1WD0A 4MHEA 2B2UA 2RSNA 4RWSC 4RAUC 1WTVA 1DOMA 5EQ0A 2R3ZA 2CVRA 3G7LA 5EKIA 4DN4M 5D65A 2L9HA 4X3TA 1LV9A 1IKMA 2B2VA 2IL8A 3FDTA 1IL8A 1HUNA 4XT3B 3UI2A 1Q3LA 4X3SA 1NR4A 1EQTA 4HEDA 2KOLA 2RVLA 2B2YC 3HP3A 4HSVA 3N52A 1G91A 4CJ2C 4XT1B 1RJTA 2K01A 1B53A 2FJ2A 1GUWA 2X6GA 4ZLTF 5CORA 5COYA 3DM1A 4O42A 1WTXA 1QE6A 2EE1A 2K05A 2FFKB 3I8ZA 1PDQA 2X6LA 4OIKA 5EPKA 1DOLA 2KEEA 1ESRA 1DZ1A 4UAIA 2HCIA 5AFWA 5EPJA 1HA6A 1ML0D 4X3UA 5CBEE 1G2SA 1U4PA 1PFNA 1XX8A 1QG7A 3I90A 1X3PA 3QO2A 1KNEA 1EIHA 2L11A 2XIWA 4XDXA 2J7ZA 2B2TC 2D9UA 1CM9A 2KEDA 1F2LA 2M2LA 4IUVA 2B2WC 4QUCA 1MSGA 4X3KA 3Q6SA 2MP1A 4CJ1B 1WTWA 1RTOA 1U4LA 1XYIA 3IL8A 2K1BA 1CA5A 1MSHA 2FHTA 4HAEA 1F9RA 1KNAA 2MGSA 2RA4A 3DEOA 4QUFA 3SVMA 1ZXTA 1G6ZA 1M8AA 1JE4A 2K03A 1J8IA 2SDFA 1CA6A 1WTPA 1O7ZA 1S4ZA 3P7JA 4R8IA 2DY8A 2FMMA 1WTOA 1TVXA 1HRJA 3TN2A 1AZPA 1HUMA 1JICA 1F9PA 2L12A 1NCVA 3KBXA 3MTSA 3D6WA 1ILQA 1C8CA 1MI2A 1BF4A 4IUQA 2BDNA 4IURA 4IUTA 2KVMA 1EOTA 2B2UC 2B2WA 5EPLA 2EPBA 4IUUA 1WTRA 2EOTA 1SSOA 2X69A 1ILPA 2NZ1D 2K28A 1HFGA 3FPUB 3IFDA 2B2VC 3MWYW 5DNFA 1PFBA 4ZK9B 5EJWA 4NW2A 1AZQA 1B3AA 2B2YA 3KUPA 4LMQD 4MN3A 1WD1A 1RTNA 1B4OA 1EIGA 2N88A 1PFMA 2MJ8A 1O7YA 3H91A 4OIJA 4R9WA 1HHVA 2HDLA 1SAPA 2KUMA 4HCSA 1J9OA 1EL0A 4ZKBB 1PLFA 2KECA 5T1IA 3F2UA 1B2TA 1U4RA 2JP1A 3R93A 1DOKA 5CBAE 1HFNA 1MGSA 2HUGA 1B50A 3I91A 5T1GA 1RHPA
chains in the Genus database with same CATH superfamily
4CDDC 3R3OA 5FLMH 2RSOA 2EIFA 5A35A 2F0FA 3EBEA 2A5HA 5ELCA 3GTMB 4ODGA 4DXFA 4JPBW 4JBKA 1E24A 1CSQA 2R92H 4JOIC 1IYJB 2AQ3B 1AP0A 4JYAQ 4DF7A 4YWKA 4U68A 1SN8A 5KEEA 3S1RH 4CBVA 5IYDH 4KY6A 2VL6A 1EQVA 1EU3A 4IUNA 5CV8A 2EYHA 2JA7G 1KRTA 1OXVA 2CVRA 2L9HA 4L5SA 4KN4C 4X3SA 1EYCA 3JAMi 4HMJA 3H0GB 4BXXG 4IJLA 2QGQA 4YHHL 1OXUA 3MXUA 1DJRD 2NVYH 1TR5A 3CC7A 3HOZH 2LFNA 3L7ZC 4FXKC 5M3MH 4QL5A 4OIKA 4B3RL 2QDLA 4GN5A 1OTCA 4UAIA 2SEBD 5IYCH 3PIOA 1K73C 4RKBA 1SE3A 2B2WC 2K6AA 2ATWA 3NPPA 1EQQA 4Y52H 1ET9A 1YHAA 4B3TL 1UE6A 1XMQL 2PYKA 3BJUA 4DV3Q 2NVXH 3PO3H 1UE5A 1I6HH 1STNA 4OONA 2JSOA 2R93B 3BVZA 1KAWA 1G6PA 1HUMA 1EWHA 3D31A 3MTSA 3I4MB 3PF4A 4IURA 1L0YB 1Z7TA 4DGZA 1WTRA 2K32A 4K6LA 2HIVA 4JI5L 1OXXK 5EJWA 3K7UC 3MC0B 4MN3A 4BBSH 2A19A 3M7NA 1TY0A 1SAPA 2Q8IB 1SBBB 4A3IB 3NWTA 4A3MH 1HNXQ 5DM63 1TS4A 3D0FA 1Y8NB 4L5TA 3A56A 2D2CC 3I91A 1RHPA 4IPGA 2L1BA 2D62A 2K52A 2M9VA 4A3LH 3SK5A 1G2TA 2JA7B 3Q0AA 1ONLA 3HOVG 2KA7A 1UWVA 1GHKA 1N32L 1N33Q 2K5HA 1NBWA 2YYZA 4A75A 1EWIA 4GKKQ 2H1EA 3NK9A 4YWLA 1W2BA 1E0BA 5CC4A 1SNCA 3A8JE 4DR2L 2AUKA 5IYBH 3BZKA 2NYZD 1B8AA 3VR5A 1X55A 4PZ6A 4R4OA 4CKCA 2VNUD 4R8NA 4F88A 1QILA 2WINB 1PHJA 3PUXA 2RDHA 3KLWA 1NR4A 1CHQD 1LT5D 4PMBA 5C3XA 3PUWA 4K8IA 5M3MG 3F1ZA 4OX9L 4KY5A 5JJKA 3SK6A 4BWGB 2Q2UA 1RJTA 1B53A 3VR2A 3S15H 2X6GA 5IYCG 4A3KB 3C3LA 4DR3L 4HJ7A 4G7OC 2KCMA 4P75A 4X64L 2RCFA 3I90A 4K8JA 4BBRH 1QUQB 4B08A 4YCWA 4DR6L 3TP7A 3UDGA 4QCLA 1XTDA 2YTYA 2IX0A 4JI3L 4DK1A 2RQXA 4DR4L 4K0KL 1SMYC 5IGGA 3KJOA 1GUSA 5IGBA 4H13C 3K59A 1UAPA 1VQEA 3OHXC 5I9OA 3GTGH 5LMNL 5EPLA 3GTOB 4MIUA 4YHHQ 4BBSG 1YITA 2X69A 4DUZL 2A6EC 1XNQL 1X6OA 4DV4L 1IXRA 2ZJRA 3A74A 2B2VC 1A6XA 2F3VA 4B3RQ 2NN6G 4POFA 2OF1A 3DWAA 2B2YA 4RHSA 4A3MG 5DEHA 3HOVB 5C44H 1KABA 4HSPA 1SE8A 2YU9B 3J81c 1EU4A 3AFPA 3CCVA 2BE5D 5T1IA 3HS0C 1B2TA 1LYLA 2JP1A 3RZDH 3T4AC 3WOEA 4KKTA 2HUGA 3M3YB 4IOCA 4B3TQ 4BY7G 1QZHA 1CKNA 1A3VA 1JWSD 1XMQQ 5FO9B 2R7ZH 4YY3L 2K5WA 3S16H 4K6DA 5C5LA 1TWFB 1E2VA 4JK1C 3DEPA 4XTCS 5IT9c 4OGQC 3NTKA 2HDMA 4U673 3GV3A 5IYBG 1U4MA 3S1MH 4JI5Q 3LGJA 1PRTF 4DK3C 4LFBL 3F2CA 1A15A 1BOSA 1X54A 1EEFD 1GM5A 2F0SA 1IW7D 3D6CA 4NKLA 5LL6S 4NXML 5IODA 4HSVA 3K0YA 4A3JG 3PF5A 3J7AV 1PH4A 2K01A 4C3HB 2FXQA 2BA1A 1CHPD 5K5PA 3D4DA 1RDPD 3BZCA 2F0DA 2EXZA 1IYUA 4BBRG 1E2ZA 3TDQA 4ME3A 1VQJA 3I73A 5G3LD 3NELA 4A3CH 2E2IH 1N32Q 4GNXA 5A2QE 5JJIA 1YJNA 1BDOA 3HOWB 2QCPX 2JA9A 1EFID 3GDEA 4X65L 1YEZA 4EGVA 1TU2B 4DR2Q 4FF2A 5FKAC 2F52A 1WCMB 1SNDA 4F7XA 1S5DD 4RGMA 2Z1CA 2A1AA 2JA5H 4G4KA 2F0NA 3KF6B 1C0AA 2IX3A 4H0LC 2B63G 4IUTA 4OX9Q 2VQEL 2B2UC 5IP7H 5CV6A 2EOTA 4BY7B 1ZKOA 1B7YB 4DR3Q 1Q8IA 4JI6L 5I6WA 1GUGA 2BH8A 4X64Q 4B3SL 4R9WA 2PQEA 2DN8A 5ELNA 2HDLA 1C9OA 3GTQH 4K14A 1S72A 1FJGL 4DR6Q 1KDAA 1YNXA 4JI4L 3RN5A 1JWMD 1Y1VB 1D6EC 1BO0A 1E1OA 2F0EA 4JI3Q 4QIWE 2MHVA 4KK7A 3PSIA 4DR4Q 3SR1A 1J5EL 4K0KQ 1B3QA 5C4HA 2UU9L 2UXBL 5BN5A 3GTKB 2NWGA 1SNMA 3Q23A 3S2HB 1MIUA 2EJMA 1QNKA 5LMNQ 4A3JB 2QW7A 2EXDA 2B39A 2TSSA 4DUZQ 2K50A 2F0KA 1XNQQ 1G291 1NNXA 1NTGA 3ND8A 4XQNA 4DV4Q 5FO7B 1PH7A 1BKBA 1DCZA 2Z4IA 3H09A 1CZGA 2KENA 1DOMA 2JQOA 1GOZA 5EQ0A 3ULJA 3G7LA 4DN4M 1VF5C 5JJLA 3FDTA 4WJWA 1U0LA 3Q8DA 1NMGA 1I50B 2H4OA 3FMCA 3MHBA 5C4XB 2V4DA 4L5QA 2C9OA 4ILWA 1VQMA 4A3CG 4YY3Q 4UP9A 2DJGC 2K75A 3K7AH 1X3PA 2F0PA 2B63B 1CQVA 4QUCA 4LF9L 4P73A 4YIJA 3S17H 1NJIC 4R4IA 1I3QB 3RR5A 4DR5L 2WB1G 2QKIC 4LFBQ 1ZXTA 2E75C 3CCRA 4JOIA 2JA5G 2SDFA 1V43A 3NBHB 1S4ZA 5JPNC 3VYRA 5C0XH 1JJGA 1HTLD 5C3EG 3HKZE 3FRPB 4HJAA 4LNQA 4NXMQ 3ZYYX 4C1NK 4DV2L 1SROA 4KJNA 4HJ8A 4V0BA 3EN2A 1TS3A 2Y0SG 4JG2A 1XJVA 1XMOL 2ZTCA 1O7IA 1O78A 1IYVA 3FPUB 1TWGB 4GN3B 2JEBI 4LAAA 1KLUD 3PGZA 1VQOA 2F0JA 1R9TH 3VDYA 1SYGA 1PFMA 5C0XI 5ELOA 2PNHA 1SNPA 1FVIA 3MA2B 1STEA 1U4RA 2A69D 4X65Q 5ELFA 1QUQA 2GN5A 5K36H 4LF8L 3BDLA 2ZXOA 5H1SE 1NUCA 1SFOH 3FHWA 3CC2A 5E7NA 4A3GH 4X62L 5AJ3L 1JORA 1OXTA 5C4JH 1VQ8A 2I07B 3LWUA 4ZAIA 1MJEA 2JA6H 5DLQE 2OT2A 2VQEQ 2B8GA 4DNRB 2J4XA 4F87A 2EYOA 1IW7C 1S3OA 2WKDA 3M4OB 3PUVA 1PXUA 4Z9CB 3T16A 1K8OA 1L2FA 1EY5A 4JI6Q 1LABA 4A3BG 4MHEA 2ZTEA 1UUPA 2G9HD 5KYIA 3A0JA 3ZJYC 3JAME 3RMHA 1FGUA 1SYBA 3TQYA 1SJHD 2XWBB 1FJGQ 3CD6A 2YTXA 2NVQH 2RVLA 1Q12A 3FKIH 3R8BA 4ALPA 4JI4Q 1XNRL 4NP5A 4L6TB 4ZLTF 1BUVT 5I9PA 4DV5L 1S40A 1J5EQ 1EZ6A 2A74C 1DZ1A 2UU9Q 2UXBQ 1PRTD 3EJIA 1QVCA 4DK6C 5M5YB 5C3EB 2B2TC 1CM9A 1J6QA 1XPOA 5CV9A 3CXCA 2Y0SB 2L15A 1GHJA 1H9RA 4CGYB 4DR1L 4HCEA 1D7QA 2PMZE 1LTSD 3SVMA 5C0XG 5M3FH 1B1ZA 3HKZG 4J1MA 4DKAC 4KKSA 2MFIA 1TKWB 3GQBA 1VQ4A 4ZCKA 1AZPA 3WDNA 4QIWB 1BF4A 3IAYA 1EIYB 2K14A 1TWAB 1SJED 2F0QA 4DAVA 3MXPA 2D5DA 5E1FA 3L3OC 3CC4A 2LY7A 2DUDA 2CFMA 2AWOA 2Q2TA 1CKNB 1M90C 2VS1A 3VR3A 2OTLA 1T5XD 4A3EG 4OWWB 4H7BA 2L0CA 5FLXE 4O0AA 4XYQA 5K36G 5CGKA 3A7LA 1XWEA 1KIXA 4LF9Q 1IZ6A 4A4IA 3R93A 2RHSB 2R61A 4DR5Q 2Z0SA 3W1GA 1PVOA 4A3BB 1IHZA 4P74A 1H9SA 2HCCA 4ZUJA 1N36Q 3I3CA 1D5ZC 3CCJA 2O5IC 2HT1A 3JC66 1VQHA 2XN9C 1JJCB 1EIFA 2ASBA 3BZDB 4DV2Q 5CV4A 3X3MA 2WAQG 2XSCA 4YCUA 4N9PA 4DNTB 1LM0A 1TWHH 3SHLA 2Q2HA 1QCBD 1V1PB 4RWSC 3G6JB 4RCOA 3CQZH 3PIPA 2B2VA 3G48A 1ASYA 2F0TA 4GNXB 4Q0FA 1ZEQX 4X66L 4LF8Q 4JV5L 5EBCA 3MFYA 5JOBA 1FYCA 3J80c 1STGA 2Z6BA 1EYGA 1Y14B 3HKZB 3K5MA 2PZWA 1WTXA 4IPCA 1NY4A 2EYFA 3GD7A 4X62Q 5AJ3Q 5C0XJ 2UXCL 3CKIB 5G3LF 2LS01 2OWOA 1JOOA 2P5ZX 2A68D 2SNSA 4IFDH 2V1CC 1HZBA 3W1BA 3J81i 5M3FG 3DM3A 1SYFA 1K0SA 2JA8H 2CH4A 3MVVA 1KNAA 2MGSA 1I94L 1G6ZA 4ZQ3A 1IL2A 1PH3A 4A3EB 2GVAA 2O4XA 1KAAA 2KBNA 2EYLA 3CCQA 1O7ZA 1PV4A 3SK4A 4KD4A 4IFDI 3QWNA 1XNRQ 1EOTA 3PCOB 1I4PA 3H3VH 1JE5A 2EJGC 2K28A 2K5NA 1HFGA 1PYBA 4DV5Q 5GQOA 2A69C 4XYOA 3CF5A 3HKSA 1SNOA 1FNUA 1K83H 1YI2A 1RTNA 3RZOH 5JAVA 1KLGD 4AYBG 1SMXA 3DUZA 4CKBA 4AIMA 3FPPA 2BCOA 1H9KA 1Z47A 4QGUA 3S1QB 3H3VI 1JCKB 3PV0A 4DR1Q 5J39A 3CRLC 5GAEC 3J80L 5ELBA 5GADC 3TZUA 4RFBA 2E2JH 2VXWA 1X3EA 1VMPA 2YV5A 2EVBA 3NBHA 2YTVA 4A93H 4RGOS 2F0LA 2RDFA 4PQXA 2K5DA 1NAPA 4ZKCB 2F0MA 1YBYA 2MPMA 3LWEA 5FLMG 1BNZA 4DK0A 3CMAA 3M85A 1MJCA 4JI8Q 3Q24A 1F2ZA 2OCEA 4DXGA 4S3SA 2B2UA 1PA6A 4JI2L 2RCNA 1Y1WH 3CCLA 1HA5A 4C3IH 4WJ3M 2PMZB 3OTOL 5GROA 2CCZA 3HOYH 1HUNA 3E9HA 1VQGA 5KIXA 1PRTC 2VW9A 2R92G 4G7ZC 1LTLA 3EQLC 3N52A 4Y7NH 2JJQA 4BY1H 1OO9B 4MTNA 5GAGC 5IYDG 3O13A 1P16A 4CDCC 1PZJD 1V1OA 1HZCA 2VZAA 4KHPL 1PTOH 1GXDC 1A2TA 1SLJA 1WTWA 4I7AA 2XNAC 3K0XA 3W2DA 3HEJA 4KV6A 4R4TA 4UHVA 3HOZG 2PZTA 4EQNA 2F3IA 2WIIB 3HRZC 4JVZA 2LKVA 1WTOA 1LT6D 1UEAB 3SGIA 1S5ED 3QJYA 5JVG3 1VQPA 1RIPA 2F0IA 4X6AH 4X66Q 1TS2A 4JV5Q 1LT3D 1STYA 1TWCH 2XRQD 3D3RA 3VA5A 1VCIA 4KY7A 2NZ1D 3ND9A 5IP9H 1STBA 1VQIA 3SK8A 3RUZA 2QF7A 1GD7A 3PO3G 4A3DH 4K5WA 4CHTB 2UXCQ 1B9NA 3FP9A 5I4DA 1HHVA 3KYHC 4HCSA 4LF7L 1LTGD 3RN2A 2EY5A 1L1OC 1SRUA 4P2CB 2IHEA 3GTJH 1L0XB 2LSSA 1I94Q 4IUPA 5LHY1 3BVMA 1SDFA 2OQKA 1QOHA 3ER0A 3AU7A 2EY2A 5J3BA 1NSNS 3CCMA 2WKCA 3S14H 4KMUC 1E7ZA 1W6JA 2R92B 2OEOA 1X9NA 3ITPA 3S1RB 2DY7A 1JOQA 3G6EA 3F2BA 4A3LG 1WTVA 2F0GA 2E8GA 2NTTA 3DXJC 1HNWL 1A3UA 4BY1G 1N34L 4IFDJ 2XVSA 3U4ZA 1W3SA 4J8QA 4CDEC 2NVYB 4CJ2C 3HOZB 3GTLH 4F8MA 4DV6L 1AFPA 1PRTB 4JI0L 5M3MB 1WYDA 1GUWA 2A68C 1GVPA 3E0EA 4ZUIA 1PDQA 3HOXH 4HN7A 2HCIA 1ML0D 4X3UA 4LF6L 1KRSA 2AUJD 4GLAC 1DGSA 1PFNA 3TEHB 5I2YA 4L5RC 1GUTA 2L11A 2XIWA 4NB3A 3MFGA 1CKOA 3CMEA 3I2ZA 4B9XA 5C5MA 1UEBA 2NTSA 1CA5A 3OWEB 1AEXA 2SNMA 2EZVA 4HIMA 3S1NH 1FNVA 2NVXB 2C35B 3QB3A 3PO3B 4JI2Q 4DAYA 1I6HB 1AN8A 4KD3A 1DYQA 1S5BD 1V1PA 2UXDL 2E5LL 3OTOQ 1H9MA 4RGTA 1BCPD 2Z8LA 4QJFA 1BBUA 1XXGA 3KBXA 1LUZA 3LX0A 4OELB 4BA2I 4AQYL 1QB5D 1CKMA 5DNFA 1CTMA 3MWYW 4BBSB 1PFBA 1AZQA 5C3WA 1B3AA 3KUPA 4A3FH 1H9SB 1VS0A 1Q1EA 4A3MB 2KUMA 4HJ5A 1EFWA 1GKHA 3A5ZB 3OSOA 1R4QB 2WB1E 1DOKA 1T5EA 1MGSA 3OMGA 1XPUA 3KLSX 3QG1A 3GTPH 4HIOA 1EUJA 1VQ6A 1HJPA 3KLSA 1L1OB 2JYOA 2B2TA 4PV1C 5JEAH 1DONA 5GAHC 3JAML 4DPGA 3PO2H 5M5XH 2A8VA 5C44G 3I55A 5I6YA 1Z6HA 3NBIA 3K57A 4QQBX 3BDCA 3UDIA 3W3AA 5M5WH 2A6HD 1U5KA 2Q2IA 1GO3E 2HQEA 2Y0SE 1CI3M 1K3RA 3KBGA 1ICWA 4C2MH 3F2DA 1KQSA 4IO9A 3HG9A 5D3IB 4DFAA 2O5JC 1G51A 2RBMA 2R7ZG 3QOJA 4LWCA 2XGTA 3A8IE 2NVTH 3LNNA 4LF7Q 1O7LA 3NEMA 1IKMA 3EVQA 2GA4B 2ZT9C 3U50C 3M4YA 1CT1D 4FF1A 1JOKA 4LF5L 3D8GA 3S15B 2NB0A 1HR0W 2DNCA 5IE8A 2EE1A 3SDZA 4UY8C 1W6KA 5IGEA 2PO4A 3TSSA 3VR4A 4ID6A 2CH4W 4BBRB 4KHZA 1G2SA 4J15A 4PMWA 1F2LA 3CAMA 1VQCA 3I4LA 3T1YL 4RCNA 1XYIA 4JC0A 3L9AX 4DUYL 2K1BA 3I4NH 3GO5A 2EYJA 2JEAI 1D5XC 3P1HA 5FLXL 3NE5B 4C3JH 4LUVA 4AH6A 4GKJL 4RHRA 1C7YA 1HNWQ 1EY7A 1LTTD 1STHA 1N34Q 2AHOB 2ICIA 5IGCA 1MI2A 3GTGB 5D3DA 1V8QA 1HTPA 1I4HA 1Z9FA 4A3FG 3KJPA 4HMIA 4DV6Q 4FF3A 4JI0Q 1PFSA 2E2HH 3S2DH 2F0HA 3IFDA 3BYYB 4WRDA 1WOCA 2PW5A 5C44B 3HOUH 1EWCA 1KDBA 2O2LD 4LF6Q 1KXLA 2VUMH 4UP8A 3RZDB 3G71A 3D4RA 4EX5A 2PW7A 5IP7G 1S5FD 2DGYA 3V96A 3PIO3 1JMCA 3PO2G 3MAQA 1F9SA 2R7ZB 1S5CD 3S16B 5JJZA 3UE0A 3J80i 3TZDA 1K0RA 1X3FA 1CUKA 2BE5C 2K5QA 2UXDQ 2E5LQ 1DM0B 1Y8OB 3G4SA 4OEMB 4K5VA 3GTMH 1IKLA 2MNAA 1KHIA 4AQYQ 3NUCA 3KDFA 5CMDA 4FO2A 4BS9A 4CJ0B 1LTAD 3S1MB 1FL0A 5I2XA 2L55A 2NBFA 3M4PA 1STAA 1ICFB 2DJFC 3CHBD 2JXMB 1ASZA 2RHQB 3A7AB 4X3TA 1LV9A 4B3ML 2XRSD 1EQTA 1RD9D 1K9MC 2KOLA 1RCVD 4IALA 4MTKA 1FNWA 4HR7B 3H0GH 4IPHA 3BDOA 5BN4A 1EOVA 3J7YW 5CORA 4UP7A 1QE6A 3I8ZA 2X6LA 3L2PA 3T53B 4DR7L 2E2IB 3T56B 2ZJPA 5AFWA 1HA6A 3AQQA 3J81E 1Q7YC 2F0UA 1QNUA 1KNEA 4XDXA 3D4WA 4B3SQ 1GJXA 2WAQE 2L5TA 2HHHL 1U4LA 1BCPC 2C5CA 4FVMA 3J7AF 1MD2D 3TMEA 3RNUA 1CQFA 3STBD 1X3GA 2A73B 2WB1B 1ENCA 1HZAA 1MHWC 1J8IA 2D0PA 3P7JA 5IT9E 2R93H 2JA5B 3U9OA 2IPKD 2F0VA 1TIID 5EKKA 2ALYB 4LF5Q 3I4MH 1QWYA 4OXPA 2ZXRA 4IUUA 3HOUG 3E3XA 3T13A 4K5XA 4N8FA 3RLOA 3CW2C 3S9WA 2Z6KA 1WD1A 1JJ2A 4M8AA 2WACA 3OW2A 1Q46A 2PI2A 3H91A 4IPDA 1HNZL 2SOBA 4OO1H 2VY3A 3GTQB 1BQQT 4RG1A 5ELDA 3NENA 5DAUA 4A3IH 4L63B 3T1YQ 3BG3A 4DUYQ 5T1GA 1SEBD 1BBWA 2Q8RE 3HGBA 1JR0D 2N78A 4GKJQ 3K5OA 1X32A 2JA7H 1ESFA 5BR8L 2PQAB 2K7VA 5D14A 4OO1I 4TQUS 2HQLA 1LTBD 4PMCA 2R6GA 1O80A 3CCEA 4KKUA 4QF4A 1KC8C 2WV6D 1I4QA 1RODA 4BXXH 4JW0A 1M4VA 5E4XA 1EQRA 1X56A 4AYBE 5CV7A 4A3GG 2R3ZA 1HNXL 3BU2A 5LMUL 2R7DA 2ZM6L 1D5MC 1F2MA 3AFQA 1Q3LA 2JA6G 1Y69U 2PZUA 1KD1C 1VQLA 4RMFA 2OXPA 3TRZA 1HR0L 2BDOA 3DM1A 4C1NI 1L1OA 2KJXA 5EAYA 4A3KH 1XMOQ 3K7AB 4DAYB 1ESRA 3C1FA 1E3PA 1RL2A 3MZ5A 4OWTB 2EQSA 1SE2A 3DWPA 3C1EA 2ZXPA 3S17B 3FKIG 1EY9A 1Q81C 1PTOD 4HAEA 2RA4A 3H15A 4QMGA 1BCPB 4XQJA 1JE4A 3BVGA 3I7FA 2A6ED 4LUZA 1WTPA 5FK9C 4KI0A 3I4MG 2FMMA 3TN2A 4B3MQ 1BCPF 1JICA 2KCNA 1ILQA 1B44D 4IUQA 3NP8A 2ZJQA 3HFZB 2EJFC 2M00A 1EY4A 3GTOH 4K2KA 4KLKA 1GUNA 4QB4A 1I5FA 4OO1G 3ERQA 2N8NA 4ZK9B 5C4ZA 1R9TB 4PZ8A 4LMQD 4DR7Q 2G5DA 2LXJA 4A3IG 3A54A 2BA0A 1K8MA 1N9WA 3A55A 3IKJA 4GLXA 3HOVH 2YU9H 1JB3A 1QZGA 2NUCA 1BR9A 3F2UA 1D1IA 2HHHQ 1AH9A 3M3YH 2L4NA 1YNND 2AQ1B 3VYTA 2PI2E 4A76A 2RKSA 1SFOB 5HGTA 5E4WC 2EY1A 4A3GB 1U9RA 1TWFH 1VQ9A 3T1HL 5C4JB 2BH2A 2JA6B 1E1TA 3OYYA 1LT4D 1F77A 2KQ3A 1F9QA 1WJJA 5HGQA 1SNQA 1TY2A 3EFXD 2WAQB 3E6ZX 2JK8A 4NPSA 5JVH3 3R2IA 4GZYC 1HNZQ 4V190 5D65A 4GLVB 2NVQB 4IN3A 3FKIB 4OWXB 1E2WA 2DNEA 4A3KG 3NSWA 1YHQA 4C3HH 4APVA 1VQAA 2OTJA 1T9HA 2IY5B 5BR8Q 1PH9A 1VF7A 1Y8PB 4HIKA 3STBC 2BOSA 4TSSA 1YVCA 2KEDA 5ISRA 5A2QL 1CK1A 1SR3A 3HZXA 3F8TA 1RTOA 3HOWH 2J0TD 3NXWA 5CR3A 5M9OA 3RLFA 4QUFA 5M3FB 2K4KA 1X65A 2Z6KC 5CV5A 2K03A 2NN6H 2IJ0A 1CA6A 2AMCB 1HRJA 1WCMH 4FP5D 5LMUQ 2ZM6Q 1I4GA 3A5UA 3H3VC 3D6WA 4WORA 4IFDG 2LXKA 1A63A 1V9PA 2NZOA 2JA8G 1ILPA 3DHQA 1DD2A 1HR0Q 3NTIA 4BY7H 1TQOA 2NN6I 4LW1A 4J6HA 4OIJA 4JCVE 5EBDA 3TP5A 3V05A 1J9OA 3A8KE 3M9BA 4AYBB 2KCTA 1IBKL 2VQFL 1YJWA 4FXGC 2UUAL 3CRKC 1B50A 1IBML 4KTAA 3KDFB 1WVLA 1ENAA 3TP6A 3PQIA 4DV0L 1JT8A 1Y1VH 2MO1A 2CHBD 4H02A 1VQ7A 1NR2A 1PMRA 1BBXC 1XPRA 3CPWA 4O1NA 3U58A 2WP8J 2OQ0A 3GV6A 3J81j 4XQQA 2MUYA 3ULPA 3GTKH 1HCZA 4C56C 1QJOA 3S2HH 1VDZA 2I0QA 4A3JH 1TWHB 3TS0A 1SE4A 3U9SA 4G57A 4DA2A 1BVSA 3CQZB 4DV1L 1LACA 3K81C 4MZ9A 2QDBA 3I56A 4NMZA 3GP7A 2I5HA 4LUOA 2F4VL 2IL8A 1IL8A 3UI2A 4A93G 3I72A 1L0WA 1SYEA 2E76C 4C3HG 1TS5A 1JWUD 2WFWA 1I50H 1JQYD 1PZKD 2AWNA 2IT1A 1PYSB 5C4XH 4XT1B 5FO8B 1B9MA 4UPAA 1YNJD 2F0WA 5COYA 5LL6X 3VYSA 1E22A 5EPKA 4JI7L 1PTOC 3T1HQ 1Y1WG 3AB9A 5IGFA 2KHIA 4C3IG 1YIJA 5CBEE 3HOWG 4DAPA 2ICEC 2ENBA 3HOYG 2PQAA 3H94A 3KFUA 2I5LX 2B63H 3OIPA 5L37A 3OW7A 2JA8B 2EYMA 2K33A 2FHTA 1F9RA 1I3QH 5CYUA 1WCMG 5IY0A 1M8AA 2I46A 3J7ZC 1Q82C 3J7A5 3S24A 1CFMA 2CWAA 2ES2A 3I70A 3JAMc 4R8IA 2F03A 1P8LA 1F9PA 2L12A 1NCVA 4I65A 3M7GA 4RGNA 3U4VA 3UDXA 3MEHA 4GOPA 3FEWX 5ELEA 2IWHA 3OPOA 1LLRD 4YWMA 1K83B 4CDFC 2VB2X 1TWGH 2Z4HA 4NW2A 3RZOB 1MBYA 2VB3X 2K5VA 3K6OA 1YNNC 4EQOA 3E0JA 2EDGA 4ABNA 5KYLA 3FVQA 1A3TA 3AYHB 2JN4A 3BS1A 2KECA 4R1JA 3DWQA 4N8X1 4DV7L 5FJ8H 2TMPA 3URYA 1Y1VG 5CBAE 4LK1C 3TBIB 3J80E 4FXDA 5IP9G 1HQRD 1LO5D 1LTRD 4RH6A 1QVFA 3KOJA 3MXNB 1Q90A 5J1ZA 1FGBD 4A3DG 2E2JB 1X3QA 4LFAL 3KF8B 4A93B 4DU9A 2IX1A 4LFCL 2UUCL 1IBLL 2KHSA 3KLRA 1K28A 4FDBA 3AEVA 1CZWA 2B3GA 4KHPQ 2K04A 2FMCA 4LF4L 3M4OH 2F3WA 1WD0A 2RSNA 4JBWA 3J81L 1Y1WB 1H95A 4C3IB 5EKIA 1EY0A 5FLXc 3ICEA 4B9WA 1F2YA 3HOYB 3CP0A 1LTID 1UE1A 2D0OA 3PUYA 5C4XG 3MXGA 3C46A 1IBKQ 2VQFQ 4Y7NB 2IW3A 4P71A 2UUAQ 1IBMQ 4BY1B 1A2UA 2GVBA 2EYPA 5IIFA 4DV0Q 4HIDA 2E74C 5EKLA 1D2BA 1YHBA 1QVGA 2CW0D 1D1KA 4PG3A 4IZ8A 1VQBA 1DOLA 1UNSA 5IT9L 3TREA 1QG7A 1PTOB 5M5YH 3P20A 5C3EH 4ZRZA 4FNFA 1EEID 2PNRC 3QIAA 4ULLA 4N9TA 4NXNL 1PTOF 3L0OA 4DNIA 4MNOA 3DEOA 2PPBC 3ULLA 5IGDA 3HOXG 4DV1Q 3ERSX 4EQPA 4EVOA 5DM73 5HURA 3K5NA 1K8AC 2DY8A 3NWSA 1WI5A 1TVXA 1TXYA 2F4VQ 3KK7A 3AMUA 1PYWD 4IQZA 3NHHA 1C8CA 4TVAB 3QR8A 1TWCB 1TWAH 5BN3A 3PIP3 3PUZA 2HIXA 4JI1L 2RF4A 4A3DB 1HZ9A 5IOCA 1PH5A 1AE2A 4JI7Q 3DLLA 5J22A 3T51B 3K80C 4GN4B 1II3A 5FJ8G 2N88A 1O7YA 3SE0A 4EQ5A 3PMFA 1VQNA 4GS3A 3GTJB 5IWAL 3CPFA 4QY7A 1EYDA 1B70B 1SYCA 1A8VA 3IFTA 1C4QA 1VMCA 1ZYRD 1GUOA 4A3BH 1HH2P 2CKZB 2AQ2B 2MO0A 3Q22A 3S14B 3X3NA 1G8ZD 3UDFA 2FINB 4BA1I 2QILA 3OMCA 1MKHA 1TT2A 4Q5VA 2KCCA 2N3SA 1PH8A 3E9IA 5JEAG 1ET6A 2QEJC 2EY6A 4TRDA 2F4IA 2E2DC 3NQIA 1YNJC 4K2LA 1Q1BA 3K58A 4XT3B 4DV7Q 2B2YC 2CQOA 2G9DA 1FR3A 3HP3A 4PNYA 1PH2A 3GTLB 1RF2D 1N36L 2KHJA 1AW7A 2FJ2A 4G7HC 5TSSA 1NE3A 4O42A 3HOXB 5FOBB 2K05A 4XIGS 2ID0A 2HD3A 2UUBL 4LFAQ 4H44C 5C6AA 1N8RC 1PH1A 4YCVA 3K5LA 3CCSA 1VQKA 1XX8A 3QO2A 4R4QA 3V2TA 2UUCQ 1IBLQ 4LFCQ 1EIHA 2J7ZA 4GOPC 2RDGA 4IUVA 3CCUA 1MSGA 4X3KA 3Q6SA 2MP1A 1VQFA 3SXHA 3IL8A 4OL7A 3S1NB 1MSHA 1I4XA 2IHFA 4LF4Q 1AE3A 1JB7A 1H9JA 1R4PB 4KHVA 4WJ4A 1SXTA 4A3EH 2F1MA 2XWJB 1WTHA 5KNDA 3EROA 2B2WA 3I4NG 1WFQA 5KNCA 1SSOA 2R7FA 1OXSC 3SEBA 3R2TA 4JYAL 2PCFB 5KRUA 4A3FB 4OHJA 1EY8A 1YZ6A 4R4CA 4C3JG 4O2DA 1VQDA 1K8GA 1B4OA 1EIGA 1BXTA 5JPMC 3K8AA 1PLFA 1HQMC 2XTIA 1DXMA 1FD7D 4DAMA 4FYDA 3GTPB 1HFNA 4UDUC 4NXNQ 2CQAA 1CSPA 1SYDA 4HTHA 4P72A 5E3FA 1M1KC 3S1QH 3CU7A 4GNXC 3TS2A 1UE7A 3OOCA 3VR6A 5M5XB 3PO2B 1WTQA 1A62A 1I6VC 4RA8A 1VQ5A 5JEAJ 2N55A 4JBMA 4PZ7A 2Q8TA 5M5WB 2VUMG 4NDXA 3BYTB 4JBJA 3EIVA 4C2MB 2B8FA 1C48A 3VA7A 1HPCA 3OIQA 3ONAB 4JI1Q 4KN7C 1ENFA 3H6MA 3EA6A 1KL9A 4DV3L 1RKNA 4RAUC 1JC7A 2A6HC 2NVTB 4FF4A 4M1UB 1PH6A 3WOFA 1PZID 2CW0C 1HXYD 3IRBA 5IWAQ 3C2PA 4E6IA 4HEDA 1K3BC 1G91A 1YJ9A 2H5XA 3P75A 2QEXA 4TKOB 2CWPA 1Q8KA 2FFKB 2I5MX 3UE1A 1A0IA 1I4RA 2KEEA 2LMCB 1KDCA 5EPJA 3MXNA 4HJ9A 4ME5A 2Z9HA 5EGTA 1U4PA 3RLNA 3M4QA 1EY6A 3KF8A 2D9UA 3E5SA 2M2LA 1EYAA 4CJ1B 3I4NB 4JI8L 3H0GG 4GOPB 3QOLA 4LJZC 4WFN3 4POGA 4IJHA 3NQTA 4C3JB 3N6RA 3B6YA 5KGUA 3I4OA 5KNBA 2AKWB 4XXEA 4RKLA 5HY6A 2N49A 1NMFA 3RD4A 3DMUA 1N33L 1Q86C 2BDNA 2JE6I 3VYUA 3NTHA 1KTKA 1EZ8A 2KVMA 5LMNW 4GKKL 4IOAA 2EPBA 2E2HB 2MQHA 4I7ZC 3S2DB 2NZHA 1SMYD 4KJOA 4ZYSA 2UUBQ 3WWVA 3HOUB 2F0OA 3TP8A 2VUMB 2QA4A 2MJ8A 3W5OA 2R93G 2B29A 1ZYRC 3KF6A 5NUCA 1EL0A 4ZKBB 1V1QA 1XTCD 4L8JA 5F2DA 1D8LA 2ZTDA 3MEFA 3OWFA 4CKEA
chains in the Genus database with same CATH topology
3R3OA 2RSOA 5A35A 2F0FA 2A5HA 5ELCA 3GTMB 4ODGA 4DXFA 2AQ3B 1AP0A 4DF7A 4U68A 5KEEA 4CBVA 4KY6A 1EQVA 1EU3A 4IUNA 5CV8A 2EYHA 1OXVA 2CVRA 2L9HA 4KN4C 4X3SA 1EYCA 4HMJA 3H0GB 1OXUA 3MXUA 1DJRD 1TR5A 2LFNA 3L7ZC 4FXKC 4OIKA 4UAIA 2SEBD 4RKBA 1SE3A 2B2WC 2K6AA 3NPPA 1ET9A 2PYKA 1STNA 2JSOA 2R93B 3BVZA 1HUMA 1EWHA 3D31A 3MTSA 3I4MB 4IURA 1L0YB 1Z7TA 4DGZA 1WTRA 2K32A 4K6LA 1OXXK 5EJWA 3MC0B 4MN3A 3M7NA 1TY0A 1SAPA 2Q8IB 1SBBB 4A3IB 3NWTA 5DM63 1TS4A 1Y8NB 3A56A 2D2CC 3I91A 1RHPA 2L1BA 2D62A 2M9VA 3SK5A 1G2TA 2JA7B 3Q0AA 1ONLA 2KA7A 1GHKA 2YYZA 2H1EA 3NK9A 1E0BA 5CC4A 1SNCA 3A8JE 2AUKA 2NYZD 3VR5A 4CKCA 2VNUD 4R8NA 4F88A 1QILA 2WINB 3PUXA 2RDHA 1NR4A 1CHQD 1LT5D 4PMBA 5C3XA 3PUWA 4K8IA 4KY5A 3SK6A 4BWGB 1RJTA 1B53A 3VR2A 2X6GA 4A3KB 3C3LA 4G7OC 3I90A 4K8JA 4B08A 3TP7A 4QCLA 2IX0A 4DK1A 2RQXA 1SMYC 5IGGA 1GUSA 5IGBA 4H13C 3K59A 1UAPA 5I9OA 3OHXC 5EPLA 3GTOB 4MIUA 2X69A 2A6EC 1A6XA 2B2VC 2F3VA 2NN6G 2OF1A 3DWAA 2B2YA 4RHSA 5DEHA 3HOVB 1KABA 4HSPA 2YU9B 1EU4A 2BE5D 5T1IA 3HS0C 1B2TA 2JP1A 3T4AC 3WOEA 4KKTA 2HUGA 3M3YB 4CKEA 1A3VA 1JWSD 5FO9B 2K5WA 4K6DA 5C5LA 1TWFB 1E2VA 4JK1C 3DEPA 4XTCS 4OGQC 3NTKA 2HDMA 4U673 3GV3A 1U4MA 1PRTF 1A15A 1BOSA 1EEFD 2F0SA 1IW7D 3D6CA 4NKLA 5LL6S 5IODA 4HSVA 3K0YA 3J7AV 2K01A 4C3HB 2BA1A 1CHPD 5K5PA 3D4DA 1RDPD 2F0DA 2EXZA 1IYUA 1E2ZA 3TDQA 3I73A 5G3LD 5A2QE 1BDOA 3HOWB 2QCPX 1EFID 4EGVA 1TU2B 4FF2A 5FKAC 1WCMB 1SNDA 4F7XA 1S5DD 4RGMA 2Z1CA 4G4KA 2F0NA 2IX3A 4H0LC 4IUTA 2B2UC 5CV6A 2EOTA 4BY7B 1ZKOA 1Q8IA 5I6WA 1GUGA 4R9WA 2PQEA 2DN8A 2HDLA 4K14A 1KDAA 1JWMD 1Y1VB 1D6EC 1BO0A 2F0EA 2MHVA 4KK7A 3SR1A 5C4HA 5BN5A 3GTKB 2NWGA 1SNMA 3Q23A 3S2HB 2EJMA 1QNKA 4A3JB 2B39A 2TSSA 2F0KA 1G291 3ND8A 4XQNA 5FO7B 1DCZA 2Z4IA 3H09A 1CZGA 1DOMA 5EQ0A 1GOZA 3G7LA 4DN4M 1VF5C 3FDTA 4WJWA 1I50B 2H4OA 3FMCA 3MHBA 5C4XB 2V4DA 2C9OA 4ILWA 1X3PA 2F0PA 2B63B 1CQVA 4QUCA 4YIJA 1I3QB 2QKIC 1ZXTA 2E75C 2SDFA 1V43A 1S4ZA 5JPNC 3VYRA 5C0XH 1HTLD 3FRPB 3ZYYX 4C1NK 4KJNA 4V0BA 1TS3A 1O78A 1IYVA 3FPUB 1TWGB 4LAAA 2JEBI 1KLUD 2F0JA 1SYGA 1PFMA 5C0XI 1SNPA 3MA2B 1STEA 1U4RA 2A69D 5ELFA 5K36H 3BDLA 2ZXOA 1NUCA 1JORA 1OXTA 2I07B 3LWUA 4ZAIA 2OT2A 2B8GA 4DNRB 2J4XA 4F87A 2EYOA 1IW7C 2WKDA 3M4OB 3PUVA 1PXUA 4Z9CB 3T16A 1K8OA 1EY5A 1LABA 4MHEA 1UUPA 2G9HD 5KYIA 3JAME 3RMHA 1SYBA 1SJHD 2XWBB 2RVLA 1Q12A 3R8BA 4NP5A 4L6TB 4ZLTF 1BUVT 5I9PA 1EZ6A 2A74C 1DZ1A 1PRTD 3EJIA 5M5YB 5C3EB 2B2TC 1CM9A 5CV9A 2Y0SB 1GHJA 1H9RA 4CGYB 4HCEA 1LTSD 3SVMA 5C0XG 1B1ZA 4J1MA 4KKSA 1TKWB 3GQBA 1AZPA 3WDNA 4QIWB 1BF4A 3IAYA 1TWAB 1SJED 2F0QA 4DAVA 3MXPA 2D5DA 5E1FA 3L3OC 2LY7A 2AWOA 3VR3A 1T5XD 4H7BA 2L0CA 5FLXE 4XYQA 5K36G 5CGKA 3A7LA 1XWEA 3R93A 2R61A 4A3BB 1IHZA 1H9SA 2HCCA 4ZUJA 3I3CA 1D5ZC 2O5IC 2XN9C 3BZDB 5CV4A 3X3MA 2XSCA 4N9PA 4DNTB 3SHLA 1QCBD 1V1PB 4RWSC 3G6JB 4RCOA 2B2VA 2F0TA 4Q0FA 1ZEQX 5EBCA 3MFYA 5JOBA 1FYCA 1STGA 3HKZB 3K5MA 2PZWA 1WTXA 2EYFA 3GD7A 5C0XJ 3CKIB 5G3LF 2LS01 1JOOA 4IFDH 2A68D 2SNSA 1SYFA 3MVVA 1KNAA 2MGSA 1G6ZA 4ZQ3A 4A3EB 2O4XA 1KAAA 2EYLA 1O7ZA 3SK4A 4KD4A 4IFDI 3QWNA 1EOTA 1I4PA 2EJGC 2K28A 1HFGA 2A69C 4XYOA 1SNOA 1FNUA 1RTNA 5JAVA 1KLGD 3DUZA 4CKBA 3FPPA 2BCOA 1H9KA 1Z47A 3S1QB 1JCKB 3PV0A 5J39A 3CRLC 3J80L 5ELBA 3TZUA 4RFBA 2VXWA 1VMPA 2EVBA 3NBHA 4RGOS 2F0LA 2RDFA 4PQXA 2K5DA 1NAPA 4ZKCB 2F0MA 2MPMA 3LWEA 1BNZA 4DK0A 3M85A 3Q24A 1F2ZA 4DXGA 4S3SA 2B2UA 1HA5A 2PMZB 1HUNA 5KIXA 1PRTC 4G7ZC 3EQLC 3N52A 1OO9B 3O13A 1PZJD 1V1OA 1PTOH 1GXDC 1A2TA 1WTWA 2XNAC 3W2DA 3HEJA 4KV6A 2PZTA 4EQNA 2WIIB 3HRZC 2LKVA 1WTOA 1LT6D 1UEAB 1S5ED 3QJYA 5JVG3 2F0IA 1TS2A 1LT3D 1STYA 2XRQD 3D3RA 3VA5A 1VCIA 4KY7A 2NZ1D 3ND9A 1STBA 3SK8A 3RUZA 2QF7A 4K5WA 4CHTB 1B9NA 5I4DA 1HHVA 4HCSA 1LTGD 2EY5A 4P2CB 1L0XB 4IUPA 5LHY1 3BVMA 1SDFA 1QOHA 3AU7A 2EY2A 1NSNS 2WKCA 4KMUC 1W6JA 2R92B 2OEOA 3ITPA 3S1RB 2DY7A 1JOQA 1WTVA 2F0GA 2NTTA 3DXJC 1A3UA 4IFDJ 2XVSA 4J8QA 2NVYB 4CJ2C 3HOZB 4F8MA 1AFPA 1GUWA 1PRTB 5M3MB 2A68C 4ZUIA 1PDQA 4HN7A 2HCIA 1ML0D 4X3UA 2AUJD 1PFNA 5I2YA 1GUTA 2L11A 2XIWA 3MFGA 4B9XA 5C5MA 2NTSA 1CA5A 3OWEB 1AEXA 2SNMA 2EZVA 1FNVA 2NVXB 3QB3A 3PO3B 4DAYA 1I6HB 1AN8A 4KD3A 1DYQA 1S5BD 1V1PA 1H9MA 4RGTA 1BCPD 2Z8LA 3KBXA 1XXGA 3LX0A 4BA2I 1QB5D 5DNFA 1CTMA 3MWYW 4BBSB 1PFBA 1AZQA 5C3WA 1B3AA 3KUPA 1H9SB 1Q1EA 4A3MB 2KUMA 3OSOA 1R4QB 1DOKA 1T5EA 1MGSA 3OMGA 3KLSX 3QG1A 3KLSA 2JYOA 2B2TA 4PV1C 5JEAH 1DONA 3JAML 5I6YA 1Z6HA 3NBIA 3K57A 3BDCA 3W3AA 2A6HD 2HQEA 3KBGA 1CI3M 1ICWA 3HG9A 5D3IB 4DFAA 2O5JC 2RBMA 3QOJA 3A8IE 3LNNA 1O7LA 1IKMA 3EVQA 2GA4B 2ZT9C 3M4YA 1CT1D 4FF1A 1JOKA 3D8GA 3S15B 2NB0A 2DNCA 2EE1A 3SDZA 1W6KA 5IGEA 2PO4A 3TSSA 3VR4A 4ID6A 4BBRB 4KHZA 1G2SA 4PMWA 1F2LA 3I4LA 4RCNA 1XYIA 3L9AX 2K1BA 3GO5A 2EYJA 2JEAI 1D5XC 3P1HA 5FLXL 3NE5B 4RHRA 1EY7A 1LTTD 1STHA 2ICIA 5IGCA 1MI2A 3GTGB 5D3DA 1V8QA 1HTPA 1I4HA 4HMIA 4FF3A 2F0HA 3IFDA 3BYYB 4WRDA 2PW5A 5C44B 1EWCA 1KDBA 2O2LD 3RZDB 3D4RA 2PW7A 1S5FD 3V96A 3PIO3 3MAQA 1F9SA 2R7ZB 1S5CD 3S16B 5JJZA 3TZDA 2BE5C 2K5QA 1DM0B 1Y8OB 4K5VA 1IKLA 3NUCA 5CMDA 4FO2A 4BS9A 4CJ0B 1LTAD 3S1MB 5I2XA 2L55A 2NBFA 1STAA 3CHBD 2JXMB 3A7AB 4X3TA 1LV9A 2XRSD 1EQTA 1RD9D 2KOLA 1RCVD 4IALA 1FNWA 4HR7B 3BDOA 5BN4A 3J7YW 5CORA 1QE6A 3I8ZA 2X6LA 3T53B 2E2IB 3T56B 5AFWA 1HA6A 3J81E 2F0UA 1QNUA 1KNEA 4XDXA 3D4WA 1GJXA 2L5TA 1U4LA 1BCPC 2C5CA 4FVMA 3J7AF 1MD2D 3TMEA 1CQFA 2A73B 2WB1B 1ENCA 1J8IA 3P7JA 5IT9E 2JA5B 3U9OA 2IPKD 2F0VA 1TIID 5EKKA 1QWYA 2ZXRA 4IUUA 3T13A 4K5XA 3S9WA 1WD1A 4M8AA 2WACA 3H91A 2SOBA 4OO1H 3GTQB 1BQQT 5ELDA 5DAUA 4L63B 3BG3A 5T1GA 1SEBD 2Q8RE 3HGBA 1JR0D 3K5OA 1X32A 1ESFA 2K7VA 5D14A 4OO1I 4TQUS 1LTBD 4PMCA 2R6GA 1O80A 4KKUA 4QF4A 2WV6D 1I4QA 1RODA 1M4VA 5E4XA 5CV7A 2R3ZA 1D5MC 1F2MA 1Q3LA 1Y69U 2PZUA 2OXPA 2BDOA 3DM1A 4C1NI 2KJXA 3K7AB 1ESRA 3C1FA 3MZ5A 1SE2A 3DWPA 3C1EA 2ZXPA 3S17B 1EY9A 1PTOD 4HAEA 2RA4A 4QMGA 1BCPB 4XQJA 1JE4A 3BVGA 2A6ED 1WTPA 5FK9C 4KI0A 2FMMA 3TN2A 1BCPF 1JICA 2KCNA 1ILQA 1B44D 4IUQA 3NP8A 2EJFC 2M00A 1EY4A 4K2KA 4QB4A 1GUNA 4OO1G 3ERQA 4ZK9B 5C4ZA 1R9TB 4LMQD 3A54A 2BA0A 1K8MA 3A55A 3IKJA 1JB3A 2NUCA 1BR9A 3F2UA 1D1IA 2L4NA 1YNND 2AQ1B 3VYTA 1SFOB 2RKSA 5HGTA 5E4WC 2EY1A 4A3GB 1U9RA 5C4JB 2JA6B 1F77A 1LT4D 2KQ3A 1F9QA 1SNQA 1TY2A 3EFXD 2WAQB 3E6ZX 5JVH3 3R2IA 4GZYC 4V190 5D65A 2NVQB 4IN3A 3FKIB 1E2WA 2DNEA 3NSWA 1VF7A 1Y8PB 2BOSA 4TSSA 2KEDA 5ISRA 5A2QL 1CK1A 3HZXA 1RTOA 2J0TD 3NXWA 5CR3A 5M9OA 3RLFA 4QUFA 5M3FB 5CV5A 2K03A 2NN6H 2IJ0A 1CA6A 1HRJA 4FP5D 1I4GA 3H3VC 3D6WA 4WORA 4IFDG 1ILPA 3DHQA 1DD2A 3NTIA 1TQOA 2NN6I 4J6HA 4OIJA 5EBDA 3TP5A 3V05A 1J9OA 3A8KE 4AYBB 4FXGC 3CRKC 1B50A 4KTAA 1WVLA 1ENAA 3TP6A 2CHBD 1NR2A 1PMRA 1BBXC 4O1NA 2WP8J 3GV6A 4XQQA 2MUYA 1HCZA 4C56C 1QJOA 1VDZA 1TWHB 1SE4A 3U9SA 4G57A 4DA2A 3CQZB 1LACA 2QDBA 4NMZA 3GP7A 2IL8A 1IL8A 3UI2A 3I72A 1SYEA 2E76C 4C3HG 1TS5A 1JWUD 1JQYD 1PZKD 2AWNA 2IT1A 5FO8B 4XT1B 1B9MA 1YNJD 2F0WA 5COYA 5LL6X 3VYSA 5EPKA 1PTOC 3AB9A 4C3IG 5CBEE 4DAPA 2ICEC 2ENBA 3H94A 3OIPA 3OW7A 2JA8B 2EYMA 2K33A 2FHTA 1F9RA 5CYUA 1M8AA 2I46A 1CFMA 3I70A 4R8IA 2F03A 1F9PA 2L12A 1NCVA 4I65A 3M7GA 4RGNA 3MEHA 3FEWX 5ELEA 2IWHA 3OPOA 1LLRD 1K83B 2VB2X 4NW2A 2Z4HA 3RZOB 1MBYA 2VB3X 3K6OA 1YNNC 4EQOA 3E0JA 2EDGA 4ABNA 5KYLA 3FVQA 1A3TA 3BS1A 2KECA 3DWQA 2TMPA 3URYA 5CBAE 4LK1C 3TBIB 3J80E 4FXDA 1HQRD 1LO5D 1LTRD 4RH6A 1Q90A 5J1ZA 1FGBD 2E2JB 1X3QA 4A93B 4DU9A 2IX1A 2KHSA 3KLRA 1CZWA 2K04A 2FMCA 2F3WA 1WD0A 2RSNA 4JBWA 3J81L 1Y1WB 4C3IB 5EKIA 1EY0A 4B9WA 1F2YA 3HOYB 1LTID 3PUYA 3MXGA 3C46A 4Y7NB 2IW3A 4BY1B 1A2UA 2EYPA 5IIFA 2E74C 5EKLA 1D2BA 2CW0D 1D1KA 4IZ8A 1DOLA 1UNSA 5IT9L 1QG7A 1PTOB 3P20A 4ZRZA 4FNFA 1EEID 2PNRC 3QIAA 4ULLA 4N9TA 1PTOF 2PPBC 3DEOA 5IGDA 4EQPA 4EVOA 5DM73 5HURA 3K5NA 2DY8A 3NWSA 1TVXA 3KK7A 3AMUA 1PYWD 4IQZA 3NHHA 1C8CA 1TWCB 5BN3A 3PIP3 3PUZA 4A3DB 5IOCA 5J22A 3T51B 1II3A 2N88A 1O7YA 3SE0A 3PMFA 3GTJB 1EYDA 1SYCA 3IFTA 1C4QA 1VMCA 1ZYRD 1GUOA 2AQ2B 3S14B 3Q22A 3X3NA 1G8ZD 2FINB 4BA1I 2QILA 3OMCA 1TT2A 4Q5VA 2KCCA 5JEAG 1ET6A 2QEJC 2EY6A 4TRDA 2F4IA 2E2DC 3NQIA 1YNJC 4K2LA 1Q1BA 3K58A 4XT3B 2B2YC 4PNYA 2G9DA 1FR3A 3HP3A 3GTLB 1RF2D 1AW7A 2FJ2A 4G7HC 5TSSA 4O42A 3HOXB 5FOBB 2K05A 4XIGS 2ID0A 4H44C 5C6AA 3K5LA 1XX8A 3QO2A 3V2TA 1EIHA 2J7ZA 2RDGA 4IUVA 1MSGA 4X3KA 3Q6SA 2MP1A 3SXHA 3IL8A 4OL7A 3S1NB 1MSHA 1I4XA 1H9JA 1R4PB 4KHVA 1SXTA 2F1MA 2XWJB 5KNDA 3EROA 2B2WA 5KNCA 1SSOA 1OXSC 3SEBA 3R2TA 2PCFB 5KRUA 4A3FB 4OHJA 1EY8A 4C3JG 1B4OA 1EIGA 1BXTA 5JPMC 1PLFA 1HQMC 1DXMA 1FD7D 4FYDA 3GTPB 1HFNA 4UDUC 2CQAA 1SYDA 4HTHA 5E3FA 3CU7A 3OOCA 3VR6A 5M5XB 3PO2B 1WTQA 1I6VC 4RA8A 5JEAJ 2N55A 2Q8TA 5M5WB 4NDXA 3BYTB 4C2MB 2B8FA 1C48A 3VA7A 1HPCA 3OIQA 3ONAB 4KN7C 1ENFA 3H6MA 3EA6A 1RKNA 4RAUC 1JC7A 2A6HC 2NVTB 4FF4A 4M1UB 3WOFA 1PZID 2CW0C 1HXYD 3C2PA 4E6IA 4HEDA 1G91A 3P75A 4TKOB 2FFKB 1I4RA 2KEEA 2LMCB 1KDCA 5EPJA 3MXNA 4ME5A 5EGTA 1U4PA 1EY6A 3KF8A 2D9UA 3E5SA 2M2LA 1EYAA 4CJ1B 3I4NB 3QOLA 4LJZC 4WFN3 3NQTA 4C3JB 3N6RA 5KGUA 5KNBA 4XXEA 4RKLA 3RD4A 3DMUA 2BDNA 2JE6I 3VYUA 3NTHA 1KTKA 1EZ8A 2KVMA 2EPBA 2E2HB 4I7ZC 3S2DB 1SMYD 4KJOA 4ZYSA 3HOUB 2F0OA 3TP8A 2VUMB 2MJ8A 1ZYRC 5NUCA 1EL0A 4ZKBB 1XTCD 4L8JA 5F2DA 3OWFA 5IGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1B A;  1F9S A;  2L4N A;  1WVL A;  2JYO A;  4IUP A;  1BO0 A;  2B2T A;  2Q8R E;  2RSO A;  1DON A;  1VMC A;  5E4W C;  5JJZ A;  2HCC A;  1NR2 A;  1SDF A;  1BBX C;  1G2T A;  3I3C A;  1WTQ A;  3TZD A;  4RA8 A;  1X3Q A;  1X32 A;  3DEP A;  2VXW A;  2N55 A;  2Q8T A;  1VMP A;  5D14 A;  3GV6 A;  2NWG A;  1IKL A;  4ZAI A;  2HDM A;  1QNK A;  3GV3 A;  2H1E A;  1ICW A;  1O80 A;  2FIN B;  1F9Q A;  1NAP A;  4ZKC B;  5CMD A;  1AP0 A;  4CJ0 B;  1ROD A;  1E0B A;  2K04 A;  2MPM A;  1U4M A;  3LWE A;  3ONA B;  5E4X A;  1BNZ A;  4U68 A;  2DY7 A;  2NYZ D;  1A15 A;  1WD0 A;  4MHE A;  2B2U A;  2RSN A;  4RWS C;  4RAU C;  1WTV A;  1DOM A;  5EQ0 A;  2R3Z A;  2CVR A;  3G7L A;  5EKI A;  4DN4 M;  5D65 A;  2L9H A;  4X3T A;  1LV9 A;  1IKM A;  2B2V A;  2IL8 A;  3FDT A;  1IL8 A;  1HUN A;  4XT3 B;  3UI2 A;  1Q3L A;  4X3S A;  1NR4 A;  1EQT A;  4HED A;  2KOL A;  2RVL A;  2B2Y C;  3HP3 A;  4HSV A;  3N52 A;  1G91 A;  4CJ2 C;  4XT1 B;  1RJT A;  2K01 A;  1B53 A;  2FJ2 A;  1GUW A;  2X6G A;  4ZLT F;  5COR A;  5COY A;  3DM1 A;  4O42 A;  1WTX A;  1QE6 A;  2EE1 A;  2K05 A;  2FFK B;  3I8Z A;  1PDQ A;  2X6L A;  4OIK A;  5EPK A;  1DOL A;  2KEE A;  1ESR A;  1DZ1 A;  4UAI A;  2HCI A;  5AFW A;  5EPJ A;  1HA6 A;  1ML0 D;  4X3U A;  5CBE E;  1G2S A;  1U4P A;  1PFN A;  1XX8 A;  1QG7 A;  3I90 A;  1X3P A;  3QO2 A;  1KNE A;  1EIH A;  2L11 A;  2XIW A;  4XDX A;  2J7Z A;  2B2T C;  2D9U A;  1CM9 A;  2KED A;  1F2L A;  2M2L A;  4IUV A;  2B2W C;  4QUC A;  1MSG A;  4X3K A;  3Q6S A;  2MP1 A;  4CJ1 B;  1WTW A;  1RTO A;  1U4L A;  1XYI A;  3IL8 A;  2K1B A;  1CA5 A;  1MSH A;  2FHT A;  4HAE A;  1F9R A;  1KNA A;  2MGS A;  2RA4 A;  3DEO A;  4QUF A;  3SVM A;  1ZXT A;  1G6Z A;  1M8A A;  1JE4 A;  2K03 A;  1J8I A;  2SDF A;  1CA6 A;  1WTP A;  1O7Z A;  1S4Z A;  3P7J A;  4R8I A;  2DY8 A;  2FMM A;  1WTO A;  1TVX A;  1HRJ A;  3TN2 A;  1AZP A;  1HUM A;  1JIC A;  1F9P A;  2L12 A;  1NCV A;  3KBX A;  3MTS A;  3D6W A;  1ILQ A;  1C8C A;  1MI2 A;  1BF4 A;  4IUQ A;  2BDN A;  4IUR A;  4IUT A;  2KVM A;  1EOT A;  2B2U C;  2B2W A;  5EPL A;  2EPB A;  4IUU A;  1WTR A;  2EOT A;  1SSO A;  2X69 A;  1ILP A;  2NZ1 D;  2K28 A;  1HFG A;  3FPU B;  3IFD A;  2B2V C;  3MWY W;  5DNF A;  1PFB A;  4ZK9 B;  5EJW A;  4NW2 A;  1AZQ A;  1B3A A;  2B2Y A;  3KUP A;  4LMQ D;  4MN3 A;  1WD1 A;  1RTN A;  1B4O A;  1EIG A;  2N88 A;  1PFM A;  2MJ8 A;  1O7Y A;  3H91 A;  4OIJ A;  4R9W A;  1HHV A;  2HDL A;  1SAP A;  2KUM A;  4HCS A;  1J9O A;  1EL0 A;  4ZKB B;  1PLF A;  2KEC A;  5T1I A;  3F2U A;  1B2T A;  1U4R A;  2JP1 A;  3R93 A;  1DOK A;  5CBA E;  1HFN A;  1MGS A;  2HUG A;  1B50 A;  3I91 A;  5T1G A;  1RHP A; 
#chains in the Genus database with same CATH topology
 4CDD C;  3R3O A;  5FLM H;  2RSO A;  2EIF A;  5A35 A;  2F0F A;  3EBE A;  2A5H A;  5ELC A;  3GTM B;  4ODG A;  4DXF A;  4JPB W;  4JBK A;  1E24 A;  1CSQ A;  2R92 H;  4JOI C;  1IYJ B;  2AQ3 B;  1AP0 A;  4JYA Q;  4DF7 A;  4YWK A;  4U68 A;  1SN8 A;  5KEE A;  3S1R H;  4CBV A;  5IYD H;  4KY6 A;  2VL6 A;  1EQV A;  1EU3 A;  4IUN A;  5CV8 A;  2EYH A;  2JA7 G;  1KRT A;  1OXV A;  2CVR A;  2L9H A;  4L5S A;  4KN4 C;  4X3S A;  1EYC A;  3JAM i;  4HMJ A;  3H0G B;  4BXX G;  4IJL A;  2QGQ A;  4YHH L;  1OXU A;  3MXU A;  1DJR D;  2NVY H;  1TR5 A;  3CC7 A;  3HOZ H;  2LFN A;  3L7Z C;  4FXK C;  5M3M H;  4QL5 A;  4OIK A;  4B3R L;  2QDL A;  4GN5 A;  1OTC A;  4UAI A;  2SEB D;  5IYC H;  3PIO A;  1K73 C;  4RKB A;  1SE3 A;  2B2W C;  2K6A A;  2ATW A;  3NPP A;  1EQQ A;  4Y52 H;  1ET9 A;  1YHA A;  4B3T L;  1UE6 A;  1XMQ L;  2PYK A;  3BJU A;  4DV3 Q;  2NVX H;  3PO3 H;  1UE5 A;  1I6H H;  1STN A;  4OON A;  2JSO A;  2R93 B;  3BVZ A;  1KAW A;  1G6P A;  1HUM A;  1EWH A;  3D31 A;  3MTS A;  3I4M B;  3PF4 A;  4IUR A;  1L0Y B;  1Z7T A;  4DGZ A;  1WTR A;  2K32 A;  4K6L A;  2HIV A;  4JI5 L;  1OXX K;  5EJW A;  3K7U C;  3MC0 B;  4MN3 A;  4BBS H;  2A19 A;  3M7N A;  1TY0 A;  1SAP A;  2Q8I B;  1SBB B;  4A3I B;  3NWT A;  4A3M H;  1HNX Q;  5DM6 3;  1TS4 A;  3D0F A;  1Y8N B;  4L5T A;  3A56 A;  2D2C C;  3I91 A;  1RHP A;  4IPG A;  2L1B A;  2D62 A;  2K52 A;  2M9V A;  4A3L H;  3SK5 A;  1G2T A;  2JA7 B;  3Q0A A;  1ONL A;  3HOV G;  2KA7 A;  1UWV A;  1GHK A;  1N32 L;  1N33 Q;  2K5H A;  1NBW A;  2YYZ A;  4A75 A;  1EWI A;  4GKK Q;  2H1E A;  3NK9 A;  4YWL A;  1W2B A;  1E0B A;  5CC4 A;  1SNC A;  3A8J E;  4DR2 L;  2AUK A;  5IYB H;  3BZK A;  2NYZ D;  1B8A A;  3VR5 A;  1X55 A;  4PZ6 A;  4R4O A;  4CKC A;  2VNU D;  4R8N A;  4F88 A;  1QIL A;  2WIN B;  1PHJ A;  3PUX A;  2RDH A;  3KLW A;  1NR4 A;  1CHQ D;  1LT5 D;  4PMB A;  5C3X A;  3PUW A;  4K8I A;  5M3M G;  3F1Z A;  4OX9 L;  4KY5 A;  5JJK A;  3SK6 A;  4BWG B;  2Q2U A;  1RJT A;  1B53 A;  3VR2 A;  3S15 H;  2X6G A;  5IYC G;  4A3K B;  3C3L A;  4DR3 L;  4HJ7 A;  4G7O C;  2KCM A;  4P75 A;  4X64 L;  2RCF A;  3I90 A;  4K8J A;  4BBR H;  1QUQ B;  4B08 A;  4YCW A;  4DR6 L;  3TP7 A;  3UDG A;  4QCL A;  1XTD A;  2YTY A;  2IX0 A;  4JI3 L;  4DK1 A;  2RQX A;  4DR4 L;  4K0K L;  1SMY C;  5IGG A;  3KJO A;  1GUS A;  5IGB A;  4H13 C;  3K59 A;  1UAP A;  1VQE A;  3OHX C;  5I9O A;  3GTG H;  5LMN L;  5EPL A;  3GTO B;  4MIU A;  4YHH Q;  4BBS G;  1YIT A;  2X69 A;  4DUZ L;  2A6E C;  1XNQ L;  1X6O A;  4DV4 L;  1IXR A;  2ZJR A;  3A74 A;  2B2V C;  1A6X A;  2F3V A;  4B3R Q;  2NN6 G;  4POF A;  2OF1 A;  3DWA A;  2B2Y A;  4RHS A;  4A3M G;  5DEH A;  3HOV B;  5C44 H;  1KAB A;  4HSP A;  1SE8 A;  2YU9 B;  3J81 c;  1EU4 A;  3AFP A;  3CCV A;  2BE5 D;  5T1I A;  3HS0 C;  1B2T A;  1LYL A;  2JP1 A;  3RZD H;  3T4A C;  3WOE A;  4KKT A;  2HUG A;  3M3Y B;  4IOC A;  4B3T Q;  4BY7 G;  1QZH A;  1CKN A;  1A3V A;  1JWS D;  1XMQ Q;  5FO9 B;  2R7Z H;  4YY3 L;  2K5W A;  3S16 H;  4K6D A;  5C5L A;  1TWF B;  1E2V A;  4JK1 C;  3DEP A;  4XTC S;  5IT9 c;  4OGQ C;  3NTK A;  2HDM A;  4U67 3;  3GV3 A;  5IYB G;  1U4M A;  3S1M H;  4JI5 Q;  3LGJ A;  1PRT F;  4DK3 C;  4LFB L;  3F2C A;  1A15 A;  1BOS A;  1X54 A;  1EEF D;  1GM5 A;  2F0S A;  1IW7 D;  3D6C A;  4NKL A;  5LL6 S;  4NXM L;  5IOD A;  4HSV A;  3K0Y A;  4A3J G;  3PF5 A;  3J7A V;  1PH4 A;  2K01 A;  4C3H B;  2FXQ A;  2BA1 A;  1CHP D;  5K5P A;  3D4D A;  1RDP D;  3BZC A;  2F0D A;  2EXZ A;  1IYU A;  4BBR G;  1E2Z A;  3TDQ A;  4ME3 A;  1VQJ A;  3I73 A;  5G3L D;  3NEL A;  4A3C H;  2E2I H;  1N32 Q;  4GNX A;  5A2Q E;  5JJI A;  1YJN A;  1BDO A;  3HOW B;  2QCP X;  2JA9 A;  1EFI D;  3GDE A;  4X65 L;  1YEZ A;  4EGV A;  1TU2 B;  4DR2 Q;  4FF2 A;  5FKA C;  2F52 A;  1WCM B;  1SND A;  4F7X A;  1S5D D;  4RGM A;  2Z1C A;  2A1A A;  2JA5 H;  4G4K A;  2F0N A;  3KF6 B;  1C0A A;  2IX3 A;  4H0L C;  2B63 G;  4IUT A;  4OX9 Q;  2VQE L;  2B2U C;  5IP7 H;  5CV6 A;  2EOT A;  4BY7 B;  1ZKO A;  1B7Y B;  4DR3 Q;  1Q8I A;  4JI6 L;  5I6W A;  1GUG A;  2BH8 A;  4X64 Q;  4B3S L;  4R9W A;  2PQE A;  2DN8 A;  5ELN A;  2HDL A;  1C9O A;  3GTQ H;  4K14 A;  1S72 A;  1FJG L;  4DR6 Q;  1KDA A;  1YNX A;  4JI4 L;  3RN5 A;  1JWM D;  1Y1V B;  1D6E C;  1BO0 A;  1E1O A;  2F0E A;  4JI3 Q;  4QIW E;  2MHV A;  4KK7 A;  3PSI A;  4DR4 Q;  3SR1 A;  1J5E L;  4K0K Q;  1B3Q A;  5C4H A;  2UU9 L;  2UXB L;  5BN5 A;  3GTK B;  2NWG A;  1SNM A;  3Q23 A;  3S2H B;  1MIU A;  2EJM A;  1QNK A;  5LMN Q;  4A3J B;  2QW7 A;  2EXD A;  2B39 A;  2TSS A;  4DUZ Q;  2K50 A;  2F0K A;  1XNQ Q;  1G29 1;  1NNX A;  1NTG A;  3ND8 A;  4XQN A;  4DV4 Q;  5FO7 B;  1PH7 A;  1BKB A;  1DCZ A;  2Z4I A;  3H09 A;  1CZG A;  2KEN A;  1DOM A;  2JQO A;  1GOZ A;  5EQ0 A;  3ULJ A;  3G7L A;  4DN4 M;  1VF5 C;  5JJL A;  3FDT A;  4WJW A;  1U0L A;  3Q8D A;  1NMG A;  1I50 B;  2H4O A;  3FMC A;  3MHB A;  5C4X B;  2V4D A;  4L5Q A;  2C9O A;  4ILW A;  1VQM A;  4A3C G;  4YY3 Q;  4UP9 A;  2DJG C;  2K75 A;  3K7A H;  1X3P A;  2F0P A;  2B63 B;  1CQV A;  4QUC A;  4LF9 L;  4P73 A;  4YIJ A;  3S17 H;  1NJI C;  4R4I A;  1I3Q B;  3RR5 A;  4DR5 L;  2WB1 G;  2QKI C;  4LFB Q;  1ZXT A;  2E75 C;  3CCR A;  4JOI A;  2JA5 G;  2SDF A;  1V43 A;  3NBH B;  1S4Z A;  5JPN C;  3VYR A;  5C0X H;  1JJG A;  1HTL D;  5C3E G;  3HKZ E;  3FRP B;  4HJA A;  4LNQ A;  4NXM Q;  3ZYY X;  4C1N K;  4DV2 L;  1SRO A;  4KJN A;  4HJ8 A;  4V0B A;  3EN2 A;  1TS3 A;  2Y0S G;  4JG2 A;  1XJV A;  1XMO L;  2ZTC A;  1O7I A;  1O78 A;  1IYV A;  3FPU B;  1TWG B;  4GN3 B;  2JEB I;  4LAA A;  1KLU D;  3PGZ A;  1VQO A;  2F0J A;  1R9T H;  3VDY A;  1SYG A;  1PFM A;  5C0X I;  5ELO A;  2PNH A;  1SNP A;  1FVI A;  3MA2 B;  1STE A;  1U4R A;  2A69 D;  4X65 Q;  5ELF A;  1QUQ A;  2GN5 A;  5K36 H;  4LF8 L;  3BDL A;  2ZXO A;  5H1S E;  1NUC A;  1SFO H;  3FHW A;  3CC2 A;  5E7N A;  4A3G H;  4X62 L;  5AJ3 L;  1JOR A;  1OXT A;  5C4J H;  1VQ8 A;  2I07 B;  3LWU A;  4ZAI A;  1MJE A;  2JA6 H;  5DLQ E;  2OT2 A;  2VQE Q;  2B8G A;  4DNR B;  2J4X A;  4F87 A;  2EYO A;  1IW7 C;  1S3O A;  2WKD A;  3M4O B;  3PUV A;  1PXU A;  4Z9C B;  3T16 A;  1K8O A;  1L2F A;  1EY5 A;  4JI6 Q;  1LAB A;  4A3B G;  4MHE A;  2ZTE A;  1UUP A;  2G9H D;  5KYI A;  3A0J A;  3ZJY C;  3JAM E;  3RMH A;  1FGU A;  1SYB A;  3TQY A;  1SJH D;  2XWB B;  1FJG Q;  3CD6 A;  2YTX A;  2NVQ H;  2RVL A;  1Q12 A;  3FKI H;  3R8B A;  4ALP A;  4JI4 Q;  1XNR L;  4NP5 A;  4L6T B;  4ZLT F;  1BUV T;  5I9P A;  4DV5 L;  1S40 A;  1J5E Q;  1EZ6 A;  2A74 C;  1DZ1 A;  2UU9 Q;  2UXB Q;  1PRT D;  3EJI A;  1QVC A;  4DK6 C;  5M5Y B;  5C3E B;  2B2T C;  1CM9 A;  1J6Q A;  1XPO A;  5CV9 A;  3CXC A;  2Y0S B;  2L15 A;  1GHJ A;  1H9R A;  4CGY B;  4DR1 L;  4HCE A;  1D7Q A;  2PMZ E;  1LTS D;  3SVM A;  5C0X G;  5M3F H;  1B1Z A;  3HKZ G;  4J1M A;  4DKA C;  4KKS A;  2MFI A;  1TKW B;  3GQB A;  1VQ4 A;  4ZCK A;  1AZP A;  3WDN A;  4QIW B;  1BF4 A;  3IAY A;  1EIY B;  2K14 A;  1TWA B;  1SJE D;  2F0Q A;  4DAV A;  3MXP A;  2D5D A;  5E1F A;  3L3O C;  3CC4 A;  2LY7 A;  2DUD A;  2CFM A;  2AWO A;  2Q2T A;  1CKN B;  1M90 C;  2VS1 A;  3VR3 A;  2OTL A;  1T5X D;  4A3E G;  4OWW B;  4H7B A;  2L0C A;  5FLX E;  4O0A A;  4XYQ A;  5K36 G;  5CGK A;  3A7L A;  1XWE A;  1KIX A;  4LF9 Q;  1IZ6 A;  4A4I A;  3R93 A;  2RHS B;  2R61 A;  4DR5 Q;  2Z0S A;  3W1G A;  1PVO A;  4A3B B;  1IHZ A;  4P74 A;  1H9S A;  2HCC A;  4ZUJ A;  1N36 Q;  3I3C A;  1D5Z C;  3CCJ A;  2O5I C;  2HT1 A;  3JC6 6;  1VQH A;  2XN9 C;  1JJC B;  1EIF A;  2ASB A;  3BZD B;  4DV2 Q;  5CV4 A;  3X3M A;  2WAQ G;  2XSC A;  4YCU A;  4N9P A;  4DNT B;  1LM0 A;  1TWH H;  3SHL A;  2Q2H A;  1QCB D;  1V1P B;  4RWS C;  3G6J B;  4RCO A;  3CQZ H;  3PIP A;  2B2V A;  3G48 A;  1ASY A;  2F0T A;  4GNX B;  4Q0F A;  1ZEQ X;  4X66 L;  4LF8 Q;  4JV5 L;  5EBC A;  3MFY A;  5JOB A;  1FYC A;  3J80 c;  1STG A;  2Z6B A;  1EYG A;  1Y14 B;  3HKZ B;  3K5M A;  2PZW A;  1WTX A;  4IPC A;  1NY4 A;  2EYF A;  3GD7 A;  4X62 Q;  5AJ3 Q;  5C0X J;  2UXC L;  3CKI B;  5G3L F;  2LS0 1;  2OWO A;  1JOO A;  2P5Z X;  2A68 D;  2SNS A;  4IFD H;  2V1C C;  1HZB A;  3W1B A;  3J81 i;  5M3F G;  3DM3 A;  1SYF A;  1K0S A;  2JA8 H;  2CH4 A;  3MVV A;  1KNA A;  2MGS A;  1I94 L;  1G6Z A;  4ZQ3 A;  1IL2 A;  1PH3 A;  4A3E B;  2GVA A;  2O4X A;  1KAA A;  2KBN A;  2EYL A;  3CCQ A;  1O7Z A;  1PV4 A;  3SK4 A;  4KD4 A;  4IFD I;  3QWN A;  1XNR Q;  1EOT A;  3PCO B;  1I4P A;  3H3V H;  1JE5 A;  2EJG C;  2K28 A;  2K5N A;  1HFG A;  1PYB A;  4DV5 Q;  5GQO A;  2A69 C;  4XYO A;  3CF5 A;  3HKS A;  1SNO A;  1FNU A;  1K83 H;  1YI2 A;  1RTN A;  3RZO H;  5JAV A;  1KLG D;  4AYB G;  1SMX A;  3DUZ A;  4CKB A;  4AIM A;  3FPP A;  2BCO A;  1H9K A;  1Z47 A;  4QGU A;  3S1Q B;  3H3V I;  1JCK B;  3PV0 A;  4DR1 Q;  5J39 A;  3CRL C;  5GAE C;  3J80 L;  5ELB A;  5GAD C;  3TZU A;  4RFB A;  2E2J H;  2VXW A;  1X3E A;  1VMP A;  2YV5 A;  2EVB A;  3NBH A;  2YTV A;  4A93 H;  4RGO S;  2F0L A;  2RDF A;  4PQX A;  2K5D A;  1NAP A;  4ZKC B;  2F0M A;  1YBY A;  2MPM A;  3LWE A;  5FLM G;  1BNZ A;  4DK0 A;  3CMA A;  3M85 A;  1MJC A;  4JI8 Q;  3Q24 A;  1F2Z A;  2OCE A;  4DXG A;  4S3S A;  2B2U A;  1PA6 A;  4JI2 L;  2RCN A;  1Y1W H;  3CCL A;  1HA5 A;  4C3I H;  4WJ3 M;  2PMZ B;  3OTO L;  5GRO A;  2CCZ A;  3HOY H;  1HUN A;  3E9H A;  1VQG A;  5KIX A;  1PRT C;  2VW9 A;  2R92 G;  4G7Z C;  1LTL A;  3EQL C;  3N52 A;  4Y7N H;  2JJQ A;  4BY1 H;  1OO9 B;  4MTN A;  5GAG C;  5IYD G;  3O13 A;  1P16 A;  4CDC C;  1PZJ D;  1V1O A;  1HZC A;  2VZA A;  4KHP L;  1PTO H;  1GXD C;  1A2T A;  1SLJ A;  1WTW A;  4I7A A;  2XNA C;  3K0X A;  3W2D A;  3HEJ A;  4KV6 A;  4R4T A;  4UHV A;  3HOZ G;  2PZT A;  4EQN A;  2F3I A;  2WII B;  3HRZ C;  4JVZ A;  2LKV A;  1WTO A;  1LT6 D;  1UEA B;  3SGI A;  1S5E D;  3QJY A;  5JVG 3;  1VQP A;  1RIP A;  2F0I A;  4X6A H;  4X66 Q;  1TS2 A;  4JV5 Q;  1LT3 D;  1STY A;  1TWC H;  2XRQ D;  3D3R A;  3VA5 A;  1VCI A;  4KY7 A;  2NZ1 D;  3ND9 A;  5IP9 H;  1STB A;  1VQI A;  3SK8 A;  3RUZ A;  2QF7 A;  1GD7 A;  3PO3 G;  4A3D H;  4K5W A;  4CHT B;  2UXC Q;  1B9N A;  3FP9 A;  5I4D A;  1HHV A;  3KYH C;  4HCS A;  4LF7 L;  1LTG D;  3RN2 A;  2EY5 A;  1L1O C;  1SRU A;  4P2C B;  2IHE A;  3GTJ H;  1L0X B;  2LSS A;  1I94 Q;  4IUP A;  5LHY 1;  3BVM A;  1SDF A;  2OQK A;  1QOH A;  3ER0 A;  3AU7 A;  2EY2 A;  5J3B A;  1NSN S;  3CCM A;  2WKC A;  3S14 H;  4KMU C;  1E7Z A;  1W6J A;  2R92 B;  2OEO A;  1X9N A;  3ITP A;  3S1R B;  2DY7 A;  1JOQ A;  3G6E A;  3F2B A;  4A3L G;  1WTV A;  2F0G A;  2E8G A;  2NTT A;  3DXJ C;  1HNW L;  1A3U A;  4BY1 G;  1N34 L;  4IFD J;  2XVS A;  3U4Z A;  1W3S A;  4J8Q A;  4CDE C;  2NVY B;  4CJ2 C;  3HOZ B;  3GTL H;  4F8M A;  4DV6 L;  1AFP A;  1PRT B;  4JI0 L;  5M3M B;  1WYD A;  1GUW A;  2A68 C;  1GVP A;  3E0E A;  4ZUI A;  1PDQ A;  3HOX H;  4HN7 A;  2HCI A;  1ML0 D;  4X3U A;  4LF6 L;  1KRS A;  2AUJ D;  4GLA C;  1DGS A;  1PFN A;  3TEH B;  5I2Y A;  4L5R C;  1GUT A;  2L11 A;  2XIW A;  4NB3 A;  3MFG A;  1CKO A;  3CME A;  3I2Z A;  4B9X A;  5C5M A;  1UEB A;  2NTS A;  1CA5 A;  3OWE B;  1AEX A;  2SNM A;  2EZV A;  4HIM A;  3S1N H;  1FNV A;  2NVX B;  2C35 B;  3QB3 A;  3PO3 B;  4JI2 Q;  4DAY A;  1I6H B;  1AN8 A;  4KD3 A;  1DYQ A;  1S5B D;  1V1P A;  2UXD L;  2E5L L;  3OTO Q;  1H9M A;  4RGT A;  1BCP D;  2Z8L A;  4QJF A;  1BBU A;  1XXG A;  3KBX A;  1LUZ A;  3LX0 A;  4OEL B;  4BA2 I;  4AQY L;  1QB5 D;  1CKM A;  5DNF A;  1CTM A;  3MWY W;  4BBS B;  1PFB A;  1AZQ A;  5C3W A;  1B3A A;  3KUP A;  4A3F H;  1H9S B;  1VS0 A;  1Q1E A;  4A3M B;  2KUM A;  4HJ5 A;  1EFW A;  1GKH A;  3A5Z B;  3OSO A;  1R4Q B;  2WB1 E;  1DOK A;  1T5E A;  1MGS A;  3OMG A;  1XPU A;  3KLS X;  3QG1 A;  3GTP H;  4HIO A;  1EUJ A;  1VQ6 A;  1HJP A;  3KLS A;  1L1O B;  2JYO A;  2B2T A;  4PV1 C;  5JEA H;  1DON A;  5GAH C;  3JAM L;  4DPG A;  3PO2 H;  5M5X H;  2A8V A;  5C44 G;  3I55 A;  5I6Y A;  1Z6H A;  3NBI A;  3K57 A;  4QQB X;  3BDC A;  3UDI A;  3W3A A;  5M5W H;  2A6H D;  1U5K A;  2Q2I A;  1GO3 E;  2HQE A;  2Y0S E;  1CI3 M;  1K3R A;  3KBG A;  1ICW A;  4C2M H;  3F2D A;  1KQS A;  4IO9 A;  3HG9 A;  5D3I B;  4DFA A;  2O5J C;  1G51 A;  2RBM A;  2R7Z G;  3QOJ A;  4LWC A;  2XGT A;  3A8I E;  2NVT H;  3LNN A;  4LF7 Q;  1O7L A;  3NEM A;  1IKM A;  3EVQ A;  2GA4 B;  2ZT9 C;  3U50 C;  3M4Y A;  1CT1 D;  4FF1 A;  1JOK A;  4LF5 L;  3D8G A;  3S15 B;  2NB0 A;  1HR0 W;  2DNC A;  5IE8 A;  2EE1 A;  3SDZ A;  4UY8 C;  1W6K A;  5IGE A;  2PO4 A;  3TSS A;  3VR4 A;  4ID6 A;  2CH4 W;  4BBR B;  4KHZ A;  1G2S A;  4J15 A;  4PMW A;  1F2L A;  3CAM A;  1VQC A;  3I4L A;  3T1Y L;  4RCN A;  1XYI A;  4JC0 A;  3L9A X;  4DUY L;  2K1B A;  3I4N H;  3GO5 A;  2EYJ A;  2JEA I;  1D5X C;  3P1H A;  5FLX L;  3NE5 B;  4C3J H;  4LUV A;  4AH6 A;  4GKJ L;  4RHR A;  1C7Y A;  1HNW Q;  1EY7 A;  1LTT D;  1STH A;  1N34 Q;  2AHO B;  2ICI A;  5IGC A;  1MI2 A;  3GTG B;  5D3D A;  1V8Q A;  1HTP A;  1I4H A;  1Z9F A;  4A3F G;  3KJP A;  4HMI A;  4DV6 Q;  4FF3 A;  4JI0 Q;  1PFS A;  2E2H H;  3S2D H;  2F0H A;  3IFD A;  3BYY B;  4WRD A;  1WOC A;  2PW5 A;  5C44 B;  3HOU H;  1EWC A;  1KDB A;  2O2L D;  4LF6 Q;  1KXL A;  2VUM H;  4UP8 A;  3RZD B;  3G71 A;  3D4R A;  4EX5 A;  2PW7 A;  5IP7 G;  1S5F D;  2DGY A;  3V96 A;  3PIO 3;  1JMC A;  3PO2 G;  3MAQ A;  1F9S A;  2R7Z B;  1S5C D;  3S16 B;  5JJZ A;  3UE0 A;  3J80 i;  3TZD A;  1K0R A;  1X3F A;  1CUK A;  2BE5 C;  2K5Q A;  2UXD Q;  2E5L Q;  1DM0 B;  1Y8O B;  3G4S A;  4OEM B;  4K5V A;  3GTM H;  1IKL A;  2MNA A;  1KHI A;  4AQY Q;  3NUC A;  3KDF A;  5CMD A;  4FO2 A;  4BS9 A;  4CJ0 B;  1LTA D;  3S1M B;  1FL0 A;  5I2X A;  2L55 A;  2NBF A;  3M4P A;  1STA A;  1ICF B;  2DJF C;  3CHB D;  2JXM B;  1ASZ A;  2RHQ B;  3A7A B;  4X3T A;  1LV9 A;  4B3M L;  2XRS D;  1EQT A;  1RD9 D;  1K9M C;  2KOL A;  1RCV D;  4IAL A;  4MTK A;  1FNW A;  4HR7 B;  3H0G H;  4IPH A;  3BDO A;  5BN4 A;  1EOV A;  3J7Y W;  5COR A;  4UP7 A;  1QE6 A;  3I8Z A;  2X6L A;  3L2P A;  3T53 B;  4DR7 L;  2E2I B;  3T56 B;  2ZJP A;  5AFW A;  1HA6 A;  3AQQ A;  3J81 E;  1Q7Y C;  2F0U A;  1QNU A;  1KNE A;  4XDX A;  3D4W A;  4B3S Q;  1GJX A;  2WAQ E;  2L5T A;  2HHH L;  1U4L A;  1BCP C;  2C5C A;  4FVM A;  3J7A F;  1MD2 D;  3TME A;  3RNU A;  1CQF A;  3STB D;  1X3G A;  2A73 B;  2WB1 B;  1ENC A;  1HZA A;  1MHW C;  1J8I A;  2D0P A;  3P7J A;  5IT9 E;  2R93 H;  2JA5 B;  3U9O A;  2IPK D;  2F0V A;  1TII D;  5EKK A;  2ALY B;  4LF5 Q;  3I4M H;  1QWY A;  4OXP A;  2ZXR A;  4IUU A;  3HOU G;  3E3X A;  3T13 A;  4K5X A;  4N8F A;  3RLO A;  3CW2 C;  3S9W A;  2Z6K A;  1WD1 A;  1JJ2 A;  4M8A A;  2WAC A;  3OW2 A;  1Q46 A;  2PI2 A;  3H91 A;  4IPD A;  1HNZ L;  2SOB A;  4OO1 H;  2VY3 A;  3GTQ B;  1BQQ T;  4RG1 A;  5ELD A;  3NEN A;  5DAU A;  4A3I H;  4L63 B;  3T1Y Q;  3BG3 A;  4DUY Q;  5T1G A;  1SEB D;  1BBW A;  2Q8R E;  3HGB A;  1JR0 D;  2N78 A;  4GKJ Q;  3K5O A;  1X32 A;  2JA7 H;  1ESF A;  5BR8 L;  2PQA B;  2K7V A;  5D14 A;  4OO1 I;  4TQU S;  2HQL A;  1LTB D;  4PMC A;  2R6G A;  1O80 A;  3CCE A;  4KKU A;  4QF4 A;  1KC8 C;  2WV6 D;  1I4Q A;  1ROD A;  4BXX H;  4JW0 A;  1M4V A;  5E4X A;  1EQR A;  1X56 A;  4AYB E;  5CV7 A;  4A3G G;  2R3Z A;  1HNX L;  3BU2 A;  5LMU L;  2R7D A;  2ZM6 L;  1D5M C;  1F2M A;  3AFQ A;  1Q3L A;  2JA6 G;  1Y69 U;  2PZU A;  1KD1 C;  1VQL A;  4RMF A;  2OXP A;  3TRZ A;  1HR0 L;  2BDO A;  3DM1 A;  4C1N I;  1L1O A;  2KJX A;  5EAY A;  4A3K H;  1XMO Q;  3K7A B;  4DAY B;  1ESR A;  3C1F A;  1E3P A;  1RL2 A;  3MZ5 A;  4OWT B;  2EQS A;  1SE2 A;  3DWP A;  3C1E A;  2ZXP A;  3S17 B;  3FKI G;  1EY9 A;  1Q81 C;  1PTO D;  4HAE A;  2RA4 A;  3H15 A;  4QMG A;  1BCP B;  4XQJ A;  1JE4 A;  3BVG A;  3I7F A;  2A6E D;  4LUZ A;  1WTP A;  5FK9 C;  4KI0 A;  3I4M G;  2FMM A;  3TN2 A;  4B3M Q;  1BCP F;  1JIC A;  2KCN A;  1ILQ A;  1B44 D;  4IUQ A;  3NP8 A;  2ZJQ A;  3HFZ B;  2EJF C;  2M00 A;  1EY4 A;  3GTO H;  4K2K A;  4KLK A;  1GUN A;  4QB4 A;  1I5F A;  4OO1 G;  3ERQ A;  2N8N A;  4ZK9 B;  5C4Z A;  1R9T B;  4PZ8 A;  4LMQ D;  4DR7 Q;  2G5D A;  2LXJ A;  4A3I G;  3A54 A;  2BA0 A;  1K8M A;  1N9W A;  3A55 A;  3IKJ A;  4GLX A;  3HOV H;  2YU9 H;  1JB3 A;  1QZG A;  2NUC A;  1BR9 A;  3F2U A;  1D1I A;  2HHH Q;  1AH9 A;  3M3Y H;  2L4N A;  1YNN D;  2AQ1 B;  3VYT A;  2PI2 E;  4A76 A;  2RKS A;  1SFO B;  5HGT A;  5E4W C;  2EY1 A;  4A3G B;  1U9R A;  1TWF H;  1VQ9 A;  3T1H L;  5C4J B;  2BH2 A;  2JA6 B;  1E1T A;  3OYY A;  1LT4 D;  1F77 A;  2KQ3 A;  1F9Q A;  1WJJ A;  5HGQ A;  1SNQ A;  1TY2 A;  3EFX D;  2WAQ B;  3E6Z X;  2JK8 A;  4NPS A;  5JVH 3;  3R2I A;  4GZY C;  1HNZ Q;  4V19 0;  5D65 A;  4GLV B;  2NVQ B;  4IN3 A;  3FKI B;  4OWX B;  1E2W A;  2DNE A;  4A3K G;  3NSW A;  1YHQ A;  4C3H H;  4APV A;  1VQA A;  2OTJ A;  1T9H A;  2IY5 B;  5BR8 Q;  1PH9 A;  1VF7 A;  1Y8P B;  4HIK A;  3STB C;  2BOS A;  4TSS A;  1YVC A;  2KED A;  5ISR A;  5A2Q L;  1CK1 A;  1SR3 A;  3HZX A;  3F8T A;  1RTO A;  3HOW H;  2J0T D;  3NXW A;  5CR3 A;  5M9O A;  3RLF A;  4QUF A;  5M3F B;  2K4K A;  1X65 A;  2Z6K C;  5CV5 A;  2K03 A;  2NN6 H;  2IJ0 A;  1CA6 A;  2AMC B;  1HRJ A;  1WCM H;  4FP5 D;  5LMU Q;  2ZM6 Q;  1I4G A;  3A5U A;  3H3V C;  3D6W A;  4WOR A;  4IFD G;  2LXK A;  1A63 A;  1V9P A;  2NZO A;  2JA8 G;  1ILP A;  3DHQ A;  1DD2 A;  1HR0 Q;  3NTI A;  4BY7 H;  1TQO A;  2NN6 I;  4LW1 A;  4J6H A;  4OIJ A;  4JCV E;  5EBD A;  3TP5 A;  3V05 A;  1J9O A;  3A8K E;  3M9B A;  4AYB B;  2KCT A;  1IBK L;  2VQF L;  1YJW A;  4FXG C;  2UUA L;  3CRK C;  1B50 A;  1IBM L;  4KTA A;  3KDF B;  1WVL A;  1ENA A;  3TP6 A;  3PQI A;  4DV0 L;  1JT8 A;  1Y1V H;  2MO1 A;  2CHB D;  4H02 A;  1VQ7 A;  1NR2 A;  1PMR A;  1BBX C;  1XPR A;  3CPW A;  4O1N A;  3U58 A;  2WP8 J;  2OQ0 A;  3GV6 A;  3J81 j;  4XQQ A;  2MUY A;  3ULP A;  3GTK H;  1HCZ A;  4C56 C;  1QJO A;  3S2H H;  1VDZ A;  2I0Q A;  4A3J H;  1TWH B;  3TS0 A;  1SE4 A;  3U9S A;  4G57 A;  4DA2 A;  1BVS A;  3CQZ B;  4DV1 L;  1LAC A;  3K81 C;  4MZ9 A;  2QDB A;  3I56 A;  4NMZ A;  3GP7 A;  2I5H A;  4LUO A;  2F4V L;  2IL8 A;  1IL8 A;  3UI2 A;  4A93 G;  3I72 A;  1L0W A;  1SYE A;  2E76 C;  4C3H G;  1TS5 A;  1JWU D;  2WFW A;  1I50 H;  1JQY D;  1PZK D;  2AWN A;  2IT1 A;  1PYS B;  5C4X H;  4XT1 B;  5FO8 B;  1B9M A;  4UPA A;  1YNJ D;  2F0W A;  5COY A;  5LL6 X;  3VYS A;  1E22 A;  5EPK A;  4JI7 L;  1PTO C;  3T1H Q;  1Y1W G;  3AB9 A;  5IGF A;  2KHI A;  4C3I G;  1YIJ A;  5CBE E;  3HOW G;  4DAP A;  2ICE C;  2ENB A;  3HOY G;  2PQA A;  3H94 A;  3KFU A;  2I5L X;  2B63 H;  3OIP A;  5L37 A;  3OW7 A;  2JA8 B;  2EYM A;  2K33 A;  2FHT A;  1F9R A;  1I3Q H;  5CYU A;  1WCM G;  5IY0 A;  1M8A A;  2I46 A;  3J7Z C;  1Q82 C;  3J7A 5;  3S24 A;  1CFM A;  2CWA A;  2ES2 A;  3I70 A;  3JAM c;  4R8I A;  2F03 A;  1P8L A;  1F9P A;  2L12 A;  1NCV A;  4I65 A;  3M7G A;  4RGN A;  3U4V A;  3UDX A;  3MEH A;  4GOP A;  3FEW X;  5ELE A;  2IWH A;  3OPO A;  1LLR D;  4YWM A;  1K83 B;  4CDF C;  2VB2 X;  1TWG H;  2Z4H A;  4NW2 A;  3RZO B;  1MBY A;  2VB3 X;  2K5V A;  3K6O A;  1YNN C;  4EQO A;  3E0J A;  2EDG A;  4ABN A;  5KYL A;  3FVQ A;  1A3T A;  3AYH B;  2JN4 A;  3BS1 A;  2KEC A;  4R1J A;  3DWQ A;  4N8X 1;  4DV7 L;  5FJ8 H;  2TMP A;  3URY A;  1Y1V G;  5CBA E;  4LK1 C;  3TBI B;  3J80 E;  4FXD A;  5IP9 G;  1HQR D;  1LO5 D;  1LTR D;  4RH6 A;  1QVF A;  3KOJ A;  3MXN B;  1Q90 A;  5J1Z A;  1FGB D;  4A3D G;  2E2J B;  1X3Q A;  4LFA L;  3KF8 B;  4A93 B;  4DU9 A;  2IX1 A;  4LFC L;  2UUC L;  1IBL L;  2KHS A;  3KLR A;  1K28 A;  4FDB A;  3AEV A;  1CZW A;  2B3G A;  4KHP Q;  2K04 A;  2FMC A;  4LF4 L;  3M4O H;  2F3W A;  1WD0 A;  2RSN A;  4JBW A;  3J81 L;  1Y1W B;  1H95 A;  4C3I B;  5EKI A;  1EY0 A;  5FLX c;  3ICE A;  4B9W A;  1F2Y A;  3HOY B;  3CP0 A;  1LTI D;  1UE1 A;  2D0O A;  3PUY A;  5C4X G;  3MXG A;  3C46 A;  1IBK Q;  2VQF Q;  4Y7N B;  2IW3 A;  4P71 A;  2UUA Q;  1IBM Q;  4BY1 B;  1A2U A;  2GVB A;  2EYP A;  5IIF A;  4DV0 Q;  4HID A;  2E74 C;  5EKL A;  1D2B A;  1YHB A;  1QVG A;  2CW0 D;  1D1K A;  4PG3 A;  4IZ8 A;  1VQB A;  1DOL A;  1UNS A;  5IT9 L;  3TRE A;  1QG7 A;  1PTO B;  5M5Y H;  3P20 A;  5C3E H;  4ZRZ A;  4FNF A;  1EEI D;  2PNR C;  3QIA A;  4ULL A;  4N9T A;  4NXN L;  1PTO F;  3L0O A;  4DNI A;  4MNO A;  3DEO A;  2PPB C;  3ULL A;  5IGD A;  3HOX G;  4DV1 Q;  3ERS X;  4EQP A;  4EVO A;  5DM7 3;  5HUR A;  3K5N A;  1K8A C;  2DY8 A;  3NWS A;  1WI5 A;  1TVX A;  1TXY A;  2F4V Q;  3KK7 A;  3AMU A;  1PYW D;  4IQZ A;  3NHH A;  1C8C A;  4TVA B;  3QR8 A;  1TWC B;  1TWA H;  5BN3 A;  3PIP 3;  3PUZ A;  2HIX A;  4JI1 L;  2RF4 A;  4A3D B;  1HZ9 A;  5IOC A;  1PH5 A;  1AE2 A;  4JI7 Q;  3DLL A;  5J22 A;  3T51 B;  3K80 C;  4GN4 B;  1II3 A;  5FJ8 G;  2N88 A;  1O7Y A;  3SE0 A;  4EQ5 A;  3PMF A;  1VQN A;  4GS3 A;  3GTJ B;  5IWA L;  3CPF A;  4QY7 A;  1EYD A;  1B70 B;  1SYC A;  1A8V A;  3IFT A;  1C4Q A;  1VMC A;  1ZYR D;  1GUO A;  4A3B H;  1HH2 P;  2CKZ B;  2AQ2 B;  2MO0 A;  3Q22 A;  3S14 B;  3X3N A;  1G8Z D;  3UDF A;  2FIN B;  4BA1 I;  2QIL A;  3OMC A;  1MKH A;  1TT2 A;  4Q5V A;  2KCC A;  2N3S A;  1PH8 A;  3E9I A;  5JEA G;  1ET6 A;  2QEJ C;  2EY6 A;  4TRD A;  2F4I A;  2E2D C;  3NQI A;  1YNJ C;  4K2L A;  1Q1B A;  3K58 A;  4XT3 B;  4DV7 Q;  2B2Y C;  2CQO A;  2G9D A;  1FR3 A;  3HP3 A;  4PNY A;  1PH2 A;  3GTL B;  1RF2 D;  1N36 L;  2KHJ A;  1AW7 A;  2FJ2 A;  4G7H C;  5TSS A;  1NE3 A;  4O42 A;  3HOX B;  5FOB B;  2K05 A;  4XIG S;  2ID0 A;  2HD3 A;  2UUB L;  4LFA Q;  4H44 C;  5C6A A;  1N8R C;  1PH1 A;  4YCV A;  3K5L A;  3CCS A;  1VQK A;  1XX8 A;  3QO2 A;  4R4Q A;  3V2T A;  2UUC Q;  1IBL Q;  4LFC Q;  1EIH A;  2J7Z A;  4GOP C;  2RDG A;  4IUV A;  3CCU A;  1MSG A;  4X3K A;  3Q6S A;  2MP1 A;  1VQF A;  3SXH A;  3IL8 A;  4OL7 A;  3S1N B;  1MSH A;  1I4X A;  2IHF A;  4LF4 Q;  1AE3 A;  1JB7 A;  1H9J A;  1R4P B;  4KHV A;  4WJ4 A;  1SXT A;  4A3E H;  2F1M A;  2XWJ B;  1WTH A;  5KND A;  3ERO A;  2B2W A;  3I4N G;  1WFQ A;  5KNC A;  1SSO A;  2R7F A;  1OXS C;  3SEB A;  3R2T A;  4JYA L;  2PCF B;  5KRU A;  4A3F B;  4OHJ A;  1EY8 A;  1YZ6 A;  4R4C A;  4C3J G;  4O2D A;  1VQD A;  1K8G A;  1B4O A;  1EIG A;  1BXT A;  5JPM C;  3K8A A;  1PLF A;  1HQM C;  2XTI A;  1DXM A;  1FD7 D;  4DAM A;  4FYD A;  3GTP B;  1HFN A;  4UDU C;  4NXN Q;  2CQA A;  1CSP A;  1SYD A;  4HTH A;  4P72 A;  5E3F A;  1M1K C;  3S1Q H;  3CU7 A;  4GNX C;  3TS2 A;  1UE7 A;  3OOC A;  3VR6 A;  5M5X B;  3PO2 B;  1WTQ A;  1A62 A;  1I6V C;  4RA8 A;  1VQ5 A;  5JEA J;  2N55 A;  4JBM A;  4PZ7 A;  2Q8T A;  5M5W B;  2VUM G;  4NDX A;  3BYT B;  4JBJ A;  3EIV A;  4C2M B;  2B8F A;  1C48 A;  3VA7 A;  1HPC A;  3OIQ A;  3ONA B;  4JI1 Q;  4KN7 C;  1ENF A;  3H6M A;  3EA6 A;  1KL9 A;  4DV3 L;  1RKN A;  4RAU C;  1JC7 A;  2A6H C;  2NVT B;  4FF4 A;  4M1U B;  1PH6 A;  3WOF A;  1PZI D;  2CW0 C;  1HXY D;  3IRB A;  5IWA Q;  3C2P A;  4E6I A;  4HED A;  1K3B C;  1G91 A;  1YJ9 A;  2H5X A;  3P75 A;  2QEX A;  4TKO B;  2CWP A;  1Q8K A;  2FFK B;  2I5M X;  3UE1 A;  1A0I A;  1I4R A;  2KEE A;  2LMC B;  1KDC A;  5EPJ A;  3MXN A;  4HJ9 A;  4ME5 A;  2Z9H A;  5EGT A;  1U4P A;  3RLN A;  3M4Q A;  1EY6 A;  3KF8 A;  2D9U A;  3E5S A;  2M2L A;  1EYA A;  4CJ1 B;  3I4N B;  4JI8 L;  3H0G G;  4GOP B;  3QOL A;  4LJZ C;  4WFN 3;  4POG A;  4IJH A;  3NQT A;  4C3J B;  3N6R A;  3B6Y A;  5KGU A;  3I4O A;  5KNB A;  2AKW B;  4XXE A;  4RKL A;  5HY6 A;  2N49 A;  1NMF A;  3RD4 A;  3DMU A;  1N33 L;  1Q86 C;  2BDN A;  2JE6 I;  3VYU A;  3NTH A;  1KTK A;  1EZ8 A;  2KVM A;  5LMN W;  4GKK L;  4IOA A;  2EPB A;  2E2H B;  2MQH A;  4I7Z C;  3S2D B;  2NZH A;  1SMY D;  4KJO A;  4ZYS A;  2UUB Q;  3WWV A;  3HOU B;  2F0O A;  3TP8 A;  2VUM B;  2QA4 A;  2MJ8 A;  3W5O A;  2R93 G;  2B29 A;  1ZYR C;  3KF6 A;  5NUC A;  1EL0 A;  4ZKB B;  1V1Q A;  1XTC D;  4L8J A;  5F2D A;  1D8L A;  2ZTD A;  3MEF A;  3OWF A;  4CKE A; 
#chains in the Genus database with same CATH homology
 3R3O A;  2RSO A;  5A35 A;  2F0F A;  2A5H A;  5ELC A;  3GTM B;  4ODG A;  4DXF A;  2AQ3 B;  1AP0 A;  4DF7 A;  4U68 A;  5KEE A;  4CBV A;  4KY6 A;  1EQV A;  1EU3 A;  4IUN A;  5CV8 A;  2EYH A;  1OXV A;  2CVR A;  2L9H A;  4KN4 C;  4X3S A;  1EYC A;  4HMJ A;  3H0G B;  1OXU A;  3MXU A;  1DJR D;  1TR5 A;  2LFN A;  3L7Z C;  4FXK C;  4OIK A;  4UAI A;  2SEB D;  4RKB A;  1SE3 A;  2B2W C;  2K6A A;  3NPP A;  1ET9 A;  2PYK A;  1STN A;  2JSO A;  2R93 B;  3BVZ A;  1HUM A;  1EWH A;  3D31 A;  3MTS A;  3I4M B;  4IUR A;  1L0Y B;  1Z7T A;  4DGZ A;  1WTR A;  2K32 A;  4K6L A;  1OXX K;  5EJW A;  3MC0 B;  4MN3 A;  3M7N A;  1TY0 A;  1SAP A;  2Q8I B;  1SBB B;  4A3I B;  3NWT A;  5DM6 3;  1TS4 A;  1Y8N B;  3A56 A;  2D2C C;  3I91 A;  1RHP A;  2L1B A;  2D62 A;  2M9V A;  3SK5 A;  1G2T A;  2JA7 B;  3Q0A A;  1ONL A;  2KA7 A;  1GHK A;  2YYZ A;  2H1E A;  3NK9 A;  1E0B A;  5CC4 A;  1SNC A;  3A8J E;  2AUK A;  2NYZ D;  3VR5 A;  4CKC A;  2VNU D;  4R8N A;  4F88 A;  1QIL A;  2WIN B;  3PUX A;  2RDH A;  1NR4 A;  1CHQ D;  1LT5 D;  4PMB A;  5C3X A;  3PUW A;  4K8I A;  4KY5 A;  3SK6 A;  4BWG B;  1RJT A;  1B53 A;  3VR2 A;  2X6G A;  4A3K B;  3C3L A;  4G7O C;  3I90 A;  4K8J A;  4B08 A;  3TP7 A;  4QCL A;  2IX0 A;  4DK1 A;  2RQX A;  1SMY C;  5IGG A;  1GUS A;  5IGB A;  4H13 C;  3K59 A;  1UAP A;  5I9O A;  3OHX C;  5EPL A;  3GTO B;  4MIU A;  2X69 A;  2A6E C;  1A6X A;  2B2V C;  2F3V A;  2NN6 G;  2OF1 A;  3DWA A;  2B2Y A;  4RHS A;  5DEH A;  3HOV B;  1KAB A;  4HSP A;  2YU9 B;  1EU4 A;  2BE5 D;  5T1I A;  3HS0 C;  1B2T A;  2JP1 A;  3T4A C;  3WOE A;  4KKT A;  2HUG A;  3M3Y B;  4CKE A;  1A3V A;  1JWS D;  5FO9 B;  2K5W A;  4K6D A;  5C5L A;  1TWF B;  1E2V A;  4JK1 C;  3DEP A;  4XTC S;  4OGQ C;  3NTK A;  2HDM A;  4U67 3;  3GV3 A;  1U4M A;  1PRT F;  1A15 A;  1BOS A;  1EEF D;  2F0S A;  1IW7 D;  3D6C A;  4NKL A;  5LL6 S;  5IOD A;  4HSV A;  3K0Y A;  3J7A V;  2K01 A;  4C3H B;  2BA1 A;  1CHP D;  5K5P A;  3D4D A;  1RDP D;  2F0D A;  2EXZ A;  1IYU A;  1E2Z A;  3TDQ A;  3I73 A;  5G3L D;  5A2Q E;  1BDO A;  3HOW B;  2QCP X;  1EFI D;  4EGV A;  1TU2 B;  4FF2 A;  5FKA C;  1WCM B;  1SND A;  4F7X A;  1S5D D;  4RGM A;  2Z1C A;  4G4K A;  2F0N A;  2IX3 A;  4H0L C;  4IUT A;  2B2U C;  5CV6 A;  2EOT A;  4BY7 B;  1ZKO A;  1Q8I A;  5I6W A;  1GUG A;  4R9W A;  2PQE A;  2DN8 A;  2HDL A;  4K14 A;  1KDA A;  1JWM D;  1Y1V B;  1D6E C;  1BO0 A;  2F0E A;  2MHV A;  4KK7 A;  3SR1 A;  5C4H A;  5BN5 A;  3GTK B;  2NWG A;  1SNM A;  3Q23 A;  3S2H B;  2EJM A;  1QNK A;  4A3J B;  2B39 A;  2TSS A;  2F0K A;  1G29 1;  3ND8 A;  4XQN A;  5FO7 B;  1DCZ A;  2Z4I A;  3H09 A;  1CZG A;  1DOM A;  5EQ0 A;  1GOZ A;  3G7L A;  4DN4 M;  1VF5 C;  3FDT A;  4WJW A;  1I50 B;  2H4O A;  3FMC A;  3MHB A;  5C4X B;  2V4D A;  2C9O A;  4ILW A;  1X3P A;  2F0P A;  2B63 B;  1CQV A;  4QUC A;  4YIJ A;  1I3Q B;  2QKI C;  1ZXT A;  2E75 C;  2SDF A;  1V43 A;  1S4Z A;  5JPN C;  3VYR A;  5C0X H;  1HTL D;  3FRP B;  3ZYY X;  4C1N K;  4KJN A;  4V0B A;  1TS3 A;  1O78 A;  1IYV A;  3FPU B;  1TWG B;  4LAA A;  2JEB I;  1KLU D;  2F0J A;  1SYG A;  1PFM A;  5C0X I;  1SNP A;  3MA2 B;  1STE A;  1U4R A;  2A69 D;  5ELF A;  5K36 H;  3BDL A;  2ZXO A;  1NUC A;  1JOR A;  1OXT A;  2I07 B;  3LWU A;  4ZAI A;  2OT2 A;  2B8G A;  4DNR B;  2J4X A;  4F87 A;  2EYO A;  1IW7 C;  2WKD A;  3M4O B;  3PUV A;  1PXU A;  4Z9C B;  3T16 A;  1K8O A;  1EY5 A;  1LAB A;  4MHE A;  1UUP A;  2G9H D;  5KYI A;  3JAM E;  3RMH A;  1SYB A;  1SJH D;  2XWB B;  2RVL A;  1Q12 A;  3R8B A;  4NP5 A;  4L6T B;  4ZLT F;  1BUV T;  5I9P A;  1EZ6 A;  2A74 C;  1DZ1 A;  1PRT D;  3EJI A;  5M5Y B;  5C3E B;  2B2T C;  1CM9 A;  5CV9 A;  2Y0S B;  1GHJ A;  1H9R A;  4CGY B;  4HCE A;  1LTS D;  3SVM A;  5C0X G;  1B1Z A;  4J1M A;  4KKS A;  1TKW B;  3GQB A;  1AZP A;  3WDN A;  4QIW B;  1BF4 A;  3IAY A;  1TWA B;  1SJE D;  2F0Q A;  4DAV A;  3MXP A;  2D5D A;  5E1F A;  3L3O C;  2LY7 A;  2AWO A;  3VR3 A;  1T5X D;  4H7B A;  2L0C A;  5FLX E;  4XYQ A;  5K36 G;  5CGK A;  3A7L A;  1XWE A;  3R93 A;  2R61 A;  4A3B B;  1IHZ A;  1H9S A;  2HCC A;  4ZUJ A;  3I3C A;  1D5Z C;  2O5I C;  2XN9 C;  3BZD B;  5CV4 A;  3X3M A;  2XSC A;  4N9P A;  4DNT B;  3SHL A;  1QCB D;  1V1P B;  4RWS C;  3G6J B;  4RCO A;  2B2V A;  2F0T A;  4Q0F A;  1ZEQ X;  5EBC A;  3MFY A;  5JOB A;  1FYC A;  1STG A;  3HKZ B;  3K5M A;  2PZW A;  1WTX A;  2EYF A;  3GD7 A;  5C0X J;  3CKI B;  5G3L F;  2LS0 1;  1JOO A;  4IFD H;  2A68 D;  2SNS A;  1SYF A;  3MVV A;  1KNA A;  2MGS A;  1G6Z A;  4ZQ3 A;  4A3E B;  2O4X A;  1KAA A;  2EYL A;  1O7Z A;  3SK4 A;  4KD4 A;  4IFD I;  3QWN A;  1EOT A;  1I4P A;  2EJG C;  2K28 A;  1HFG A;  2A69 C;  4XYO A;  1SNO A;  1FNU A;  1RTN A;  5JAV A;  1KLG D;  3DUZ A;  4CKB A;  3FPP A;  2BCO A;  1H9K A;  1Z47 A;  3S1Q B;  1JCK B;  3PV0 A;  5J39 A;  3CRL C;  3J80 L;  5ELB A;  3TZU A;  4RFB A;  2VXW A;  1VMP A;  2EVB A;  3NBH A;  4RGO S;  2F0L A;  2RDF A;  4PQX A;  2K5D A;  1NAP A;  4ZKC B;  2F0M A;  2MPM A;  3LWE A;  1BNZ A;  4DK0 A;  3M85 A;  3Q24 A;  1F2Z A;  4DXG A;  4S3S A;  2B2U A;  1HA5 A;  2PMZ B;  1HUN A;  5KIX A;  1PRT C;  4G7Z C;  3EQL C;  3N52 A;  1OO9 B;  3O13 A;  1PZJ D;  1V1O A;  1PTO H;  1GXD C;  1A2T A;  1WTW A;  2XNA C;  3W2D A;  3HEJ A;  4KV6 A;  2PZT A;  4EQN A;  2WII B;  3HRZ C;  2LKV A;  1WTO A;  1LT6 D;  1UEA B;  1S5E D;  3QJY A;  5JVG 3;  2F0I A;  1TS2 A;  1LT3 D;  1STY A;  2XRQ D;  3D3R A;  3VA5 A;  1VCI A;  4KY7 A;  2NZ1 D;  3ND9 A;  1STB A;  3SK8 A;  3RUZ A;  2QF7 A;  4K5W A;  4CHT B;  1B9N A;  5I4D A;  1HHV A;  4HCS A;  1LTG D;  2EY5 A;  4P2C B;  1L0X B;  4IUP A;  5LHY 1;  3BVM A;  1SDF A;  1QOH A;  3AU7 A;  2EY2 A;  1NSN S;  2WKC A;  4KMU C;  1W6J A;  2R92 B;  2OEO A;  3ITP A;  3S1R B;  2DY7 A;  1JOQ A;  1WTV A;  2F0G A;  2NTT A;  3DXJ C;  1A3U A;  4IFD J;  2XVS A;  4J8Q A;  2NVY B;  4CJ2 C;  3HOZ B;  4F8M A;  1AFP A;  1GUW A;  1PRT B;  5M3M B;  2A68 C;  4ZUI A;  1PDQ A;  4HN7 A;  2HCI A;  1ML0 D;  4X3U A;  2AUJ D;  1PFN A;  5I2Y A;  1GUT A;  2L11 A;  2XIW A;  3MFG A;  4B9X A;  5C5M A;  2NTS A;  1CA5 A;  3OWE B;  1AEX A;  2SNM A;  2EZV A;  1FNV A;  2NVX B;  3QB3 A;  3PO3 B;  4DAY A;  1I6H B;  1AN8 A;  4KD3 A;  1DYQ A;  1S5B D;  1V1P A;  1H9M A;  4RGT A;  1BCP D;  2Z8L A;  3KBX A;  1XXG A;  3LX0 A;  4BA2 I;  1QB5 D;  5DNF A;  1CTM A;  3MWY W;  4BBS B;  1PFB A;  1AZQ A;  5C3W A;  1B3A A;  3KUP A;  1H9S B;  1Q1E A;  4A3M B;  2KUM A;  3OSO A;  1R4Q B;  1DOK A;  1T5E A;  1MGS A;  3OMG A;  3KLS X;  3QG1 A;  3KLS A;  2JYO A;  2B2T A;  4PV1 C;  5JEA H;  1DON A;  3JAM L;  5I6Y A;  1Z6H A;  3NBI A;  3K57 A;  3BDC A;  3W3A A;  2A6H D;  2HQE A;  3KBG A;  1CI3 M;  1ICW A;  3HG9 A;  5D3I B;  4DFA A;  2O5J C;  2RBM A;  3QOJ A;  3A8I E;  3LNN A;  1O7L A;  1IKM A;  3EVQ A;  2GA4 B;  2ZT9 C;  3M4Y A;  1CT1 D;  4FF1 A;  1JOK A;  3D8G A;  3S15 B;  2NB0 A;  2DNC A;  2EE1 A;  3SDZ A;  1W6K A;  5IGE A;  2PO4 A;  3TSS A;  3VR4 A;  4ID6 A;  4BBR B;  4KHZ A;  1G2S A;  4PMW A;  1F2L A;  3I4L A;  4RCN A;  1XYI A;  3L9A X;  2K1B A;  3GO5 A;  2EYJ A;  2JEA I;  1D5X C;  3P1H A;  5FLX L;  3NE5 B;  4RHR A;  1EY7 A;  1LTT D;  1STH A;  2ICI A;  5IGC A;  1MI2 A;  3GTG B;  5D3D A;  1V8Q A;  1HTP A;  1I4H A;  4HMI A;  4FF3 A;  2F0H A;  3IFD A;  3BYY B;  4WRD A;  2PW5 A;  5C44 B;  1EWC A;  1KDB A;  2O2L D;  3RZD B;  3D4R A;  2PW7 A;  1S5F D;  3V96 A;  3PIO 3;  3MAQ A;  1F9S A;  2R7Z B;  1S5C D;  3S16 B;  5JJZ A;  3TZD A;  2BE5 C;  2K5Q A;  1DM0 B;  1Y8O B;  4K5V A;  1IKL A;  3NUC A;  5CMD A;  4FO2 A;  4BS9 A;  4CJ0 B;  1LTA D;  3S1M B;  5I2X A;  2L55 A;  2NBF A;  1STA A;  3CHB D;  2JXM B;  3A7A B;  4X3T A;  1LV9 A;  2XRS D;  1EQT A;  1RD9 D;  2KOL A;  1RCV D;  4IAL A;  1FNW A;  4HR7 B;  3BDO A;  5BN4 A;  3J7Y W;  5COR A;  1QE6 A;  3I8Z A;  2X6L A;  3T53 B;  2E2I B;  3T56 B;  5AFW A;  1HA6 A;  3J81 E;  2F0U A;  1QNU A;  1KNE A;  4XDX A;  3D4W A;  1GJX A;  2L5T A;  1U4L A;  1BCP C;  2C5C A;  4FVM A;  3J7A F;  1MD2 D;  3TME A;  1CQF A;  2A73 B;  2WB1 B;  1ENC A;  1J8I A;  3P7J A;  5IT9 E;  2JA5 B;  3U9O A;  2IPK D;  2F0V A;  1TII D;  5EKK A;  1QWY A;  2ZXR A;  4IUU A;  3T13 A;  4K5X A;  3S9W A;  1WD1 A;  4M8A A;  2WAC A;  3H91 A;  2SOB A;  4OO1 H;  3GTQ B;  1BQQ T;  5ELD A;  5DAU A;  4L63 B;  3BG3 A;  5T1G A;  1SEB D;  2Q8R E;  3HGB A;  1JR0 D;  3K5O A;  1X32 A;  1ESF A;  2K7V A;  5D14 A;  4OO1 I;  4TQU S;  1LTB D;  4PMC A;  2R6G A;  1O80 A;  4KKU A;  4QF4 A;  2WV6 D;  1I4Q A;  1ROD A;  1M4V A;  5E4X A;  5CV7 A;  2R3Z A;  1D5M C;  1F2M A;  1Q3L A;  1Y69 U;  2PZU A;  2OXP A;  2BDO A;  3DM1 A;  4C1N I;  2KJX A;  3K7A B;  1ESR A;  3C1F A;  3MZ5 A;  1SE2 A;  3DWP A;  3C1E A;  2ZXP A;  3S17 B;  1EY9 A;  1PTO D;  4HAE A;  2RA4 A;  4QMG A;  1BCP B;  4XQJ A;  1JE4 A;  3BVG A;  2A6E D;  1WTP A;  5FK9 C;  4KI0 A;  2FMM A;  3TN2 A;  1BCP F;  1JIC A;  2KCN A;  1ILQ A;  1B44 D;  4IUQ A;  3NP8 A;  2EJF C;  2M00 A;  1EY4 A;  4K2K A;  4QB4 A;  1GUN A;  4OO1 G;  3ERQ A;  4ZK9 B;  5C4Z A;  1R9T B;  4LMQ D;  3A54 A;  2BA0 A;  1K8M A;  3A55 A;  3IKJ A;  1JB3 A;  2NUC A;  1BR9 A;  3F2U A;  1D1I A;  2L4N A;  1YNN D;  2AQ1 B;  3VYT A;  1SFO B;  2RKS A;  5HGT A;  5E4W C;  2EY1 A;  4A3G B;  1U9R A;  5C4J B;  2JA6 B;  1F77 A;  1LT4 D;  2KQ3 A;  1F9Q A;  1SNQ A;  1TY2 A;  3EFX D;  2WAQ B;  3E6Z X;  5JVH 3;  3R2I A;  4GZY C;  4V19 0;  5D65 A;  2NVQ B;  4IN3 A;  3FKI B;  1E2W A;  2DNE A;  3NSW A;  1VF7 A;  1Y8P B;  2BOS A;  4TSS A;  2KED A;  5ISR A;  5A2Q L;  1CK1 A;  3HZX A;  1RTO A;  2J0T D;  3NXW A;  5CR3 A;  5M9O A;  3RLF A;  4QUF A;  5M3F B;  5CV5 A;  2K03 A;  2NN6 H;  2IJ0 A;  1CA6 A;  1HRJ A;  4FP5 D;  1I4G A;  3H3V C;  3D6W A;  4WOR A;  4IFD G;  1ILP A;  3DHQ A;  1DD2 A;  3NTI A;  1TQO A;  2NN6 I;  4J6H A;  4OIJ A;  5EBD A;  3TP5 A;  3V05 A;  1J9O A;  3A8K E;  4AYB B;  4FXG C;  3CRK C;  1B50 A;  4KTA A;  1WVL A;  1ENA A;  3TP6 A;  2CHB D;  1NR2 A;  1PMR A;  1BBX C;  4O1N A;  2WP8 J;  3GV6 A;  4XQQ A;  2MUY A;  1HCZ A;  4C56 C;  1QJO A;  1VDZ A;  1TWH B;  1SE4 A;  3U9S A;  4G57 A;  4DA2 A;  3CQZ B;  1LAC A;  2QDB A;  4NMZ A;  3GP7 A;  2IL8 A;  1IL8 A;  3UI2 A;  3I72 A;  1SYE A;  2E76 C;  4C3H G;  1TS5 A;  1JWU D;  1JQY D;  1PZK D;  2AWN A;  2IT1 A;  5FO8 B;  4XT1 B;  1B9M A;  1YNJ D;  2F0W A;  5COY A;  5LL6 X;  3VYS A;  5EPK A;  1PTO C;  3AB9 A;  4C3I G;  5CBE E;  4DAP A;  2ICE C;  2ENB A;  3H94 A;  3OIP A;  3OW7 A;  2JA8 B;  2EYM A;  2K33 A;  2FHT A;  1F9R A;  5CYU A;  1M8A A;  2I46 A;  1CFM A;  3I70 A;  4R8I A;  2F03 A;  1F9P A;  2L12 A;  1NCV A;  4I65 A;  3M7G A;  4RGN A;  3MEH A;  3FEW X;  5ELE A;  2IWH A;  3OPO A;  1LLR D;  1K83 B;  2VB2 X;  4NW2 A;  2Z4H A;  3RZO B;  1MBY A;  2VB3 X;  3K6O A;  1YNN C;  4EQO A;  3E0J A;  2EDG A;  4ABN A;  5KYL A;  3FVQ A;  1A3T A;  3BS1 A;  2KEC A;  3DWQ A;  2TMP A;  3URY A;  5CBA E;  4LK1 C;  3TBI B;  3J80 E;  4FXD A;  1HQR D;  1LO5 D;  1LTR D;  4RH6 A;  1Q90 A;  5J1Z A;  1FGB D;  2E2J B;  1X3Q A;  4A93 B;  4DU9 A;  2IX1 A;  2KHS A;  3KLR A;  1CZW A;  2K04 A;  2FMC A;  2F3W A;  1WD0 A;  2RSN A;  4JBW A;  3J81 L;  1Y1W B;  4C3I B;  5EKI A;  1EY0 A;  4B9W A;  1F2Y A;  3HOY B;  1LTI D;  3PUY A;  3MXG A;  3C46 A;  4Y7N B;  2IW3 A;  4BY1 B;  1A2U A;  2EYP A;  5IIF A;  2E74 C;  5EKL A;  1D2B A;  2CW0 D;  1D1K A;  4IZ8 A;  1DOL A;  1UNS A;  5IT9 L;  1QG7 A;  1PTO B;  3P20 A;  4ZRZ A;  4FNF A;  1EEI D;  2PNR C;  3QIA A;  4ULL A;  4N9T A;  1PTO F;  2PPB C;  3DEO A;  5IGD A;  4EQP A;  4EVO A;  5DM7 3;  5HUR A;  3K5N A;  2DY8 A;  3NWS A;  1TVX A;  3KK7 A;  3AMU A;  1PYW D;  4IQZ A;  3NHH A;  1C8C A;  1TWC B;  5BN3 A;  3PIP 3;  3PUZ A;  4A3D B;  5IOC A;  5J22 A;  3T51 B;  1II3 A;  2N88 A;  1O7Y A;  3SE0 A;  3PMF A;  3GTJ B;  1EYD A;  1SYC A;  3IFT A;  1C4Q A;  1VMC A;  1ZYR D;  1GUO A;  2AQ2 B;  3S14 B;  3Q22 A;  3X3N A;  1G8Z D;  2FIN B;  4BA1 I;  2QIL A;  3OMC A;  1TT2 A;  4Q5V A;  2KCC A;  5JEA G;  1ET6 A;  2QEJ C;  2EY6 A;  4TRD A;  2F4I A;  2E2D C;  3NQI A;  1YNJ C;  4K2L A;  1Q1B A;  3K58 A;  4XT3 B;  2B2Y C;  4PNY A;  2G9D A;  1FR3 A;  3HP3 A;  3GTL B;  1RF2 D;  1AW7 A;  2FJ2 A;  4G7H C;  5TSS A;  4O42 A;  3HOX B;  5FOB B;  2K05 A;  4XIG S;  2ID0 A;  4H44 C;  5C6A A;  3K5L A;  1XX8 A;  3QO2 A;  3V2T A;  1EIH A;  2J7Z A;  2RDG A;  4IUV A;  1MSG A;  4X3K A;  3Q6S A;  2MP1 A;  3SXH A;  3IL8 A;  4OL7 A;  3S1N B;  1MSH A;  1I4X A;  1H9J A;  1R4P B;  4KHV A;  1SXT A;  2F1M A;  2XWJ B;  5KND A;  3ERO A;  2B2W A;  5KNC A;  1SSO A;  1OXS C;  3SEB A;  3R2T A;  2PCF B;  5KRU A;  4A3F B;  4OHJ A;  1EY8 A;  4C3J G;  1B4O A;  1EIG A;  1BXT A;  5JPM C;  1PLF A;  1HQM C;  1DXM A;  1FD7 D;  4FYD A;  3GTP B;  1HFN A;  4UDU C;  2CQA A;  1SYD A;  4HTH A;  5E3F A;  3CU7 A;  3OOC A;  3VR6 A;  5M5X B;  3PO2 B;  1WTQ A;  1I6V C;  4RA8 A;  5JEA J;  2N55 A;  2Q8T A;  5M5W B;  4NDX A;  3BYT B;  4C2M B;  2B8F A;  1C48 A;  3VA7 A;  1HPC A;  3OIQ A;  3ONA B;  4KN7 C;  1ENF A;  3H6M A;  3EA6 A;  1RKN A;  4RAU C;  1JC7 A;  2A6H C;  2NVT B;  4FF4 A;  4M1U B;  3WOF A;  1PZI D;  2CW0 C;  1HXY D;  3C2P A;  4E6I A;  4HED A;  1G91 A;  3P75 A;  4TKO B;  2FFK B;  1I4R A;  2KEE A;  2LMC B;  1KDC A;  5EPJ A;  3MXN A;  4ME5 A;  5EGT A;  1U4P A;  1EY6 A;  3KF8 A;  2D9U A;  3E5S A;  2M2L A;  1EYA A;  4CJ1 B;  3I4N B;  3QOL A;  4LJZ C;  4WFN 3;  3NQT A;  4C3J B;  3N6R A;  5KGU A;  5KNB A;  4XXE A;  4RKL A;  3RD4 A;  3DMU A;  2BDN A;  2JE6 I;  3VYU A;  3NTH A;  1KTK A;  1EZ8 A;  2KVM A;  2EPB A;  2E2H B;  4I7Z C;  3S2D B;  1SMY D;  4KJO A;  4ZYS A;  3HOU B;  2F0O A;  3TP8 A;  2VUM B;  2MJ8 A;  1ZYR C;  5NUC A;  1EL0 A;  4ZKB B;  1XTC D;  4L8J A;  5F2D A;  3OWF A;  5IGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...