3I3CA

Crystal structural of cbx5 chromo shadow domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
57
Chain Sequence
NDIARGFERGLEPEKIIGATDDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structural of CBX5 Chromo Shadow Domain
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromobox protein homolog 5
total genus 13
structure length 57
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i3cA00
2J7ZA 1HUMA 2FJ2A 3N52A 4XDXA 1NCVA 5EPJA 5CMDA 1CA6A 1HRJA 2M2LA 1E0BA 1U4RA 2N88A 1O80A 4X3KA 2Q8RE 5CBEE 1M8AA 1VMPA 1WTOA 5E4XA 4QUFA 1ILPA 1BNZA 1HUNA 2R3ZA 5EKIA 2FFKB 3P7JA 1QG7A 1KNAA 2MJ8A 5D14A 5CORA 1WTVA 2EOTA 2VXWA 2K04A 2KVMA 5D65A 1XYIA 1CM9A 1WTPA 1U4MA 1RTOA 3F2UA 1DONA 2RSNA 1BBXC 1SAPA 2H1EA 2K05A 2MP1A 2N55A 2D9UA 3KUPA 3LWEA 4QUCA 4RWSC 1WD1A 1WD0A 4ZKBB 1A15A 2HCIA 1WVLA 2HDLA 2KEDA 3DEPA 2FINB 5AFWA 3DEOA 1MSHA 1F9QA 1X32A 1Q3LA 4R8IA 1EL0A 1B3AA 1GUWA 3FDTA 2L12A 2JYOA 1ILQA 1AZQA 2NZ1D 2IL8A 1G6ZA 5DNFA 2B2UC 1G91A 5EQ0A 4IUQA 1B50A 3DM1A 4MN3A 2FHTA 1RJTA 3TZDA 2NWGA 1MGSA 1EOTA 2JP1A 2L9HA 4U68A 4XT1B 1ML0D 2B2WC 2L4NA 2EPBA 4OIKA 1O7YA 2NYZD 1VMCA 3GV6A 4OIJA 3I8ZA 3IL8A 1SDFA 3ONAB 1EIGA 3R93A 4ZLTF 5T1GA 1MI2A 4X3UA 4O42A 1TVXA 1G2SA 4X3SA 1NR4A 1ICWA 2B2TC 4MHEA 1PFNA 1RHPA 2EE1A 2KOLA 4IUTA 1AZPA 4ZAIA 2KECA 3I3CA 1DOKA 4IUUA 2MGSA 1J8IA 3I90A 3G7LA 2B2WA 1U4PA 1JE4A 1XX8A 2HDMA 2K01A 2X69A 2XIWA 2RA4A 3D6WA 3HP3A 4CJ2C 4ZKCB 1PFBA 1S4ZA 2L1BA 1EQTA 1X3QA 5JJZA 4HCSA 3IFDA 4R9WA 5EJWA 2X6LA 3SVMA 4NW2A 1DOLA 3MTSA 1B4OA 1MSGA 2K28A 2KUMA 3Q6SA 2HUGA 2RVLA 1SSOA 1CA5A 1RTNA 4RAUC 3FPUB 1F9RA 4IUVA 1PLFA 2DY7A 2MPMA 3GV3A 3KBXA 1B2TA 1G2TA 3I91A 1JICA 2KEEA 1QE6A 1QNKA 1HFGA 2X6GA 1NAPA 4IUPA 4UAIA 5EPKA 1IKLA 1AP0A 3MWYW 4X3TA 5COYA 2B2VC 2B2YC 1F9SA 4ZK9B 3UI2A 1BF4A 1ZXTA 1F9PA 1HA6A 2DY8A 2K1BA 4HAEA 3QO2A 4HSVA 5E4WC 5EPLA 5CBAE 1NR2A 1PDQA 1WTQA 1WTXA 1ESRA 1O7ZA 1C8CA 1EIHA 4CJ0B 4IURA 1BO0A 3TN2A 1X3PA 1F2LA 2B2TA 1LV9A 1DOMA 1U4LA 2CVRA 2BDNA 1RODA 1IKMA 2HCCA 1J9OA 4LMQD 1PFMA 2Q8TA 4HEDA 1WTRA 1DZ1A 1WTWA 2SDFA 2FMMA 1B53A 4XT3B 4CJ1B 1HHVA 2B2UA 4DN4M 2K03A 2RSOA 1HFNA 2L11A 1IL8A 2B2VA 4RA8A 3H91A 2B2YA 1KNEA 5T1IA
chains in the Genus database with same CATH superfamily
3A0JA 3FKIH 1HUMA 3N52A 4H44C 4LK1C 3UE0A 1K8AC 4LF8Q 2TSSA 1H9RA 2JEBI 3LX0A 1BR9A 4DR1Q 3QWNA 2K4KA 4LF6L 1KIXA 1STGA 4NP5A 4KHZA 1JC7A 1LTRD 1PZKD 3W2DA 5K36H 5KGUA 3UDFA 2BCOA 3T1HQ 2CQOA 4C3HH 4DR4L 2E8GA 4DR1L 2F0EA 2KCMA 1TXYA 3H09A 3SDZA 4F88A 3OMGA 3I7FA 3NK9A 4RGTA 4EGVA 3NBHA 2VUMH 2F0TA 1B50A 1UE7A 2PW7A 2JXMB 1L2FA 4BY7H 2L5TA 1CT1D 2JP1A 1HNXL 1B70B 2N78A 4YWKA 5C44G 1SDFA 5I6YA 2PI2E 5M3FG 1QUQB 3NTIA 4MTKA 2EE1A 1EQVA 3QJYA 5JAVA 4IUUA 1JOQA 4BY1G 4IPCA 4JVZA 3EA6A 2JA5G 1N34Q 3W3AA 1Y1VB 1J5EL 3D6CA 3BYTB 4O2DA 4B3TL 3HOWB 3V05A 1KDCA 2F0GA 3GTQB 1D6EC 3M4OB 4TSSA 4IOCA 5HY6A 3MEFA 1HNZL 4ODGA 3I4NG 4XQNA 1HJPA 3HOXH 1PH7A 1E22A 3TS2A 2B63H 1G291 3KBXA 1LUZA 1I4RA 4KMUC 3K59A 2MUYA 5FOBB 5IT9L 1PH8A 5IGGA 1I3QH 4DAYB 3SK6A 4WJ3M 4JV5L 3FEWX 1P16A 3D8GA 1EY5A 5IE8A 3GTGH 1I5FA 1LT5D 2OT2A 1X3PA 2B2TA 4MZ9A 3RZDH 1VQLA 2A74C 4DR5Q 3IKJA 2F0SA 2DNCA 3HOWG 4QL5A 2JA6G 1AFPA 2Q8TA 1DZ1A 4FXGC 5K5PA 1E1TA 4IPGA 5CV5A 5JPMC 1CSPA 1WCMB 2WAQG 1TWHH 4G4KA 2F0HA 5E4XA 2NUCA 3JAMc 4DAYA 4POGA 4YWLA 1R4PB 5C6AA 5IGFA 3AU7A 1IBMQ 4BS9A 4JI1L 3SK8A 2L0CA 1XMOL 2F0FA 3KF8B 1A2TA 4M1UB 5E7NA 3D4WA 4K5WA 1VCIA 4FF4A 2DJGC 3BYYB 2KEDA 2VS1A 2CWPA 2A8VA 3U9OA 3HOVG 1B3AA 1EZ6A 1E2VA 2EQSA 4OXPA 1F77A 5EQ0A 1XNRL 1AEXA 5C4JB 3VA5A 2UXBL 1L0XB 4ALPA 1MGSA 4DUYQ 5D3DA 1ENFA 3C1FA 2WFWA 4XT1B 1ML0D 5M5XH 4KKTA 2F0IA 3H6MA 3OOCA 1S5ED 3RD4A 1BVSA 4OGQC 1VQIA 3TP8A 1SMYC 2R7DA 4BBSG 1TKWB 3HP3A 1SNDA 2JQOA 2F0NA 3E6ZX 4G7HC 4XYQA 5GAGC 4A3MB 1SE8A 3Q8DA 3IFDA 1OXUA 4CKCA 1STBA 4CKBA 5IWAQ 4A3CG 1ET6A 5NUCA 2P5ZX 2RVLA 3NSWA 3GTLH 2KCTA 2VNUD 4OEMB 1PHJA 2Z6KA 4JI2Q 1IKLA 4PMBA 4UP9A 4KHVA 2E2IB 4CDDC 1IYJB 2F0QA 1N32L 1YZ6A 2KHIA 3NUCA 2ZTDA 3MC0B 4HAEA 4YCUA 3STBD 4LNQA 1LTSD 4DV2L 3M9BA 2PZWA 4N9PA 3Q24A 4JK1C 1AE3A 4GNXC 5J1ZA 4IPDA 4A93B 5LMUL 1FGBD 3EVQA 5EPJA 5KYIA 2C5CA 2N88A 3CU7A 1ASYA 3K0YA 3H15A 2R92B 2K33A 3RN5A 2LKVA 1QNUA 4G7ZC 1N33Q 2DGYA 4NXNL 1EYGA 1GOZA 2IJ0A 1SNPA 4DV2Q 1LO5D 4JI0Q 4UY8C 1VQ4A 5GAHC 3L0OA 4OL7A 4GLVB 3PGZA 1QWYA 3KLRA 1KRSA 1ET9A 1EU4A 5C4HA 1GHJA 5IODA 4C2MB 1WVLA 2B63B 2XNAC 3DEOA 4GN5A 1Z47A 5HURA 4R8IA 1WFQA 2LS01 5KYLA 4J8QA 2SNSA 1ILQA 4DPGA 3A7LA 3H3VC 1VQ8A 1JR0D 2NZOA 2AMCB 2R7ZH 4H02A 4A3GB 3VR3A 5KEEA 1BCPF 4A3BG 1NJIC 1XMQQ 4NKLA 2OQ0A 3CMAA 1MD2D 4B3SL 5IGCA 2I0QA 4YCVA 4ZUIA 5CGKA 1SYCA 4KN7C 1M1KC 1CQVA 2AUJD 4J1MA 3GTGB 1PTOF 2UUBL 4GS3A 3URYA 1EY9A 2HQLA 2YU9B 2EIFA 1PFBA 5L37A 2UXCQ 5FK9C 4OO1G 2R93H 2WIIB 4LUOA 5JEAG 3NPPA 5BN3A 1XPOA 1CHPD 2EY6A 2KQ3A 1I4GA 2I5HA 2K75A 5DM73 3HZXA 1KQSA 1CA5A 1SFOH 4RAUC 3JAMi 1D5MC 1F9RA 1LTLA 4N9TA 4AIMA 4B3RL 1RL2A 4QCLA 1STHA 3HOUG 2LXKA 1HFGA 1QNKA 3MAQA 3F2BA 2F3VA 3BZCA 4RHSA 2D62A 3S17B 3UI2A 4AYBE 5M5WH 1BCPB 1K8OA 1B44D 1STAA 1AE2A 2NZHA 1ESRA 3K7UC 3PSIA 5CV7A 2DNEA 1BCPD 2K6AA 1HZ9A 1LLRD 4KN4C 3SE0A 5IYDH 2QEJC 1FGUA 2F0KA 1DYQA 1JCKB 1UWVA 2L11A 5GROA 3CCQA 5JJIA 2PO4A 4JI5L 4A93H 2LY7A 4OO1H 1VMPA 1DXMA 1GJXA 2UU9Q 2RCFA 1F2MA 1G6PA 5IT9E 5C3XA 1PH6A 3W5OA 3S17H 1SYDA 3PUWA 2Y0SG 1W3SA 5D65A 4RCNA 3G6EA 3HOWH 3F2UA 3K57A 3CCSA 1BCPC 3T51B 3V2TA 3MFGA 2ZXPA 5EKLA 1WCMG 1Y8OB 5I4DA 1K0SA 5TSSA 2HDLA 1I4PA 1NMGA 4GLXA 4C1NK 1IBML 1F9QA 1X32A 1FNWA 3E3XA 1N36L 3IRBA 3NEMA 2JJQA 1TS3A 4U673 5JEAH 1S5DD 4K0KL 3DM1A 2YTVA 1H9SB 2HIVA 5JJKA 5BN5A 2ZXOA 1JORA 4A3FB 3BVGA 5IYCG 1SYGA 2WB1E 2BE5D 3AQQA 4HSPA 1GUWA 1MI2A 5M3FB 1HA6A 1VQ9A 1EYCA 4FYDA 4HJ9A 4KD3A 1DOKA 1X3FA 3SHLA 1K0RA 1SNOA 2WKCA 5CV6A 4EQ5A 1XX8A 2XIWA 5KIXA 3PUYA 3OWEB 4DR7L 1B8AA 4BBRB 1X9NA 1BBUA 3MEHA 3T16A 2N49A 1MSGA 2K28A 3DWQA 4WRDA 4ID6A 4TQUS 2HUGA 3GDEA 1PH9A 3ER0A 2OWOA 4JI7Q 3K5LA 5CV9A 1PZJD 1TWFH 4F8MA 1HNZQ 4GKJL 1LT4D 1JQYD 1GO3E 1YJWA 3N6RA 2KBNA 1XNQQ 3CMEA 2B2YC 1RIPA 5JJLA 5C44B 4RCOA 4DV5L 1I3QB 5EPLA 1V43A 3CW2C 3DHQA 1B9MA 1M90C 4A3GG 2E5LL 1ZYRD 4LF8L 3X3NA 2VQEQ 1WTWA 1WCMH 4PG3A 1NE3A 1IL2A 3I73A 3J7YW 2Z4HA 1SYBA 4CKEA 1M8AA 1YHBA 2IX0A 5ELNA 2VW9A 1L0YB 3PQIA 1PTOH 5CORA 3EBEA 2CKZB 1EY7A 3DWAA 4KKUA 4JV5Q 2EY1A 1SN8A 4DV1Q 3LWEA 1E1OA 2H5XA 1CK1A 2E74C 2ES2A 2FINB 4Y52H 1MSHA 4L5SA 5FLXL 2H4OA 1NSNS 1DCZA 1JJCB 3NTHA 3GP7A 3JC66 2M9VA 2FHTA 4DA2A 2Y0SB 2O2LD 3ERQA 1L1OC 3A8IE 2EPBA 3OYYA 5KNDA 2G5DA 4AQYL 4B3TQ 4OX9L 5J3BA 1G2SA 2ENBA 4FVMA 3L3OC 2KECA 3I3CA 2MGSA 4AYBG 4L5RC 1OXTA 2ICIA 2HDMA 5IYDG 1DONA 4ZKCB 4P75A 3HOZH 2N8NA 3PO2G 3ND8A 1Q8IA 3SVMA 2JN4A 1XNQL 4YHHL 1GUSA 3MTSA 2VB2X 1Q90A 4JI6L 4ABNA 3F1ZA 3UDXA 2RDHA 2DY7A 1Q1EA 4V190 2CHBD 5BN4A 1QOHA 3S15H 2DUDA 1AH9A 2JE6I 2MO1A 1O78A 2LXJA 4WJWA 4CBVA 1A3TA 3G4SA 2ASBA 2DJFC 1IYVA 1J5EQ 1R4QB 3CCVA 4PZ6A 2EZVA 1HR0Q 1TWHB 4DV4L 1F2LA 3M7GA 5C3WA 3S1MB 2R61A 1LTTD 1RODA 1UE5A 1FVIA 3M4YA 1IKMA 2HIXA 2IY5B 4JBJA 4FO2A 1A8VA 3EROA 2K5VA 3OHXC 3AB9A 1W6KA 5IGBA 4C3JH 1YNNC 4JBKA 3U4ZA 1K73C 1MHWC 2A6HC 5M3MG 4Y7NH 1CKNB 3E9HA 1KLGD 4BY1H 3KK7A 1BNZA 1TY0A 3P20A 2JSOA 1X54A 1N36Q 1QG7A 1TT2A 3H3VH 1NUCA 2NTTA 2Q2UA 3TEHB 1IYUA 4DR4Q 5M5XB 2A19A 1QVFA 2KVMA 3UE1A 2K5WA 4BXXH 3HOUB 4HMIA 3LGJA 1EFID 1YNXA 1ZYRC 4DK0A 1PYSB 2K05A 4LFCQ 3S14H 3O13A 3HOXG 3H0GG 2Q2HA 1KTKA 1SMXA 4XQQA 1EQQA 4RG1A 2B63G 1VQJA 5F2DA 1LTAD 2GVBA 2ZM6Q 3K5NA 3E5SA 1MBYA 4K5XA 1M4VA 2EY5A 3PUZA 4BA1I 1XJVA 4L8JA 1FNUA 1T5EA 1JE5A 3R3OA 3J80c 2UUCL 3M4PA 2Z6KC 1EFWA 4MIUA 2E2JH 2D0OA 1KL9A 2OQKA 1H9JA 3R93A 2PCFB 2ALYB 4GOPA 4KY5A 1D5XC 1Z6HA 3KF6A 2BA0A 3EFXD 4ZAIA 1E3PA 3CAMA 4FF2A 4JCVE 2E2HH 2L55A 1QZGA 3CC4A 3KF8A 1U4PA 1W6JA 5ELCA 1KRTA 4DR6L 5E3FA 4KHPL 5A35A 5M3MH 2UXDQ 2PZTA 3EN2A 3X3MA 3T56B 5EJWA 4DR3Q 4LJZC 4HIOA 4JI8L 5IYBH 1Y1WH 3W1GA 3Q6SA 4GKJQ 3GTJH 3FPUB 3KBGA 1IHZA 3CRLC 4L5TA 1TY2A 1PH1A 1V1OA 1PRTB 2JA7H 1Y1VG 1LABA 3R2TA 1D2BA 4KLKA 4NDXA 3AFPA 4A3EB 2QGQA 3MWYW 2F0OA 4C3JG 1FJGL 2B2VC 5I9PA 1PRTD 3BDOA 4F7XA 2ID0A 4DNIA 1PTOB 2AHOB 3NWSA 2ZJPA 1CZGA 1NR2A 1C8CA 1NNXA 4J6HA 3HOXB 2XVSA 4OWWB 1PV4A 2OTLA 4R8NA 2PNHA 4DR2Q 5ELDA 4C1NI 3H3VI 1OTCA 1B53A 3BDCA 4XT3B 3RN2A 2B2UA 4BWGB 2RSOA 2XRQD 1XMQL 1AN8A 4RA8A 1JOOA 1GVPA 3QOJA 4ZUJA 4XDXA 2FJ2A 1MJCA 4YY3L 2F0MA 2JA9A 3D4DA 4QIWE 2E2IH 1X65A 2EYJA 1X3GA 4WFN3 1S40A 3MXGA 1UE1A 1Q12A 1HA5A 4DAPA 1ENCA 2A69D 1D8LA 2VXWA 3E0JA 1CFMA 2OEOA 4K6LA 1ESFA 2RSNA 2MP1A 3KLWA 1WD0A 3OWFA 4GLAC 2A6HD 5KNCA 3VA7A 1N33L 1L1OA 4FP5D 3RLFA 2IT1A 1QUQA 4AH6A 4LFBL 3BG3A 4R4TA 2K5HA 1VQ7A 3FHWA 1CZWA 2IL8A 1GD7A 4HIMA 3L7ZC 2F0VA 4U68A 2L4NA 1VMCA 5J22A 1OXXK 4ZLTF 4JI3Q 1TVXA 3BU2A 3HKZE 1HHVA 4MNOA 4IUTA 1VQNA 1H9KA 4X6AH 5EBDA 1IXRA 1YHAA 2ZTCA 4RKLA 1J8IA 3HOVH 4POFA 3C2PA 4J15A 4P72A 4GKKQ 2MO0A 4XIGS 4ME5A 1S5CD 2F0PA 4JI4Q 2A68D 5FO7B 1JB7A 3I4MB 2VUMB 3TS0A 1O7IA 2WV6D 4CDEC 2PW5A 3PF4A 4QJFA 2JA8G 2SEBD 3W1BA 3DMUA 1G2TA 1V8QA 1FR3A 1I50B 2XSCA 2KEEA 5LMNL 3S15B 1F2ZA 1K83H 1YITA 1SJHD 1DM0B 2ZXRA 3L9AX 3M4OH 4X3TA 5CV4A 4UDUC 3CXCA 3H0GH 3KLSA 2PQAA 1IBLL 1JWSD 4NPSA 2WAQB 2VL6A 5CBAE 4GKKL 1WTXA 3MHBA 2UUBQ 4DUZL 5C3EG 4FNFA 2WB1G 3FKIB 4IFDI 4A3DB 4C3IG 3BVMA 4B3SQ 4V0BA 3DUZA 2O5IC 2FMCA 4ZYSA 5IGEA 2PYKA 5C0XG 2O5JC 2JA5B 2B2VA 2JK8A 2UUCQ 3M3YB 2UXBQ 1TS4A 3CQZH 3NQIA 5KNBA 3S16B 3GTKH 3J80L 4DR2L 4O0AA 4O1NA 3U50C 4Z9CB 3K8AA 1KD1C 1WTVA 3TSSA 3K6OA 1R9TH 1N8RC 1LT6D 2AQ2B 2J0TD 2NB0A 2F1MA 3GTPB 3MZ5A 4JI0L 5HGQA 1N32Q 1GXDC 2MHVA 2OTJA 2PPBC 2NVTB 2BDOA 1Q81C 1L0WA 4JOIA 4JI2L 5BR8L 1XPUA 2NZ1D 5C0XH 2R7FA 4DKAC 2B2UC 4A3KH 3NXWA 2SNMA 1I6HH 2IPKD 5IP9G 3WWVA 2NWGA 3OIPA 4DFAA 2EYFA 2B2WC 5FO9B 5I9OA 1QZHA 3SR1A 2K50A 4H7BA 4X3SA 4PV1C 1NMFA 2IHFA 4JBWA 1MIUA 2EDGA 4LF9Q 1KXLA 1AZPA 1UAPA 1HZCA 1B7YB 4DV4Q 4DAMA 3D6WA 1B3QA 4RH6A 4RKBA 1BKBA 1X3EA 4DF7A 5C4XH 2F52A 1YJNA 3TMEA 2O4XA 4DV0Q 3S9WA 4HCSA 3K5MA 3CP0A 2QDLA 1FJGQ 3KLSX 3C46A 4IO9A 4IN3A 3M85A 5C3EH 1IW7D 2SOBA 1PLFA 1O7LA 1TWCB 3NHHA 3PUVA 4QB4A 5FLXE 5H1SE 1H9SA 1FD7D 3SEBA 5I6WA 4GNXA 4A3FG 3GTOB 4A3LG 1QE6A 4WORA 5ISRA 3UDGA 2F4VL 1NAPA 1AP0A 4UP7A 4JI8Q 1EOVA 3CCRA 4DV1L 1WI5A 3BDLA 1TIID 3MVVA 4S3SA 4B08A 2VB3X 2Q8IB 4JYAL 2K1BA 2RKSA 4KHPQ 1WYDA 1J6QA 2D5DA 2QW7A 1P8LA 4DNRB 3JAML 3TN2A 3A55A 1VQDA 3NWTA 2F0LA 3BS1A 1XTDA 2EXZA 3J80E 4BBRG 3T53B 2V1CC 1LTGD 3PIOA 5G3LF 2EYMA 3J7ZC 4OX9Q 4LMQD 2JA7G 1KC8C 2UUAQ 3I56A 4FF3A 2DN8A 5IYCH 3HRZC 3RZOH 3S2HH 5C44H 1A3VA 3I55A 1VQGA 1DJRD 3NBHB 3S1RB 1O80A 4X3KA 2GVAA 5CBEE 2RQXA 3R2IA 2NVXB 2N3SA 4CDFC 2AWNA 1A6XA 1STEA 3K58A 3EQLC 3NTKA 2R92G 3P1HA 1BBXC 3T1YL 2H1EA 2N55A 4RWSC 1XMOQ 2WB1B 3K7AH 5M5YB 4JI1Q 1BUVT 3Q0AA 1EL0A 1CSQA 3VYTA 3KJOA 1SNQA 2JA7B 4A3MG 1SYEA 4KY6A 4JI7L 2BA1A 4DXFA 3ERSX 2HHHQ 4BBSB 1T5XD 4RFBA 1IBKQ 1K8MA 2QDBA 3T13A 1U9RA 1O7YA 2YTXA 2EJMA 3L2PA 2UUAL 2PZUA 3DXJC 2I5MX 1Z9FA 3I8ZA 1PYWD 3IL8A 5T1GA 3KDFA 4EQPA 1QVGA 2JA8B 3S1NH 3RMHA 2E5LQ 2XWBB 2OCEA 4DNTB 2BH2A 1EUJA 3NBIA 4LF4L 3A8KE 4EQOA 1C4QA 2TMPA 2NN6H 1X3QA 4NW2A 3HEJA 1PXUA 3H0GB 2HHHL 1K3BC 2QEXA 1K3RA 4K6DA 2Q2TA 5ELEA 1PH2A 4R4CA 3FPPA 2K5DA 1GUTA 4A3EH 1VQBA 2AKWB 1FL0A 1PVOA 3LNNA 1HTLD 1EWIA 4ZK9B 4DV0L 1EYDA 3ICEA 2NVYB 1TWAB 4PQXA 4HSVA 1HPCA 1I4QA 5E4WC 1WTQA 5FLMG 4F87A 4IURA 2XGTA 3MXUA 3J7AF 3ZJYC 4LWCA 4LF5L 2CVRA 3PO2B 3OSOA 4B9XA 4APVA 4RGMA 1LM0A 5JPNC 1HFNA 1IL8A 2HD3A 1H9MA 1E2ZA 1HRJA 1NCVA 5CMDA 2R6GA 4YCWA 1JMCA 1Q7YC 1C0AA 1S5BD 2NN6G 2FFKB 3PV0A 5HGTA 3BJUA 4X64L 2YYZA 3G6JB 1STNA 4CGYB 1SE2A 1SXTA 1K8GA 5ELOA 3T1HL 1RTOA 5CV8A 2LSSA 3FVQA 1KDAA 1SMYD 3I4OA 2C9OA 3OW7A 5C4XB 2KCNA 2RHSB 3PO3H 1A15A 3UDIA 2EVBA 3HOYH 5C0XJ 1SRUA 1GHKA 4HMJA 3QG1A 2F4VQ 1HNWQ 4BBSH 3FDTA 2L12A 3QR8A 2AWOA 2JA6B 1X55A 3GTKB 4XQJA 3CQZB 3S16H 4MN3A 1Q86C 4NXML 2V4DA 5FLMH 2E75C 4JI3L 2Z9HA 3CC2A 1UNSA 4KJNA 1LYLA 4OIJA 3CPWA 4A3IG 3HG9A 1B9NA 4HJAA 5A2QE 1TWGH 4MHEA 3EJIA 5FJ8H 3J81c 2E76C 1GUNA 1JE4A 3WOEA 4DK6C 2PMZE 4DV5Q 1CI3M 1RKNA 2Z8LA 3TP6A 2X6LA 1A0IA 1B4OA 4L63B 2WKDA 3HKZG 4EVOA 3JAME 1SSOA 4IPHA 5LMNQ 4PMCA 3S2HB 4K0KQ 4IUVA 4R1JA 4DXGA 4IFDH 3J81L 5KRUA 2G9HD 4C3HG 2K7VA 2R92H 2EYPA 2IWHA 3CD6A 3TBIB 1ZXTA 2F4IA 3BZKA 3GTJB 3VR4A 2CH4W 3QO2A 3A5UA 4GOPC 4BY7G 2Z4IA 1ZKOA 2XTIA 3QIAA 1ASZA 2NVXH 1V9PA 2HCCA 4NMZA 3D4RA 3FP9A 5EAYA 2ZT9C 1X6OA 2NBFA 3GD7A 5FJ8G 1KNEA 2JA8H 3S1NB 2J7ZA 4IFDG 5DEHA 2JA5H 1E0BA 1U4RA 3DWPA 1I94Q 1EQRA 3BZDB 3AMUA 1SNCA 1WTOA 4LFAL 5C0XI 2PI2A 1PRTC 3AYHB 2R7ZG 3I4MH 1EY8A 2OF1A 1I4HA 4DK1A 2QKIC 5IT9c 4IJHA 1HXYD 2K14A 4Q0FA 1VQKA 1C48A 2Z0SA 3KFUA 2YU9H 2BE5C 3HOVB 1RCVD 1PZID 2EXDA 3GTQH 1Q8KA 4KV6A 5EGTA 4FXDA 3CKIB 3J80i 4ILWA 1QJOA 2UU9L 3CCEA 2RBMA 4YY3Q 4A3JG 2D0PA 2F03A 2XWJB 4LF7Q 4OWXB 1Y8PB 4KK7A 4L6TB 5IGDA 4O42A 3ND9A 2Z6BA 1VQAA 1EIYB 2VY3A 3VR6A 1YBYA 3K5OA 1NTGA 2BOSA 4X65Q 1PFSA 2B2WA 4X65L 4HCEA 2K01A 5AJ3L 1S4ZA 1YIJA 1LACA 4JW0A 3F8TA 5FO8B 3FMCA 3TZUA 4C3IB 1Z7TA 1DGSA 3FKIG 3WOFA 3OW2A 2Z1CA 4DAVA 2K5QA 4DUYL 4IJLA 5FKAC 4AYBB 1UE6A 2F0JA 4I7AA 2ZTEA 4YWMA 3SGIA 3TREA 1SNMA 3GV3A 1IZ6A 1F2YA 3K7AB 2GN5A 4JOIC 1JICA 2CH4A 4K5VA 3PUXA 4LFCL 5COYA 1BQQT 3T4AC 1U0LA 2UXDL 1QVCA 2YV5A 1YVCA 5C5MA 2AQ1B 4QGUA 5AJ3Q 2BH8A 4UPAA 4TVAB 4P71A 1R9TB 4K2KA 4LUVA 1CKNA 2QF7A 3MA2B 2B8GA 1FYCA 4NXNQ 2B29A 2CW0C 4DK3C 3I4MG 1XWEA 1XTCD 1UEAB 1E24A 1KABA 2SDFA 4CJ1B 4LF7L 3H91A 2B2YA 3CCLA 3J81j 5M3FH 1D7QA 1HQRD 4IQZA 1Y1WG 5C4XG 4A3FH 3GO5A 4FXKC 1EWHA 4Q5VA 2EJGC 4R4QA 4A3LH 1V1PA 3P7JA 5JEAJ 4A3CH 4A3DH 2HQEA 1CKMA 1D1KA 1ZEQX 4IFDJ 1VF5C 2WP8J 2K04A 2HT1A 1WTHA 1WTPA 2KHJA 1BBWA 5CR3A 1JB3A 1WD1A 4QIWB 1FNVA 3TQYA 4OWTB 4BBRH 5AFWA 1RDPD 1Q3LA 3CHBD 3RLOA 3KF6B 1KLUD 4C2MH 5DNFA 4P2CB 1LTBD 1I6VC 1SE3A 4IUQA 3OTOL 4C3JB 3TP5A 3CF5A 1V1PB 3J81i 1LT3D 2L9HA 3QB3A 4OELB 4YHHQ 1JJ2A 2NYZD 5LL6X 1EIHA 4X3UA 2I5LX 1VF7A 1VQFA 1XPRA 2R93B 4IZ8A 4KD4A 5ELBA 4DR5L 1PRTF 4DR6Q 5GADC 1E7ZA 1HZBA 1S3OA 3S14B 1EYAA 3S1QH 1SJED 2KHSA 4H13C 4YIJA 2RDFA 4X62L 1E2WA 3HS0C 1TR5A 2ZJQA 2ICEC 4XXEA 4A3KB 4CHTB 5K36G 2KUMA 5M9OA 5IP7H 2WACA 2EYOA 1WJJA 2MPMA 1TWCH 1HR0W 1OO9B 1K83B 2ZM6L 3S2DB 4JI6Q 1CHQD 4UAIA 1RF2D 3ULPA 3I72A 1RD9D 4OONA 3S1QB 3RZDB 3E9IA 1PDQA 2EYLA 3SXHA 4LF6Q 2CFMA 1GKHA 4A3KG 1YNJC 3CRKC 2D2CC 2K32A 3U9SA 1PFMA 4HEDA 1WTRA 1IW7C 2B8FA 1HCZA 3M4QA 2K03A 3IAYA 2JEAI 5T1IA 5JVH3 1SR3A 1Y69U 2R93G 2B39A 4GNXB 3A5ZB 3GQBA 1PYBA 3KYHC 4QUFA 1D5ZC 2IX3A 3RLNA 4IOAA 1XXGA 4B3MQ 2F0WA 5I2XA 2C35B 4A4IA 4DV6L 5IP7G 1YJ9A 1N9WA 2Y0SE 2NN6I 1Q1BA 3KUPA 1OXSC 4QUCA 2D9UA 2CCZA 4MTNA 1KDBA 2E2DC 3CCUA 2B3GA 5C4ZA 3D0FA 4DV3L 1G91A 1UEBA 2CQAA 1RJTA 4BY7B 1STYA 4OHJA 3J7AV 1EOTA 4I65A 5E1FA 3ULJA 3GV6A 3PIP3 5DM63 2VQEL 4N8X1 1VQPA 1VQHA 1ONLA 5D14A 1NR4A 4DGZA 1PFNA 5M3MB 1HZAA 4LF5Q 2EYHA 2NVTH 3GTMH 5IIFA 1A2UA 3S24A 4C3HB 4RMFA 1CUKA 1SEBD 1PTOC 1SE4A 1GUGA 2LFNA 5JJZA 2MNAA 1TU2B 2CWAA 3A74A 1DOLA 1EWCA 4FDBA 1PA6A 2VQFL 1C9OA 3DLLA 5M5WB 1KAAA 2IW3A 2PQAB 2M00A 1B2TA 2KENA 5EKKA 4A3BH 5BR8Q 2QCPX 1CKOA 4BXXG 3DM3A 1VQOA 3S1MH 5IY0A 5IP9H 3KDFB 3MXPA 4B9WA 1DD2A 4X62Q 3CCJA 1Y1WB 1SLJA 1II3A 2K5NA 2PQEA 3KJPA 2J4XA 2F3WA 2A69C 5DAUA 2FXQA 2AQ3B 1SYFA 2PNRC 3H94A 1HNXQ 1IBKL 4DU9A 2XN9C 3MFYA 3OTOQ 1NBWA 3D31A 3Q22A 2Q8RE 4A3JH 4DV3Q 1ILPA 1HUNA 4E6IA 1S72A 2R3ZA 3ITPA 2K52A 1MKHA 3VYSA 1C7YA 3K80C 4TRDA 4P73A 1CM9A 4LUZA 3T1YQ 2A1AA 4JYAQ 1YNJD 4XTCS 4X66Q 3DEPA 4B3ML 4ME3A 1YI2A 1Q46A 3MXNA 1B1ZA 1BOSA 2I46A 1I6HB 3F2CA 4A3DG 2MQHA 3TZDA 3M3YH 2A68C 4JI5Q 5C3EB 1JJGA 1Q82C 4R4IA 4BY1B 3A56A 2R7ZB 4GZYC 4DR7Q 4R4OA 4RHRA 4GN3B 3HOZB 2UXCL 3NQTA 2I07B 4HJ5A 1Y1VH 4A3JB 1EIFA 3ONAB 4HTHA 4CJ2C 1YEZA 1QCBD 2E2JB 4NB3A 4QF4A 4R9WA 4DV7Q 1VDZA 1ICFB 3QOLA 3PF5A 2JA6H 1I50H 1RTNA 2VUMG 3AFQA 2OXPA 5DLQE 1S5FD 1TS5A 1SFOB 1OXVA 2QILA 1PTOD 1Y8NB 2KA7A 1A62A 4K14A 5CYUA 3VYUA 4JPBW 1CQFA 3RUZA 2MFIA 4L5QA 2DY8A 2EJFC 5JOBA 3A7AB 1VQ6A 5IYBG 1O7ZA 3TRZA 1PH4A 4ZRZA 3V96A 1DOMA 1U4LA 2Q2IA 3D3RA 4LF9L 1TS2A 2IHEA 4QMGA 4LFAQ 4PZ8A 1J9OA 1UUPA 2A73B 1V1QA 3K0XA 2G9DA 2FMMA 4DN4M 3CPFA 1L1OB 1G51A 3A54A 3I4LA 5LMUQ 3IFTA 1GM5A 2M2LA 3HOZG 1A63A 4BA2I 1CTMA 3C1EA 4A3IB 1EEID 1H95A 5EKIA 4LFBQ 1KNAA 3I70A 1HQMC 3ZYYX 4DUZQ 3I2ZA 3B6YA 5GAEC 3TP7A 2EOTA 4A3EG 1MJEA 2GA4B 4JG2A 2ZJRA 1XYIA 3PO3B 4HJ7A 1U4MA 5LMNW 3VDYA 1WOCA 4HIDA 1SAPA 3PIPA 4P74A 2F0DA 3HKZB 5LL6S 3BVZA 3J7A5 4FF1A 1G8ZD 3HFZB 4K2LA 3RNUA 1AZQA 4PNYA 1G6ZA 1YNND 3NENA 3PIO3 3SK4A 4B3RQ 1I94L 1BXTA 2F0UA 1GUOA 4C56C 2RDGA 1TWGB 2EY2A 5C4JH 1VQEA 4EX5A 3KOJA 4PMWA 3GTPH 1EIGA 2AUKA 1JOKA 4JI4L 2B2TC 2RF4A 3M7NA 5G3LD 3HOYG 3I4NB 3S1RH 3G7LA 2X69A 2NVYH 4A76A 1IBLQ 3A8JE 3CC7A 1PH3A 3NELA 4CDCC 4N8FA 1HTPA 1U5KA 2YTYA 4ULLA 4IUNA 4A3GH 4A3IH 4GOPB 1AW7A 4K8IA 4JC0A 3EIVA 4Y7NB 2A6EC 1EZ8A 4A3BB 2X6GA 4IUPA 4M8AA 1K28A 3NP8A 1F9SA 4A3MH 1F9PA 3R8BA 3U4VA 3GTOH 3C3LA 1BDOA 3U58A 2IX1A 2XRSD 1BO0A 4ZCKA 3RR5A 1LV9A 1W2BA 4IALA 1VS0A 3PO2H 4RGOS 2BDNA 5EBCA 3G48A 2ATWA 3SK5A 2NVQB 4RGNA 4LW1A 3GTMB 4KY7A 1TWAH 2LMCB 5JVG3 1NY4A 3CCMA 2A6ED 4NXMQ 2KCCA 4XYOA 4KI0A 1CA6A 3STBC 1XNRQ 2WAQE 4TKOB 1HH2P 3I4NH 3GTLB 1VQMA 1D1IA 3AEVA 2MJ8A 1YHQA 3NE5B 4X66L 1T9HA 1X56A 5M5YH 1HR0L 1A3UA 2KJXA 5C5LA 2F3IA 5D3IB 3HOUH 2CW0D 3HGBA 4ZKBB 2HCIA 5IOCA 1KHIA 1TQOA 5CC4A 4HN7A 4G57A 2JYOA 3VR5A 4I7ZC 1EY4A 3TDQA 4C3IH 1EY0A 1SROA 2VQFQ 3K81C 4HIKA 1EEFD 4QQBX 3LWUA 2L15A 4KTAA 3WDNA 4DR3L 4OIKA 5FLXc 3HOYB 4DV7L 1PH5A 3OIQA 5A2QL 4EQNA 4OO1I 3OMCA 3MXNB 1ICWA 4K8JA 1RHPA 2KOLA 2RHQB 3FRPB 5I2YA 3PMFA 3ULLA 1N34L 4LAAA 4HR7B 3I90A 3P75A 1VQCA 2E2HB 2RA4A 2NVQH 4A93G 4UHVA 2RCNA 4QY7A 1EU3A 2L1BA 1EQTA 1KAWA 1ENAA 3PCOB 1JWMD 2A5HA 1I4XA 4HJ8A 1Y14B 5GQOA 4GN4B 3E0EA 2NTSA 3Q23A 4KKSA 5ELFA 4A75A 1VQ5A 3OPOA 3HKSA 3I91A 5J39A 5LHY1 1PMRA 1SBBB 3PO3G 1HNWL 4KJOA 3VYRA 5EPKA 3S2DH 1JT8A 5IWAL 1K9MC 1JWUD 3J81E 1BF4A 4G7OC 1LTID 3RZOB 4DV6Q 4JBMA 3F2DA 4LF4Q 4CJ0B 4X64Q 3VR2A 2PMZB 2VZAA 4ZQ3A 1QB5D 4AQYQ 1QILA 1EY6A 4WJ4A 4UP8A 4PZ7A 4H0LC 2WINB 3G71A 2QA4A 1TWFB
chains in the Genus database with same CATH topology
1HUMA 3N52A 4H44C 4LK1C 2TSSA 1H9RA 2JEBI 3LX0A 1BR9A 3QWNA 1STGA 4NP5A 4KHZA 1JC7A 1LTRD 1PZKD 3W2DA 5K36H 5KGUA 2BCOA 2F0EA 3H09A 3SDZA 4F88A 3OMGA 4EGVA 3NK9A 4RGTA 3NBHA 2F0TA 1B50A 2PW7A 2JXMB 2L5TA 1CT1D 2JP1A 1SDFA 5I6YA 3NTIA 2EE1A 1EQVA 3QJYA 5JAVA 4IUUA 1JOQA 3EA6A 3W3AA 1Y1VB 3D6CA 3BYTB 3HOWB 3V05A 1KDCA 2F0GA 3GTQB 1D6EC 3M4OB 4TSSA 4ODGA 4XQNA 1G291 3KBXA 1I4RA 4KMUC 3K59A 2MUYA 5FOBB 5IT9L 5IGGA 3SK6A 3FEWX 3D8GA 1EY5A 1LT5D 2OT2A 1X3PA 2B2TA 2A74C 3IKJA 2F0SA 2DNCA 1AFPA 2Q8TA 1DZ1A 4FXGC 5K5PA 5CV5A 5JPMC 1WCMB 4G4KA 2F0HA 5E4XA 2NUCA 4DAYA 1R4PB 5C6AA 5IGFA 3AU7A 4BS9A 3SK8A 2L0CA 2F0FA 1A2TA 4M1UB 3D4WA 4K5WA 1VCIA 4FF4A 3BYYB 2KEDA 3U9OA 1B3AA 1EZ6A 1E2VA 1F77A 5EQ0A 1AEXA 5C4JB 3VA5A 1L0XB 1MGSA 5D3DA 1ENFA 3C1FA 4XT1B 1ML0D 4KKTA 2F0IA 3H6MA 3OOCA 1S5ED 3RD4A 4OGQC 3TP8A 1SMYC 1TKWB 3HP3A 1SNDA 2F0NA 3E6ZX 4G7HC 4XYQA 4A3MB 3IFDA 1OXUA 4CKCA 1STBA 4CKBA 1ET6A 5NUCA 2RVLA 3NSWA 2VNUD 1IKLA 4PMBA 4KHVA 2E2IB 2F0QA 3NUCA 3MC0B 4HAEA 1LTSD 2PZWA 4N9PA 3Q24A 4JK1C 5J1ZA 4A93B 1FGBD 3EVQA 5EPJA 5KYIA 2C5CA 2N88A 3CU7A 3K0YA 2R92B 2K33A 2LKVA 1QNUA 4G7ZC 1GOZA 2IJ0A 1SNPA 1LO5D 4OL7A 1QWYA 3KLRA 1ET9A 1EU4A 5C4HA 1GHJA 5IODA 1WVLA 4C2MB 2B63B 2XNAC 3DEOA 1Z47A 5HURA 4R8IA 2LS01 5KYLA 4J8QA 2SNSA 1ILQA 3A7LA 3H3VC 1JR0D 4A3GB 3VR3A 5KEEA 1BCPF 4NKLA 1MD2D 5IGCA 4ZUIA 5CGKA 1SYCA 4KN7C 1CQVA 2AUJD 4J1MA 3GTGB 1PTOF 3URYA 1EY9A 2YU9B 1PFBA 5FK9C 4OO1G 2WIIB 5JEAG 3NPPA 5BN3A 1CHPD 2EY6A 2KQ3A 1I4GA 5DM73 3HZXA 1CA5A 4RAUC 1D5MC 1F9RA 4N9TA 4QCLA 1STHA 1HFGA 1QNKA 3MAQA 2F3VA 4RHSA 2D62A 3S17B 3UI2A 1K8OA 1BCPB 1B44D 1STAA 1ESRA 5CV7A 2DNEA 1BCPD 2K6AA 4KN4C 1LLRD 3SE0A 2QEJC 2F0KA 1DYQA 1JCKB 2L11A 2PO4A 2LY7A 4OO1H 1VMPA 1DXMA 1GJXA 1F2MA 5IT9E 5C3XA 1SYDA 3PUWA 5D65A 4RCNA 3F2UA 3K57A 1BCPC 3T51B 3V2TA 3MFGA 2ZXPA 5EKLA 1Y8OB 5I4DA 5TSSA 2HDLA 1I4PA 4C1NK 1F9QA 1X32A 1FNWA 1TS3A 4U673 5JEAH 1S5DD 3DM1A 1H9SB 5BN5A 2ZXOA 1JORA 4A3FB 3BVGA 1SYGA 2BE5D 4HSPA 1MI2A 5M3FB 1HA6A 1EYCA 4FYDA 4KD3A 1DOKA 3SHLA 1SNOA 2WKCA 5CV6A 1XX8A 2XIWA 5KIXA 3PUYA 3OWEB 4BBRB 3MEHA 3T16A 3DWQA 1MSGA 2K28A 4WRDA 4ID6A 4TQUS 2HUGA 3K5LA 5CV9A 1PZJD 4F8MA 1LT4D 1JQYD 3N6RA 2B2YC 5C44B 4RCOA 1I3QB 5EPLA 1V43A 3DHQA 1B9MA 1ZYRD 3X3NA 1WTWA 3I73A 3J7YW 2Z4HA 1SYBA 4CKEA 1M8AA 2IX0A 1L0YB 1PTOH 5CORA 1EY7A 3DWAA 4KKUA 2EY1A 3LWEA 1CK1A 2E74C 2FINB 1MSHA 5FLXL 2H4OA 1NSNS 1DCZA 3NTHA 3GP7A 2M9VA 2FHTA 4DA2A 2Y0SB 2O2LD 3ERQA 3A8IE 2EPBA 5KNDA 1G2SA 2ENBA 4FVMA 3L3OC 2KECA 3I3CA 2MGSA 1OXTA 2ICIA 2HDMA 1DONA 4ZKCB 3ND8A 1Q8IA 3SVMA 1GUSA 3MTSA 2VB2X 1Q90A 4ABNA 2RDHA 2DY7A 1Q1EA 4V190 2CHBD 5BN4A 1QOHA 2JE6I 1O78A 4WJWA 4CBVA 1A3TA 1IYVA 1R4QB 2EZVA 1TWHB 1F2LA 3M7GA 5C3WA 3S1MB 2R61A 1LTTD 1RODA 1IKMA 3M4YA 4FO2A 3EROA 3OHXC 3AB9A 1W6KA 5IGBA 1YNNC 2A6HC 1KLGD 3KK7A 1BNZA 1TY0A 3P20A 2JSOA 1QG7A 1TT2A 1NUCA 2NTTA 1IYUA 5M5XB 2KVMA 2K5WA 3HOUB 4HMIA 1EFID 1ZYRC 4DK0A 2K05A 3O13A 1KTKA 4XQQA 5F2DA 1LTAD 3K5NA 3E5SA 1MBYA 4K5XA 1M4VA 2EY5A 3PUZA 4BA1I 4L8JA 1FNUA 1T5EA 3R3OA 4MIUA 1H9JA 3R93A 2PCFB 4KY5A 1D5XC 1Z6HA 2BA0A 3EFXD 4ZAIA 4FF2A 2L55A 3KF8A 1U4PA 1W6JA 5ELCA 5E3FA 5A35A 2PZTA 3X3MA 3T56B 5EJWA 4LJZC 3Q6SA 3FPUB 3KBGA 1IHZA 3CRLC 1TY2A 1V1OA 1PRTB 1LABA 3R2TA 1D2BA 4NDXA 4A3EB 3MWYW 2F0OA 4C3JG 2B2VC 5I9PA 1PRTD 3BDOA 4F7XA 2ID0A 1PTOB 3NWSA 1CZGA 1NR2A 1C8CA 4J6HA 3HOXB 2XVSA 4R8NA 5ELDA 4C1NI 1B53A 3BDCA 4XT3B 2B2UA 4BWGB 2RSOA 2XRQD 1AN8A 4RA8A 1JOOA 3QOJA 4ZUJA 4XDXA 2FJ2A 2F0MA 3D4DA 2EYJA 4WFN3 3MXGA 1Q12A 1HA5A 4DAPA 1ENCA 2A69D 2VXWA 3E0JA 1CFMA 2OEOA 4K6LA 1ESFA 2RSNA 2MP1A 1WD0A 3OWFA 2A6HD 5KNCA 3VA7A 4FP5D 3RLFA 2IT1A 3BG3A 1CZWA 2IL8A 3L7ZC 2F0VA 4U68A 2L4NA 1VMCA 5J22A 1OXXK 4ZLTF 1TVXA 1HHVA 4IUTA 1H9KA 5EBDA 4RKLA 1J8IA 3C2PA 4XIGS 4ME5A 1S5CD 2F0PA 2A68D 5FO7B 3I4MB 2VUMB 2WV6D 2PW5A 2SEBD 3DMUA 1G2TA 1V8QA 1FR3A 1I50B 2XSCA 2KEEA 3S15B 1F2ZA 1SJHD 1DM0B 2ZXRA 3L9AX 4X3TA 5CV4A 4UDUC 3KLSA 1JWSD 5CBAE 2WAQB 1WTXA 3MHBA 4FNFA 3FKIB 4IFDI 4A3DB 4C3IG 3BVMA 4V0BA 3DUZA 2O5IC 2FMCA 4ZYSA 5IGEA 2PYKA 5C0XG 2O5JC 2JA5B 2B2VA 3M3YB 1TS4A 3NQIA 3S16B 5KNBA 3J80L 4O1NA 4Z9CB 1WTVA 3TSSA 3K6OA 1LT6D 2AQ2B 2J0TD 2NB0A 2F1MA 3GTPB 3MZ5A 1GXDC 2MHVA 2PPBC 2NVTB 2BDOA 2NZ1D 5C0XH 2B2UC 3NXWA 2SNMA 2IPKD 2NWGA 3OIPA 4DFAA 2EYFA 2B2WC 5FO9B 5I9OA 3SR1A 4H7BA 4X3SA 4PV1C 4JBWA 2EDGA 1AZPA 1UAPA 3D6WA 4RH6A 4RKBA 4DF7A 3TMEA 2O4XA 3S9WA 4HCSA 3K5MA 3KLSX 3C46A 4IN3A 3M85A 1IW7D 2SOBA 1PLFA 1O7LA 1TWCB 3NHHA 3PUVA 4QB4A 5FLXE 1H9SA 1FD7D 3SEBA 5I6WA 3GTOB 1QE6A 4WORA 5ISRA 1NAPA 1AP0A 3BDLA 1TIID 3MVVA 4S3SA 4B08A 2VB3X 2Q8IB 2K1BA 2RKSA 2D5DA 4DNRB 3JAML 3TN2A 3A55A 3NWTA 2F0LA 3BS1A 3J80E 2EXZA 3T53B 1LTGD 5G3LF 2EYMA 4LMQD 4FF3A 2DN8A 3HRZC 1A3VA 1DJRD 3S1RB 1O80A 4X3KA 5CBEE 2RQXA 3R2IA 2NVXB 2AWNA 1A6XA 1STEA 3K58A 3EQLC 3NTKA 3P1HA 1BBXC 2H1EA 2N55A 4RWSC 2WB1B 5M5YB 1BUVT 3Q0AA 1EL0A 3VYTA 1SNQA 2JA7B 1SYEA 4KY6A 2BA1A 4DXFA 4BBSB 1T5XD 4RFBA 1K8MA 2QDBA 3T13A 1U9RA 1O7YA 2EJMA 2PZUA 3DXJC 3I8ZA 3IL8A 1PYWD 5T1GA 4EQPA 2JA8B 3RMHA 2XWBB 4DNTB 3NBIA 3A8KE 4EQOA 1C4QA 2TMPA 2NN6H 1X3QA 4NW2A 3HEJA 1PXUA 3H0GB 4K6DA 5ELEA 3FPPA 2K5DA 1GUTA 3LNNA 1HTLD 4ZK9B 1EYDA 2NVYB 1TWAB 4PQXA 4HSVA 1HPCA 1I4QA 5E4WC 1WTQA 4F87A 4IURA 3MXUA 3J7AF 2CVRA 3PO2B 3OSOA 4B9XA 4RGMA 5JPNC 1HFNA 1IL8A 1H9MA 1E2ZA 1HRJA 1NCVA 5CMDA 2R6GA 1S5BD 2NN6G 2FFKB 3PV0A 5HGTA 2YYZA 3G6JB 1STNA 4CGYB 1SE2A 1SXTA 1RTOA 5CV8A 3FVQA 1KDAA 1SMYD 3OW7A 2C9OA 5C4XB 2KCNA 1A15A 2EVBA 5C0XJ 1GHKA 4HMJA 3QG1A 3FDTA 2L12A 2AWOA 2JA6B 3GTKB 4XQJA 3CQZB 4MN3A 2V4DA 2E75C 1UNSA 4KJNA 4OIJA 3HG9A 1B9NA 5A2QE 4MHEA 3EJIA 2E76C 1GUNA 1JE4A 3WOEA 1CI3M 1RKNA 2Z8LA 3TP6A 2X6LA 1B4OA 4L63B 2WKDA 4EVOA 3JAME 1SSOA 4PMCA 3S2HB 4IUVA 4DXGA 4IFDH 3J81L 5KRUA 2G9HD 4C3HG 2K7VA 2EYPA 2IWHA 3TBIB 1ZXTA 2F4IA 3GTJB 3VR4A 3QO2A 2Z4IA 1ZKOA 3QIAA 2HCCA 4NMZA 3D4RA 2ZT9C 2NBFA 3GD7A 1KNEA 3S1NB 2J7ZA 4IFDG 5DEHA 1E0BA 1U4RA 3DWPA 3BZDB 3AMUA 1SNCA 1WTOA 5C0XI 1PRTC 1EY8A 2OF1A 1I4HA 4DK1A 2QKIC 1HXYD 4Q0FA 1C48A 2BE5C 3HOVB 1RCVD 1PZID 4KV6A 5EGTA 4FXDA 3CKIB 4ILWA 1QJOA 2RBMA 2F03A 2XWJB 1Y8PB 4KK7A 4L6TB 5IGDA 4O42A 3ND9A 3VR6A 3K5OA 2BOSA 2B2WA 4HCEA 2K01A 1S4ZA 1LACA 5FO8B 3FMCA 3TZUA 4C3IB 1Z7TA 3WOFA 2Z1CA 4DAVA 2K5QA 5FKAC 4AYBB 2F0JA 1SNMA 3GV3A 1F2YA 3K7AB 1JICA 4K5VA 3PUXA 5COYA 1BQQT 3T4AC 5C5MA 2AQ1B 1R9TB 4K2KA 2QF7A 3MA2B 2B8GA 1FYCA 2CW0C 1XWEA 1XTCD 1UEAB 1KABA 2SDFA 4CJ1B 3H91A 2B2YA 1HQRD 4IQZA 3GO5A 4FXKC 1EWHA 4Q5VA 2EJGC 1V1PA 3P7JA 5JEAJ 2HQEA 1D1KA 1ZEQX 4IFDJ 1VF5C 2WP8J 2K04A 1WTPA 5CR3A 1JB3A 1WD1A 4QIWB 1FNVA 5AFWA 1RDPD 1Q3LA 3CHBD 1KLUD 5DNFA 4P2CB 1LTBD 1I6VC 1SE3A 4IUQA 4C3JB 3TP5A 1V1PB 1LT3D 2L9HA 3QB3A 2NYZD 5LL6X 1EIHA 4X3UA 1VF7A 2R93B 4IZ8A 4KD4A 5ELBA 1PRTF 3S14B 1EYAA 1SJED 2KHSA 4H13C 4YIJA 2RDFA 1E2WA 3HS0C 1TR5A 2ICEC 4XXEA 4A3KB 4CHTB 5K36G 2KUMA 5M9OA 2WACA 2EYOA 2MPMA 1OO9B 1K83B 3S2DB 1CHQD 4UAIA 1RF2D 3I72A 1RD9D 3S1QB 3RZDB 1PDQA 2EYLA 3SXHA 1YNJC 3CRKC 2D2CC 2K32A 3U9SA 1PFMA 4HEDA 1WTRA 1IW7C 2B8FA 1HCZA 2K03A 3IAYA 2JEAI 5T1IA 5JVH3 1Y69U 2B39A 3GQBA 4QUFA 1D5ZC 2IX3A 1XXGA 2F0WA 5I2XA 2NN6I 1Q1BA 3KUPA 1OXSC 4QUCA 2D9UA 1KDBA 2E2DC 5C4ZA 1G91A 2CQAA 1RJTA 4BY7B 1STYA 4OHJA 3J7AV 1EOTA 4I65A 5E1FA 3GV6A 3PIP3 5DM63 1ONLA 5D14A 1NR4A 4DGZA 1PFNA 5M3MB 2EYHA 5IIFA 1A2UA 4C3HB 1SEBD 1PTOC 1SE4A 1GUGA 2LFNA 5JJZA 1TU2B 1DOLA 1EWCA 5M5WB 1KAAA 2IW3A 2M00A 1B2TA 5EKKA 2QCPX 3MXPA 4B9WA 1DD2A 1Y1WB 1II3A 2PQEA 2J4XA 2F3WA 2A69C 5DAUA 2AQ3B 1SYFA 2PNRC 3H94A 4DU9A 2XN9C 3MFYA 3D31A 3Q22A 2Q8RE 1ILPA 1HUNA 4E6IA 2R3ZA 3ITPA 3VYSA 4TRDA 1CM9A 1YNJD 4XTCS 3DEPA 3MXNA 1B1ZA 1BOSA 2I46A 1I6HB 3TZDA 2A68C 5C3EB 4BY1B 3A56A 2R7ZB 4GZYC 4RHRA 3HOZB 3NQTA 2I07B 4A3JB 3ONAB 4HTHA 4CJ2C 1QCBD 2E2JB 4QF4A 4R9WA 1VDZA 3QOLA 1RTNA 2OXPA 1S5FD 1TS5A 1SFOB 1OXVA 2QILA 1PTOD 1Y8NB 2KA7A 4K14A 5CYUA 3VYUA 1CQFA 3RUZA 2DY8A 2EJFC 5JOBA 3A7AB 1O7ZA 4ZRZA 3V96A 1DOMA 1U4LA 3D3RA 1TS2A 4QMGA 1J9OA 1UUPA 2A73B 2G9DA 2FMMA 4DN4M 3A54A 3I4LA 3IFTA 2M2LA 4BA2I 1CTMA 3C1EA 4A3IB 1EEID 5EKIA 1KNAA 3I70A 1HQMC 3ZYYX 3TP7A 2EOTA 2GA4B 1XYIA 3PO3B 1U4MA 1SAPA 2F0DA 3HKZB 5LL6S 3BVZA 4FF1A 1G8ZD 4K2LA 1AZQA 4PNYA 1G6ZA 1YNND 3PIO3 3SK4A 1BXTA 2F0UA 1GUOA 4C56C 2RDGA 1TWGB 2EY2A 4PMWA 1EIGA 2AUKA 1JOKA 2B2TC 3M7NA 5G3LD 3I4NB 3G7LA 2X69A 3A8JE 1HTPA 4ULLA 4IUNA 1AW7A 4K8IA 4Y7NB 2A6EC 1EZ8A 4A3BB 2X6GA 4IUPA 4M8AA 3NP8A 1F9SA 1F9PA 3R8BA 3C3LA 1BDOA 2IX1A 2XRSD 1BO0A 1LV9A 4IALA 4RGOS 2BDNA 5EBCA 3SK5A 2NVQB 4RGNA 3GTMB 4KY7A 5JVG3 2LMCB 2A6ED 2KCCA 4XYOA 4KI0A 1CA6A 4TKOB 3GTLB 1D1IA 2MJ8A 3NE5B 1A3UA 2KJXA 5C5LA 5D3IB 2CW0D 3HGBA 4ZKBB 2HCIA 5IOCA 1TQOA 5CC4A 4HN7A 4G57A 2JYOA 3VR5A 4I7ZC 1EY4A 3TDQA 1EY0A 1EEFD 3LWUA 4KTAA 3WDNA 4OIKA 3HOYB 3OIQA 5A2QL 4EQNA 4OO1I 3OMCA 1ICWA 4K8JA 1RHPA 2KOLA 5I2YA 3FRPB 3PMFA 4LAAA 4HR7B 3I90A 3P75A 2E2HB 2RA4A 1EU3A 2L1BA 1EQTA 1ENAA 1JWMD 2A5HA 1I4XA 2NTSA 3Q23A 4KKSA 5ELFA 3OPOA 3I91A 5J39A 5LHY1 1PMRA 1SBBB 4KJOA 3VYRA 5EPKA 1JWUD 3J81E 1BF4A 4G7OC 1LTID 3RZOB 4CJ0B 3VR2A 2PMZB 4ZQ3A 1QB5D 1QILA 1EY6A 4H0LC 2WINB 1GUWA 1TWFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7Z A;  1HUM A;  2FJ2 A;  3N52 A;  4XDX A;  1NCV A;  5EPJ A;  5CMD A;  1CA6 A;  1HRJ A;  2M2L A;  1E0B A;  1U4R A;  2N88 A;  1O80 A;  4X3K A;  2Q8R E;  5CBE E;  1M8A A;  1VMP A;  1WTO A;  5E4X A;  4QUF A;  1ILP A;  1BNZ A;  1HUN A;  2R3Z A;  5EKI A;  2FFK B;  3P7J A;  1QG7 A;  1KNA A;  2MJ8 A;  5D14 A;  5COR A;  1WTV A;  2EOT A;  2VXW A;  2K04 A;  2KVM A;  5D65 A;  1XYI A;  1CM9 A;  1WTP A;  1U4M A;  1RTO A;  3F2U A;  1DON A;  2RSN A;  1BBX C;  1SAP A;  2H1E A;  2K05 A;  2MP1 A;  2N55 A;  2D9U A;  3KUP A;  3LWE A;  4QUC A;  4RWS C;  1WD1 A;  1WD0 A;  4ZKB B;  1A15 A;  2HCI A;  1WVL A;  2HDL A;  2KED A;  3DEP A;  2FIN B;  5AFW A;  3DEO A;  1MSH A;  1F9Q A;  1X32 A;  1Q3L A;  4R8I A;  1EL0 A;  1B3A A;  1GUW A;  3FDT A;  2L12 A;  2JYO A;  1ILQ A;  1AZQ A;  2NZ1 D;  2IL8 A;  1G6Z A;  5DNF A;  2B2U C;  1G91 A;  5EQ0 A;  4IUQ A;  1B50 A;  3DM1 A;  4MN3 A;  2FHT A;  1RJT A;  3TZD A;  2NWG A;  1MGS A;  1EOT A;  2JP1 A;  2L9H A;  4U68 A;  4XT1 B;  1ML0 D;  2B2W C;  2L4N A;  2EPB A;  4OIK A;  1O7Y A;  2NYZ D;  1VMC A;  3GV6 A;  4OIJ A;  3I8Z A;  3IL8 A;  1SDF A;  3ONA B;  1EIG A;  3R93 A;  4ZLT F;  5T1G A;  1MI2 A;  4X3U A;  4O42 A;  1TVX A;  1G2S A;  4X3S A;  1NR4 A;  1ICW A;  2B2T C;  4MHE A;  1PFN A;  1RHP A;  2EE1 A;  2KOL A;  4IUT A;  1AZP A;  4ZAI A;  2KEC A;  3I3C A;  1DOK A;  4IUU A;  2MGS A;  1J8I A;  3I90 A;  3G7L A;  2B2W A;  1U4P A;  1JE4 A;  1XX8 A;  2HDM A;  2K01 A;  2X69 A;  2XIW A;  2RA4 A;  3D6W A;  3HP3 A;  4CJ2 C;  4ZKC B;  1PFB A;  1S4Z A;  2L1B A;  1EQT A;  1X3Q A;  5JJZ A;  4HCS A;  3IFD A;  4R9W A;  5EJW A;  2X6L A;  3SVM A;  4NW2 A;  1DOL A;  3MTS A;  1B4O A;  1MSG A;  2K28 A;  2KUM A;  3Q6S A;  2HUG A;  2RVL A;  1SSO A;  1CA5 A;  1RTN A;  4RAU C;  3FPU B;  1F9R A;  4IUV A;  1PLF A;  2DY7 A;  2MPM A;  3GV3 A;  3KBX A;  1B2T A;  1G2T A;  3I91 A;  1JIC A;  2KEE A;  1QE6 A;  1QNK A;  1HFG A;  2X6G A;  1NAP A;  4IUP A;  4UAI A;  5EPK A;  1IKL A;  1AP0 A;  3MWY W;  4X3T A;  5COY A;  2B2V C;  2B2Y C;  1F9S A;  4ZK9 B;  3UI2 A;  1BF4 A;  1ZXT A;  1F9P A;  1HA6 A;  2DY8 A;  2K1B A;  4HAE A;  3QO2 A;  4HSV A;  5E4W C;  5EPL A;  5CBA E;  1NR2 A;  1PDQ A;  1WTQ A;  1WTX A;  1ESR A;  1O7Z A;  1C8C A;  1EIH A;  4CJ0 B;  4IUR A;  1BO0 A;  3TN2 A;  1X3P A;  1F2L A;  2B2T A;  1LV9 A;  1DOM A;  1U4L A;  2CVR A;  2BDN A;  1ROD A;  1IKM A;  2HCC A;  1J9O A;  4LMQ D;  1PFM A;  2Q8T A;  4HED A;  1WTR A;  1DZ1 A;  1WTW A;  2SDF A;  2FMM A;  1B53 A;  4XT3 B;  4CJ1 B;  1HHV A;  2B2U A;  4DN4 M;  2K03 A;  2RSO A;  1HFN A;  2L11 A;  1IL8 A;  2B2V A;  4RA8 A;  3H91 A;  2B2Y A;  1KNE A;  5T1I A; 
#chains in the Genus database with same CATH topology
 3A0J A;  3FKI H;  1HUM A;  3N52 A;  4H44 C;  4LK1 C;  3UE0 A;  1K8A C;  4LF8 Q;  2TSS A;  1H9R A;  2JEB I;  3LX0 A;  1BR9 A;  4DR1 Q;  3QWN A;  2K4K A;  4LF6 L;  1KIX A;  1STG A;  4NP5 A;  4KHZ A;  1JC7 A;  1LTR D;  1PZK D;  3W2D A;  5K36 H;  5KGU A;  3UDF A;  2BCO A;  3T1H Q;  2CQO A;  4C3H H;  4DR4 L;  2E8G A;  4DR1 L;  2F0E A;  2KCM A;  1TXY A;  3H09 A;  3SDZ A;  4F88 A;  3OMG A;  3I7F A;  3NK9 A;  4RGT A;  4EGV A;  3NBH A;  2VUM H;  2F0T A;  1B50 A;  1UE7 A;  2PW7 A;  2JXM B;  1L2F A;  4BY7 H;  2L5T A;  1CT1 D;  2JP1 A;  1HNX L;  1B70 B;  2N78 A;  4YWK A;  5C44 G;  1SDF A;  5I6Y A;  2PI2 E;  5M3F G;  1QUQ B;  3NTI A;  4MTK A;  2EE1 A;  1EQV A;  3QJY A;  5JAV A;  4IUU A;  1JOQ A;  4BY1 G;  4IPC A;  4JVZ A;  3EA6 A;  2JA5 G;  1N34 Q;  3W3A A;  1Y1V B;  1J5E L;  3D6C A;  3BYT B;  4O2D A;  4B3T L;  3HOW B;  3V05 A;  1KDC A;  2F0G A;  3GTQ B;  1D6E C;  3M4O B;  4TSS A;  4IOC A;  5HY6 A;  3MEF A;  1HNZ L;  4ODG A;  3I4N G;  4XQN A;  1HJP A;  3HOX H;  1PH7 A;  1E22 A;  3TS2 A;  2B63 H;  1G29 1;  3KBX A;  1LUZ A;  1I4R A;  4KMU C;  3K59 A;  2MUY A;  5FOB B;  5IT9 L;  1PH8 A;  5IGG A;  1I3Q H;  4DAY B;  3SK6 A;  4WJ3 M;  4JV5 L;  3FEW X;  1P16 A;  3D8G A;  1EY5 A;  5IE8 A;  3GTG H;  1I5F A;  1LT5 D;  2OT2 A;  1X3P A;  2B2T A;  4MZ9 A;  3RZD H;  1VQL A;  2A74 C;  4DR5 Q;  3IKJ A;  2F0S A;  2DNC A;  3HOW G;  4QL5 A;  2JA6 G;  1AFP A;  2Q8T A;  1DZ1 A;  4FXG C;  5K5P A;  1E1T A;  4IPG A;  5CV5 A;  5JPM C;  1CSP A;  1WCM B;  2WAQ G;  1TWH H;  4G4K A;  2F0H A;  5E4X A;  2NUC A;  3JAM c;  4DAY A;  4POG A;  4YWL A;  1R4P B;  5C6A A;  5IGF A;  3AU7 A;  1IBM Q;  4BS9 A;  4JI1 L;  3SK8 A;  2L0C A;  1XMO L;  2F0F A;  3KF8 B;  1A2T A;  4M1U B;  5E7N A;  3D4W A;  4K5W A;  1VCI A;  4FF4 A;  2DJG C;  3BYY B;  2KED A;  2VS1 A;  2CWP A;  2A8V A;  3U9O A;  3HOV G;  1B3A A;  1EZ6 A;  1E2V A;  2EQS A;  4OXP A;  1F77 A;  5EQ0 A;  1XNR L;  1AEX A;  5C4J B;  3VA5 A;  2UXB L;  1L0X B;  4ALP A;  1MGS A;  4DUY Q;  5D3D A;  1ENF A;  3C1F A;  2WFW A;  4XT1 B;  1ML0 D;  5M5X H;  4KKT A;  2F0I A;  3H6M A;  3OOC A;  1S5E D;  3RD4 A;  1BVS A;  4OGQ C;  1VQI A;  3TP8 A;  1SMY C;  2R7D A;  4BBS G;  1TKW B;  3HP3 A;  1SND A;  2JQO A;  2F0N A;  3E6Z X;  4G7H C;  4XYQ A;  5GAG C;  4A3M B;  1SE8 A;  3Q8D A;  3IFD A;  1OXU A;  4CKC A;  1STB A;  4CKB A;  5IWA Q;  4A3C G;  1ET6 A;  5NUC A;  2P5Z X;  2RVL A;  3NSW A;  3GTL H;  2KCT A;  2VNU D;  4OEM B;  1PHJ A;  2Z6K A;  4JI2 Q;  1IKL A;  4PMB A;  4UP9 A;  4KHV A;  2E2I B;  4CDD C;  1IYJ B;  2F0Q A;  1N32 L;  1YZ6 A;  2KHI A;  3NUC A;  2ZTD A;  3MC0 B;  4HAE A;  4YCU A;  3STB D;  4LNQ A;  1LTS D;  4DV2 L;  3M9B A;  2PZW A;  4N9P A;  3Q24 A;  4JK1 C;  1AE3 A;  4GNX C;  5J1Z A;  4IPD A;  4A93 B;  5LMU L;  1FGB D;  3EVQ A;  5EPJ A;  5KYI A;  2C5C A;  2N88 A;  3CU7 A;  1ASY A;  3K0Y A;  3H15 A;  2R92 B;  2K33 A;  3RN5 A;  2LKV A;  1QNU A;  4G7Z C;  1N33 Q;  2DGY A;  4NXN L;  1EYG A;  1GOZ A;  2IJ0 A;  1SNP A;  4DV2 Q;  1LO5 D;  4JI0 Q;  4UY8 C;  1VQ4 A;  5GAH C;  3L0O A;  4OL7 A;  4GLV B;  3PGZ A;  1QWY A;  3KLR A;  1KRS A;  1ET9 A;  1EU4 A;  5C4H A;  1GHJ A;  5IOD A;  4C2M B;  1WVL A;  2B63 B;  2XNA C;  3DEO A;  4GN5 A;  1Z47 A;  5HUR A;  4R8I A;  1WFQ A;  2LS0 1;  5KYL A;  4J8Q A;  2SNS A;  1ILQ A;  4DPG A;  3A7L A;  3H3V C;  1VQ8 A;  1JR0 D;  2NZO A;  2AMC B;  2R7Z H;  4H02 A;  4A3G B;  3VR3 A;  5KEE A;  1BCP F;  4A3B G;  1NJI C;  1XMQ Q;  4NKL A;  2OQ0 A;  3CMA A;  1MD2 D;  4B3S L;  5IGC A;  2I0Q A;  4YCV A;  4ZUI A;  5CGK A;  1SYC A;  4KN7 C;  1M1K C;  1CQV A;  2AUJ D;  4J1M A;  3GTG B;  1PTO F;  2UUB L;  4GS3 A;  3URY A;  1EY9 A;  2HQL A;  2YU9 B;  2EIF A;  1PFB A;  5L37 A;  2UXC Q;  5FK9 C;  4OO1 G;  2R93 H;  2WII B;  4LUO A;  5JEA G;  3NPP A;  5BN3 A;  1XPO A;  1CHP D;  2EY6 A;  2KQ3 A;  1I4G A;  2I5H A;  2K75 A;  5DM7 3;  3HZX A;  1KQS A;  1CA5 A;  1SFO H;  4RAU C;  3JAM i;  1D5M C;  1F9R A;  1LTL A;  4N9T A;  4AIM A;  4B3R L;  1RL2 A;  4QCL A;  1STH A;  3HOU G;  2LXK A;  1HFG A;  1QNK A;  3MAQ A;  3F2B A;  2F3V A;  3BZC A;  4RHS A;  2D62 A;  3S17 B;  3UI2 A;  4AYB E;  5M5W H;  1BCP B;  1K8O A;  1B44 D;  1STA A;  1AE2 A;  2NZH A;  1ESR A;  3K7U C;  3PSI A;  5CV7 A;  2DNE A;  1BCP D;  2K6A A;  1HZ9 A;  1LLR D;  4KN4 C;  3SE0 A;  5IYD H;  2QEJ C;  1FGU A;  2F0K A;  1DYQ A;  1JCK B;  1UWV A;  2L11 A;  5GRO A;  3CCQ A;  5JJI A;  2PO4 A;  4JI5 L;  4A93 H;  2LY7 A;  4OO1 H;  1VMP A;  1DXM A;  1GJX A;  2UU9 Q;  2RCF A;  1F2M A;  1G6P A;  5IT9 E;  5C3X A;  1PH6 A;  3W5O A;  3S17 H;  1SYD A;  3PUW A;  2Y0S G;  1W3S A;  5D65 A;  4RCN A;  3G6E A;  3HOW H;  3F2U A;  3K57 A;  3CCS A;  1BCP C;  3T51 B;  3V2T A;  3MFG A;  2ZXP A;  5EKL A;  1WCM G;  1Y8O B;  5I4D A;  1K0S A;  5TSS A;  2HDL A;  1I4P A;  1NMG A;  4GLX A;  4C1N K;  1IBM L;  1F9Q A;  1X32 A;  1FNW A;  3E3X A;  1N36 L;  3IRB A;  3NEM A;  2JJQ A;  1TS3 A;  4U67 3;  5JEA H;  1S5D D;  4K0K L;  3DM1 A;  2YTV A;  1H9S B;  2HIV A;  5JJK A;  5BN5 A;  2ZXO A;  1JOR A;  4A3F B;  3BVG A;  5IYC G;  1SYG A;  2WB1 E;  2BE5 D;  3AQQ A;  4HSP A;  1GUW A;  1MI2 A;  5M3F B;  1HA6 A;  1VQ9 A;  1EYC A;  4FYD A;  4HJ9 A;  4KD3 A;  1DOK A;  1X3F A;  3SHL A;  1K0R A;  1SNO A;  2WKC A;  5CV6 A;  4EQ5 A;  1XX8 A;  2XIW A;  5KIX A;  3PUY A;  3OWE B;  4DR7 L;  1B8A A;  4BBR B;  1X9N A;  1BBU A;  3MEH A;  3T16 A;  2N49 A;  1MSG A;  2K28 A;  3DWQ A;  4WRD A;  4ID6 A;  4TQU S;  2HUG A;  3GDE A;  1PH9 A;  3ER0 A;  2OWO A;  4JI7 Q;  3K5L A;  5CV9 A;  1PZJ D;  1TWF H;  4F8M A;  1HNZ Q;  4GKJ L;  1LT4 D;  1JQY D;  1GO3 E;  1YJW A;  3N6R A;  2KBN A;  1XNQ Q;  3CME A;  2B2Y C;  1RIP A;  5JJL A;  5C44 B;  4RCO A;  4DV5 L;  1I3Q B;  5EPL A;  1V43 A;  3CW2 C;  3DHQ A;  1B9M A;  1M90 C;  4A3G G;  2E5L L;  1ZYR D;  4LF8 L;  3X3N A;  2VQE Q;  1WTW A;  1WCM H;  4PG3 A;  1NE3 A;  1IL2 A;  3I73 A;  3J7Y W;  2Z4H A;  1SYB A;  4CKE A;  1M8A A;  1YHB A;  2IX0 A;  5ELN A;  2VW9 A;  1L0Y B;  3PQI A;  1PTO H;  5COR A;  3EBE A;  2CKZ B;  1EY7 A;  3DWA A;  4KKU A;  4JV5 Q;  2EY1 A;  1SN8 A;  4DV1 Q;  3LWE A;  1E1O A;  2H5X A;  1CK1 A;  2E74 C;  2ES2 A;  2FIN B;  4Y52 H;  1MSH A;  4L5S A;  5FLX L;  2H4O A;  1NSN S;  1DCZ A;  1JJC B;  3NTH A;  3GP7 A;  3JC6 6;  2M9V A;  2FHT A;  4DA2 A;  2Y0S B;  2O2L D;  3ERQ A;  1L1O C;  3A8I E;  2EPB A;  3OYY A;  5KND A;  2G5D A;  4AQY L;  4B3T Q;  4OX9 L;  5J3B A;  1G2S A;  2ENB A;  4FVM A;  3L3O C;  2KEC A;  3I3C A;  2MGS A;  4AYB G;  4L5R C;  1OXT A;  2ICI A;  2HDM A;  5IYD G;  1DON A;  4ZKC B;  4P75 A;  3HOZ H;  2N8N A;  3PO2 G;  3ND8 A;  1Q8I A;  3SVM A;  2JN4 A;  1XNQ L;  4YHH L;  1GUS A;  3MTS A;  2VB2 X;  1Q90 A;  4JI6 L;  4ABN A;  3F1Z A;  3UDX A;  2RDH A;  2DY7 A;  1Q1E A;  4V19 0;  2CHB D;  5BN4 A;  1QOH A;  3S15 H;  2DUD A;  1AH9 A;  2JE6 I;  2MO1 A;  1O78 A;  2LXJ A;  4WJW A;  4CBV A;  1A3T A;  3G4S A;  2ASB A;  2DJF C;  1IYV A;  1J5E Q;  1R4Q B;  3CCV A;  4PZ6 A;  2EZV A;  1HR0 Q;  1TWH B;  4DV4 L;  1F2L A;  3M7G A;  5C3W A;  3S1M B;  2R61 A;  1LTT D;  1ROD A;  1UE5 A;  1FVI A;  3M4Y A;  1IKM A;  2HIX A;  2IY5 B;  4JBJ A;  4FO2 A;  1A8V A;  3ERO A;  2K5V A;  3OHX C;  3AB9 A;  1W6K A;  5IGB A;  4C3J H;  1YNN C;  4JBK A;  3U4Z A;  1K73 C;  1MHW C;  2A6H C;  5M3M G;  4Y7N H;  1CKN B;  3E9H A;  1KLG D;  4BY1 H;  3KK7 A;  1BNZ A;  1TY0 A;  3P20 A;  2JSO A;  1X54 A;  1N36 Q;  1QG7 A;  1TT2 A;  3H3V H;  1NUC A;  2NTT A;  2Q2U A;  3TEH B;  1IYU A;  4DR4 Q;  5M5X B;  2A19 A;  1QVF A;  2KVM A;  3UE1 A;  2K5W A;  4BXX H;  3HOU B;  4HMI A;  3LGJ A;  1EFI D;  1YNX A;  1ZYR C;  4DK0 A;  1PYS B;  2K05 A;  4LFC Q;  3S14 H;  3O13 A;  3HOX G;  3H0G G;  2Q2H A;  1KTK A;  1SMX A;  4XQQ A;  1EQQ A;  4RG1 A;  2B63 G;  1VQJ A;  5F2D A;  1LTA D;  2GVB A;  2ZM6 Q;  3K5N A;  3E5S A;  1MBY A;  4K5X A;  1M4V A;  2EY5 A;  3PUZ A;  4BA1 I;  1XJV A;  4L8J A;  1FNU A;  1T5E A;  1JE5 A;  3R3O A;  3J80 c;  2UUC L;  3M4P A;  2Z6K C;  1EFW A;  4MIU A;  2E2J H;  2D0O A;  1KL9 A;  2OQK A;  1H9J A;  3R93 A;  2PCF B;  2ALY B;  4GOP A;  4KY5 A;  1D5X C;  1Z6H A;  3KF6 A;  2BA0 A;  3EFX D;  4ZAI A;  1E3P A;  3CAM A;  4FF2 A;  4JCV E;  2E2H H;  2L55 A;  1QZG A;  3CC4 A;  3KF8 A;  1U4P A;  1W6J A;  5ELC A;  1KRT A;  4DR6 L;  5E3F A;  4KHP L;  5A35 A;  5M3M H;  2UXD Q;  2PZT A;  3EN2 A;  3X3M A;  3T56 B;  5EJW A;  4DR3 Q;  4LJZ C;  4HIO A;  4JI8 L;  5IYB H;  1Y1W H;  3W1G A;  3Q6S A;  4GKJ Q;  3GTJ H;  3FPU B;  3KBG A;  1IHZ A;  3CRL C;  4L5T A;  1TY2 A;  1PH1 A;  1V1O A;  1PRT B;  2JA7 H;  1Y1V G;  1LAB A;  3R2T A;  1D2B A;  4KLK A;  4NDX A;  3AFP A;  4A3E B;  2QGQ A;  3MWY W;  2F0O A;  4C3J G;  1FJG L;  2B2V C;  5I9P A;  1PRT D;  3BDO A;  4F7X A;  2ID0 A;  4DNI A;  1PTO B;  2AHO B;  3NWS A;  2ZJP A;  1CZG A;  1NR2 A;  1C8C A;  1NNX A;  4J6H A;  3HOX B;  2XVS A;  4OWW B;  1PV4 A;  2OTL A;  4R8N A;  2PNH A;  4DR2 Q;  5ELD A;  4C1N I;  3H3V I;  1OTC A;  1B53 A;  3BDC A;  4XT3 B;  3RN2 A;  2B2U A;  4BWG B;  2RSO A;  2XRQ D;  1XMQ L;  1AN8 A;  4RA8 A;  1JOO A;  1GVP A;  3QOJ A;  4ZUJ A;  4XDX A;  2FJ2 A;  1MJC A;  4YY3 L;  2F0M A;  2JA9 A;  3D4D A;  4QIW E;  2E2I H;  1X65 A;  2EYJ A;  1X3G A;  4WFN 3;  1S40 A;  3MXG A;  1UE1 A;  1Q12 A;  1HA5 A;  4DAP A;  1ENC A;  2A69 D;  1D8L A;  2VXW A;  3E0J A;  1CFM A;  2OEO A;  4K6L A;  1ESF A;  2RSN A;  2MP1 A;  3KLW A;  1WD0 A;  3OWF A;  4GLA C;  2A6H D;  5KNC A;  3VA7 A;  1N33 L;  1L1O A;  4FP5 D;  3RLF A;  2IT1 A;  1QUQ A;  4AH6 A;  4LFB L;  3BG3 A;  4R4T A;  2K5H A;  1VQ7 A;  3FHW A;  1CZW A;  2IL8 A;  1GD7 A;  4HIM A;  3L7Z C;  2F0V A;  4U68 A;  2L4N A;  1VMC A;  5J22 A;  1OXX K;  4ZLT F;  4JI3 Q;  1TVX A;  3BU2 A;  3HKZ E;  1HHV A;  4MNO A;  4IUT A;  1VQN A;  1H9K A;  4X6A H;  5EBD A;  1IXR A;  1YHA A;  2ZTC A;  4RKL A;  1J8I A;  3HOV H;  4POF A;  3C2P A;  4J15 A;  4P72 A;  4GKK Q;  2MO0 A;  4XIG S;  4ME5 A;  1S5C D;  2F0P A;  4JI4 Q;  2A68 D;  5FO7 B;  1JB7 A;  3I4M B;  2VUM B;  3TS0 A;  1O7I A;  2WV6 D;  4CDE C;  2PW5 A;  3PF4 A;  4QJF A;  2JA8 G;  2SEB D;  3W1B A;  3DMU A;  1G2T A;  1V8Q A;  1FR3 A;  1I50 B;  2XSC A;  2KEE A;  5LMN L;  3S15 B;  1F2Z A;  1K83 H;  1YIT A;  1SJH D;  1DM0 B;  2ZXR A;  3L9A X;  3M4O H;  4X3T A;  5CV4 A;  4UDU C;  3CXC A;  3H0G H;  3KLS A;  2PQA A;  1IBL L;  1JWS D;  4NPS A;  2WAQ B;  2VL6 A;  5CBA E;  4GKK L;  1WTX A;  3MHB A;  2UUB Q;  4DUZ L;  5C3E G;  4FNF A;  2WB1 G;  3FKI B;  4IFD I;  4A3D B;  4C3I G;  3BVM A;  4B3S Q;  4V0B A;  3DUZ A;  2O5I C;  2FMC A;  4ZYS A;  5IGE A;  2PYK A;  5C0X G;  2O5J C;  2JA5 B;  2B2V A;  2JK8 A;  2UUC Q;  3M3Y B;  2UXB Q;  1TS4 A;  3CQZ H;  3NQI A;  5KNB A;  3S16 B;  3GTK H;  3J80 L;  4DR2 L;  4O0A A;  4O1N A;  3U50 C;  4Z9C B;  3K8A A;  1KD1 C;  1WTV A;  3TSS A;  3K6O A;  1R9T H;  1N8R C;  1LT6 D;  2AQ2 B;  2J0T D;  2NB0 A;  2F1M A;  3GTP B;  3MZ5 A;  4JI0 L;  5HGQ A;  1N32 Q;  1GXD C;  2MHV A;  2OTJ A;  2PPB C;  2NVT B;  2BDO A;  1Q81 C;  1L0W A;  4JOI A;  4JI2 L;  5BR8 L;  1XPU A;  2NZ1 D;  5C0X H;  2R7F A;  4DKA C;  2B2U C;  4A3K H;  3NXW A;  2SNM A;  1I6H H;  2IPK D;  5IP9 G;  3WWV A;  2NWG A;  3OIP A;  4DFA A;  2EYF A;  2B2W C;  5FO9 B;  5I9O A;  1QZH A;  3SR1 A;  2K50 A;  4H7B A;  4X3S A;  4PV1 C;  1NMF A;  2IHF A;  4JBW A;  1MIU A;  2EDG A;  4LF9 Q;  1KXL A;  1AZP A;  1UAP A;  1HZC A;  1B7Y B;  4DV4 Q;  4DAM A;  3D6W A;  1B3Q A;  4RH6 A;  4RKB A;  1BKB A;  1X3E A;  4DF7 A;  5C4X H;  2F52 A;  1YJN A;  3TME A;  2O4X A;  4DV0 Q;  3S9W A;  4HCS A;  3K5M A;  3CP0 A;  2QDL A;  1FJG Q;  3KLS X;  3C46 A;  4IO9 A;  4IN3 A;  3M85 A;  5C3E H;  1IW7 D;  2SOB A;  1PLF A;  1O7L A;  1TWC B;  3NHH A;  3PUV A;  4QB4 A;  5FLX E;  5H1S E;  1H9S A;  1FD7 D;  3SEB A;  5I6W A;  4GNX A;  4A3F G;  3GTO B;  4A3L G;  1QE6 A;  4WOR A;  5ISR A;  3UDG A;  2F4V L;  1NAP A;  1AP0 A;  4UP7 A;  4JI8 Q;  1EOV A;  3CCR A;  4DV1 L;  1WI5 A;  3BDL A;  1TII D;  3MVV A;  4S3S A;  4B08 A;  2VB3 X;  2Q8I B;  4JYA L;  2K1B A;  2RKS A;  4KHP Q;  1WYD A;  1J6Q A;  2D5D A;  2QW7 A;  1P8L A;  4DNR B;  3JAM L;  3TN2 A;  3A55 A;  1VQD A;  3NWT A;  2F0L A;  3BS1 A;  1XTD A;  2EXZ A;  3J80 E;  4BBR G;  3T53 B;  2V1C C;  1LTG D;  3PIO A;  5G3L F;  2EYM A;  3J7Z C;  4OX9 Q;  4LMQ D;  2JA7 G;  1KC8 C;  2UUA Q;  3I56 A;  4FF3 A;  2DN8 A;  5IYC H;  3HRZ C;  3RZO H;  3S2H H;  5C44 H;  1A3V A;  3I55 A;  1VQG A;  1DJR D;  3NBH B;  3S1R B;  1O80 A;  4X3K A;  2GVA A;  5CBE E;  2RQX A;  3R2I A;  2NVX B;  2N3S A;  4CDF C;  2AWN A;  1A6X A;  1STE A;  3K58 A;  3EQL C;  3NTK A;  2R92 G;  3P1H A;  1BBX C;  3T1Y L;  2H1E A;  2N55 A;  4RWS C;  1XMO Q;  2WB1 B;  3K7A H;  5M5Y B;  4JI1 Q;  1BUV T;  3Q0A A;  1EL0 A;  1CSQ A;  3VYT A;  3KJO A;  1SNQ A;  2JA7 B;  4A3M G;  1SYE A;  4KY6 A;  4JI7 L;  2BA1 A;  4DXF A;  3ERS X;  2HHH Q;  4BBS B;  1T5X D;  4RFB A;  1IBK Q;  1K8M A;  2QDB A;  3T13 A;  1U9R A;  1O7Y A;  2YTX A;  2EJM A;  3L2P A;  2UUA L;  2PZU A;  3DXJ C;  2I5M X;  1Z9F A;  3I8Z A;  1PYW D;  3IL8 A;  5T1G A;  3KDF A;  4EQP A;  1QVG A;  2JA8 B;  3S1N H;  3RMH A;  2E5L Q;  2XWB B;  2OCE A;  4DNT B;  2BH2 A;  1EUJ A;  3NBI A;  4LF4 L;  3A8K E;  4EQO A;  1C4Q A;  2TMP A;  2NN6 H;  1X3Q A;  4NW2 A;  3HEJ A;  1PXU A;  3H0G B;  2HHH L;  1K3B C;  2QEX A;  1K3R A;  4K6D A;  2Q2T A;  5ELE A;  1PH2 A;  4R4C A;  3FPP A;  2K5D A;  1GUT A;  4A3E H;  1VQB A;  2AKW B;  1FL0 A;  1PVO A;  3LNN A;  1HTL D;  1EWI A;  4ZK9 B;  4DV0 L;  1EYD A;  3ICE A;  2NVY B;  1TWA B;  4PQX A;  4HSV A;  1HPC A;  1I4Q A;  5E4W C;  1WTQ A;  5FLM G;  4F87 A;  4IUR A;  2XGT A;  3MXU A;  3J7A F;  3ZJY C;  4LWC A;  4LF5 L;  2CVR A;  3PO2 B;  3OSO A;  4B9X A;  4APV A;  4RGM A;  1LM0 A;  5JPN C;  1HFN A;  1IL8 A;  2HD3 A;  1H9M A;  1E2Z A;  1HRJ A;  1NCV A;  5CMD A;  2R6G A;  4YCW A;  1JMC A;  1Q7Y C;  1C0A A;  1S5B D;  2NN6 G;  2FFK B;  3PV0 A;  5HGT A;  3BJU A;  4X64 L;  2YYZ A;  3G6J B;  1STN A;  4CGY B;  1SE2 A;  1SXT A;  1K8G A;  5ELO A;  3T1H L;  1RTO A;  5CV8 A;  2LSS A;  3FVQ A;  1KDA A;  1SMY D;  3I4O A;  2C9O A;  3OW7 A;  5C4X B;  2KCN A;  2RHS B;  3PO3 H;  1A15 A;  3UDI A;  2EVB A;  3HOY H;  5C0X J;  1SRU A;  1GHK A;  4HMJ A;  3QG1 A;  2F4V Q;  1HNW Q;  4BBS H;  3FDT A;  2L12 A;  3QR8 A;  2AWO A;  2JA6 B;  1X55 A;  3GTK B;  4XQJ A;  3CQZ B;  3S16 H;  4MN3 A;  1Q86 C;  4NXM L;  2V4D A;  5FLM H;  2E75 C;  4JI3 L;  2Z9H A;  3CC2 A;  1UNS A;  4KJN A;  1LYL A;  4OIJ A;  3CPW A;  4A3I G;  3HG9 A;  1B9N A;  4HJA A;  5A2Q E;  1TWG H;  4MHE A;  3EJI A;  5FJ8 H;  3J81 c;  2E76 C;  1GUN A;  1JE4 A;  3WOE A;  4DK6 C;  2PMZ E;  4DV5 Q;  1CI3 M;  1RKN A;  2Z8L A;  3TP6 A;  2X6L A;  1A0I A;  1B4O A;  4L63 B;  2WKD A;  3HKZ G;  4EVO A;  3JAM E;  1SSO A;  4IPH A;  5LMN Q;  4PMC A;  3S2H B;  4K0K Q;  4IUV A;  4R1J A;  4DXG A;  4IFD H;  3J81 L;  5KRU A;  2G9H D;  4C3H G;  2K7V A;  2R92 H;  2EYP A;  2IWH A;  3CD6 A;  3TBI B;  1ZXT A;  2F4I A;  3BZK A;  3GTJ B;  3VR4 A;  2CH4 W;  3QO2 A;  3A5U A;  4GOP C;  4BY7 G;  2Z4I A;  1ZKO A;  2XTI A;  3QIA A;  1ASZ A;  2NVX H;  1V9P A;  2HCC A;  4NMZ A;  3D4R A;  3FP9 A;  5EAY A;  2ZT9 C;  1X6O A;  2NBF A;  3GD7 A;  5FJ8 G;  1KNE A;  2JA8 H;  3S1N B;  2J7Z A;  4IFD G;  5DEH A;  2JA5 H;  1E0B A;  1U4R A;  3DWP A;  1I94 Q;  1EQR A;  3BZD B;  3AMU A;  1SNC A;  1WTO A;  4LFA L;  5C0X I;  2PI2 A;  1PRT C;  3AYH B;  2R7Z G;  3I4M H;  1EY8 A;  2OF1 A;  1I4H A;  4DK1 A;  2QKI C;  5IT9 c;  4IJH A;  1HXY D;  2K14 A;  4Q0F A;  1VQK A;  1C48 A;  2Z0S A;  3KFU A;  2YU9 H;  2BE5 C;  3HOV B;  1RCV D;  1PZI D;  2EXD A;  3GTQ H;  1Q8K A;  4KV6 A;  5EGT A;  4FXD A;  3CKI B;  3J80 i;  4ILW A;  1QJO A;  2UU9 L;  3CCE A;  2RBM A;  4YY3 Q;  4A3J G;  2D0P A;  2F03 A;  2XWJ B;  4LF7 Q;  4OWX B;  1Y8P B;  4KK7 A;  4L6T B;  5IGD A;  4O42 A;  3ND9 A;  2Z6B A;  1VQA A;  1EIY B;  2VY3 A;  3VR6 A;  1YBY A;  3K5O A;  1NTG A;  2BOS A;  4X65 Q;  1PFS A;  2B2W A;  4X65 L;  4HCE A;  2K01 A;  5AJ3 L;  1S4Z A;  1YIJ A;  1LAC A;  4JW0 A;  3F8T A;  5FO8 B;  3FMC A;  3TZU A;  4C3I B;  1Z7T A;  1DGS A;  3FKI G;  3WOF A;  3OW2 A;  2Z1C A;  4DAV A;  2K5Q A;  4DUY L;  4IJL A;  5FKA C;  4AYB B;  1UE6 A;  2F0J A;  4I7A A;  2ZTE A;  4YWM A;  3SGI A;  3TRE A;  1SNM A;  3GV3 A;  1IZ6 A;  1F2Y A;  3K7A B;  2GN5 A;  4JOI C;  1JIC A;  2CH4 A;  4K5V A;  3PUX A;  4LFC L;  5COY A;  1BQQ T;  3T4A C;  1U0L A;  2UXD L;  1QVC A;  2YV5 A;  1YVC A;  5C5M A;  2AQ1 B;  4QGU A;  5AJ3 Q;  2BH8 A;  4UPA A;  4TVA B;  4P71 A;  1R9T B;  4K2K A;  4LUV A;  1CKN A;  2QF7 A;  3MA2 B;  2B8G A;  1FYC A;  4NXN Q;  2B29 A;  2CW0 C;  4DK3 C;  3I4M G;  1XWE A;  1XTC D;  1UEA B;  1E24 A;  1KAB A;  2SDF A;  4CJ1 B;  4LF7 L;  3H91 A;  2B2Y A;  3CCL A;  3J81 j;  5M3F H;  1D7Q A;  1HQR D;  4IQZ A;  1Y1W G;  5C4X G;  4A3F H;  3GO5 A;  4FXK C;  1EWH A;  4Q5V A;  2EJG C;  4R4Q A;  4A3L H;  1V1P A;  3P7J A;  5JEA J;  4A3C H;  4A3D H;  2HQE A;  1CKM A;  1D1K A;  1ZEQ X;  4IFD J;  1VF5 C;  2WP8 J;  2K04 A;  2HT1 A;  1WTH A;  1WTP A;  2KHJ A;  1BBW A;  5CR3 A;  1JB3 A;  1WD1 A;  4QIW B;  1FNV A;  3TQY A;  4OWT B;  4BBR H;  5AFW A;  1RDP D;  1Q3L A;  3CHB D;  3RLO A;  3KF6 B;  1KLU D;  4C2M H;  5DNF A;  4P2C B;  1LTB D;  1I6V C;  1SE3 A;  4IUQ A;  3OTO L;  4C3J B;  3TP5 A;  3CF5 A;  1V1P B;  3J81 i;  1LT3 D;  2L9H A;  3QB3 A;  4OEL B;  4YHH Q;  1JJ2 A;  2NYZ D;  5LL6 X;  1EIH A;  4X3U A;  2I5L X;  1VF7 A;  1VQF A;  1XPR A;  2R93 B;  4IZ8 A;  4KD4 A;  5ELB A;  4DR5 L;  1PRT F;  4DR6 Q;  5GAD C;  1E7Z A;  1HZB A;  1S3O A;  3S14 B;  1EYA A;  3S1Q H;  1SJE D;  2KHS A;  4H13 C;  4YIJ A;  2RDF A;  4X62 L;  1E2W A;  3HS0 C;  1TR5 A;  2ZJQ A;  2ICE C;  4XXE A;  4A3K B;  4CHT B;  5K36 G;  2KUM A;  5M9O A;  5IP7 H;  2WAC A;  2EYO A;  1WJJ A;  2MPM A;  1TWC H;  1HR0 W;  1OO9 B;  1K83 B;  2ZM6 L;  3S2D B;  4JI6 Q;  1CHQ D;  4UAI A;  1RF2 D;  3ULP A;  3I72 A;  1RD9 D;  4OON A;  3S1Q B;  3RZD B;  3E9I A;  1PDQ A;  2EYL A;  3SXH A;  4LF6 Q;  2CFM A;  1GKH A;  4A3K G;  1YNJ C;  3CRK C;  2D2C C;  2K32 A;  3U9S A;  1PFM A;  4HED A;  1WTR A;  1IW7 C;  2B8F A;  1HCZ A;  3M4Q A;  2K03 A;  3IAY A;  2JEA I;  5T1I A;  5JVH 3;  1SR3 A;  1Y69 U;  2R93 G;  2B39 A;  4GNX B;  3A5Z B;  3GQB A;  1PYB A;  3KYH C;  4QUF A;  1D5Z C;  2IX3 A;  3RLN A;  4IOA A;  1XXG A;  4B3M Q;  2F0W A;  5I2X A;  2C35 B;  4A4I A;  4DV6 L;  5IP7 G;  1YJ9 A;  1N9W A;  2Y0S E;  2NN6 I;  1Q1B A;  3KUP A;  1OXS C;  4QUC A;  2D9U A;  2CCZ A;  4MTN A;  1KDB A;  2E2D C;  3CCU A;  2B3G A;  5C4Z A;  3D0F A;  4DV3 L;  1G91 A;  1UEB A;  2CQA A;  1RJT A;  4BY7 B;  1STY A;  4OHJ A;  3J7A V;  1EOT A;  4I65 A;  5E1F A;  3ULJ A;  3GV6 A;  3PIP 3;  5DM6 3;  2VQE L;  4N8X 1;  1VQP A;  1VQH A;  1ONL A;  5D14 A;  1NR4 A;  4DGZ A;  1PFN A;  5M3M B;  1HZA A;  4LF5 Q;  2EYH A;  2NVT H;  3GTM H;  5IIF A;  1A2U A;  3S24 A;  4C3H B;  4RMF A;  1CUK A;  1SEB D;  1PTO C;  1SE4 A;  1GUG A;  2LFN A;  5JJZ A;  2MNA A;  1TU2 B;  2CWA A;  3A74 A;  1DOL A;  1EWC A;  4FDB A;  1PA6 A;  2VQF L;  1C9O A;  3DLL A;  5M5W B;  1KAA A;  2IW3 A;  2PQA B;  2M00 A;  1B2T A;  2KEN A;  5EKK A;  4A3B H;  5BR8 Q;  2QCP X;  1CKO A;  4BXX G;  3DM3 A;  1VQO A;  3S1M H;  5IY0 A;  5IP9 H;  3KDF B;  3MXP A;  4B9W A;  1DD2 A;  4X62 Q;  3CCJ A;  1Y1W B;  1SLJ A;  1II3 A;  2K5N A;  2PQE A;  3KJP A;  2J4X A;  2F3W A;  2A69 C;  5DAU A;  2FXQ A;  2AQ3 B;  1SYF A;  2PNR C;  3H94 A;  1HNX Q;  1IBK L;  4DU9 A;  2XN9 C;  3MFY A;  3OTO Q;  1NBW A;  3D31 A;  3Q22 A;  2Q8R E;  4A3J H;  4DV3 Q;  1ILP A;  1HUN A;  4E6I A;  1S72 A;  2R3Z A;  3ITP A;  2K52 A;  1MKH A;  3VYS A;  1C7Y A;  3K80 C;  4TRD A;  4P73 A;  1CM9 A;  4LUZ A;  3T1Y Q;  2A1A A;  4JYA Q;  1YNJ D;  4XTC S;  4X66 Q;  3DEP A;  4B3M L;  4ME3 A;  1YI2 A;  1Q46 A;  3MXN A;  1B1Z A;  1BOS A;  2I46 A;  1I6H B;  3F2C A;  4A3D G;  2MQH A;  3TZD A;  3M3Y H;  2A68 C;  4JI5 Q;  5C3E B;  1JJG A;  1Q82 C;  4R4I A;  4BY1 B;  3A56 A;  2R7Z B;  4GZY C;  4DR7 Q;  4R4O A;  4RHR A;  4GN3 B;  3HOZ B;  2UXC L;  3NQT A;  2I07 B;  4HJ5 A;  1Y1V H;  4A3J B;  1EIF A;  3ONA B;  4HTH A;  4CJ2 C;  1YEZ A;  1QCB D;  2E2J B;  4NB3 A;  4QF4 A;  4R9W A;  4DV7 Q;  1VDZ A;  1ICF B;  3QOL A;  3PF5 A;  2JA6 H;  1I50 H;  1RTN A;  2VUM G;  3AFQ A;  2OXP A;  5DLQ E;  1S5F D;  1TS5 A;  1SFO B;  1OXV A;  2QIL A;  1PTO D;  1Y8N B;  2KA7 A;  1A62 A;  4K14 A;  5CYU A;  3VYU A;  4JPB W;  1CQF A;  3RUZ A;  2MFI A;  4L5Q A;  2DY8 A;  2EJF C;  5JOB A;  3A7A B;  1VQ6 A;  5IYB G;  1O7Z A;  3TRZ A;  1PH4 A;  4ZRZ A;  3V96 A;  1DOM A;  1U4L A;  2Q2I A;  3D3R A;  4LF9 L;  1TS2 A;  2IHE A;  4QMG A;  4LFA Q;  4PZ8 A;  1J9O A;  1UUP A;  2A73 B;  1V1Q A;  3K0X A;  2G9D A;  2FMM A;  4DN4 M;  3CPF A;  1L1O B;  1G51 A;  3A54 A;  3I4L A;  5LMU Q;  3IFT A;  1GM5 A;  2M2L A;  3HOZ G;  1A63 A;  4BA2 I;  1CTM A;  3C1E A;  4A3I B;  1EEI D;  1H95 A;  5EKI A;  4LFB Q;  1KNA A;  3I70 A;  1HQM C;  3ZYY X;  4DUZ Q;  3I2Z A;  3B6Y A;  5GAE C;  3TP7 A;  2EOT A;  4A3E G;  1MJE A;  2GA4 B;  4JG2 A;  2ZJR A;  1XYI A;  3PO3 B;  4HJ7 A;  1U4M A;  5LMN W;  3VDY A;  1WOC A;  4HID A;  1SAP A;  3PIP A;  4P74 A;  2F0D A;  3HKZ B;  5LL6 S;  3BVZ A;  3J7A 5;  4FF1 A;  1G8Z D;  3HFZ B;  4K2L A;  3RNU A;  1AZQ A;  4PNY A;  1G6Z A;  1YNN D;  3NEN A;  3PIO 3;  3SK4 A;  4B3R Q;  1I94 L;  1BXT A;  2F0U A;  1GUO A;  4C56 C;  2RDG A;  1TWG B;  2EY2 A;  5C4J H;  1VQE A;  4EX5 A;  3KOJ A;  4PMW A;  3GTP H;  1EIG A;  2AUK A;  1JOK A;  4JI4 L;  2B2T C;  2RF4 A;  3M7N A;  5G3L D;  3HOY G;  3I4N B;  3S1R H;  3G7L A;  2X69 A;  2NVY H;  4A76 A;  1IBL Q;  3A8J E;  3CC7 A;  1PH3 A;  3NEL A;  4CDC C;  4N8F A;  1HTP A;  1U5K A;  2YTY A;  4ULL A;  4IUN A;  4A3G H;  4A3I H;  4GOP B;  1AW7 A;  4K8I A;  4JC0 A;  3EIV A;  4Y7N B;  2A6E C;  1EZ8 A;  4A3B B;  2X6G A;  4IUP A;  4M8A A;  1K28 A;  3NP8 A;  1F9S A;  4A3M H;  1F9P A;  3R8B A;  3U4V A;  3GTO H;  3C3L A;  1BDO A;  3U58 A;  2IX1 A;  2XRS D;  1BO0 A;  4ZCK A;  3RR5 A;  1LV9 A;  1W2B A;  4IAL A;  1VS0 A;  3PO2 H;  4RGO S;  2BDN A;  5EBC A;  3G48 A;  2ATW A;  3SK5 A;  2NVQ B;  4RGN A;  4LW1 A;  3GTM B;  4KY7 A;  1TWA H;  2LMC B;  5JVG 3;  1NY4 A;  3CCM A;  2A6E D;  4NXM Q;  2KCC A;  4XYO A;  4KI0 A;  1CA6 A;  3STB C;  1XNR Q;  2WAQ E;  4TKO B;  1HH2 P;  3I4N H;  3GTL B;  1VQM A;  1D1I A;  3AEV A;  2MJ8 A;  1YHQ A;  3NE5 B;  4X66 L;  1T9H A;  1X56 A;  5M5Y H;  1HR0 L;  1A3U A;  2KJX A;  5C5L A;  2F3I A;  5D3I B;  3HOU H;  2CW0 D;  3HGB A;  4ZKB B;  2HCI A;  5IOC A;  1KHI A;  1TQO A;  5CC4 A;  4HN7 A;  4G57 A;  2JYO A;  3VR5 A;  4I7Z C;  1EY4 A;  3TDQ A;  4C3I H;  1EY0 A;  1SRO A;  2VQF Q;  3K81 C;  4HIK A;  1EEF D;  4QQB X;  3LWU A;  2L15 A;  4KTA A;  3WDN A;  4DR3 L;  4OIK A;  5FLX c;  3HOY B;  4DV7 L;  1PH5 A;  3OIQ A;  5A2Q L;  4EQN A;  4OO1 I;  3OMC A;  3MXN B;  1ICW A;  4K8J A;  1RHP A;  2KOL A;  2RHQ B;  3FRP B;  5I2Y A;  3PMF A;  3ULL A;  1N34 L;  4LAA A;  4HR7 B;  3I90 A;  3P75 A;  1VQC A;  2E2H B;  2RA4 A;  2NVQ H;  4A93 G;  4UHV A;  2RCN A;  4QY7 A;  1EU3 A;  2L1B A;  1EQT A;  1KAW A;  1ENA A;  3PCO B;  1JWM D;  2A5H A;  1I4X A;  4HJ8 A;  1Y14 B;  5GQO A;  4GN4 B;  3E0E A;  2NTS A;  3Q23 A;  4KKS A;  5ELF A;  4A75 A;  1VQ5 A;  3OPO A;  3HKS A;  3I91 A;  5J39 A;  5LHY 1;  1PMR A;  1SBB B;  3PO3 G;  1HNW L;  4KJO A;  3VYR A;  5EPK A;  3S2D H;  1JT8 A;  5IWA L;  1K9M C;  1JWU D;  3J81 E;  1BF4 A;  4G7O C;  1LTI D;  3RZO B;  4DV6 Q;  4JBM A;  3F2D A;  4LF4 Q;  4CJ0 B;  4X64 Q;  3VR2 A;  2PMZ B;  2VZA A;  4ZQ3 A;  1QB5 D;  4AQY Q;  1QIL A;  1EY6 A;  4WJ4 A;  4UP8 A;  4PZ7 A;  4H0L C;  2WIN B;  3G71 A;  2QA4 A;  1TWF B; 
#chains in the Genus database with same CATH homology
 1HUM A;  3N52 A;  4H44 C;  4LK1 C;  2TSS A;  1H9R A;  2JEB I;  3LX0 A;  1BR9 A;  3QWN A;  1STG A;  4NP5 A;  4KHZ A;  1JC7 A;  1LTR D;  1PZK D;  3W2D A;  5K36 H;  5KGU A;  2BCO A;  2F0E A;  3H09 A;  3SDZ A;  4F88 A;  3OMG A;  4EGV A;  3NK9 A;  4RGT A;  3NBH A;  2F0T A;  1B50 A;  2PW7 A;  2JXM B;  2L5T A;  1CT1 D;  2JP1 A;  1SDF A;  5I6Y A;  3NTI A;  2EE1 A;  1EQV A;  3QJY A;  5JAV A;  4IUU A;  1JOQ A;  3EA6 A;  3W3A A;  1Y1V B;  3D6C A;  3BYT B;  3HOW B;  3V05 A;  1KDC A;  2F0G A;  3GTQ B;  1D6E C;  3M4O B;  4TSS A;  4ODG A;  4XQN A;  1G29 1;  3KBX A;  1I4R A;  4KMU C;  3K59 A;  2MUY A;  5FOB B;  5IT9 L;  5IGG A;  3SK6 A;  3FEW X;  3D8G A;  1EY5 A;  1LT5 D;  2OT2 A;  1X3P A;  2B2T A;  2A74 C;  3IKJ A;  2F0S A;  2DNC A;  1AFP A;  2Q8T A;  1DZ1 A;  4FXG C;  5K5P A;  5CV5 A;  5JPM C;  1WCM B;  4G4K A;  2F0H A;  5E4X A;  2NUC A;  4DAY A;  1R4P B;  5C6A A;  5IGF A;  3AU7 A;  4BS9 A;  3SK8 A;  2L0C A;  2F0F A;  1A2T A;  4M1U B;  3D4W A;  4K5W A;  1VCI A;  4FF4 A;  3BYY B;  2KED A;  3U9O A;  1B3A A;  1EZ6 A;  1E2V A;  1F77 A;  5EQ0 A;  1AEX A;  5C4J B;  3VA5 A;  1L0X B;  1MGS A;  5D3D A;  1ENF A;  3C1F A;  4XT1 B;  1ML0 D;  4KKT A;  2F0I A;  3H6M A;  3OOC A;  1S5E D;  3RD4 A;  4OGQ C;  3TP8 A;  1SMY C;  1TKW B;  3HP3 A;  1SND A;  2F0N A;  3E6Z X;  4G7H C;  4XYQ A;  4A3M B;  3IFD A;  1OXU A;  4CKC A;  1STB A;  4CKB A;  1ET6 A;  5NUC A;  2RVL A;  3NSW A;  2VNU D;  1IKL A;  4PMB A;  4KHV A;  2E2I B;  2F0Q A;  3NUC A;  3MC0 B;  4HAE A;  1LTS D;  2PZW A;  4N9P A;  3Q24 A;  4JK1 C;  5J1Z A;  4A93 B;  1FGB D;  3EVQ A;  5EPJ A;  5KYI A;  2C5C A;  2N88 A;  3CU7 A;  3K0Y A;  2R92 B;  2K33 A;  2LKV A;  1QNU A;  4G7Z C;  1GOZ A;  2IJ0 A;  1SNP A;  1LO5 D;  4OL7 A;  1QWY A;  3KLR A;  1ET9 A;  1EU4 A;  5C4H A;  1GHJ A;  5IOD A;  1WVL A;  4C2M B;  2B63 B;  2XNA C;  3DEO A;  1Z47 A;  5HUR A;  4R8I A;  2LS0 1;  5KYL A;  4J8Q A;  2SNS A;  1ILQ A;  3A7L A;  3H3V C;  1JR0 D;  4A3G B;  3VR3 A;  5KEE A;  1BCP F;  4NKL A;  1MD2 D;  5IGC A;  4ZUI A;  5CGK A;  1SYC A;  4KN7 C;  1CQV A;  2AUJ D;  4J1M A;  3GTG B;  1PTO F;  3URY A;  1EY9 A;  2YU9 B;  1PFB A;  5FK9 C;  4OO1 G;  2WII B;  5JEA G;  3NPP A;  5BN3 A;  1CHP D;  2EY6 A;  2KQ3 A;  1I4G A;  5DM7 3;  3HZX A;  1CA5 A;  4RAU C;  1D5M C;  1F9R A;  4N9T A;  4QCL A;  1STH A;  1HFG A;  1QNK A;  3MAQ A;  2F3V A;  4RHS A;  2D62 A;  3S17 B;  3UI2 A;  1K8O A;  1BCP B;  1B44 D;  1STA A;  1ESR A;  5CV7 A;  2DNE A;  1BCP D;  2K6A A;  4KN4 C;  1LLR D;  3SE0 A;  2QEJ C;  2F0K A;  1DYQ A;  1JCK B;  2L11 A;  2PO4 A;  2LY7 A;  4OO1 H;  1VMP A;  1DXM A;  1GJX A;  1F2M A;  5IT9 E;  5C3X A;  1SYD A;  3PUW A;  5D65 A;  4RCN A;  3F2U A;  3K57 A;  1BCP C;  3T51 B;  3V2T A;  3MFG A;  2ZXP A;  5EKL A;  1Y8O B;  5I4D A;  5TSS A;  2HDL A;  1I4P A;  4C1N K;  1F9Q A;  1X32 A;  1FNW A;  1TS3 A;  4U67 3;  5JEA H;  1S5D D;  3DM1 A;  1H9S B;  5BN5 A;  2ZXO A;  1JOR A;  4A3F B;  3BVG A;  1SYG A;  2BE5 D;  4HSP A;  1MI2 A;  5M3F B;  1HA6 A;  1EYC A;  4FYD A;  4KD3 A;  1DOK A;  3SHL A;  1SNO A;  2WKC A;  5CV6 A;  1XX8 A;  2XIW A;  5KIX A;  3PUY A;  3OWE B;  4BBR B;  3MEH A;  3T16 A;  3DWQ A;  1MSG A;  2K28 A;  4WRD A;  4ID6 A;  4TQU S;  2HUG A;  3K5L A;  5CV9 A;  1PZJ D;  4F8M A;  1LT4 D;  1JQY D;  3N6R A;  2B2Y C;  5C44 B;  4RCO A;  1I3Q B;  5EPL A;  1V43 A;  3DHQ A;  1B9M A;  1ZYR D;  3X3N A;  1WTW A;  3I73 A;  3J7Y W;  2Z4H A;  1SYB A;  4CKE A;  1M8A A;  2IX0 A;  1L0Y B;  1PTO H;  5COR A;  1EY7 A;  3DWA A;  4KKU A;  2EY1 A;  3LWE A;  1CK1 A;  2E74 C;  2FIN B;  1MSH A;  5FLX L;  2H4O A;  1NSN S;  1DCZ A;  3NTH A;  3GP7 A;  2M9V A;  2FHT A;  4DA2 A;  2Y0S B;  2O2L D;  3ERQ A;  3A8I E;  2EPB A;  5KND A;  1G2S A;  2ENB A;  4FVM A;  3L3O C;  2KEC A;  3I3C A;  2MGS A;  1OXT A;  2ICI A;  2HDM A;  1DON A;  4ZKC B;  3ND8 A;  1Q8I A;  3SVM A;  1GUS A;  3MTS A;  2VB2 X;  1Q90 A;  4ABN A;  2RDH A;  2DY7 A;  1Q1E A;  4V19 0;  2CHB D;  5BN4 A;  1QOH A;  2JE6 I;  1O78 A;  4WJW A;  4CBV A;  1A3T A;  1IYV A;  1R4Q B;  2EZV A;  1TWH B;  1F2L A;  3M7G A;  5C3W A;  3S1M B;  2R61 A;  1LTT D;  1ROD A;  1IKM A;  3M4Y A;  4FO2 A;  3ERO A;  3OHX C;  3AB9 A;  1W6K A;  5IGB A;  1YNN C;  2A6H C;  1KLG D;  3KK7 A;  1BNZ A;  1TY0 A;  3P20 A;  2JSO A;  1QG7 A;  1TT2 A;  1NUC A;  2NTT A;  1IYU A;  5M5X B;  2KVM A;  2K5W A;  3HOU B;  4HMI A;  1EFI D;  1ZYR C;  4DK0 A;  2K05 A;  3O13 A;  1KTK A;  4XQQ A;  5F2D A;  1LTA D;  3K5N A;  3E5S A;  1MBY A;  4K5X A;  1M4V A;  2EY5 A;  3PUZ A;  4BA1 I;  4L8J A;  1FNU A;  1T5E A;  3R3O A;  4MIU A;  1H9J A;  3R93 A;  2PCF B;  4KY5 A;  1D5X C;  1Z6H A;  2BA0 A;  3EFX D;  4ZAI A;  4FF2 A;  2L55 A;  3KF8 A;  1U4P A;  1W6J A;  5ELC A;  5E3F A;  5A35 A;  2PZT A;  3X3M A;  3T56 B;  5EJW A;  4LJZ C;  3Q6S A;  3FPU B;  3KBG A;  1IHZ A;  3CRL C;  1TY2 A;  1V1O A;  1PRT B;  1LAB A;  3R2T A;  1D2B A;  4NDX A;  4A3E B;  3MWY W;  2F0O A;  4C3J G;  2B2V C;  5I9P A;  1PRT D;  3BDO A;  4F7X A;  2ID0 A;  1PTO B;  3NWS A;  1CZG A;  1NR2 A;  1C8C A;  4J6H A;  3HOX B;  2XVS A;  4R8N A;  5ELD A;  4C1N I;  1B53 A;  3BDC A;  4XT3 B;  2B2U A;  4BWG B;  2RSO A;  2XRQ D;  1AN8 A;  4RA8 A;  1JOO A;  3QOJ A;  4ZUJ A;  4XDX A;  2FJ2 A;  2F0M A;  3D4D A;  2EYJ A;  4WFN 3;  3MXG A;  1Q12 A;  1HA5 A;  4DAP A;  1ENC A;  2A69 D;  2VXW A;  3E0J A;  1CFM A;  2OEO A;  4K6L A;  1ESF A;  2RSN A;  2MP1 A;  1WD0 A;  3OWF A;  2A6H D;  5KNC A;  3VA7 A;  4FP5 D;  3RLF A;  2IT1 A;  3BG3 A;  1CZW A;  2IL8 A;  3L7Z C;  2F0V A;  4U68 A;  2L4N A;  1VMC A;  5J22 A;  1OXX K;  4ZLT F;  1TVX A;  1HHV A;  4IUT A;  1H9K A;  5EBD A;  4RKL A;  1J8I A;  3C2P A;  4XIG S;  4ME5 A;  1S5C D;  2F0P A;  2A68 D;  5FO7 B;  3I4M B;  2VUM B;  2WV6 D;  2PW5 A;  2SEB D;  3DMU A;  1G2T A;  1V8Q A;  1FR3 A;  1I50 B;  2XSC A;  2KEE A;  3S15 B;  1F2Z A;  1SJH D;  1DM0 B;  2ZXR A;  3L9A X;  4X3T A;  5CV4 A;  4UDU C;  3KLS A;  1JWS D;  5CBA E;  2WAQ B;  1WTX A;  3MHB A;  4FNF A;  3FKI B;  4IFD I;  4A3D B;  4C3I G;  3BVM A;  4V0B A;  3DUZ A;  2O5I C;  2FMC A;  4ZYS A;  5IGE A;  2PYK A;  5C0X G;  2O5J C;  2JA5 B;  2B2V A;  3M3Y B;  1TS4 A;  3NQI A;  3S16 B;  5KNB A;  3J80 L;  4O1N A;  4Z9C B;  1WTV A;  3TSS A;  3K6O A;  1LT6 D;  2AQ2 B;  2J0T D;  2NB0 A;  2F1M A;  3GTP B;  3MZ5 A;  1GXD C;  2MHV A;  2PPB C;  2NVT B;  2BDO A;  2NZ1 D;  5C0X H;  2B2U C;  3NXW A;  2SNM A;  2IPK D;  2NWG A;  3OIP A;  4DFA A;  2EYF A;  2B2W C;  5FO9 B;  5I9O A;  3SR1 A;  4H7B A;  4X3S A;  4PV1 C;  4JBW A;  2EDG A;  1AZP A;  1UAP A;  3D6W A;  4RH6 A;  4RKB A;  4DF7 A;  3TME A;  2O4X A;  3S9W A;  4HCS A;  3K5M A;  3KLS X;  3C46 A;  4IN3 A;  3M85 A;  1IW7 D;  2SOB A;  1PLF A;  1O7L A;  1TWC B;  3NHH A;  3PUV A;  4QB4 A;  5FLX E;  1H9S A;  1FD7 D;  3SEB A;  5I6W A;  3GTO B;  1QE6 A;  4WOR A;  5ISR A;  1NAP A;  1AP0 A;  3BDL A;  1TII D;  3MVV A;  4S3S A;  4B08 A;  2VB3 X;  2Q8I B;  2K1B A;  2RKS A;  2D5D A;  4DNR B;  3JAM L;  3TN2 A;  3A55 A;  3NWT A;  2F0L A;  3BS1 A;  3J80 E;  2EXZ A;  3T53 B;  1LTG D;  5G3L F;  2EYM A;  4LMQ D;  4FF3 A;  2DN8 A;  3HRZ C;  1A3V A;  1DJR D;  3S1R B;  1O80 A;  4X3K A;  5CBE E;  2RQX A;  3R2I A;  2NVX B;  2AWN A;  1A6X A;  1STE A;  3K58 A;  3EQL C;  3NTK A;  3P1H A;  1BBX C;  2H1E A;  2N55 A;  4RWS C;  2WB1 B;  5M5Y B;  1BUV T;  3Q0A A;  1EL0 A;  3VYT A;  1SNQ A;  2JA7 B;  1SYE A;  4KY6 A;  2BA1 A;  4DXF A;  4BBS B;  1T5X D;  4RFB A;  1K8M A;  2QDB A;  3T13 A;  1U9R A;  1O7Y A;  2EJM A;  2PZU A;  3DXJ C;  3I8Z A;  3IL8 A;  1PYW D;  5T1G A;  4EQP A;  2JA8 B;  3RMH A;  2XWB B;  4DNT B;  3NBI A;  3A8K E;  4EQO A;  1C4Q A;  2TMP A;  2NN6 H;  1X3Q A;  4NW2 A;  3HEJ A;  1PXU A;  3H0G B;  4K6D A;  5ELE A;  3FPP A;  2K5D A;  1GUT A;  3LNN A;  1HTL D;  4ZK9 B;  1EYD A;  2NVY B;  1TWA B;  4PQX A;  4HSV A;  1HPC A;  1I4Q A;  5E4W C;  1WTQ A;  4F87 A;  4IUR A;  3MXU A;  3J7A F;  2CVR A;  3PO2 B;  3OSO A;  4B9X A;  4RGM A;  5JPN C;  1HFN A;  1IL8 A;  1H9M A;  1E2Z A;  1HRJ A;  1NCV A;  5CMD A;  2R6G A;  1S5B D;  2NN6 G;  2FFK B;  3PV0 A;  5HGT A;  2YYZ A;  3G6J B;  1STN A;  4CGY B;  1SE2 A;  1SXT A;  1RTO A;  5CV8 A;  3FVQ A;  1KDA A;  1SMY D;  3OW7 A;  2C9O A;  5C4X B;  2KCN A;  1A15 A;  2EVB A;  5C0X J;  1GHK A;  4HMJ A;  3QG1 A;  3FDT A;  2L12 A;  2AWO A;  2JA6 B;  3GTK B;  4XQJ A;  3CQZ B;  4MN3 A;  2V4D A;  2E75 C;  1UNS A;  4KJN A;  4OIJ A;  3HG9 A;  1B9N A;  5A2Q E;  4MHE A;  3EJI A;  2E76 C;  1GUN A;  1JE4 A;  3WOE A;  1CI3 M;  1RKN A;  2Z8L A;  3TP6 A;  2X6L A;  1B4O A;  4L63 B;  2WKD A;  4EVO A;  3JAM E;  1SSO A;  4PMC A;  3S2H B;  4IUV A;  4DXG A;  4IFD H;  3J81 L;  5KRU A;  2G9H D;  4C3H G;  2K7V A;  2EYP A;  2IWH A;  3TBI B;  1ZXT A;  2F4I A;  3GTJ B;  3VR4 A;  3QO2 A;  2Z4I A;  1ZKO A;  3QIA A;  2HCC A;  4NMZ A;  3D4R A;  2ZT9 C;  2NBF A;  3GD7 A;  1KNE A;  3S1N B;  2J7Z A;  4IFD G;  5DEH A;  1E0B A;  1U4R A;  3DWP A;  3BZD B;  3AMU A;  1SNC A;  1WTO A;  5C0X I;  1PRT C;  1EY8 A;  2OF1 A;  1I4H A;  4DK1 A;  2QKI C;  1HXY D;  4Q0F A;  1C48 A;  2BE5 C;  3HOV B;  1RCV D;  1PZI D;  4KV6 A;  5EGT A;  4FXD A;  3CKI B;  4ILW A;  1QJO A;  2RBM A;  2F03 A;  2XWJ B;  1Y8P B;  4KK7 A;  4L6T B;  5IGD A;  4O42 A;  3ND9 A;  3VR6 A;  3K5O A;  2BOS A;  2B2W A;  4HCE A;  2K01 A;  1S4Z A;  1LAC A;  5FO8 B;  3FMC A;  3TZU A;  4C3I B;  1Z7T A;  3WOF A;  2Z1C A;  4DAV A;  2K5Q A;  5FKA C;  4AYB B;  2F0J A;  1SNM A;  3GV3 A;  1F2Y A;  3K7A B;  1JIC A;  4K5V A;  3PUX A;  5COY A;  1BQQ T;  3T4A C;  5C5M A;  2AQ1 B;  1R9T B;  4K2K A;  2QF7 A;  3MA2 B;  2B8G A;  1FYC A;  2CW0 C;  1XWE A;  1XTC D;  1UEA B;  1KAB A;  2SDF A;  4CJ1 B;  3H91 A;  2B2Y A;  1HQR D;  4IQZ A;  3GO5 A;  4FXK C;  1EWH A;  4Q5V A;  2EJG C;  1V1P A;  3P7J A;  5JEA J;  2HQE A;  1D1K A;  1ZEQ X;  4IFD J;  1VF5 C;  2WP8 J;  2K04 A;  1WTP A;  5CR3 A;  1JB3 A;  1WD1 A;  4QIW B;  1FNV A;  5AFW A;  1RDP D;  1Q3L A;  3CHB D;  1KLU D;  5DNF A;  4P2C B;  1LTB D;  1I6V C;  1SE3 A;  4IUQ A;  4C3J B;  3TP5 A;  1V1P B;  1LT3 D;  2L9H A;  3QB3 A;  2NYZ D;  5LL6 X;  1EIH A;  4X3U A;  1VF7 A;  2R93 B;  4IZ8 A;  4KD4 A;  5ELB A;  1PRT F;  3S14 B;  1EYA A;  1SJE D;  2KHS A;  4H13 C;  4YIJ A;  2RDF A;  1E2W A;  3HS0 C;  1TR5 A;  2ICE C;  4XXE A;  4A3K B;  4CHT B;  5K36 G;  2KUM A;  5M9O A;  2WAC A;  2EYO A;  2MPM A;  1OO9 B;  1K83 B;  3S2D B;  1CHQ D;  4UAI A;  1RF2 D;  3I72 A;  1RD9 D;  3S1Q B;  3RZD B;  1PDQ A;  2EYL A;  3SXH A;  1YNJ C;  3CRK C;  2D2C C;  2K32 A;  3U9S A;  1PFM A;  4HED A;  1WTR A;  1IW7 C;  2B8F A;  1HCZ A;  2K03 A;  3IAY A;  2JEA I;  5T1I A;  5JVH 3;  1Y69 U;  2B39 A;  3GQB A;  4QUF A;  1D5Z C;  2IX3 A;  1XXG A;  2F0W A;  5I2X A;  2NN6 I;  1Q1B A;  3KUP A;  1OXS C;  4QUC A;  2D9U A;  1KDB A;  2E2D C;  5C4Z A;  1G91 A;  2CQA A;  1RJT A;  4BY7 B;  1STY A;  4OHJ A;  3J7A V;  1EOT A;  4I65 A;  5E1F A;  3GV6 A;  3PIP 3;  5DM6 3;  1ONL A;  5D14 A;  1NR4 A;  4DGZ A;  1PFN A;  5M3M B;  2EYH A;  5IIF A;  1A2U A;  4C3H B;  1SEB D;  1PTO C;  1SE4 A;  1GUG A;  2LFN A;  5JJZ A;  1TU2 B;  1DOL A;  1EWC A;  5M5W B;  1KAA A;  2IW3 A;  2M00 A;  1B2T A;  5EKK A;  2QCP X;  3MXP A;  4B9W A;  1DD2 A;  1Y1W B;  1II3 A;  2PQE A;  2J4X A;  2F3W A;  2A69 C;  5DAU A;  2AQ3 B;  1SYF A;  2PNR C;  3H94 A;  4DU9 A;  2XN9 C;  3MFY A;  3D31 A;  3Q22 A;  2Q8R E;  1ILP A;  1HUN A;  4E6I A;  2R3Z A;  3ITP A;  3VYS A;  4TRD A;  1CM9 A;  1YNJ D;  4XTC S;  3DEP A;  3MXN A;  1B1Z A;  1BOS A;  2I46 A;  1I6H B;  3TZD A;  2A68 C;  5C3E B;  4BY1 B;  3A56 A;  2R7Z B;  4GZY C;  4RHR A;  3HOZ B;  3NQT A;  2I07 B;  4A3J B;  3ONA B;  4HTH A;  4CJ2 C;  1QCB D;  2E2J B;  4QF4 A;  4R9W A;  1VDZ A;  3QOL A;  1RTN A;  2OXP A;  1S5F D;  1TS5 A;  1SFO B;  1OXV A;  2QIL A;  1PTO D;  1Y8N B;  2KA7 A;  4K14 A;  5CYU A;  3VYU A;  1CQF A;  3RUZ A;  2DY8 A;  2EJF C;  5JOB A;  3A7A B;  1O7Z A;  4ZRZ A;  3V96 A;  1DOM A;  1U4L A;  3D3R A;  1TS2 A;  4QMG A;  1J9O A;  1UUP A;  2A73 B;  2G9D A;  2FMM A;  4DN4 M;  3A54 A;  3I4L A;  3IFT A;  2M2L A;  4BA2 I;  1CTM A;  3C1E A;  4A3I B;  1EEI D;  5EKI A;  1KNA A;  3I70 A;  1HQM C;  3ZYY X;  3TP7 A;  2EOT A;  2GA4 B;  1XYI A;  3PO3 B;  1U4M A;  1SAP A;  2F0D A;  3HKZ B;  5LL6 S;  3BVZ A;  4FF1 A;  1G8Z D;  4K2L A;  1AZQ A;  4PNY A;  1G6Z A;  1YNN D;  3PIO 3;  3SK4 A;  1BXT A;  2F0U A;  1GUO A;  4C56 C;  2RDG A;  1TWG B;  2EY2 A;  4PMW A;  1EIG A;  2AUK A;  1JOK A;  2B2T C;  3M7N A;  5G3L D;  3I4N B;  3G7L A;  2X69 A;  3A8J E;  1HTP A;  4ULL A;  4IUN A;  1AW7 A;  4K8I A;  4Y7N B;  2A6E C;  1EZ8 A;  4A3B B;  2X6G A;  4IUP A;  4M8A A;  3NP8 A;  1F9S A;  1F9P A;  3R8B A;  3C3L A;  1BDO A;  2IX1 A;  2XRS D;  1BO0 A;  1LV9 A;  4IAL A;  4RGO S;  2BDN A;  5EBC A;  3SK5 A;  2NVQ B;  4RGN A;  3GTM B;  4KY7 A;  5JVG 3;  2LMC B;  2A6E D;  2KCC A;  4XYO A;  4KI0 A;  1CA6 A;  4TKO B;  3GTL B;  1D1I A;  2MJ8 A;  3NE5 B;  1A3U A;  2KJX A;  5C5L A;  5D3I B;  2CW0 D;  3HGB A;  4ZKB B;  2HCI A;  5IOC A;  1TQO A;  5CC4 A;  4HN7 A;  4G57 A;  2JYO A;  3VR5 A;  4I7Z C;  1EY4 A;  3TDQ A;  1EY0 A;  1EEF D;  3LWU A;  4KTA A;  3WDN A;  4OIK A;  3HOY B;  3OIQ A;  5A2Q L;  4EQN A;  4OO1 I;  3OMC A;  1ICW A;  4K8J A;  1RHP A;  2KOL A;  5I2Y A;  3FRP B;  3PMF A;  4LAA A;  4HR7 B;  3I90 A;  3P75 A;  2E2H B;  2RA4 A;  1EU3 A;  2L1B A;  1EQT A;  1ENA A;  1JWM D;  2A5H A;  1I4X A;  2NTS A;  3Q23 A;  4KKS A;  5ELF A;  3OPO A;  3I91 A;  5J39 A;  5LHY 1;  1PMR A;  1SBB B;  4KJO A;  3VYR A;  5EPK A;  1JWU D;  3J81 E;  1BF4 A;  4G7O C;  1LTI D;  3RZO B;  4CJ0 B;  3VR2 A;  2PMZ B;  4ZQ3 A;  1QB5 D;  1QIL A;  1EY6 A;  4H0L C;  2WIN B;  1GUW A;  1TWF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...