3I3CA

Crystal structural of cbx5 chromo shadow domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
60
structure length
57
Chain Sequence
NDIARGFERGLEPEKIIGATDDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structural of CBX5 Chromo Shadow Domain
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Chromobox protein homolog 5
total genus 13
structure length 57
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3i3cA00
2H1EA 4X3SA 2CVRA 4ZKCB 1RJTA 2VXWA 1WD0A 3DM1A 2B2TA 4R9WA 1WTQA 4ZLTF 1G91A 2KEDA 2SDFA 1QG7A 1QNKA 1SSOA 3GV3A 5AFWA 3IL8A 1ILPA 4ZK9B 1G2TA 2DY8A 1Q3LA 2FFKB 5EQ0A 1WTRA 2FMMA 4O42A 1O80A 1PLFA 1E0BA 1HUMA 1F9QA 2NWGA 4RA8A 1IL8A 2RA4A 5JJZA 1AZPA 4ZKBB 1BF4A 2MJ8A 2B2WC 2M2LA 1JE4A 1EIHA 2KEEA 4OIJA 1WTPA 1RHPA 2KOLA 5T1GA 3Q6SA 1U4LA 2HDMA 2K03A 4CJ1B 3TZDA 1EL0A 4HCSA 1CM9A 2RSNA 4X3TA 2JYOA 4XT3B 1WD1A 5D65A 1G2SA 3UI2A 1S4ZA 1DOLA 5EPJA 4UAIA 3P7JA 1PFNA 2EE1A 1F9RA 2B2VC 1RODA 2HUGA 3ONAB 4IURA 4QUCA 2Q8TA 3TN2A 5CBEE 5CMDA 2NYZD 5EPKA 4OIKA 2Q8RE 2J7ZA 1MSHA 2B2YA 1ZXTA 4IUUA 1XYIA 1AP0A 1BBXC 1F2LA 1X3QA 5T1IA 2B2TC 1HRJA 1X3PA 1PFMA 3IFDA 2DY7A 1HA6A 1O7YA 3F2UA 3HP3A 2FJ2A 1CA5A 2MPMA 1F9PA 4LMQD 1NR4A 1WVLA 3H91A 1SAPA 2B2UA 3I90A 1PDQA 3QO2A 4IUVA 1DONA 3I91A 1WTWA 2HDLA 5CBAE 1X32A 2MGSA 2BDNA 2B2WA 2K28A 1EQTA 3GV6A 1HFNA 2R3ZA 1U4PA 1ILQA 1KNEA 2HCCA 1DOKA 1XX8A 5CORA 2K1BA 4CJ0B 3LWEA 5EKIA 4IUTA 2RSOA 2MP1A 5EPLA 4HEDA 3D6WA 1HUNA 1WTXA 2D9UA 2EPBA 2X6LA 1KNAA 4R8IA 2IL8A 2HCIA 2JP1A 1MI2A 2KVMA 3G7LA 1B50A 4MN3A 1SDFA 4RAUC 2RVLA 3FPUB 4IUPA 5DNFA 1VMPA 4U68A 1JICA 2XIWA 1MSGA 2N88A 1F9SA 2K04A 1VMCA 1M8AA 2KECA 2B2VA 2NZ1D 2X6GA 1O7ZA 3I8ZA 1B3AA 2K01A 1EIGA 4MHEA 2L4NA 1WTOA 1J9OA 4HAEA 1J8IA 1RTOA 1RTNA 2B2YC 3MWYW 4X3UA 2L9HA 1DOMA 3DEPA 1ICWA 1QE6A 1AZQA 1ESRA 1NCVA 2L1BA 5D14A 1BNZA 1G6ZA 5EJWA 3KUPA 4XT1B 2X69A 4DN4M 4NW2A 4QUFA 3FDTA 3N52A 2FINB 1B4OA 1C8CA 1B2TA 4RWSC 1NR2A 1NAPA 4IUQA 5COYA 5E4XA 4CJ2C 1IKLA 3SVMA 1EOTA 2L12A 4HSVA 1PFBA 1U4MA 1WTVA 3DEOA 1TVXA 1A15A 3MTSA 1HFGA 4ZAIA 1LV9A 1DZ1A 2KUMA 3R93A 1ML0D 2L11A 2EOTA 1MGSA 1CA6A 1B53A 2FHTA 2K05A 1BO0A 4X3KA 2N55A 4XDXA 1U4RA 3KBXA 1GUWA 1HHVA 5E4WC 3I3CA 1IKMA 2B2UC
chains in the Genus database with same CATH superfamily
2EY1A 1TR5A 4M8AA 2YTXA 1TXYA 3DM1A 2MNAA 4DR1L 4OO1I 3URYA 4A3LH 2B63G 2DY8A 2WAQB 1PLFA 3DWQA 3PO3B 2QDLA 4OO1H 4LNQA 3S14B 3HOYB 4HCSA 3UE1A 1SNPA 1PZID 2EY5A 4CKBA 4AYBE 4XQJA 3RN2A 4OWWB 2AMCB 2NYZD 3EA6A 4R1JA 1BUVT 3H0GB 4JW0A 5C0XG 1ZXTA 1TIID 4IALA 4DK1A 3A56A 5CV5A 4X64Q 1B9NA 1HRJA 2JJQA 1L2FA 1CA5A 3U50C 3M3YH 2OWOA 3SE0A 4V0BA 1JOKA 4B08A 1X65A 1YZ6A 1PDQA 4UPAA 1B1ZA 2JK8A 2I5HA 3NBHA 4C2MH 4FNFA 1X32A 3S16H 2NBFA 2IHFA 3GTQH 1B3QA 1J6QA 4A3BB 2K32A 1HFNA 3D31A 1LTBD 3FMCA 1QB5D 4IZ8A 4RCOA 2R7ZB 1S5ED 4DXGA 3CC4A 4DUZL 1WTXA 2D9UA 1EIYB 4DV5L 2HCIA 1XNQQ 3KFUA 2UUCL 2K04A 1XNQL 4RG1A 4LFCL 4C3JB 1X9NA 4O1NA 2L4NA 2BA1A 4JPBW 5M3MB 4O2DA 4POGA 2F0DA 4KTAA 1VQFA 3MAQA 4B9WA 3PIOA 1S5FD 4RGTA 2XTIA 3HKZB 1FNUA 2R92H 2Z4IA 2KJXA 4A3GB 4P2CB 5IGGA 3PIO3 1JMCA 2ASBA 3TBIB 4BXXG 2R92G 5JJIA 1X3EA 4BBRB 4X64L 3I70A 1AE3A 5EAYA 3DUZA 4X3KA 3VR3A 2OQ0A 2CWPA 3SK5A 3MXNB 1D7QA 3NENA 3KJOA 1VQPA 4ZK9B 4GNXA 1E0BA 1EFID 3CQZB 3K5OA 2HIXA 5CV7A 2ZJRA 2IX1A 2Z6KA 2JA6B 3H09A 1UUPA 5EGTA 4KHVA 3TSSA 2F0QA 1JT8A 3KOJA 1X3GA 4BBRG 1SMYD 3I7FA 5GAHC 3H94A 1VQMA 3S1MH 2JA6G 2JYOA 1KXLA 3UI2A 1VQJA 1KAWA 1GOZA 1QVCA 1F9RA 1UWVA 2CQAA 2R93H 5EPKA 1KL9A 1RKNA 4B3SQ 1N32L 5C4JH 4ALPA 2QEJC 2IPKD 2EJGC 3NWSA 5C44B 3S14H 1I5FA 4K8IA 2EIFA 4KD3A 4FP5D 1HA6A 1O7YA 3W2DA 3HP3A 1FVIA 2Y0SB 5LL6S 2O2LD 3BDCA 3P75A 1VQ4A 2NN6G 2Z0SA 1PRTC 4NP5A 1L1OB 2OCEA 5CBAE 4A3JG 1QJOA 5IOCA 3IRBA 1Q82C 4JK1C 2NVYB 1SROA 2KCNA 5ISRA 3D3RA 1IXRA 4I7AA 3E6ZX 2WP8J 4P73A 1JC7A 2F1MA 4DAYA 4DNIA 1N33Q 4K5WA 1YNND 4C2MB 1LTTD 5I2YA 4BBSG 3F2DA 1LTGD 1HNZL 4A3FH 2F0WA 1E1TA 2IT1A 2X6GA 3VYRA 1LO5D 2E76C 5DM73 2VNUD 1T5XD 3HFZB 1J9OA 4QQBX 4A3LG 1WJJA 1R9TH 3S1QB 3EROA 4A3IB 3HRZC 3K7AB 4DUYL 2YU9B 1XNRQ 4GS3A 5C0XH 3N52A 1LTID 3V2TA 4DNTB 1C8CA 3VR6A 3CMAA 3PSIA 2GVBA 4BS9A 4J6HA 1A15A 4GKKL 1OXSC 2ZJQA 3R93A 4BA1I 3GTPB 2F0IA 3RN5A 5IE8A 1GUWA 5I6WA 4YCVA 3HOXB 3S1RH 2LKVA 1WTQA 4JI6Q 3PO3H 1Q3LA 1WOCA 3DM3A 2F4VQ 3CU7A 4X66L 1K0RA 1NMGA 3ER0A 3CRLC 4LF8Q 1IL8A 1SNCA 2RA4A 5M5XH 4LFCQ 1IYUA 5JAVA 4FF3A 4JI7Q 1X56A 4ZUIA 2JA7G 3H0GH 4J1MA 1AH9A 2XVSA 5AJ3Q 1I4XA 4IUNA 4HIDA 1MSHA 4BY7B 1XYIA 1PV4A 3J81i 4TKOB 2WINB 1FYCA 2KHSA 4C3HG 4LMQD 2A68D 3FRPB 1VQBA 3T16A 2F3WA 1T9HA 1WTWA 3DMUA 2BH8A 1A63A 4KHZA 4CKEA 2TMPA 5FLMG 3OMGA 4A3KH 1SNOA 3F2BA 4YY3Q 5ELFA 4B9XA 2RCNA 4P72A 1E22A 2NZHA 1L1OA 3BVMA 4DR3Q 1XTDA 5JJKA 1MI2A 1QVFA 1TT2A 1UAPA 3CCLA 1D1KA 5EKKA 2Q8IB 1GUNA 2KECA 1TWAB 5EBDA 3BS1A 4RCNA 2E8GA 3E3XA 1WTOA 3D6CA 5M3FB 2K50A 4K6LA 1JWUD 2ZM6Q 1PH2A 4HJ9A 5EJWA 1V1OA 2G5DA 1AEXA 2LMCB 3HOWH 4BY7G 4NW2A 5IYBG 1VQ7A 4QUFA 4JBJA 1P16A 3K58A 1OXVA 4LFAQ 3K81C 1EY5A 2OEOA 2RCFA 1RIPA 3NBIA 4CJ2C 2A69C 3NUCA 2L12A 1J5EQ 4PZ8A 3MTSA 4E6IA 4L5TA 2PNHA 1LTRD 3LGJA 2UXCL 5C4XG 2AUKA 2B2UC 4N8FA 1N9WA 4UP8A 2AQ3B 1T5EA 3BU2A 2WB1B 2Q2TA 5M5YB 1VQ5A 3M4OH 2FMMA 1HJPA 2K5QA 1E3PA 1CUKA 1SE8A 3K80C 4MNOA 4ZKBB 3SDZA 1ET9A 3PIP3 1QZHA 2KOLA 2J4XA 2QEXA 1YNJC 2Z1CA 4CKCA 3GTLH 1K28A 2Z6BA 1OO9B 1G2SA 4B3RQ 5CV4A 2QDBA 3STBD 1SYFA 2A8VA 1TWFB 1FD7D 5HY6A 2D5DA 1Q90A 4ABNA 4APVA 1CQVA 2Z4HA 1XPOA 4KKSA 2JE6I 2JA7H 3LWUA 1AN8A 2K5DA 4K14A 1QUQB 2UXDQ 4DR4L 4JVZA 5IYCH 4GN5A 1YNXA 1UE1A 2I0QA 3CD6A 3GQBA 4FVMA 4QIWB 3B6YA 2DGYA 3PCOB 3MFYA 3VYTA 1EWHA 1YHAA 3NTHA 3I4MG 2RQXA 1SXTA 1FR3A 2R7FA 3KF8A 3FKIH 2JEBI 3T1HL 2G9HD 3KF8B 2IL8A 2LSSA 3TZUA 3HGBA 4HJ7A 1IZ6A 3OHXC 3ULJA 4U68A 1QOHA 1K8AC 1VQIA 2IW3A 3OW7A 1SYBA 4DAYB 1WYDA 5BR8Q 1D5MC 4XYQA 1Y1WB 4HAEA 1MJEA 3EN2A 4GKJL 1STGA 1ZEQX 4BY1G 3G48A 5E3FA 1STYA 1ZYRC 2A19A 5IWAL 1EIFA 4JI4Q 2H5XA 4PMWA 3FPPA 3LX0A 4WJ3M 3CKIB 2PZWA 4A3BH 4LUZA 1LV9A 4R4IA 2MQHA 1PH5A 1O7LA 1SJHD 5M9OA 5JVH3 1QUQA 4A3EG 1U4RA 4LFBL 2AQ1B 3D4RA 3I4MH 1SYDA 4JV5L 1KAAA 4Z9CB 3PIPA 2K7VA 2Z6KC 1E24A 2DJGC 1GUOA 2Y0SG 3C1FA 1KABA 1VDZA 3WOEA 3CF5A 4JI2Q 2D62A 2KEEA 3QR8A 1B7YB 4X3TA 3EFXD 1PRTB 4U673 4YHHQ 3CXCA 4YWLA 3G4SA 1GHJA 3OIPA 4JI1L 5G3LD 4DR3L 1RCVD 2N49A 1KTKA 2PI2A 4DR7L 1K8MA 4OX9Q 1WI5A 1HNXL 1HZBA 2B2YA 1VQ6A 5IY0A 4DV0Q 2ZXRA 2EXZA 3GTGB 1X3QA 4JI3L 4Y7NB 3Q24A 4I7ZC 2L15A 1TY2A 3IFDA 1C9OA 4H44C 3TQYA 1ASYA 4ZUJA 2MO0A 4QY7A 1DONA 2F03A 3I91A 5HGQA 1ONLA 5EBCA 3NHHA 2BCOA 3J7A5 5KRUA 1TWGB 3ITPA 3BDOA 3T56B 2F0NA 4DV6Q 3GO5A 1EY9A 3LWEA 3TP7A 5GROA 2CWAA 3Q23A 1X54A 2E75C 1ICFB 1Q1BA 4A3MH 4LAAA 5IT9E 4DV2Q 1SJED 3CCMA 5JOBA 3I4NB 3PUVA 4MTKA 5DNFA 3RMHA 1TQOA 3K5MA 2XIWA 5FO8B 4K5VA 1VMCA 5ELNA 3GDEA 5E7NA 4EQPA 3MXGA 5CR3A 3MWYW 2L9HA 1K83B 1JWMD 4CDCC 2F0OA 2O5IC 1SE2A 2IJ0A 3SK6A 5C44H 2E5LL 1E7ZA 5C3EG 1SNDA 3OTOL 2VS1A 1UEAB 1STAA 1B4OA 5JEAJ 1Q7YC 2DJFC 3CW2C 3I4NG 3D0FA 3G6EA 2F3IA 4FYDA 3PUZA 4A3DB 1XMOL 4A3JB 3E5SA 3NWTA 4OWTB 2YTYA 2HQLA 4NPSA 1IL2A 3I56A 2H1EA 5FK9C 1L0XB 1V8QA 4DUYQ 4L5SA 2MUYA 5AFWA 4JI1Q 4DU9A 4HIKA 1V1QA 1AW7A 4JI8Q 5EQ0A 3FHWA 4FF1A 3NTIA 3J80L 2UXCQ 4BY1H 3RZDH 2EY2A 2EYLA 2GVAA 1EWCA 1G8ZD 1HTPA 3NK9A 3Q6SA 1H9MA 1H9SB 5EKLA 4DGZA 4OL7A 4XT3B 3OWEB 3GTMH 4IFDH 3P7JA 4ZYSA 5LL6X 4EQOA 5LHY1 4GLAC 3HKZG 1XJVA 5K5PA 1U5KA 4UHVA 3M4QA 1Q8IA 1JCKB 5I4DA 4A93G 1BDOA 4IUUA 1CHPD 2ZM6L 1C4QA 4PV1C 4LK1C 1PFMA 1XPRA 3GTPH 3NPPA 1Y14B 1WVLA 3A7LA 3I90A 4YWKA 2VY3A 3S1RB 2C9OA 2PQAA 1B44D 2WV6D 4GN4B 2R3ZA 2HCCA 3GTOB 4A3EB 1KLUD 5C5LA 2PQEA 3W1GA 3I2ZA 4DR5Q 5EPLA 3P20A 1ET6A 3PMFA 3JAME 3FKIG 4CGYB 5A2QL 5CV6A 3SK8A 3SEBA 1CT1D 1VQ8A 2NVXB 1TWGH 2XWBB 4IJLA 1PTOH 1K73C 2UUBL 1YHBA 4IPCA 1Y1VH 3HZXA 2K01A 2OT2A 4R4QA 4BY7H 2Z8LA 2IX0A 5JPMC 1G291 3S1MB 2F0GA 4OONA 2R93G 4HIMA 5JJLA 2V1CC 3I4NH 2ICEC 2BE5D 1Z7TA 2JSOA 5E4XA 1I4QA 1PH3A 1CKNA 3DEOA 2R61A 1FGBD 3PUWA 2KUMA 3V96A 4AQYL 1TWFH 3D4WA 1XMQQ 4X66Q 3HOUG 1Q86C 3KBXA 1HZ9A 4OELB 3ZYYX 1DXMA 2KEDA 1A0IA 1EY8A 1QG7A 1TWCB 5KNDA 5E1FA 3T1YL 3MXUA 2FFKB 3S15B 1WCMG 2PNRC 3H0GG 5IGBA 1F9QA 3HOVB 1SE4A 3BZKA 3M4YA 3K0YA 4AQYQ 2F0KA 1WCMB 3EJIA 3KJPA 3ND8A 2KCCA 4ZRZA 1PH7A 2K5NA 2LS01 4QMGA 1VQEA 4A3FB 2E2HB 4LF5Q 2HUGA 4QUCA 2Q8TA 3PQIA 2VUMB 3GTGH 1LTLA 3H3VI 4BY1B 4UP7A 4DV1Q 5D3DA 2N8NA 3K7AH 3ND9A 1NJIC 4IOCA 1N34L 4RGNA 3M4PA 1K9MC 1EYCA 3H91A 2N3SA 1LYLA 2QKIC 1GD7A 4OHJA 4PNYA 4A3MG 2QA4A 2MO1A 1N33L 3DWAA 4DA2A 2NN6H 4KY5A 3RLFA 3GV6A 4X6AH 2KHJA 1KNEA 4DV0L 1QZGA 1IBKL 1I94Q 2Z9HA 4JC0A 3QJYA 1ASZA 1XXGA 1X6OA 2PMZB 3PO2B 3TDQA 2BH2A 1G6PA 3W5OA 4R8IA 1EYDA 3AU7A 1ESFA 3QB3A 1B50A 1CSPA 5C5MA 2RVLA 1WTHA 5IIFA 1Z47A 3GTJB 2A1AA 1STNA 3S2DH 1IBLL 4L63B 1CZGA 5C6AA 1IBMQ 3A7AB 1TWHB 4JCVE 5IGCA 3H6MA 4ME5A 3L7ZC 1EIGA 1H9JA 3E0JA 4HSPA 4GNXC 3DEPA 2B39A 1FL0A 1PRTF 1YJNA 1IBKQ 1C0AA 5D3IB 4F8MA 4JI0Q 1Z9FA 2FINB 4F87A 1YITA 4RWSC 3MXPA 1NMFA 1HNWQ 3JAMi 3T4AC 1EZ8A 2K5VA 1DZ1A 3T53B 2K05A 2E2DC 3C46A 1GXDC 2K4KA 5E4WC 3J7ZC 1EY7A 5AJ3L 1RJTA 2Q2UA 3VR4A 4Y7NH 1TY0A 4A3KB 1HR0W 2WKCA 4LF5L 3IL8A 3ULPA 3RZDB 1G2TA 2RDFA 4V190 2D0PA 2XN9C 1WTRA 3MHBA 5LMNQ 4IFDG 2NWGA 2VB3X 4N9TA 1JJCB 1EY4A 2F0VA 5ELBA 2M2LA 2NTTA 1YJ9A 3TMEA 2D0OA 5FJ8G 1CM9A 2RSNA 4ZCKA 1S4ZA 3K5NA 1YNNC 1STBA 1TWAH 1SYEA 5KIXA 1RODA 3RR5A 4LF4Q 3S15H 5CBEE 3S16B 2PO4A 5C3XA 1LTAD 3S1NH 1C7YA 2R93B 3KLWA 5A35A 1ENFA 4KKUA 4A93H 1PTOF 2NVQB 3BDLA 1EUJA 1BR9A 4DR6L 1K83H 4EQ5A 2EDGA 4NXML 3BVZA 5TSSA 2V4DA 5HGTA 3HOUH 1KRSA 1YEZA 4IN3A 4H13C 4LJZC 1ILQA 1U4PA 2PI2E 4L5RC 1EYAA 1K3BC 3FP9A 2EQSA 4DV6L 4B3ML 5LMUL 2RDGA 2EPBA 4FXGC 1KNAA 1Q81C 1JJ2A 1H9KA 1F2ZA 2FXQA 4A3DH 4MN3A 2CKZB 1JORA 3KK7A 1VF5C 1Y1VB 3K5LA 4HCEA 2EY6A 2R6GA 2XGTA 5C4XB 2LXJA 4JI3Q 4J8QA 4K8JA 1DOMA 3HOZH 3OYYA 1ESRA 2JA8B 1HNXQ 2FMCA 1HQRD 3NTKA 3A74A 2X69A 4C1NI 1D1IA 2ZJPA 1LABA 3A8JE 3FDTA 3NEMA 4A76A 1FJGQ 4AYBG 1JOQA 3AFPA 1EU4A 1PTOC 3IFTA 1B2TA 5IYBH 2NN6I 4HMJA 1WFQA 5IGDA 2A69D 1KRTA 3KDFA 1GHKA 1B8AA 3MVVA 4N8X1 1RL2A 4RKBA 1Y8OB 2FHTA 1HNWL 1PHJA 4YIJA 2PCFB 1KLGD 3SXHA 2J0TD 4X3SA 2CVRA 1SFOB 3C3LA 1ILPA 4RMFA 4LFBQ 1RDPD 4FO2A 3MXNA 5GQOA 3S17B 3HOWB 1RHPA 2E2HH 4KMUC 1EL0A 4C3IG 1EY0A 1VQKA 1SNMA 2VUMH 5J39A 1DOLA 5M3FG 4X65Q 2KHIA 3ONAB 2ZTCA 1JB3A 2J7ZA 5I6YA 2BA0A 4HIOA 4GKJQ 1IHZA 1I6HH 2F0FA 4LF7Q 4GLXA 4YY3L 1M1KC 5BR8L 2DUDA 3M7GA 1CKOA 5IT9L 5KNCA 1NR4A 3RZOH 2PZUA 3QO2A 1EQVA 2EYFA 3AEVA 1N34Q 2B2WA 2EXDA 3BVGA 3S1NB 2E2IB 1SMXA 4N9PA 2XRSD 4KN4C 3AB9A 4WRDA 4QL5A 4LF6Q 2NVQH 1XPUA 3JAMc 3IAYA 2JP1A 3G7LA 4GKKQ 2B29A 3HOVG 1BBUA 2O4XA 1TWHH 2ZTEA 1JICA 3RLOA 2HHHL 2L0CA 2N88A 3QIAA 3Q0AA 3HOUB 1M8AA 2JXMB 4DR4Q 1YVCA 4F88A 4IPHA 1Y8PB 1J8IA 1Q1EA 1B70B 1PFSA 5GAEC 4LF6L 1ICWA 2QW7A 5IYDG 4ULLA 3CHBD 4K5XA 4DN4M 3S2HH 4LF9Q 5IYDH 1MIUA 4GOPA 4QIWE 3I55A 1U0LA 1GO3E 5LMNW 5J1ZA 5FOBB 4G7OC 4DAMA 3MA2B 5F2DA 4IUQA 1BQQT 2EYMA 1U4MA 1S3OA 1SMYC 1VF7A 4ZAIA 5BN3A 2JA8H 1B53A 2XSCA 3R2IA 4IFDI 1E2WA 5C0XI 5LMNL 3CMEA 1VQHA 4DV3Q 4IQZA 3KLRA 2K75A 4DR7Q 1E2ZA 4ZLTF 1QNKA 4X65L 3W3AA 1BBWA 3OSOA 4DR2L 4KK7A 1Q8KA 3M85A 5M5YH 1AZPA 1PYWD 5BN5A 1MD2D 5T1GA 1EU3A 1U4LA 2HDMA 3TZDA 2JA5H 3GTKB 1EEFD 1N36Q 4A4IA 1YIJA 1PFNA 2EE1A 5FJ8H 2ENBA 2EYJA 2NVTB 1I50H 2Q8RE 2WKDA 1NBWA 1EYGA 5C3EB 4XXEA 1BBXC 2Q2IA 5T1IA 1X3PA 3NQTA 4NDXA 2RF4A 1CKNB 1OXUA 5NUCA 3AMUA 2MPMA 2IX3A 4BXXH 1HQMC 1F9PA 2UUAL 2JA7B 4GOPB 1ZKOA 4IUVA 4JI4L 1D6EC 3NBHB 1XTCD 3UE0A 4MIUA 1TWCH 2L55A 4A3DG 1EQTA 4K0KL 2OTJA 4A3IG 1D5ZC 1KD1C 4B3SL 2R7ZG 3UDIA 1CSQA 5HURA 5IT9c 3M3YB 5FKAC 2RBMA 3VR2A 2F0UA 3FPUB 3FKIB 1BCPF 3I73A 5C4ZA 4Q0FA 1NSNS 4NMZA 4K2LA 2BOSA 1O7ZA 2F4IA 1Y8NB 1V43A 1II3A 1M4VA 1UE5A 2ZXPA 4DV1L 1SR3A 1M90C 4B3MQ 1C48A 1MJCA 1NCVA 4DR2Q 1BNZA 2AHOB 3AYHB 4BWGB 5DAUA 4LWCA 1PZJD 1H9SA 1A3UA 1EZ6A 1KDCA 3E9IA 3IKJA 4YCWA 2LXKA 3HKSA 1NR2A 2EZVA 4HSVA 5KNBA 1PFBA 1ZYRD 4DV2L 1SBBB 3K7UC 5M3MH 2PZTA 1PH1A 3NE5B 4WFN3 3QG1A 4CDFC 4BA2I 3HG9A 1LTSD 4A75A 3PF5A 5M3MG 1HHVA 4KHPQ 5ELCA 3O13A 2CCZA 1I3QB 3CAMA 3J80E 4A93B 1SSOA 3GV3A 3S17H 4XQNA 4DK3C 2E5LQ 4JG2A 3AFQA 3GTOH 5BN4A 2ZXOA 4K6DA 3OIQA 3SK4A 3OW2A 1VQCA 1A3VA 4DV4Q 3DHQA 5G3LF 2ATWA 2HHHQ 3M9BA 2UUCQ 3CRKC 2CH4W 2HD3A 2KENA 4GNXB 3KYHC 2Q2HA 1I6HB 4IO9A 4A3BG 4EVOA 3BYTB 1S5CD 3DWPA 4R4TA 4DNRB 2JA8G 2RHQB 5L37A 2RHSB 4RKLA 2JA6H 3A8IE 2F0LA 3S9WA 3RZOB 1F2LA 2F0TA 3RD4A 2R7DA 3KF6A 4G7ZC 3PUYA 3GTKH 4JI2L 1RD9D 1UE7A 4C1NK 1GM5A 3HOZB 5ELDA 4G4KA 2NB0A 3I72A 4F7XA 2BDNA 2K28A 4MTNA 2F0JA 1H95A 1DOKA 3PUXA 5CORA 4DR5L 5K36G 1O7IA 4FXDA 5IYCG 2YYZA 2MHVA 1YNJD 4DFAA 4HEDA 2HT1A 1TKWB 2NZOA 4KLKA 3J7AF 3P1HA 1VS0A 1EFWA 4RAUC 3K59A 4PZ6A 3PF4A 4ZQ3A 4EGVA 1HXYD 4A3MB 1PTOD 1V1PB 2UUAQ 4FXKC 1CTMA 2B2VA 1I4GA 1TS3A 2I5LX 2K5HA 4DXFA 1K0SA 5J22A 2DNCA 4HR7B 2F0SA 3KLSA 3OMCA 5IP7G 3I4MB 2SOBA 4YCUA 3RNUA 2IWHA 3SVMA 4AYBB 1FNWA 1WTVA 1TS2A 5IP9G 1MKHA 4GN3B 1A2UA 1BVSA 2A5HA 3GP7A 3BYYB 5LMUQ 3S1QH 3RUZA 4JI8L 2NTSA 2EJMA 5FO7B 4HJAA 1VQ9A 4R9WA 1ENCA 3CQZH 2A74C 1S5BD 5I9OA 3ICEA 1VQDA 3QOLA 5J3BA 5ELOA 1CFMA 4JI7L 1SYCA 4HTHA 4O0AA 1UNSA 4CBVA 4DAVA 1XMOQ 2MJ8A 4DKAC 2F0PA 5C4HA 4Y52H 1Q12A 2K03A 3BZDB 4C3JG 4CDDC 1IYVA 3STBC 3NSWA 3KLSX 2UXBL 3PV0A 2VQEL 4LF4L 1UEBA 4JI5L 1VQOA 4ILWA 5C0XJ 4KHPL 4JYAQ 4IFDJ 1GVPA 1XMQL 2B8GA 1L0WA 2CHBD 1D8LA 4A3KG 1W2BA 3TP6A 1KQSA 4OGQC 3EQLC 3KDFB 4EQNA 4Q5VA 2IY5B 1TU2B 3ULLA 4DR6Q 1AFPA 4C3IB 2ES2A 1D2BA 1NE3A 1DD2A 4TVAB 3R2TA 3S2HB 1JB7A 3JC66 3R8BA 2K1BA 3CC2A 1B9MA 4C56C 2P5ZX 3G71A 1HZCA 2RSOA 4JI5Q 3D6WA 1HUNA 3S24A 2ID0A 2LY7A 3VA7A 1HNZQ 2PYKA 1GUSA 3NELA 3G6JB 2M00A 5JEAH 1B3AA 2B2YC 1A8VA 1Q46A 2K52A 2L1BA 4NXNL 3CCVA 1VQGA 2OXPA 4PMBA 1G6ZA 4XIGS 4K0KQ 3U4VA 4UY8C 4L6TB 1F2YA 3U9OA 3CCRA 5IGFA 4CHTB 4PG3A 1IBML 4YHHL 1IBLQ 3ERQA 1EY6A 1NAPA 2VW9A 3BZCA 4RH6A 3MEFA 4FF2A 3GTQB 1TVXA 1I4PA 4C3HH 2PMZE 4IOAA 3J81E 3HOXH 4K2KA 2L11A 3CPWA 5CYUA 3MEHA 2BDOA 3PGZA 2E2IH 1I3QH 1BO0A 1I50B 4XDXA 2QGQA 3LNNA 1JQYD 4JI0L 2PW7A 4ZKCB 4OO1G 3GTMB 2AWNA 4XTCS 4JV5Q 4KI0A 1I4RA 1V9PA 1GUTA 1KHIA 2VUMG 3NP8A 2AUJD 4P75A 1HUMA 4KY7A 3NQIA 5CC4A 1KC8C 3L0OA 2H4OA 5IODA 5JJZA 4KV6A 3N6RA 2B2WC 1JE4A 1JJGA 2WACA 4OIJA 1IW7D 1LUZA 4A3FG 2EYOA 2KCTA 4FDBA 1O78A 1DCZA 1XWEA 4RHSA 4QGUA 4G7HC 4UAIA 2QILA 1UE6A 4IURA 1S5DD 3M4OB 4NB3A 1LT4D 1R4QB 2WIIB 5M5WH 2XRQD 1IW7C 4PZ7A 4R4CA 4A3GH 1KDAA 4DF7A 4UDUC 1AP0A 3U4ZA 1OXXK 4OWXB 3GTLB 3F2UA 2B63H 3MZ5A 2FJ2A 2TSSA 4BBSB 2DNEA 4LF8L 1Y69U 2GA4B 2B2UA 2K33A 1LT5D 3T1YQ 2MGSA 1OXTA 4GOPC 3OTOQ 2YTVA 5KEEA 1MBYA 1U9RA 2PQAB 3CC7A 2G9DA 4NXMQ 2K14A 5JEAG 1YJWA 2D2CC 1IYJB 1GJXA 1PRTD 3F8TA 2AKWB 3F1ZA 2E2JB 2I46A 3TS2A 4X3UA 1NTGA 4P71A 3A5ZB 3J81L 4X62L 3HOYH 4JYAL 5I2XA 2O5JC 4H7BA 1YBYA 2VB2X 2OQKA 2CH4A 1L0YB 2VQFQ 4B3RL 3AQQA 4HJ5A 1BKBA 4H02A 4YWMA 4DK0A 3X3NA 1GKHA 1EOTA 3ERSX 3FVQA 5ELEA 1Y1WH 4IJHA 1VQLA 4RFBA 1HTLD 1CA6A 2A68C 3E9HA 1WCMH 1TS4A 3BJUA 1FNVA 2JEAI 5C4XH 4OX9L 1HCZA 2B2TA 3T13A 2WAQG 4LUOA 4PQXA 5DM63 1QNUA 2F0EA 3HS0C 1O80A 1VCIA 4O42A 2XWJB 1AE2A 2C35B 4RA8A 3MC0B 1HR0L 4B3TL 1DJRD 1S72A 1A2TA 1W6JA 2UU9Q 4L8JA 1K3RA 2WFWA 4CDEC 2UUBQ 4CJ1B 1I6VC 4WORA 2I07B 1WD1A 3GD7A 1A62A 5D65A 2RKSA 3D4DA 2A73B 4RHRA 1P8LA 2B8FA 4QJFA 3HOXG 1HH2P 3VYUA 5CMDA 2CW0C 4DR1Q 4RGOS 4OXPA 3K8AA 1BXTA 3PO2G 1N36L 1FGUA 3J7YW 3VR5A 2A6HC 2UU9L 4ODGA 4DAPA 2DY7A 3PO2H 3A5UA 1CK1A 1JR0D 4DPGA 2JA9A 4QF4A 5IP9H 2R92B 1PXUA 3J7AV 4GLVB 3GTJH 3BG3A 5KYIA 2NUCA 2I5MX 3S2DB 2ALYB 4BBRH 1XX8A 3L3OC 5CV8A 3D8GA 2CFMA 3X3MA 4DV3L 4NXNQ 1I94L 2VZAA 3E0EA 4J15A 1PYSB 5FLXc 1SDFA 3DLLA 1LM0A 4IUPA 1VMPA 1PH6A 1RF2D 4KJNA 4M1UB 3H3VH 2N78A 2WB1E 4DV7Q 3TP8A 1F77A 4I65A 2PW5A 1RTNA 3R3OA 3J81j 1JWSD 4X62Q 1STHA 1Y1WG 1W6KA 3CCEA 4FF4A 3WOFA 4R8NA 1G51A 1YI2A 3EBEA 3K6OA 2NVTH 3KF6B 4TQUS 4AH6A 3TS0A 3K57A 1W3SA 2BE5C 3UDXA 1QILA 2R7ZH 4QCLA 1QWYA 2EJFC 2E2JH 4NKLA 3A54A 1HFGA 3T51B 3CCUA 3HKZE 1ML0D 4KN7C 4WJ4A 2HIVA 3L2PA 2F4VL 1OTCA 3MFGA 3F2CA 4RGMA 2K6AA 1L1OC 2KBNA 2VXWA 1WD0A 2VQEQ 1G91A 5JPNC 2SDFA 2UXBQ 1EWIA 3SGIA 3TRZA 2NVYH 1YHQA 1JOOA 1PH8A 3ZJYC 2C5CA 1F2MA 4A3JH 1BF4A 1V1PA 5DLQE 1X55A 1WTPA 1SRUA 5K36H 3I4LA 1PVOA 4IPDA 5H1SE 1VQNA 1GUGA 2JA5G 1BCPB 4JBWA 1XNRL 3L9AX 3TN2A 5JVG3 1PZKD 4OIKA 5C44G 2F52A 3J80c 3U9SA 3CP0A 3VDYA 3OWFA 3QOJA 4BBSH 5CGKA 3KBGA 1CZWA 2EYHA 2GN5A 1SEBD 4IPGA 1SLJA 4MZ9A 3DXJC 4DV7L 4A3GG 1A6XA 1DYQA 3OPOA 3VYSA 1E2VA 1SAPA 2L5TA 2HDLA 4HN7A 4QB4A 1I4HA 3CCJA 2Y0SE 4A3CH 4JOIC 4LF7L 2LFNA 2F0MA 3CCQA 4GZYC 5EKIA 2CQOA 1E1OA 1CQFA 3HEJA 4XYOA 2QF7A 3PO3G 2KVMA 3SHLA 4KJOA 4S3SA 2KQ3A 2E74C 5GADC 5C4JB 3M7NA 1MSGA 5C3EH 2OTLA 3CCSA 1K8GA 1EOVA 2IHEA 2NZ1D 2WAQE 2SNMA 4ID6A 1MHWC 3I8ZA 5IWAQ 1FJGL 1NY4A 4MHEA 2ZT9C 1RTOA 2CW0D 3V05A 1AZQA 4L5QA 1ENAA 5DEHA 3I4OA 1EQRA 3U58A 1N32Q 5FO9B 4P74A 5A2QE 4XT1B 3W1BA 4KD4A 1SFOH 5IGEA 2NVXH 4R4OA 1HA5A 4C3IH 2HQEA 1LT3D 1LLRD 5C3WA 1PMRA 1HZAA 1X3FA 2K5WA 1HR0Q 4B3TQ 1H9RA 1S40A 1KDBA 1PH4A 2EOTA 3T1HQ 4WJWA 2JN4A 3J81c 1VQAA 2YV5A 1CHQD 4ME3A 3TEHB 5M5WB 1KIXA 2N55A 1PA6A 3FEWX 3WWVA 5FLMH 3TREA 1IKMA 4JBKA 1N8RC 4KKTA 2WB1G 4LUVA 1LACA 4JOIA 1JE5A 3C1EA 3H15A 4JBMA 4DV4L 3HOWG 2VL6A 2F3VA 2UXDL 2A6HD 4XQQA 1EIHA 3CPFA 2AWOA 3WDNA 2SNSA 4POFA 4EX5A 4H0LC 5EPJA 2VQFL 2EVBA 1LT6D 4JI6L 2JA5B 2B2VC 1NNXA 4G57A 4LF9L 3EVQA 3UDGA 3C2PA 1NUCA 3HOVH 3Q22A 1QVGA 5M3FH 2MFIA 1PH9A 4AIMA 5FLXE 4C3HB 4HJ8A 2B2TC 3A0JA 2EYPA 1Y1VG 1EEID 2DN8A 1BCPC 1SE3A 3JAML 3H3VC 3QWNA 3VA5A 4A3CG 1PYBA 2F0HA 4A3EH 5M5XB 4DV5Q 5IP7H 4DUZQ 4LW1A 4C3JH 4KY6A 2B3GA 1R4PB 2QCPX 3NXWA 4CJ0B 2JQOA 1SNQA 2OF1A 4IUTA 1CKMA 1BOSA 2MP1A 1STEA 1HPCA 3RLNA 1BCPD 3A8KE 2X6LA 3UDFA 1DGSA 1PTOB 2A6EC 4UP9A 1F9SA 2XNAC 2KCMA 4LFAL 3A55A 3HOZG 2AQ2B 3HOYG 3Q8DA 4OEMB 3TP5A 1K8OA 2A6ED 1QE6A 2ICIA 1CI3M 4TRDA 5D14A 2RDHA 3SR1A 1SYGA 3KUPA 5FLXL 2PPBC 4PMCA 5CV9A 2B63B 4HMIA 1D5XC 5I9PA 1R9TB 5GAGC 1DM0B 4A3IH 5COYA 1IKLA 1A3TA 3OOCA 2YU9H 3K0XA 1SN8A 1QCBD 1Z6HA 5KGUA 2KA7A 2ZTDA 1MGSA 1TS5A 4TSSA 5KYLA 1J5EL 1EQQA 3EIVA 2M9VA 2SEBD 3I3CA 4DK6C 3J80i
chains in the Genus database with same CATH topology
2EY1A 1TR5A 4M8AA 3DM1A 4OO1I 3URYA 2DY8A 2WAQB 1PLFA 3DWQA 3PO3B 4OO1H 3S14B 3HOYB 4HCSA 1SNPA 1PZID 2EY5A 4CKBA 4XQJA 2NYZD 3EA6A 1BUVT 3H0GB 5C0XG 1ZXTA 1TIID 4IALA 4DK1A 3A56A 5CV5A 1B9NA 1HRJA 1CA5A 3SE0A 4V0BA 1JOKA 4B08A 1PDQA 1B1ZA 3NBHA 4FNFA 1X32A 2NBFA 4A3BB 2K32A 1HFNA 3D31A 1LTBD 3FMCA 1QB5D 4IZ8A 4RCOA 2R7ZB 1S5ED 4DXGA 1WTXA 2D9UA 2HCIA 2K04A 4C3JB 4O1NA 2L4NA 2BA1A 5M3MB 2F0DA 4KTAA 3MAQA 4B9WA 1S5FD 4RGTA 3HKZB 1FNUA 2Z4IA 2KJXA 4A3GB 4P2CB 5IGGA 3PIO3 3TBIB 4BBRB 3I70A 3DUZA 4X3KA 3VR3A 3SK5A 4ZK9B 1E0BA 1EFID 3CQZB 3K5OA 5CV7A 2IX1A 2JA6B 3H09A 1UUPA 5EGTA 4KHVA 3TSSA 2F0QA 1SMYD 3H94A 2JYOA 3UI2A 1GOZA 1F9RA 2CQAA 5EPKA 1RKNA 2QEJC 2IPKD 2EJGC 3NWSA 5C44B 4K8IA 4KD3A 4FP5D 1HA6A 1O7YA 3W2DA 3HP3A 2Y0SB 5LL6S 2O2LD 3BDCA 3P75A 2NN6G 1PRTC 4NP5A 5CBAE 1QJOA 5IOCA 4JK1C 2NVYB 2KCNA 5ISRA 3D3RA 3E6ZX 2WP8J 1JC7A 2F1MA 4DAYA 4K5WA 1YNND 4C2MB 1LTTD 5I2YA 1LTGD 2F0WA 2IT1A 2X6GA 3VYRA 5DM73 1LO5D 2E76C 2VNUD 1T5XD 1J9OA 3S1QB 3EROA 4A3IB 3HRZC 3K7AB 2YU9B 5C0XH 3N52A 1LTID 3V2TA 4DNTB 1C8CA 3VR6A 4BS9A 4J6HA 1A15A 1OXSC 3R93A 4BA1I 3GTPB 2F0IA 1GUWA 5I6WA 3HOXB 2LKVA 1WTQA 1Q3LA 3CU7A 3CRLC 1IL8A 1SNCA 2RA4A 1IYUA 5JAVA 4FF3A 4ZUIA 4J1MA 2XVSA 1I4XA 4IUNA 1MSHA 4BY7B 1XYIA 4TKOB 2WINB 1FYCA 2KHSA 4C3HG 4LMQD 2A68D 3FRPB 3T16A 2F3WA 1WTWA 3DMUA 4KHZA 4CKEA 2TMPA 3OMGA 1SNOA 5ELFA 4B9XA 3BVMA 1MI2A 1TT2A 1UAPA 1D1KA 5EKKA 2Q8IB 1GUNA 2KECA 1TWAB 5EBDA 3BS1A 4RCNA 1WTOA 3D6CA 5M3FB 4K6LA 1JWUD 5EJWA 1V1OA 1AEXA 2LMCB 4NW2A 4QUFA 3K58A 1OXVA 1EY5A 2OEOA 3NBIA 4CJ2C 2A69C 3NUCA 2L12A 3MTSA 4E6IA 1LTRD 2AUKA 2B2UC 2AQ3B 1T5EA 2WB1B 5M5YB 2FMMA 2K5QA 4ZKBB 3SDZA 1ET9A 3PIP3 2KOLA 2J4XA 1YNJC 2Z1CA 4CKCA 1OO9B 1G2SA 5CV4A 2QDBA 1SYFA 1TWFB 1FD7D 2D5DA 1Q90A 4ABNA 1CQVA 2Z4HA 4KKSA 2JE6I 3LWUA 1AN8A 2K5DA 4K14A 3GQBA 4FVMA 4QIWB 3MFYA 3VYTA 1EWHA 3NTHA 2RQXA 1SXTA 1FR3A 3KF8A 2JEBI 2G9HD 2IL8A 3TZUA 3HGBA 3OHXC 4U68A 1QOHA 2IW3A 3OW7A 1SYBA 1D5MC 4XYQA 1Y1WB 4HAEA 1STGA 1ZEQX 5E3FA 1STYA 1ZYRC 4PMWA 3FPPA 3LX0A 3CKIB 2PZWA 1LV9A 1O7LA 1SJHD 5M9OA 5JVH3 1U4RA 2AQ1B 3D4RA 1SYDA 1KAAA 4Z9CB 2K7VA 1GUOA 3C1FA 1KABA 1VDZA 3WOEA 2D62A 2KEEA 4X3TA 3EFXD 1PRTB 4U673 1GHJA 3OIPA 5G3LD 1RCVD 1KTKA 1K8MA 2B2YA 2ZXRA 2EXZA 3GTGB 1X3QA 4Y7NB 3Q24A 4I7ZC 1TY2A 3IFDA 4H44C 4ZUJA 1DONA 2F03A 3I91A 1ONLA 5EBCA 3NHHA 2BCOA 5KRUA 1TWGB 3ITPA 3BDOA 3T56B 2F0NA 3GO5A 1EY9A 3LWEA 3TP7A 3Q23A 2E75C 1Q1BA 4LAAA 5IT9E 1SJED 5JOBA 3I4NB 3PUVA 5DNFA 3RMHA 1TQOA 3K5MA 2XIWA 5FO8B 4K5VA 1VMCA 4EQPA 3MXGA 5CR3A 3MWYW 2L9HA 1K83B 1JWMD 2F0OA 2O5IC 1SE2A 2IJ0A 3SK6A 1SNDA 1UEAB 1STAA 1B4OA 5JEAJ 4FYDA 3PUZA 4A3DB 4A3JB 3E5SA 3NWTA 2H1EA 5FK9C 1L0XB 1V8QA 2MUYA 5AFWA 4DU9A 1AW7A 5EQ0A 4FF1A 3NTIA 3J80L 2EY2A 2EYLA 1EWCA 1G8ZD 1HTPA 3NK9A 3Q6SA 1H9MA 1H9SB 5EKLA 4DGZA 4OL7A 4XT3B 3OWEB 4IFDH 3P7JA 4ZYSA 5LL6X 4EQOA 5LHY1 5K5PA 5I4DA 1Q8IA 1JCKB 1BDOA 4IUUA 1CHPD 1C4QA 4PV1C 4LK1C 1PFMA 3NPPA 1WVLA 3A7LA 3I90A 3S1RB 2C9OA 1B44D 2WV6D 2R3ZA 2HCCA 3GTOB 4A3EB 1KLUD 5C5LA 2PQEA 5EPLA 3P20A 1ET6A 3PMFA 3JAME 5A2QL 4CGYB 5CV6A 3SK8A 3SEBA 1CT1D 2NVXB 2XWBB 1PTOH 3HZXA 2K01A 2OT2A 2Z8LA 2IX0A 5JPMC 1G291 3S1MB 2F0GA 2ICEC 2BE5D 1Z7TA 2JSOA 5E4XA 1I4QA 3DEOA 2R61A 1FGBD 3PUWA 2KUMA 3V96A 3D4WA 3KBXA 3ZYYX 1DXMA 2KEDA 1EY8A 1QG7A 1TWCB 5KNDA 5E1FA 3MXUA 2FFKB 3S15B 2PNRC 5IGBA 1F9QA 3HOVB 1SE4A 3M4YA 3K0YA 2F0KA 1WCMB 3EJIA 3ND8A 2KCCA 4ZRZA 2LS01 4QMGA 4A3FB 2E2HB 2HUGA 4QUCA 2Q8TA 2VUMB 4BY1B 5D3DA 3ND9A 4RGNA 1EYCA 3H91A 2QKIC 4OHJA 4PNYA 3DWAA 4DA2A 2NN6H 4KY5A 3RLFA 3GV6A 1KNEA 3QJYA 1XXGA 2PMZB 3PO2B 3TDQA 4R8IA 1EYDA 3AU7A 1ESFA 3QB3A 1B50A 5C5MA 2RVLA 5IIFA 1Z47A 3GTJB 1STNA 1CZGA 4L63B 5C6AA 3A7AB 1TWHB 5IGCA 3H6MA 4ME5A 1EIGA 3E0JA 1H9JA 3L7ZC 4HSPA 3DEPA 2B39A 1PRTF 5D3IB 4F8MA 2FINB 4F87A 4RWSC 3MXPA 3T4AC 1EZ8A 1DZ1A 3T53B 2K05A 2E2DC 3C46A 1GXDC 5E4WC 1EY7A 1RJTA 3VR4A 1TY0A 4A3KB 2WKCA 3IL8A 3RZDB 1G2TA 2RDFA 4V190 2XN9C 1WTRA 3MHBA 4IFDG 2NWGA 2VB3X 4N9TA 1EY4A 2F0VA 5ELBA 2M2LA 2NTTA 3TMEA 1CM9A 2RSNA 1S4ZA 3K5NA 1YNNC 1STBA 1SYEA 5KIXA 1RODA 5CBEE 3S16B 2PO4A 5C3XA 1LTAD 2R93B 5A35A 1ENFA 4KKUA 1PTOF 2NVQB 3BDLA 1BR9A 2EDGA 3BVZA 5TSSA 2V4DA 5HGTA 4IN3A 4H13C 1ILQA 1U4PA 4LJZC 1EYAA 2RDGA 2EPBA 4FXGC 1KNAA 1H9KA 1F2ZA 4MN3A 1JORA 3KK7A 1VF5C 1Y1VB 3K5LA 4HCEA 2EY6A 2R6GA 5C4XB 4J8QA 4K8JA 1DOMA 1ESRA 2JA8B 2FMCA 1HQRD 3NTKA 2X69A 4C1NI 1D1IA 1LABA 3A8JE 3FDTA 1JOQA 1EU4A 1PTOC 3IFTA 1B2TA 2NN6I 4HMJA 5IGDA 2A69D 1GHKA 3MVVA 4RKBA 1Y8OB 2FHTA 4YIJA 2PCFB 1KLGD 3SXHA 2J0TD 4X3SA 2CVRA 1SFOB 3C3LA 1ILPA 1RDPD 4FO2A 3MXNA 3S17B 3HOWB 1RHPA 4KMUC 1EL0A 4C3IG 1EY0A 1SNMA 5J39A 1DOLA 3ONAB 1JB3A 2J7ZA 5I6YA 2BA0A 1IHZA 2F0FA 3M7GA 5IT9L 5KNCA 1NR4A 2PZUA 3QO2A 1EQVA 2EYFA 2B2WA 3BVGA 3S1NB 2E2IB 4N9PA 2XRSD 4KN4C 3AB9A 4WRDA 3IAYA 2JP1A 3G7LA 2O4XA 1JICA 2L0CA 2N88A 3QIAA 3Q0AA 3HOUB 1M8AA 2JXMB 4F88A 1Y8PB 1J8IA 1Q1EA 1ICWA 4ULLA 3CHBD 4K5XA 4DN4M 5J1ZA 5FOBB 4G7OC 3MA2B 5F2DA 4IUQA 1BQQT 2EYMA 1U4MA 1SMYC 1VF7A 4ZAIA 5BN3A 1B53A 2XSCA 3R2IA 4IFDI 1E2WA 5C0XI 4IQZA 3KLRA 1E2ZA 4ZLTF 1QNKA 3W3AA 3OSOA 4KK7A 3M85A 1AZPA 1PYWD 5BN5A 1MD2D 5T1GA 1EU3A 1U4LA 2HDMA 3TZDA 3GTKB 1EEFD 1PFNA 2EE1A 2ENBA 2EYJA 2NVTB 2Q8RE 2WKDA 5C3EB 4XXEA 1BBXC 5T1IA 1X3PA 3NQTA 4NDXA 1OXUA 5NUCA 3AMUA 2MPMA 2IX3A 1HQMC 1F9PA 2JA7B 1ZKOA 4IUVA 1D6EC 1XTCD 4MIUA 2L55A 1EQTA 1D5ZC 5HURA 3M3YB 5FKAC 2RBMA 3VR2A 2F0UA 3FPUB 3FKIB 1BCPF 3I73A 5C4ZA 4Q0FA 1NSNS 4NMZA 4K2LA 2BOSA 1O7ZA 2F4IA 1Y8NB 1V43A 1II3A 1M4VA 2ZXPA 1C48A 1NCVA 1BNZA 4BWGB 5DAUA 1PZJD 1H9SA 1A3UA 1EZ6A 1KDCA 3IKJA 1NR2A 2EZVA 4HSVA 5KNBA 1PFBA 1ZYRD 1SBBB 2PZTA 3NE5B 4WFN3 3QG1A 4BA2I 3HG9A 1LTSD 1HHVA 5ELCA 3O13A 1I3QB 3J80E 4A93B 1SSOA 3GV3A 4XQNA 5BN4A 2ZXOA 4K6DA 3OIQA 3SK4A 1A3VA 3DHQA 5G3LF 3CRKC 1I6HB 4EVOA 3BYTB 1S5CD 3DWPA 4DNRB 4RKLA 3A8IE 2F0LA 3S9WA 3RZOB 1F2LA 2F0TA 3RD4A 4G7ZC 3PUYA 1RD9D 4C1NK 3HOZB 5ELDA 4G4KA 2NB0A 3I72A 4F7XA 2BDNA 2K28A 2F0JA 1DOKA 3PUXA 5CORA 5K36G 4FXDA 2YYZA 2MHVA 1YNJD 4DFAA 4HEDA 1TKWB 3J7AF 3P1HA 4RAUC 3K59A 4ZQ3A 4EGVA 1HXYD 4A3MB 1PTOD 1V1PB 4FXKC 1CTMA 2B2VA 1I4GA 1TS3A 4DXFA 5J22A 2DNCA 4HR7B 2F0SA 3KLSA 3OMCA 3I4MB 2SOBA 2IWHA 3SVMA 4AYBB 1FNWA 1WTVA 1TS2A 1A2UA 2A5HA 3GP7A 3BYYB 3RUZA 2NTSA 2EJMA 5FO7B 4R9WA 1ENCA 2A74C 1S5BD 5I9OA 3QOLA 1CFMA 1SYCA 4HTHA 1UNSA 4CBVA 4DAVA 2MJ8A 2F0PA 5C4HA 1Q12A 2K03A 3BZDB 4C3JG 1IYVA 3NSWA 3KLSX 3PV0A 4ILWA 5C0XJ 4IFDJ 2B8GA 2CHBD 3TP6A 4OGQC 3EQLC 4EQNA 4Q5VA 1TU2B 1AFPA 4C3IB 1D2BA 1DD2A 3R2TA 3S2HB 3R8BA 2K1BA 1B9MA 4C56C 2RSOA 3D6WA 1HUNA 2ID0A 2LY7A 3VA7A 2PYKA 1GUSA 3G6JB 2M00A 5JEAH 1B3AA 2B2YC 2L1BA 2OXPA 4PMBA 1G6ZA 4XIGS 4L6TB 1F2YA 3U9OA 5IGFA 4CHTB 3ERQA 1EY6A 1NAPA 4RH6A 4FF2A 3GTQB 1TVXA 1I4PA 3J81E 4K2KA 2L11A 5CYUA 3MEHA 2BDOA 1BO0A 1I50B 4XDXA 3LNNA 1JQYD 2PW7A 4ZKCB 4OO1G 3GTMB 2AWNA 4XTCS 4KI0A 1I4RA 1GUTA 3NP8A 2AUJD 1HUMA 4KY7A 3NQIA 5CC4A 2H4OA 5IODA 5JJZA 4KV6A 3N6RA 2B2WC 1JE4A 2WACA 4OIJA 1IW7D 2EYOA 1O78A 1DCZA 1XWEA 4RHSA 4G7HC 4UAIA 2QILA 4IURA 1S5DD 3M4OB 1LT4D 1R4QB 2WIIB 2XRQD 1IW7C 1KDAA 4DF7A 4UDUC 1AP0A 1OXXK 3GTLB 3F2UA 3MZ5A 2FJ2A 2TSSA 4BBSB 2DNEA 1Y69U 2GA4B 2B2UA 2K33A 1LT5D 2MGSA 1OXTA 5KEEA 1MBYA 1U9RA 2G9DA 5JEAG 2D2CC 1GJXA 1PRTD 2E2JB 2I46A 4X3UA 3J81L 5I2XA 2O5JC 4H7BA 2VB2X 1L0YB 4DK0A 3X3NA 1EOTA 3FVQA 5ELEA 4RFBA 1HTLD 1CA6A 2A68C 1TS4A 1FNVA 2JEAI 1HCZA 2B2TA 3T13A 4PQXA 5DM63 1QNUA 2F0EA 3HS0C 1O80A 1VCIA 4O42A 2XWJB 4RA8A 3MC0B 1DJRD 1A2TA 1W6JA 4L8JA 4CJ1B 1I6VC 4WORA 2I07B 1WD1A 3GD7A 5D65A 2RKSA 3D4DA 2A73B 4RHRA 2B8FA 3VYUA 5CMDA 2CW0C 4RGOS 1BXTA 3J7YW 3VR5A 2A6HC 4ODGA 4DAPA 2DY7A 1CK1A 1JR0D 4QF4A 2R92B 1PXUA 3J7AV 3BG3A 5KYIA 2NUCA 3S2DB 1XX8A 3L3OC 5CV8A 3D8GA 3X3MA 1SDFA 4IUPA 1VMPA 1RF2D 4KJNA 4M1UB 3TP8A 1F77A 4I65A 2PW5A 1RTNA 3R3OA 1JWSD 1STHA 1W6KA 4FF4A 3WOFA 4R8NA 3K6OA 4TQUS 3K57A 2BE5C 1QILA 4QCLA 1QWYA 2EJFC 4NKLA 3A54A 1HFGA 3T51B 1ML0D 4KN7C 3MFGA 4RGMA 2K6AA 2VXWA 1WD0A 1G91A 5JPNC 2SDFA 1JOOA 2C5CA 1F2MA 1BF4A 1V1PA 1WTPA 5K36H 3I4LA 1GUGA 1BCPB 4JBWA 3L9AX 3TN2A 5JVG3 1PZKD 4OIKA 3U9SA 3OWFA 3QOJA 5CGKA 3KBGA 1CZWA 2EYHA 1SEBD 3DXJC 1A6XA 1DYQA 3OPOA 3VYSA 1E2VA 1SAPA 2L5TA 2HDLA 4HN7A 4QB4A 1I4HA 2LFNA 2F0MA 4GZYC 5EKIA 1CQFA 3HEJA 4XYOA 2QF7A 2KVMA 3SHLA 4KJOA 4S3SA 2KQ3A 2E74C 5C4JB 3M7NA 1MSGA 2NZ1D 2SNMA 4ID6A 3I8ZA 4MHEA 2ZT9C 1RTOA 2CW0D 3V05A 1AZQA 1ENAA 5DEHA 5FO9B 5A2QE 4XT1B 4KD4A 5IGEA 1HA5A 2HQEA 1LT3D 1LLRD 5C3WA 1PMRA 2K5WA 1H9RA 1KDBA 2EOTA 4WJWA 1CHQD 5M5WB 2N55A 3FEWX 1IKMA 4KKTA 1LACA 3C1EA 2F3VA 2A6HD 4XQQA 1EIHA 2AWOA 3WDNA 2SNSA 4H0LC 5EPJA 2EVBA 1LT6D 2JA5B 2B2VC 4G57A 3EVQA 3C2PA 1NUCA 3Q22A 5FLXE 4C3HB 2B2TC 2EYPA 1EEID 2DN8A 1BCPC 1SE3A 3JAML 3H3VC 3QWNA 3VA5A 2F0HA 5M5XB 3NXWA 4KY6A 1R4PB 2QCPX 4CJ0B 1SNQA 2OF1A 4IUTA 1BOSA 2MP1A 1STEA 1HPCA 1BCPD 3A8KE 2X6LA 1PTOB 2A6EC 1F9SA 2XNAC 3A55A 2AQ2B 3TP5A 1K8OA 2A6ED 1QE6A 2ICIA 1CI3M 4TRDA 5D14A 2RDHA 3SR1A 1SYGA 3KUPA 5FLXL 2PPBC 4PMCA 5CV9A 2B63B 4HMIA 1D5XC 5I9PA 1R9TB 1DM0B 5COYA 1IKLA 1A3TA 3OOCA 1QCBD 1Z6HA 5KGUA 2KA7A 1MGSA 5KYLA 1TS5A 4TSSA 2M9VA 2SEBD 3I3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H1E A;  4X3S A;  2CVR A;  4ZKC B;  1RJT A;  2VXW A;  1WD0 A;  3DM1 A;  2B2T A;  4R9W A;  1WTQ A;  4ZLT F;  1G91 A;  2KED A;  2SDF A;  1QG7 A;  1QNK A;  1SSO A;  3GV3 A;  5AFW A;  3IL8 A;  1ILP A;  4ZK9 B;  1G2T A;  2DY8 A;  1Q3L A;  2FFK B;  5EQ0 A;  1WTR A;  2FMM A;  4O42 A;  1O80 A;  1PLF A;  1E0B A;  1HUM A;  1F9Q A;  2NWG A;  4RA8 A;  1IL8 A;  2RA4 A;  5JJZ A;  1AZP A;  4ZKB B;  1BF4 A;  2MJ8 A;  2B2W C;  2M2L A;  1JE4 A;  1EIH A;  2KEE A;  4OIJ A;  1WTP A;  1RHP A;  2KOL A;  5T1G A;  3Q6S A;  1U4L A;  2HDM A;  2K03 A;  4CJ1 B;  3TZD A;  1EL0 A;  4HCS A;  1CM9 A;  2RSN A;  4X3T A;  2JYO A;  4XT3 B;  1WD1 A;  5D65 A;  1G2S A;  3UI2 A;  1S4Z A;  1DOL A;  5EPJ A;  4UAI A;  3P7J A;  1PFN A;  2EE1 A;  1F9R A;  2B2V C;  1ROD A;  2HUG A;  3ONA B;  4IUR A;  4QUC A;  2Q8T A;  3TN2 A;  5CBE E;  5CMD A;  2NYZ D;  5EPK A;  4OIK A;  2Q8R E;  2J7Z A;  1MSH A;  2B2Y A;  1ZXT A;  4IUU A;  1XYI A;  1AP0 A;  1BBX C;  1F2L A;  1X3Q A;  5T1I A;  2B2T C;  1HRJ A;  1X3P A;  1PFM A;  3IFD A;  2DY7 A;  1HA6 A;  1O7Y A;  3F2U A;  3HP3 A;  2FJ2 A;  1CA5 A;  2MPM A;  1F9P A;  4LMQ D;  1NR4 A;  1WVL A;  3H91 A;  1SAP A;  2B2U A;  3I90 A;  1PDQ A;  3QO2 A;  4IUV A;  1DON A;  3I91 A;  1WTW A;  2HDL A;  5CBA E;  1X32 A;  2MGS A;  2BDN A;  2B2W A;  2K28 A;  1EQT A;  3GV6 A;  1HFN A;  2R3Z A;  1U4P A;  1ILQ A;  1KNE A;  2HCC A;  1DOK A;  1XX8 A;  5COR A;  2K1B A;  4CJ0 B;  3LWE A;  5EKI A;  4IUT A;  2RSO A;  2MP1 A;  5EPL A;  4HED A;  3D6W A;  1HUN A;  1WTX A;  2D9U A;  2EPB A;  2X6L A;  1KNA A;  4R8I A;  2IL8 A;  2HCI A;  2JP1 A;  1MI2 A;  2KVM A;  3G7L A;  1B50 A;  4MN3 A;  1SDF A;  4RAU C;  2RVL A;  3FPU B;  4IUP A;  5DNF A;  1VMP A;  4U68 A;  1JIC A;  2XIW A;  1MSG A;  2N88 A;  1F9S A;  2K04 A;  1VMC A;  1M8A A;  2KEC A;  2B2V A;  2NZ1 D;  2X6G A;  1O7Z A;  3I8Z A;  1B3A A;  2K01 A;  1EIG A;  4MHE A;  2L4N A;  1WTO A;  1J9O A;  4HAE A;  1J8I A;  1RTO A;  1RTN A;  2B2Y C;  3MWY W;  4X3U A;  2L9H A;  1DOM A;  3DEP A;  1ICW A;  1QE6 A;  1AZQ A;  1ESR A;  1NCV A;  2L1B A;  5D14 A;  1BNZ A;  1G6Z A;  5EJW A;  3KUP A;  4XT1 B;  2X69 A;  4DN4 M;  4NW2 A;  4QUF A;  3FDT A;  3N52 A;  2FIN B;  1B4O A;  1C8C A;  1B2T A;  4RWS C;  1NR2 A;  1NAP A;  4IUQ A;  5COY A;  5E4X A;  4CJ2 C;  1IKL A;  3SVM A;  1EOT A;  2L12 A;  4HSV A;  1PFB A;  1U4M A;  1WTV A;  3DEO A;  1TVX A;  1A15 A;  3MTS A;  1HFG A;  4ZAI A;  1LV9 A;  1DZ1 A;  2KUM A;  3R93 A;  1ML0 D;  2L11 A;  2EOT A;  1MGS A;  1CA6 A;  1B53 A;  2FHT A;  2K05 A;  1BO0 A;  4X3K A;  2N55 A;  4XDX A;  1U4R A;  3KBX A;  1GUW A;  1HHV A;  5E4W C;  3I3C A;  1IKM A;  2B2U C; 
#chains in the Genus database with same CATH topology
 2EY1 A;  1TR5 A;  4M8A A;  2YTX A;  1TXY A;  3DM1 A;  2MNA A;  4DR1 L;  4OO1 I;  3URY A;  4A3L H;  2B63 G;  2DY8 A;  2WAQ B;  1PLF A;  3DWQ A;  3PO3 B;  2QDL A;  4OO1 H;  4LNQ A;  3S14 B;  3HOY B;  4HCS A;  3UE1 A;  1SNP A;  1PZI D;  2EY5 A;  4CKB A;  4AYB E;  4XQJ A;  3RN2 A;  4OWW B;  2AMC B;  2NYZ D;  3EA6 A;  4R1J A;  1BUV T;  3H0G B;  4JW0 A;  5C0X G;  1ZXT A;  1TII D;  4IAL A;  4DK1 A;  3A56 A;  5CV5 A;  4X64 Q;  1B9N A;  1HRJ A;  2JJQ A;  1L2F A;  1CA5 A;  3U50 C;  3M3Y H;  2OWO A;  3SE0 A;  4V0B A;  1JOK A;  4B08 A;  1X65 A;  1YZ6 A;  1PDQ A;  4UPA A;  1B1Z A;  2JK8 A;  2I5H A;  3NBH A;  4C2M H;  4FNF A;  1X32 A;  3S16 H;  2NBF A;  2IHF A;  3GTQ H;  1B3Q A;  1J6Q A;  4A3B B;  2K32 A;  1HFN A;  3D31 A;  1LTB D;  3FMC A;  1QB5 D;  4IZ8 A;  4RCO A;  2R7Z B;  1S5E D;  4DXG A;  3CC4 A;  4DUZ L;  1WTX A;  2D9U A;  1EIY B;  4DV5 L;  2HCI A;  1XNQ Q;  3KFU A;  2UUC L;  2K04 A;  1XNQ L;  4RG1 A;  4LFC L;  4C3J B;  1X9N A;  4O1N A;  2L4N A;  2BA1 A;  4JPB W;  5M3M B;  4O2D A;  4POG A;  2F0D A;  4KTA A;  1VQF A;  3MAQ A;  4B9W A;  3PIO A;  1S5F D;  4RGT A;  2XTI A;  3HKZ B;  1FNU A;  2R92 H;  2Z4I A;  2KJX A;  4A3G B;  4P2C B;  5IGG A;  3PIO 3;  1JMC A;  2ASB A;  3TBI B;  4BXX G;  2R92 G;  5JJI A;  1X3E A;  4BBR B;  4X64 L;  3I70 A;  1AE3 A;  5EAY A;  3DUZ A;  4X3K A;  3VR3 A;  2OQ0 A;  2CWP A;  3SK5 A;  3MXN B;  1D7Q A;  3NEN A;  3KJO A;  1VQP A;  4ZK9 B;  4GNX A;  1E0B A;  1EFI D;  3CQZ B;  3K5O A;  2HIX A;  5CV7 A;  2ZJR A;  2IX1 A;  2Z6K A;  2JA6 B;  3H09 A;  1UUP A;  5EGT A;  4KHV A;  3TSS A;  2F0Q A;  1JT8 A;  3KOJ A;  1X3G A;  4BBR G;  1SMY D;  3I7F A;  5GAH C;  3H94 A;  1VQM A;  3S1M H;  2JA6 G;  2JYO A;  1KXL A;  3UI2 A;  1VQJ A;  1KAW A;  1GOZ A;  1QVC A;  1F9R A;  1UWV A;  2CQA A;  2R93 H;  5EPK A;  1KL9 A;  1RKN A;  4B3S Q;  1N32 L;  5C4J H;  4ALP A;  2QEJ C;  2IPK D;  2EJG C;  3NWS A;  5C44 B;  3S14 H;  1I5F A;  4K8I A;  2EIF A;  4KD3 A;  4FP5 D;  1HA6 A;  1O7Y A;  3W2D A;  3HP3 A;  1FVI A;  2Y0S B;  5LL6 S;  2O2L D;  3BDC A;  3P75 A;  1VQ4 A;  2NN6 G;  2Z0S A;  1PRT C;  4NP5 A;  1L1O B;  2OCE A;  5CBA E;  4A3J G;  1QJO A;  5IOC A;  3IRB A;  1Q82 C;  4JK1 C;  2NVY B;  1SRO A;  2KCN A;  5ISR A;  3D3R A;  1IXR A;  4I7A A;  3E6Z X;  2WP8 J;  4P73 A;  1JC7 A;  2F1M A;  4DAY A;  4DNI A;  1N33 Q;  4K5W A;  1YNN D;  4C2M B;  1LTT D;  5I2Y A;  4BBS G;  3F2D A;  1LTG D;  1HNZ L;  4A3F H;  2F0W A;  1E1T A;  2IT1 A;  2X6G A;  3VYR A;  1LO5 D;  2E76 C;  5DM7 3;  2VNU D;  1T5X D;  3HFZ B;  1J9O A;  4QQB X;  4A3L G;  1WJJ A;  1R9T H;  3S1Q B;  3ERO A;  4A3I B;  3HRZ C;  3K7A B;  4DUY L;  2YU9 B;  1XNR Q;  4GS3 A;  5C0X H;  3N52 A;  1LTI D;  3V2T A;  4DNT B;  1C8C A;  3VR6 A;  3CMA A;  3PSI A;  2GVB A;  4BS9 A;  4J6H A;  1A15 A;  4GKK L;  1OXS C;  2ZJQ A;  3R93 A;  4BA1 I;  3GTP B;  2F0I A;  3RN5 A;  5IE8 A;  1GUW A;  5I6W A;  4YCV A;  3HOX B;  3S1R H;  2LKV A;  1WTQ A;  4JI6 Q;  3PO3 H;  1Q3L A;  1WOC A;  3DM3 A;  2F4V Q;  3CU7 A;  4X66 L;  1K0R A;  1NMG A;  3ER0 A;  3CRL C;  4LF8 Q;  1IL8 A;  1SNC A;  2RA4 A;  5M5X H;  4LFC Q;  1IYU A;  5JAV A;  4FF3 A;  4JI7 Q;  1X56 A;  4ZUI A;  2JA7 G;  3H0G H;  4J1M A;  1AH9 A;  2XVS A;  5AJ3 Q;  1I4X A;  4IUN A;  4HID A;  1MSH A;  4BY7 B;  1XYI A;  1PV4 A;  3J81 i;  4TKO B;  2WIN B;  1FYC A;  2KHS A;  4C3H G;  4LMQ D;  2A68 D;  3FRP B;  1VQB A;  3T16 A;  2F3W A;  1T9H A;  1WTW A;  3DMU A;  2BH8 A;  1A63 A;  4KHZ A;  4CKE A;  2TMP A;  5FLM G;  3OMG A;  4A3K H;  1SNO A;  3F2B A;  4YY3 Q;  5ELF A;  4B9X A;  2RCN A;  4P72 A;  1E22 A;  2NZH A;  1L1O A;  3BVM A;  4DR3 Q;  1XTD A;  5JJK A;  1MI2 A;  1QVF A;  1TT2 A;  1UAP A;  3CCL A;  1D1K A;  5EKK A;  2Q8I B;  1GUN A;  2KEC A;  1TWA B;  5EBD A;  3BS1 A;  4RCN A;  2E8G A;  3E3X A;  1WTO A;  3D6C A;  5M3F B;  2K50 A;  4K6L A;  1JWU D;  2ZM6 Q;  1PH2 A;  4HJ9 A;  5EJW A;  1V1O A;  2G5D A;  1AEX A;  2LMC B;  3HOW H;  4BY7 G;  4NW2 A;  5IYB G;  1VQ7 A;  4QUF A;  4JBJ A;  1P16 A;  3K58 A;  1OXV A;  4LFA Q;  3K81 C;  1EY5 A;  2OEO A;  2RCF A;  1RIP A;  3NBI A;  4CJ2 C;  2A69 C;  3NUC A;  2L12 A;  1J5E Q;  4PZ8 A;  3MTS A;  4E6I A;  4L5T A;  2PNH A;  1LTR D;  3LGJ A;  2UXC L;  5C4X G;  2AUK A;  2B2U C;  4N8F A;  1N9W A;  4UP8 A;  2AQ3 B;  1T5E A;  3BU2 A;  2WB1 B;  2Q2T A;  5M5Y B;  1VQ5 A;  3M4O H;  2FMM A;  1HJP A;  2K5Q A;  1E3P A;  1CUK A;  1SE8 A;  3K80 C;  4MNO A;  4ZKB B;  3SDZ A;  1ET9 A;  3PIP 3;  1QZH A;  2KOL A;  2J4X A;  2QEX A;  1YNJ C;  2Z1C A;  4CKC A;  3GTL H;  1K28 A;  2Z6B A;  1OO9 B;  1G2S A;  4B3R Q;  5CV4 A;  2QDB A;  3STB D;  1SYF A;  2A8V A;  1TWF B;  1FD7 D;  5HY6 A;  2D5D A;  1Q90 A;  4ABN A;  4APV A;  1CQV A;  2Z4H A;  1XPO A;  4KKS A;  2JE6 I;  2JA7 H;  3LWU A;  1AN8 A;  2K5D A;  4K14 A;  1QUQ B;  2UXD Q;  4DR4 L;  4JVZ A;  5IYC H;  4GN5 A;  1YNX A;  1UE1 A;  2I0Q A;  3CD6 A;  3GQB A;  4FVM A;  4QIW B;  3B6Y A;  2DGY A;  3PCO B;  3MFY A;  3VYT A;  1EWH A;  1YHA A;  3NTH A;  3I4M G;  2RQX A;  1SXT A;  1FR3 A;  2R7F A;  3KF8 A;  3FKI H;  2JEB I;  3T1H L;  2G9H D;  3KF8 B;  2IL8 A;  2LSS A;  3TZU A;  3HGB A;  4HJ7 A;  1IZ6 A;  3OHX C;  3ULJ A;  4U68 A;  1QOH A;  1K8A C;  1VQI A;  2IW3 A;  3OW7 A;  1SYB A;  4DAY B;  1WYD A;  5BR8 Q;  1D5M C;  4XYQ A;  1Y1W B;  4HAE A;  1MJE A;  3EN2 A;  4GKJ L;  1STG A;  1ZEQ X;  4BY1 G;  3G48 A;  5E3F A;  1STY A;  1ZYR C;  2A19 A;  5IWA L;  1EIF A;  4JI4 Q;  2H5X A;  4PMW A;  3FPP A;  3LX0 A;  4WJ3 M;  3CKI B;  2PZW A;  4A3B H;  4LUZ A;  1LV9 A;  4R4I A;  2MQH A;  1PH5 A;  1O7L A;  1SJH D;  5M9O A;  5JVH 3;  1QUQ A;  4A3E G;  1U4R A;  4LFB L;  2AQ1 B;  3D4R A;  3I4M H;  1SYD A;  4JV5 L;  1KAA A;  4Z9C B;  3PIP A;  2K7V A;  2Z6K C;  1E24 A;  2DJG C;  1GUO A;  2Y0S G;  3C1F A;  1KAB A;  1VDZ A;  3WOE A;  3CF5 A;  4JI2 Q;  2D62 A;  2KEE A;  3QR8 A;  1B7Y B;  4X3T A;  3EFX D;  1PRT B;  4U67 3;  4YHH Q;  3CXC A;  4YWL A;  3G4S A;  1GHJ A;  3OIP A;  4JI1 L;  5G3L D;  4DR3 L;  1RCV D;  2N49 A;  1KTK A;  2PI2 A;  4DR7 L;  1K8M A;  4OX9 Q;  1WI5 A;  1HNX L;  1HZB A;  2B2Y A;  1VQ6 A;  5IY0 A;  4DV0 Q;  2ZXR A;  2EXZ A;  3GTG B;  1X3Q A;  4JI3 L;  4Y7N B;  3Q24 A;  4I7Z C;  2L15 A;  1TY2 A;  3IFD A;  1C9O A;  4H44 C;  3TQY A;  1ASY A;  4ZUJ A;  2MO0 A;  4QY7 A;  1DON A;  2F03 A;  3I91 A;  5HGQ A;  1ONL A;  5EBC A;  3NHH A;  2BCO A;  3J7A 5;  5KRU A;  1TWG B;  3ITP A;  3BDO A;  3T56 B;  2F0N A;  4DV6 Q;  3GO5 A;  1EY9 A;  3LWE A;  3TP7 A;  5GRO A;  2CWA A;  3Q23 A;  1X54 A;  2E75 C;  1ICF B;  1Q1B A;  4A3M H;  4LAA A;  5IT9 E;  4DV2 Q;  1SJE D;  3CCM A;  5JOB A;  3I4N B;  3PUV A;  4MTK A;  5DNF A;  3RMH A;  1TQO A;  3K5M A;  2XIW A;  5FO8 B;  4K5V A;  1VMC A;  5ELN A;  3GDE A;  5E7N A;  4EQP A;  3MXG A;  5CR3 A;  3MWY W;  2L9H A;  1K83 B;  1JWM D;  4CDC C;  2F0O A;  2O5I C;  1SE2 A;  2IJ0 A;  3SK6 A;  5C44 H;  2E5L L;  1E7Z A;  5C3E G;  1SND A;  3OTO L;  2VS1 A;  1UEA B;  1STA A;  1B4O A;  5JEA J;  1Q7Y C;  2DJF C;  3CW2 C;  3I4N G;  3D0F A;  3G6E A;  2F3I A;  4FYD A;  3PUZ A;  4A3D B;  1XMO L;  4A3J B;  3E5S A;  3NWT A;  4OWT B;  2YTY A;  2HQL A;  4NPS A;  1IL2 A;  3I56 A;  2H1E A;  5FK9 C;  1L0X B;  1V8Q A;  4DUY Q;  4L5S A;  2MUY A;  5AFW A;  4JI1 Q;  4DU9 A;  4HIK A;  1V1Q A;  1AW7 A;  4JI8 Q;  5EQ0 A;  3FHW A;  4FF1 A;  3NTI A;  3J80 L;  2UXC Q;  4BY1 H;  3RZD H;  2EY2 A;  2EYL A;  2GVA A;  1EWC A;  1G8Z D;  1HTP A;  3NK9 A;  3Q6S A;  1H9M A;  1H9S B;  5EKL A;  4DGZ A;  4OL7 A;  4XT3 B;  3OWE B;  3GTM H;  4IFD H;  3P7J A;  4ZYS A;  5LL6 X;  4EQO A;  5LHY 1;  4GLA C;  3HKZ G;  1XJV A;  5K5P A;  1U5K A;  4UHV A;  3M4Q A;  1Q8I A;  1JCK B;  5I4D A;  4A93 G;  1BDO A;  4IUU A;  1CHP D;  2ZM6 L;  1C4Q A;  4PV1 C;  4LK1 C;  1PFM A;  1XPR A;  3GTP H;  3NPP A;  1Y14 B;  1WVL A;  3A7L A;  3I90 A;  4YWK A;  2VY3 A;  3S1R B;  2C9O A;  2PQA A;  1B44 D;  2WV6 D;  4GN4 B;  2R3Z A;  2HCC A;  3GTO B;  4A3E B;  1KLU D;  5C5L A;  2PQE A;  3W1G A;  3I2Z A;  4DR5 Q;  5EPL A;  3P20 A;  1ET6 A;  3PMF A;  3JAM E;  3FKI G;  4CGY B;  5A2Q L;  5CV6 A;  3SK8 A;  3SEB A;  1CT1 D;  1VQ8 A;  2NVX B;  1TWG H;  2XWB B;  4IJL A;  1PTO H;  1K73 C;  2UUB L;  1YHB A;  4IPC A;  1Y1V H;  3HZX A;  2K01 A;  2OT2 A;  4R4Q A;  4BY7 H;  2Z8L A;  2IX0 A;  5JPM C;  1G29 1;  3S1M B;  2F0G A;  4OON A;  2R93 G;  4HIM A;  5JJL A;  2V1C C;  3I4N H;  2ICE C;  2BE5 D;  1Z7T A;  2JSO A;  5E4X A;  1I4Q A;  1PH3 A;  1CKN A;  3DEO A;  2R61 A;  1FGB D;  3PUW A;  2KUM A;  3V96 A;  4AQY L;  1TWF H;  3D4W A;  1XMQ Q;  4X66 Q;  3HOU G;  1Q86 C;  3KBX A;  1HZ9 A;  4OEL B;  3ZYY X;  1DXM A;  2KED A;  1A0I A;  1EY8 A;  1QG7 A;  1TWC B;  5KND A;  5E1F A;  3T1Y L;  3MXU A;  2FFK B;  3S15 B;  1WCM G;  2PNR C;  3H0G G;  5IGB A;  1F9Q A;  3HOV B;  1SE4 A;  3BZK A;  3M4Y A;  3K0Y A;  4AQY Q;  2F0K A;  1WCM B;  3EJI A;  3KJP A;  3ND8 A;  2KCC A;  4ZRZ A;  1PH7 A;  2K5N A;  2LS0 1;  4QMG A;  1VQE A;  4A3F B;  2E2H B;  4LF5 Q;  2HUG A;  4QUC A;  2Q8T A;  3PQI A;  2VUM B;  3GTG H;  1LTL A;  3H3V I;  4BY1 B;  4UP7 A;  4DV1 Q;  5D3D A;  2N8N A;  3K7A H;  3ND9 A;  1NJI C;  4IOC A;  1N34 L;  4RGN A;  3M4P A;  1K9M C;  1EYC A;  3H91 A;  2N3S A;  1LYL A;  2QKI C;  1GD7 A;  4OHJ A;  4PNY A;  4A3M G;  2QA4 A;  2MO1 A;  1N33 L;  3DWA A;  4DA2 A;  2NN6 H;  4KY5 A;  3RLF A;  3GV6 A;  4X6A H;  2KHJ A;  1KNE A;  4DV0 L;  1QZG A;  1IBK L;  1I94 Q;  2Z9H A;  4JC0 A;  3QJY A;  1ASZ A;  1XXG A;  1X6O A;  2PMZ B;  3PO2 B;  3TDQ A;  2BH2 A;  1G6P A;  3W5O A;  4R8I A;  1EYD A;  3AU7 A;  1ESF A;  3QB3 A;  1B50 A;  1CSP A;  5C5M A;  2RVL A;  1WTH A;  5IIF A;  1Z47 A;  3GTJ B;  2A1A A;  1STN A;  3S2D H;  1IBL L;  4L63 B;  1CZG A;  5C6A A;  1IBM Q;  3A7A B;  1TWH B;  4JCV E;  5IGC A;  3H6M A;  4ME5 A;  3L7Z C;  1EIG A;  1H9J A;  3E0J A;  4HSP A;  4GNX C;  3DEP A;  2B39 A;  1FL0 A;  1PRT F;  1YJN A;  1IBK Q;  1C0A A;  5D3I B;  4F8M A;  4JI0 Q;  1Z9F A;  2FIN B;  4F87 A;  1YIT A;  4RWS C;  3MXP A;  1NMF A;  1HNW Q;  3JAM i;  3T4A C;  1EZ8 A;  2K5V A;  1DZ1 A;  3T53 B;  2K05 A;  2E2D C;  3C46 A;  1GXD C;  2K4K A;  5E4W C;  3J7Z C;  1EY7 A;  5AJ3 L;  1RJT A;  2Q2U A;  3VR4 A;  4Y7N H;  1TY0 A;  4A3K B;  1HR0 W;  2WKC A;  4LF5 L;  3IL8 A;  3ULP A;  3RZD B;  1G2T A;  2RDF A;  4V19 0;  2D0P A;  2XN9 C;  1WTR A;  3MHB A;  5LMN Q;  4IFD G;  2NWG A;  2VB3 X;  4N9T A;  1JJC B;  1EY4 A;  2F0V A;  5ELB A;  2M2L A;  2NTT A;  1YJ9 A;  3TME A;  2D0O A;  5FJ8 G;  1CM9 A;  2RSN A;  4ZCK A;  1S4Z A;  3K5N A;  1YNN C;  1STB A;  1TWA H;  1SYE A;  5KIX A;  1ROD A;  3RR5 A;  4LF4 Q;  3S15 H;  5CBE E;  3S16 B;  2PO4 A;  5C3X A;  1LTA D;  3S1N H;  1C7Y A;  2R93 B;  3KLW A;  5A35 A;  1ENF A;  4KKU A;  4A93 H;  1PTO F;  2NVQ B;  3BDL A;  1EUJ A;  1BR9 A;  4DR6 L;  1K83 H;  4EQ5 A;  2EDG A;  4NXM L;  3BVZ A;  5TSS A;  2V4D A;  5HGT A;  3HOU H;  1KRS A;  1YEZ A;  4IN3 A;  4H13 C;  4LJZ C;  1ILQ A;  1U4P A;  2PI2 E;  4L5R C;  1EYA A;  1K3B C;  3FP9 A;  2EQS A;  4DV6 L;  4B3M L;  5LMU L;  2RDG A;  2EPB A;  4FXG C;  1KNA A;  1Q81 C;  1JJ2 A;  1H9K A;  1F2Z A;  2FXQ A;  4A3D H;  4MN3 A;  2CKZ B;  1JOR A;  3KK7 A;  1VF5 C;  1Y1V B;  3K5L A;  4HCE A;  2EY6 A;  2R6G A;  2XGT A;  5C4X B;  2LXJ A;  4JI3 Q;  4J8Q A;  4K8J A;  1DOM A;  3HOZ H;  3OYY A;  1ESR A;  2JA8 B;  1HNX Q;  2FMC A;  1HQR D;  3NTK A;  3A74 A;  2X69 A;  4C1N I;  1D1I A;  2ZJP A;  1LAB A;  3A8J E;  3FDT A;  3NEM A;  4A76 A;  1FJG Q;  4AYB G;  1JOQ A;  3AFP A;  1EU4 A;  1PTO C;  3IFT A;  1B2T A;  5IYB H;  2NN6 I;  4HMJ A;  1WFQ A;  5IGD A;  2A69 D;  1KRT A;  3KDF A;  1GHK A;  1B8A A;  3MVV A;  4N8X 1;  1RL2 A;  4RKB A;  1Y8O B;  2FHT A;  1HNW L;  1PHJ A;  4YIJ A;  2PCF B;  1KLG D;  3SXH A;  2J0T D;  4X3S A;  2CVR A;  1SFO B;  3C3L A;  1ILP A;  4RMF A;  4LFB Q;  1RDP D;  4FO2 A;  3MXN A;  5GQO A;  3S17 B;  3HOW B;  1RHP A;  2E2H H;  4KMU C;  1EL0 A;  4C3I G;  1EY0 A;  1VQK A;  1SNM A;  2VUM H;  5J39 A;  1DOL A;  5M3F G;  4X65 Q;  2KHI A;  3ONA B;  2ZTC A;  1JB3 A;  2J7Z A;  5I6Y A;  2BA0 A;  4HIO A;  4GKJ Q;  1IHZ A;  1I6H H;  2F0F A;  4LF7 Q;  4GLX A;  4YY3 L;  1M1K C;  5BR8 L;  2DUD A;  3M7G A;  1CKO A;  5IT9 L;  5KNC A;  1NR4 A;  3RZO H;  2PZU A;  3QO2 A;  1EQV A;  2EYF A;  3AEV A;  1N34 Q;  2B2W A;  2EXD A;  3BVG A;  3S1N B;  2E2I B;  1SMX A;  4N9P A;  2XRS D;  4KN4 C;  3AB9 A;  4WRD A;  4QL5 A;  4LF6 Q;  2NVQ H;  1XPU A;  3JAM c;  3IAY A;  2JP1 A;  3G7L A;  4GKK Q;  2B29 A;  3HOV G;  1BBU A;  2O4X A;  1TWH H;  2ZTE A;  1JIC A;  3RLO A;  2HHH L;  2L0C A;  2N88 A;  3QIA A;  3Q0A A;  3HOU B;  1M8A A;  2JXM B;  4DR4 Q;  1YVC A;  4F88 A;  4IPH A;  1Y8P B;  1J8I A;  1Q1E A;  1B70 B;  1PFS A;  5GAE C;  4LF6 L;  1ICW A;  2QW7 A;  5IYD G;  4ULL A;  3CHB D;  4K5X A;  4DN4 M;  3S2H H;  4LF9 Q;  5IYD H;  1MIU A;  4GOP A;  4QIW E;  3I55 A;  1U0L A;  1GO3 E;  5LMN W;  5J1Z A;  5FOB B;  4G7O C;  4DAM A;  3MA2 B;  5F2D A;  4IUQ A;  1BQQ T;  2EYM A;  1U4M A;  1S3O A;  1SMY C;  1VF7 A;  4ZAI A;  5BN3 A;  2JA8 H;  1B53 A;  2XSC A;  3R2I A;  4IFD I;  1E2W A;  5C0X I;  5LMN L;  3CME A;  1VQH A;  4DV3 Q;  4IQZ A;  3KLR A;  2K75 A;  4DR7 Q;  1E2Z A;  4ZLT F;  1QNK A;  4X65 L;  3W3A A;  1BBW A;  3OSO A;  4DR2 L;  4KK7 A;  1Q8K A;  3M85 A;  5M5Y H;  1AZP A;  1PYW D;  5BN5 A;  1MD2 D;  5T1G A;  1EU3 A;  1U4L A;  2HDM A;  3TZD A;  2JA5 H;  3GTK B;  1EEF D;  1N36 Q;  4A4I A;  1YIJ A;  1PFN A;  2EE1 A;  5FJ8 H;  2ENB A;  2EYJ A;  2NVT B;  1I50 H;  2Q8R E;  2WKD A;  1NBW A;  1EYG A;  5C3E B;  4XXE A;  1BBX C;  2Q2I A;  5T1I A;  1X3P A;  3NQT A;  4NDX A;  2RF4 A;  1CKN B;  1OXU A;  5NUC A;  3AMU A;  2MPM A;  2IX3 A;  4BXX H;  1HQM C;  1F9P A;  2UUA L;  2JA7 B;  4GOP B;  1ZKO A;  4IUV A;  4JI4 L;  1D6E C;  3NBH B;  1XTC D;  3UE0 A;  4MIU A;  1TWC H;  2L55 A;  4A3D G;  1EQT A;  4K0K L;  2OTJ A;  4A3I G;  1D5Z C;  1KD1 C;  4B3S L;  2R7Z G;  3UDI A;  1CSQ A;  5HUR A;  5IT9 c;  3M3Y B;  5FKA C;  2RBM A;  3VR2 A;  2F0U A;  3FPU B;  3FKI B;  1BCP F;  3I73 A;  5C4Z A;  4Q0F A;  1NSN S;  4NMZ A;  4K2L A;  2BOS A;  1O7Z A;  2F4I A;  1Y8N B;  1V43 A;  1II3 A;  1M4V A;  1UE5 A;  2ZXP A;  4DV1 L;  1SR3 A;  1M90 C;  4B3M Q;  1C48 A;  1MJC A;  1NCV A;  4DR2 Q;  1BNZ A;  2AHO B;  3AYH B;  4BWG B;  5DAU A;  4LWC A;  1PZJ D;  1H9S A;  1A3U A;  1EZ6 A;  1KDC A;  3E9I A;  3IKJ A;  4YCW A;  2LXK A;  3HKS A;  1NR2 A;  2EZV A;  4HSV A;  5KNB A;  1PFB A;  1ZYR D;  4DV2 L;  1SBB B;  3K7U C;  5M3M H;  2PZT A;  1PH1 A;  3NE5 B;  4WFN 3;  3QG1 A;  4CDF C;  4BA2 I;  3HG9 A;  1LTS D;  4A75 A;  3PF5 A;  5M3M G;  1HHV A;  4KHP Q;  5ELC A;  3O13 A;  2CCZ A;  1I3Q B;  3CAM A;  3J80 E;  4A93 B;  1SSO A;  3GV3 A;  3S17 H;  4XQN A;  4DK3 C;  2E5L Q;  4JG2 A;  3AFQ A;  3GTO H;  5BN4 A;  2ZXO A;  4K6D A;  3OIQ A;  3SK4 A;  3OW2 A;  1VQC A;  1A3V A;  4DV4 Q;  3DHQ A;  5G3L F;  2ATW A;  2HHH Q;  3M9B A;  2UUC Q;  3CRK C;  2CH4 W;  2HD3 A;  2KEN A;  4GNX B;  3KYH C;  2Q2H A;  1I6H B;  4IO9 A;  4A3B G;  4EVO A;  3BYT B;  1S5C D;  3DWP A;  4R4T A;  4DNR B;  2JA8 G;  2RHQ B;  5L37 A;  2RHS B;  4RKL A;  2JA6 H;  3A8I E;  2F0L A;  3S9W A;  3RZO B;  1F2L A;  2F0T A;  3RD4 A;  2R7D A;  3KF6 A;  4G7Z C;  3PUY A;  3GTK H;  4JI2 L;  1RD9 D;  1UE7 A;  4C1N K;  1GM5 A;  3HOZ B;  5ELD A;  4G4K A;  2NB0 A;  3I72 A;  4F7X A;  2BDN A;  2K28 A;  4MTN A;  2F0J A;  1H95 A;  1DOK A;  3PUX A;  5COR A;  4DR5 L;  5K36 G;  1O7I A;  4FXD A;  5IYC G;  2YYZ A;  2MHV A;  1YNJ D;  4DFA A;  4HED A;  2HT1 A;  1TKW B;  2NZO A;  4KLK A;  3J7A F;  3P1H A;  1VS0 A;  1EFW A;  4RAU C;  3K59 A;  4PZ6 A;  3PF4 A;  4ZQ3 A;  4EGV A;  1HXY D;  4A3M B;  1PTO D;  1V1P B;  2UUA Q;  4FXK C;  1CTM A;  2B2V A;  1I4G A;  1TS3 A;  2I5L X;  2K5H A;  4DXF A;  1K0S A;  5J22 A;  2DNC A;  4HR7 B;  2F0S A;  3KLS A;  3OMC A;  5IP7 G;  3I4M B;  2SOB A;  4YCU A;  3RNU A;  2IWH A;  3SVM A;  4AYB B;  1FNW A;  1WTV A;  1TS2 A;  5IP9 G;  1MKH A;  4GN3 B;  1A2U A;  1BVS A;  2A5H A;  3GP7 A;  3BYY B;  5LMU Q;  3S1Q H;  3RUZ A;  4JI8 L;  2NTS A;  2EJM A;  5FO7 B;  4HJA A;  1VQ9 A;  4R9W A;  1ENC A;  3CQZ H;  2A74 C;  1S5B D;  5I9O A;  3ICE A;  1VQD A;  3QOL A;  5J3B A;  5ELO A;  1CFM A;  4JI7 L;  1SYC A;  4HTH A;  4O0A A;  1UNS A;  4CBV A;  4DAV A;  1XMO Q;  2MJ8 A;  4DKA C;  2F0P A;  5C4H A;  4Y52 H;  1Q12 A;  2K03 A;  3BZD B;  4C3J G;  4CDD C;  1IYV A;  3STB C;  3NSW A;  3KLS X;  2UXB L;  3PV0 A;  2VQE L;  4LF4 L;  1UEB A;  4JI5 L;  1VQO A;  4ILW A;  5C0X J;  4KHP L;  4JYA Q;  4IFD J;  1GVP A;  1XMQ L;  2B8G A;  1L0W A;  2CHB D;  1D8L A;  4A3K G;  1W2B A;  3TP6 A;  1KQS A;  4OGQ C;  3EQL C;  3KDF B;  4EQN A;  4Q5V A;  2IY5 B;  1TU2 B;  3ULL A;  4DR6 Q;  1AFP A;  4C3I B;  2ES2 A;  1D2B A;  1NE3 A;  1DD2 A;  4TVA B;  3R2T A;  3S2H B;  1JB7 A;  3JC6 6;  3R8B A;  2K1B A;  3CC2 A;  1B9M A;  4C56 C;  2P5Z X;  3G71 A;  1HZC A;  2RSO A;  4JI5 Q;  3D6W A;  1HUN A;  3S24 A;  2ID0 A;  2LY7 A;  3VA7 A;  1HNZ Q;  2PYK A;  1GUS A;  3NEL A;  3G6J B;  2M00 A;  5JEA H;  1B3A A;  2B2Y C;  1A8V A;  1Q46 A;  2K52 A;  2L1B A;  4NXN L;  3CCV A;  1VQG A;  2OXP A;  4PMB A;  1G6Z A;  4XIG S;  4K0K Q;  3U4V A;  4UY8 C;  4L6T B;  1F2Y A;  3U9O A;  3CCR A;  5IGF A;  4CHT B;  4PG3 A;  1IBM L;  4YHH L;  1IBL Q;  3ERQ A;  1EY6 A;  1NAP A;  2VW9 A;  3BZC A;  4RH6 A;  3MEF A;  4FF2 A;  3GTQ B;  1TVX A;  1I4P A;  4C3H H;  2PMZ E;  4IOA A;  3J81 E;  3HOX H;  4K2K A;  2L11 A;  3CPW A;  5CYU A;  3MEH A;  2BDO A;  3PGZ A;  2E2I H;  1I3Q H;  1BO0 A;  1I50 B;  4XDX A;  2QGQ A;  3LNN A;  1JQY D;  4JI0 L;  2PW7 A;  4ZKC B;  4OO1 G;  3GTM B;  2AWN A;  4XTC S;  4JV5 Q;  4KI0 A;  1I4R A;  1V9P A;  1GUT A;  1KHI A;  2VUM G;  3NP8 A;  2AUJ D;  4P75 A;  1HUM A;  4KY7 A;  3NQI A;  5CC4 A;  1KC8 C;  3L0O A;  2H4O A;  5IOD A;  5JJZ A;  4KV6 A;  3N6R A;  2B2W C;  1JE4 A;  1JJG A;  2WAC A;  4OIJ A;  1IW7 D;  1LUZ A;  4A3F G;  2EYO A;  2KCT A;  4FDB A;  1O78 A;  1DCZ A;  1XWE A;  4RHS A;  4QGU A;  4G7H C;  4UAI A;  2QIL A;  1UE6 A;  4IUR A;  1S5D D;  3M4O B;  4NB3 A;  1LT4 D;  1R4Q B;  2WII B;  5M5W H;  2XRQ D;  1IW7 C;  4PZ7 A;  4R4C A;  4A3G H;  1KDA A;  4DF7 A;  4UDU C;  1AP0 A;  3U4Z A;  1OXX K;  4OWX B;  3GTL B;  3F2U A;  2B63 H;  3MZ5 A;  2FJ2 A;  2TSS A;  4BBS B;  2DNE A;  4LF8 L;  1Y69 U;  2GA4 B;  2B2U A;  2K33 A;  1LT5 D;  3T1Y Q;  2MGS A;  1OXT A;  4GOP C;  3OTO Q;  2YTV A;  5KEE A;  1MBY A;  1U9R A;  2PQA B;  3CC7 A;  2G9D A;  4NXM Q;  2K14 A;  5JEA G;  1YJW A;  2D2C C;  1IYJ B;  1GJX A;  1PRT D;  3F8T A;  2AKW B;  3F1Z A;  2E2J B;  2I46 A;  3TS2 A;  4X3U A;  1NTG A;  4P71 A;  3A5Z B;  3J81 L;  4X62 L;  3HOY H;  4JYA L;  5I2X A;  2O5J C;  4H7B A;  1YBY A;  2VB2 X;  2OQK A;  2CH4 A;  1L0Y B;  2VQF Q;  4B3R L;  3AQQ A;  4HJ5 A;  1BKB A;  4H02 A;  4YWM A;  4DK0 A;  3X3N A;  1GKH A;  1EOT A;  3ERS X;  3FVQ A;  5ELE A;  1Y1W H;  4IJH A;  1VQL A;  4RFB A;  1HTL D;  1CA6 A;  2A68 C;  3E9H A;  1WCM H;  1TS4 A;  3BJU A;  1FNV A;  2JEA I;  5C4X H;  4OX9 L;  1HCZ A;  2B2T A;  3T13 A;  2WAQ G;  4LUO A;  4PQX A;  5DM6 3;  1QNU A;  2F0E A;  3HS0 C;  1O80 A;  1VCI A;  4O42 A;  2XWJ B;  1AE2 A;  2C35 B;  4RA8 A;  3MC0 B;  1HR0 L;  4B3T L;  1DJR D;  1S72 A;  1A2T A;  1W6J A;  2UU9 Q;  4L8J A;  1K3R A;  2WFW A;  4CDE C;  2UUB Q;  4CJ1 B;  1I6V C;  4WOR A;  2I07 B;  1WD1 A;  3GD7 A;  1A62 A;  5D65 A;  2RKS A;  3D4D A;  2A73 B;  4RHR A;  1P8L A;  2B8F A;  4QJF A;  3HOX G;  1HH2 P;  3VYU A;  5CMD A;  2CW0 C;  4DR1 Q;  4RGO S;  4OXP A;  3K8A A;  1BXT A;  3PO2 G;  1N36 L;  1FGU A;  3J7Y W;  3VR5 A;  2A6H C;  2UU9 L;  4ODG A;  4DAP A;  2DY7 A;  3PO2 H;  3A5U A;  1CK1 A;  1JR0 D;  4DPG A;  2JA9 A;  4QF4 A;  5IP9 H;  2R92 B;  1PXU A;  3J7A V;  4GLV B;  3GTJ H;  3BG3 A;  5KYI A;  2NUC A;  2I5M X;  3S2D B;  2ALY B;  4BBR H;  1XX8 A;  3L3O C;  5CV8 A;  3D8G A;  2CFM A;  3X3M A;  4DV3 L;  4NXN Q;  1I94 L;  2VZA A;  3E0E A;  4J15 A;  1PYS B;  5FLX c;  1SDF A;  3DLL A;  1LM0 A;  4IUP A;  1VMP A;  1PH6 A;  1RF2 D;  4KJN A;  4M1U B;  3H3V H;  2N78 A;  2WB1 E;  4DV7 Q;  3TP8 A;  1F77 A;  4I65 A;  2PW5 A;  1RTN A;  3R3O A;  3J81 j;  1JWS D;  4X62 Q;  1STH A;  1Y1W G;  1W6K A;  3CCE A;  4FF4 A;  3WOF A;  4R8N A;  1G51 A;  1YI2 A;  3EBE A;  3K6O A;  2NVT H;  3KF6 B;  4TQU S;  4AH6 A;  3TS0 A;  3K57 A;  1W3S A;  2BE5 C;  3UDX A;  1QIL A;  2R7Z H;  4QCL A;  1QWY A;  2EJF C;  2E2J H;  4NKL A;  3A54 A;  1HFG A;  3T51 B;  3CCU A;  3HKZ E;  1ML0 D;  4KN7 C;  4WJ4 A;  2HIV A;  3L2P A;  2F4V L;  1OTC A;  3MFG A;  3F2C A;  4RGM A;  2K6A A;  1L1O C;  2KBN A;  2VXW A;  1WD0 A;  2VQE Q;  1G91 A;  5JPN C;  2SDF A;  2UXB Q;  1EWI A;  3SGI A;  3TRZ A;  2NVY H;  1YHQ A;  1JOO A;  1PH8 A;  3ZJY C;  2C5C A;  1F2M A;  4A3J H;  1BF4 A;  1V1P A;  5DLQ E;  1X55 A;  1WTP A;  1SRU A;  5K36 H;  3I4L A;  1PVO A;  4IPD A;  5H1S E;  1VQN A;  1GUG A;  2JA5 G;  1BCP B;  4JBW A;  1XNR L;  3L9A X;  3TN2 A;  5JVG 3;  1PZK D;  4OIK A;  5C44 G;  2F52 A;  3J80 c;  3U9S A;  3CP0 A;  3VDY A;  3OWF A;  3QOJ A;  4BBS H;  5CGK A;  3KBG A;  1CZW A;  2EYH A;  2GN5 A;  1SEB D;  4IPG A;  1SLJ A;  4MZ9 A;  3DXJ C;  4DV7 L;  4A3G G;  1A6X A;  1DYQ A;  3OPO A;  3VYS A;  1E2V A;  1SAP A;  2L5T A;  2HDL A;  4HN7 A;  4QB4 A;  1I4H A;  3CCJ A;  2Y0S E;  4A3C H;  4JOI C;  4LF7 L;  2LFN A;  2F0M A;  3CCQ A;  4GZY C;  5EKI A;  2CQO A;  1E1O A;  1CQF A;  3HEJ A;  4XYO A;  2QF7 A;  3PO3 G;  2KVM A;  3SHL A;  4KJO A;  4S3S A;  2KQ3 A;  2E74 C;  5GAD C;  5C4J B;  3M7N A;  1MSG A;  5C3E H;  2OTL A;  3CCS A;  1K8G A;  1EOV A;  2IHE A;  2NZ1 D;  2WAQ E;  2SNM A;  4ID6 A;  1MHW C;  3I8Z A;  5IWA Q;  1FJG L;  1NY4 A;  4MHE A;  2ZT9 C;  1RTO A;  2CW0 D;  3V05 A;  1AZQ A;  4L5Q A;  1ENA A;  5DEH A;  3I4O A;  1EQR A;  3U58 A;  1N32 Q;  5FO9 B;  4P74 A;  5A2Q E;  4XT1 B;  3W1B A;  4KD4 A;  1SFO H;  5IGE A;  2NVX H;  4R4O A;  1HA5 A;  4C3I H;  2HQE A;  1LT3 D;  1LLR D;  5C3W A;  1PMR A;  1HZA A;  1X3F A;  2K5W A;  1HR0 Q;  4B3T Q;  1H9R A;  1S40 A;  1KDB A;  1PH4 A;  2EOT A;  3T1H Q;  4WJW A;  2JN4 A;  3J81 c;  1VQA A;  2YV5 A;  1CHQ D;  4ME3 A;  3TEH B;  5M5W B;  1KIX A;  2N55 A;  1PA6 A;  3FEW X;  3WWV A;  5FLM H;  3TRE A;  1IKM A;  4JBK A;  1N8R C;  4KKT A;  2WB1 G;  4LUV A;  1LAC A;  4JOI A;  1JE5 A;  3C1E A;  3H15 A;  4JBM A;  4DV4 L;  3HOW G;  2VL6 A;  2F3V A;  2UXD L;  2A6H D;  4XQQ A;  1EIH A;  3CPF A;  2AWO A;  3WDN A;  2SNS A;  4POF A;  4EX5 A;  4H0L C;  5EPJ A;  2VQF L;  2EVB A;  1LT6 D;  4JI6 L;  2JA5 B;  2B2V C;  1NNX A;  4G57 A;  4LF9 L;  3EVQ A;  3UDG A;  3C2P A;  1NUC A;  3HOV H;  3Q22 A;  1QVG A;  5M3F H;  2MFI A;  1PH9 A;  4AIM A;  5FLX E;  4C3H B;  4HJ8 A;  2B2T C;  3A0J A;  2EYP A;  1Y1V G;  1EEI D;  2DN8 A;  1BCP C;  1SE3 A;  3JAM L;  3H3V C;  3QWN A;  3VA5 A;  4A3C G;  1PYB A;  2F0H A;  4A3E H;  5M5X B;  4DV5 Q;  5IP7 H;  4DUZ Q;  4LW1 A;  4C3J H;  4KY6 A;  2B3G A;  1R4P B;  2QCP X;  3NXW A;  4CJ0 B;  2JQO A;  1SNQ A;  2OF1 A;  4IUT A;  1CKM A;  1BOS A;  2MP1 A;  1STE A;  1HPC A;  3RLN A;  1BCP D;  3A8K E;  2X6L A;  3UDF A;  1DGS A;  1PTO B;  2A6E C;  4UP9 A;  1F9S A;  2XNA C;  2KCM A;  4LFA L;  3A55 A;  3HOZ G;  2AQ2 B;  3HOY G;  3Q8D A;  4OEM B;  3TP5 A;  1K8O A;  2A6E D;  1QE6 A;  2ICI A;  1CI3 M;  4TRD A;  5D14 A;  2RDH A;  3SR1 A;  1SYG A;  3KUP A;  5FLX L;  2PPB C;  4PMC A;  5CV9 A;  2B63 B;  4HMI A;  1D5X C;  5I9P A;  1R9T B;  5GAG C;  1DM0 B;  4A3I H;  5COY A;  1IKL A;  1A3T A;  3OOC A;  2YU9 H;  3K0X A;  1SN8 A;  1QCB D;  1Z6H A;  5KGU A;  2KA7 A;  2ZTD A;  1MGS A;  1TS5 A;  4TSS A;  5KYL A;  1J5E L;  1EQQ A;  3EIV A;  2M9V A;  2SEB D;  3I3C A;  4DK6 C;  3J80 i; 
#chains in the Genus database with same CATH homology
 2EY1 A;  1TR5 A;  4M8A A;  3DM1 A;  4OO1 I;  3URY A;  2DY8 A;  2WAQ B;  1PLF A;  3DWQ A;  3PO3 B;  4OO1 H;  3S14 B;  3HOY B;  4HCS A;  1SNP A;  1PZI D;  2EY5 A;  4CKB A;  4XQJ A;  2NYZ D;  3EA6 A;  1BUV T;  3H0G B;  5C0X G;  1ZXT A;  1TII D;  4IAL A;  4DK1 A;  3A56 A;  5CV5 A;  1B9N A;  1HRJ A;  1CA5 A;  3SE0 A;  4V0B A;  1JOK A;  4B08 A;  1PDQ A;  1B1Z A;  3NBH A;  4FNF A;  1X32 A;  2NBF A;  4A3B B;  2K32 A;  1HFN A;  3D31 A;  1LTB D;  3FMC A;  1QB5 D;  4IZ8 A;  4RCO A;  2R7Z B;  1S5E D;  4DXG A;  1WTX A;  2D9U A;  2HCI A;  2K04 A;  4C3J B;  4O1N A;  2L4N A;  2BA1 A;  5M3M B;  2F0D A;  4KTA A;  3MAQ A;  4B9W A;  1S5F D;  4RGT A;  3HKZ B;  1FNU A;  2Z4I A;  2KJX A;  4A3G B;  4P2C B;  5IGG A;  3PIO 3;  3TBI B;  4BBR B;  3I70 A;  3DUZ A;  4X3K A;  3VR3 A;  3SK5 A;  4ZK9 B;  1E0B A;  1EFI D;  3CQZ B;  3K5O A;  5CV7 A;  2IX1 A;  2JA6 B;  3H09 A;  1UUP A;  5EGT A;  4KHV A;  3TSS A;  2F0Q A;  1SMY D;  3H94 A;  2JYO A;  3UI2 A;  1GOZ A;  1F9R A;  2CQA A;  5EPK A;  1RKN A;  2QEJ C;  2IPK D;  2EJG C;  3NWS A;  5C44 B;  4K8I A;  4KD3 A;  4FP5 D;  1HA6 A;  1O7Y A;  3W2D A;  3HP3 A;  2Y0S B;  5LL6 S;  2O2L D;  3BDC A;  3P75 A;  2NN6 G;  1PRT C;  4NP5 A;  5CBA E;  1QJO A;  5IOC A;  4JK1 C;  2NVY B;  2KCN A;  5ISR A;  3D3R A;  3E6Z X;  2WP8 J;  1JC7 A;  2F1M A;  4DAY A;  4K5W A;  1YNN D;  4C2M B;  1LTT D;  5I2Y A;  1LTG D;  2F0W A;  2IT1 A;  2X6G A;  3VYR A;  5DM7 3;  1LO5 D;  2E76 C;  2VNU D;  1T5X D;  1J9O A;  3S1Q B;  3ERO A;  4A3I B;  3HRZ C;  3K7A B;  2YU9 B;  5C0X H;  3N52 A;  1LTI D;  3V2T A;  4DNT B;  1C8C A;  3VR6 A;  4BS9 A;  4J6H A;  1A15 A;  1OXS C;  3R93 A;  4BA1 I;  3GTP B;  2F0I A;  1GUW A;  5I6W A;  3HOX B;  2LKV A;  1WTQ A;  1Q3L A;  3CU7 A;  3CRL C;  1IL8 A;  1SNC A;  2RA4 A;  1IYU A;  5JAV A;  4FF3 A;  4ZUI A;  4J1M A;  2XVS A;  1I4X A;  4IUN A;  1MSH A;  4BY7 B;  1XYI A;  4TKO B;  2WIN B;  1FYC A;  2KHS A;  4C3H G;  4LMQ D;  2A68 D;  3FRP B;  3T16 A;  2F3W A;  1WTW A;  3DMU A;  4KHZ A;  4CKE A;  2TMP A;  3OMG A;  1SNO A;  5ELF A;  4B9X A;  3BVM A;  1MI2 A;  1TT2 A;  1UAP A;  1D1K A;  5EKK A;  2Q8I B;  1GUN A;  2KEC A;  1TWA B;  5EBD A;  3BS1 A;  4RCN A;  1WTO A;  3D6C A;  5M3F B;  4K6L A;  1JWU D;  5EJW A;  1V1O A;  1AEX A;  2LMC B;  4NW2 A;  4QUF A;  3K58 A;  1OXV A;  1EY5 A;  2OEO A;  3NBI A;  4CJ2 C;  2A69 C;  3NUC A;  2L12 A;  3MTS A;  4E6I A;  1LTR D;  2AUK A;  2B2U C;  2AQ3 B;  1T5E A;  2WB1 B;  5M5Y B;  2FMM A;  2K5Q A;  4ZKB B;  3SDZ A;  1ET9 A;  3PIP 3;  2KOL A;  2J4X A;  1YNJ C;  2Z1C A;  4CKC A;  1OO9 B;  1G2S A;  5CV4 A;  2QDB A;  1SYF A;  1TWF B;  1FD7 D;  2D5D A;  1Q90 A;  4ABN A;  1CQV A;  2Z4H A;  4KKS A;  2JE6 I;  3LWU A;  1AN8 A;  2K5D A;  4K14 A;  3GQB A;  4FVM A;  4QIW B;  3MFY A;  3VYT A;  1EWH A;  3NTH A;  2RQX A;  1SXT A;  1FR3 A;  3KF8 A;  2JEB I;  2G9H D;  2IL8 A;  3TZU A;  3HGB A;  3OHX C;  4U68 A;  1QOH A;  2IW3 A;  3OW7 A;  1SYB A;  1D5M C;  4XYQ A;  1Y1W B;  4HAE A;  1STG A;  1ZEQ X;  5E3F A;  1STY A;  1ZYR C;  4PMW A;  3FPP A;  3LX0 A;  3CKI B;  2PZW A;  1LV9 A;  1O7L A;  1SJH D;  5M9O A;  5JVH 3;  1U4R A;  2AQ1 B;  3D4R A;  1SYD A;  1KAA A;  4Z9C B;  2K7V A;  1GUO A;  3C1F A;  1KAB A;  1VDZ A;  3WOE A;  2D62 A;  2KEE A;  4X3T A;  3EFX D;  1PRT B;  4U67 3;  1GHJ A;  3OIP A;  5G3L D;  1RCV D;  1KTK A;  1K8M A;  2B2Y A;  2ZXR A;  2EXZ A;  3GTG B;  1X3Q A;  4Y7N B;  3Q24 A;  4I7Z C;  1TY2 A;  3IFD A;  4H44 C;  4ZUJ A;  1DON A;  2F03 A;  3I91 A;  1ONL A;  5EBC A;  3NHH A;  2BCO A;  5KRU A;  1TWG B;  3ITP A;  3BDO A;  3T56 B;  2F0N A;  3GO5 A;  1EY9 A;  3LWE A;  3TP7 A;  3Q23 A;  2E75 C;  1Q1B A;  4LAA A;  5IT9 E;  1SJE D;  5JOB A;  3I4N B;  3PUV A;  5DNF A;  3RMH A;  1TQO A;  3K5M A;  2XIW A;  5FO8 B;  4K5V A;  1VMC A;  4EQP A;  3MXG A;  5CR3 A;  3MWY W;  2L9H A;  1K83 B;  1JWM D;  2F0O A;  2O5I C;  1SE2 A;  2IJ0 A;  3SK6 A;  1SND A;  1UEA B;  1STA A;  1B4O A;  5JEA J;  4FYD A;  3PUZ A;  4A3D B;  4A3J B;  3E5S A;  3NWT A;  2H1E A;  5FK9 C;  1L0X B;  1V8Q A;  2MUY A;  5AFW A;  4DU9 A;  1AW7 A;  5EQ0 A;  4FF1 A;  3NTI A;  3J80 L;  2EY2 A;  2EYL A;  1EWC A;  1G8Z D;  1HTP A;  3NK9 A;  3Q6S A;  1H9M A;  1H9S B;  5EKL A;  4DGZ A;  4OL7 A;  4XT3 B;  3OWE B;  4IFD H;  3P7J A;  4ZYS A;  5LL6 X;  4EQO A;  5LHY 1;  5K5P A;  5I4D A;  1Q8I A;  1JCK B;  1BDO A;  4IUU A;  1CHP D;  1C4Q A;  4PV1 C;  4LK1 C;  1PFM A;  3NPP A;  1WVL A;  3A7L A;  3I90 A;  3S1R B;  2C9O A;  1B44 D;  2WV6 D;  2R3Z A;  2HCC A;  3GTO B;  4A3E B;  1KLU D;  5C5L A;  2PQE A;  5EPL A;  3P20 A;  1ET6 A;  3PMF A;  3JAM E;  5A2Q L;  4CGY B;  5CV6 A;  3SK8 A;  3SEB A;  1CT1 D;  2NVX B;  2XWB B;  1PTO H;  3HZX A;  2K01 A;  2OT2 A;  2Z8L A;  2IX0 A;  5JPM C;  1G29 1;  3S1M B;  2F0G A;  2ICE C;  2BE5 D;  1Z7T A;  2JSO A;  5E4X A;  1I4Q A;  3DEO A;  2R61 A;  1FGB D;  3PUW A;  2KUM A;  3V96 A;  3D4W A;  3KBX A;  3ZYY X;  1DXM A;  2KED A;  1EY8 A;  1QG7 A;  1TWC B;  5KND A;  5E1F A;  3MXU A;  2FFK B;  3S15 B;  2PNR C;  5IGB A;  1F9Q A;  3HOV B;  1SE4 A;  3M4Y A;  3K0Y A;  2F0K A;  1WCM B;  3EJI A;  3ND8 A;  2KCC A;  4ZRZ A;  2LS0 1;  4QMG A;  4A3F B;  2E2H B;  2HUG A;  4QUC A;  2Q8T A;  2VUM B;  4BY1 B;  5D3D A;  3ND9 A;  4RGN A;  1EYC A;  3H91 A;  2QKI C;  4OHJ A;  4PNY A;  3DWA A;  4DA2 A;  2NN6 H;  4KY5 A;  3RLF A;  3GV6 A;  1KNE A;  3QJY A;  1XXG A;  2PMZ B;  3PO2 B;  3TDQ A;  4R8I A;  1EYD A;  3AU7 A;  1ESF A;  3QB3 A;  1B50 A;  5C5M A;  2RVL A;  5IIF A;  1Z47 A;  3GTJ B;  1STN A;  1CZG A;  4L63 B;  5C6A A;  3A7A B;  1TWH B;  5IGC A;  3H6M A;  4ME5 A;  1EIG A;  3E0J A;  1H9J A;  3L7Z C;  4HSP A;  3DEP A;  2B39 A;  1PRT F;  5D3I B;  4F8M A;  2FIN B;  4F87 A;  4RWS C;  3MXP A;  3T4A C;  1EZ8 A;  1DZ1 A;  3T53 B;  2K05 A;  2E2D C;  3C46 A;  1GXD C;  5E4W C;  1EY7 A;  1RJT A;  3VR4 A;  1TY0 A;  4A3K B;  2WKC A;  3IL8 A;  3RZD B;  1G2T A;  2RDF A;  4V19 0;  2XN9 C;  1WTR A;  3MHB A;  4IFD G;  2NWG A;  2VB3 X;  4N9T A;  1EY4 A;  2F0V A;  5ELB A;  2M2L A;  2NTT A;  3TME A;  1CM9 A;  2RSN A;  1S4Z A;  3K5N A;  1YNN C;  1STB A;  1SYE A;  5KIX A;  1ROD A;  5CBE E;  3S16 B;  2PO4 A;  5C3X A;  1LTA D;  2R93 B;  5A35 A;  1ENF A;  4KKU A;  1PTO F;  2NVQ B;  3BDL A;  1BR9 A;  2EDG A;  3BVZ A;  5TSS A;  2V4D A;  5HGT A;  4IN3 A;  4H13 C;  1ILQ A;  1U4P A;  4LJZ C;  1EYA A;  2RDG A;  2EPB A;  4FXG C;  1KNA A;  1H9K A;  1F2Z A;  4MN3 A;  1JOR A;  3KK7 A;  1VF5 C;  1Y1V B;  3K5L A;  4HCE A;  2EY6 A;  2R6G A;  5C4X B;  4J8Q A;  4K8J A;  1DOM A;  1ESR A;  2JA8 B;  2FMC A;  1HQR D;  3NTK A;  2X69 A;  4C1N I;  1D1I A;  1LAB A;  3A8J E;  3FDT A;  1JOQ A;  1EU4 A;  1PTO C;  3IFT A;  1B2T A;  2NN6 I;  4HMJ A;  5IGD A;  2A69 D;  1GHK A;  3MVV A;  4RKB A;  1Y8O B;  2FHT A;  4YIJ A;  2PCF B;  1KLG D;  3SXH A;  2J0T D;  4X3S A;  2CVR A;  1SFO B;  3C3L A;  1ILP A;  1RDP D;  4FO2 A;  3MXN A;  3S17 B;  3HOW B;  1RHP A;  4KMU C;  1EL0 A;  4C3I G;  1EY0 A;  1SNM A;  5J39 A;  1DOL A;  3ONA B;  1JB3 A;  2J7Z A;  5I6Y A;  2BA0 A;  1IHZ A;  2F0F A;  3M7G A;  5IT9 L;  5KNC A;  1NR4 A;  2PZU A;  3QO2 A;  1EQV A;  2EYF A;  2B2W A;  3BVG A;  3S1N B;  2E2I B;  4N9P A;  2XRS D;  4KN4 C;  3AB9 A;  4WRD A;  3IAY A;  2JP1 A;  3G7L A;  2O4X A;  1JIC A;  2L0C A;  2N88 A;  3QIA A;  3Q0A A;  3HOU B;  1M8A A;  2JXM B;  4F88 A;  1Y8P B;  1J8I A;  1Q1E A;  1ICW A;  4ULL A;  3CHB D;  4K5X A;  4DN4 M;  5J1Z A;  5FOB B;  4G7O C;  3MA2 B;  5F2D A;  4IUQ A;  1BQQ T;  2EYM A;  1U4M A;  1SMY C;  1VF7 A;  4ZAI A;  5BN3 A;  1B53 A;  2XSC A;  3R2I A;  4IFD I;  1E2W A;  5C0X I;  4IQZ A;  3KLR A;  1E2Z A;  4ZLT F;  1QNK A;  3W3A A;  3OSO A;  4KK7 A;  3M85 A;  1AZP A;  1PYW D;  5BN5 A;  1MD2 D;  5T1G A;  1EU3 A;  1U4L A;  2HDM A;  3TZD A;  3GTK B;  1EEF D;  1PFN A;  2EE1 A;  2ENB A;  2EYJ A;  2NVT B;  2Q8R E;  2WKD A;  5C3E B;  4XXE A;  1BBX C;  5T1I A;  1X3P A;  3NQT A;  4NDX A;  1OXU A;  5NUC A;  3AMU A;  2MPM A;  2IX3 A;  1HQM C;  1F9P A;  2JA7 B;  1ZKO A;  4IUV A;  1D6E C;  1XTC D;  4MIU A;  2L55 A;  1EQT A;  1D5Z C;  5HUR A;  3M3Y B;  5FKA C;  2RBM A;  3VR2 A;  2F0U A;  3FPU B;  3FKI B;  1BCP F;  3I73 A;  5C4Z A;  4Q0F A;  1NSN S;  4NMZ A;  4K2L A;  2BOS A;  1O7Z A;  2F4I A;  1Y8N B;  1V43 A;  1II3 A;  1M4V A;  2ZXP A;  1C48 A;  1NCV A;  1BNZ A;  4BWG B;  5DAU A;  1PZJ D;  1H9S A;  1A3U A;  1EZ6 A;  1KDC A;  3IKJ A;  1NR2 A;  2EZV A;  4HSV A;  5KNB A;  1PFB A;  1ZYR D;  1SBB B;  2PZT A;  3NE5 B;  4WFN 3;  3QG1 A;  4BA2 I;  3HG9 A;  1LTS D;  1HHV A;  5ELC A;  3O13 A;  1I3Q B;  3J80 E;  4A93 B;  1SSO A;  3GV3 A;  4XQN A;  5BN4 A;  2ZXO A;  4K6D A;  3OIQ A;  3SK4 A;  1A3V A;  3DHQ A;  5G3L F;  3CRK C;  1I6H B;  4EVO A;  3BYT B;  1S5C D;  3DWP A;  4DNR B;  4RKL A;  3A8I E;  2F0L A;  3S9W A;  3RZO B;  1F2L A;  2F0T A;  3RD4 A;  4G7Z C;  3PUY A;  1RD9 D;  4C1N K;  3HOZ B;  5ELD A;  4G4K A;  2NB0 A;  3I72 A;  4F7X A;  2BDN A;  2K28 A;  2F0J A;  1DOK A;  3PUX A;  5COR A;  5K36 G;  4FXD A;  2YYZ A;  2MHV A;  1YNJ D;  4DFA A;  4HED A;  1TKW B;  3J7A F;  3P1H A;  4RAU C;  3K59 A;  4ZQ3 A;  4EGV A;  1HXY D;  4A3M B;  1PTO D;  1V1P B;  4FXK C;  1CTM A;  2B2V A;  1I4G A;  1TS3 A;  4DXF A;  5J22 A;  2DNC A;  4HR7 B;  2F0S A;  3KLS A;  3OMC A;  3I4M B;  2SOB A;  2IWH A;  3SVM A;  4AYB B;  1FNW A;  1WTV A;  1TS2 A;  1A2U A;  2A5H A;  3GP7 A;  3BYY B;  3RUZ A;  2NTS A;  2EJM A;  5FO7 B;  4R9W A;  1ENC A;  2A74 C;  1S5B D;  5I9O A;  3QOL A;  1CFM A;  1SYC A;  4HTH A;  1UNS A;  4CBV A;  4DAV A;  2MJ8 A;  2F0P A;  5C4H A;  1Q12 A;  2K03 A;  3BZD B;  4C3J G;  1IYV A;  3NSW A;  3KLS X;  3PV0 A;  4ILW A;  5C0X J;  4IFD J;  2B8G A;  2CHB D;  3TP6 A;  4OGQ C;  3EQL C;  4EQN A;  4Q5V A;  1TU2 B;  1AFP A;  4C3I B;  1D2B A;  1DD2 A;  3R2T A;  3S2H B;  3R8B A;  2K1B A;  1B9M A;  4C56 C;  2RSO A;  3D6W A;  1HUN A;  2ID0 A;  2LY7 A;  3VA7 A;  2PYK A;  1GUS A;  3G6J B;  2M00 A;  5JEA H;  1B3A A;  2B2Y C;  2L1B A;  2OXP A;  4PMB A;  1G6Z A;  4XIG S;  4L6T B;  1F2Y A;  3U9O A;  5IGF A;  4CHT B;  3ERQ A;  1EY6 A;  1NAP A;  4RH6 A;  4FF2 A;  3GTQ B;  1TVX A;  1I4P A;  3J81 E;  4K2K A;  2L11 A;  5CYU A;  3MEH A;  2BDO A;  1BO0 A;  1I50 B;  4XDX A;  3LNN A;  1JQY D;  2PW7 A;  4ZKC B;  4OO1 G;  3GTM B;  2AWN A;  4XTC S;  4KI0 A;  1I4R A;  1GUT A;  3NP8 A;  2AUJ D;  1HUM A;  4KY7 A;  3NQI A;  5CC4 A;  2H4O A;  5IOD A;  5JJZ A;  4KV6 A;  3N6R A;  2B2W C;  1JE4 A;  2WAC A;  4OIJ A;  1IW7 D;  2EYO A;  1O78 A;  1DCZ A;  1XWE A;  4RHS A;  4G7H C;  4UAI A;  2QIL A;  4IUR A;  1S5D D;  3M4O B;  1LT4 D;  1R4Q B;  2WII B;  2XRQ D;  1IW7 C;  1KDA A;  4DF7 A;  4UDU C;  1AP0 A;  1OXX K;  3GTL B;  3F2U A;  3MZ5 A;  2FJ2 A;  2TSS A;  4BBS B;  2DNE A;  1Y69 U;  2GA4 B;  2B2U A;  2K33 A;  1LT5 D;  2MGS A;  1OXT A;  5KEE A;  1MBY A;  1U9R A;  2G9D A;  5JEA G;  2D2C C;  1GJX A;  1PRT D;  2E2J B;  2I46 A;  4X3U A;  3J81 L;  5I2X A;  2O5J C;  4H7B A;  2VB2 X;  1L0Y B;  4DK0 A;  3X3N A;  1EOT A;  3FVQ A;  5ELE A;  4RFB A;  1HTL D;  1CA6 A;  2A68 C;  1TS4 A;  1FNV A;  2JEA I;  1HCZ A;  2B2T A;  3T13 A;  4PQX A;  5DM6 3;  1QNU A;  2F0E A;  3HS0 C;  1O80 A;  1VCI A;  4O42 A;  2XWJ B;  4RA8 A;  3MC0 B;  1DJR D;  1A2T A;  1W6J A;  4L8J A;  4CJ1 B;  1I6V C;  4WOR A;  2I07 B;  1WD1 A;  3GD7 A;  5D65 A;  2RKS A;  3D4D A;  2A73 B;  4RHR A;  2B8F A;  3VYU A;  5CMD A;  2CW0 C;  4RGO S;  1BXT A;  3J7Y W;  3VR5 A;  2A6H C;  4ODG A;  4DAP A;  2DY7 A;  1CK1 A;  1JR0 D;  4QF4 A;  2R92 B;  1PXU A;  3J7A V;  3BG3 A;  5KYI A;  2NUC A;  3S2D B;  1XX8 A;  3L3O C;  5CV8 A;  3D8G A;  3X3M A;  1SDF A;  4IUP A;  1VMP A;  1RF2 D;  4KJN A;  4M1U B;  3TP8 A;  1F77 A;  4I65 A;  2PW5 A;  1RTN A;  3R3O A;  1JWS D;  1STH A;  1W6K A;  4FF4 A;  3WOF A;  4R8N A;  3K6O A;  4TQU S;  3K57 A;  2BE5 C;  1QIL A;  4QCL A;  1QWY A;  2EJF C;  4NKL A;  3A54 A;  1HFG A;  3T51 B;  1ML0 D;  4KN7 C;  3MFG A;  4RGM A;  2K6A A;  2VXW A;  1WD0 A;  1G91 A;  5JPN C;  2SDF A;  1JOO A;  2C5C A;  1F2M A;  1BF4 A;  1V1P A;  1WTP A;  5K36 H;  3I4L A;  1GUG A;  1BCP B;  4JBW A;  3L9A X;  3TN2 A;  5JVG 3;  1PZK D;  4OIK A;  3U9S A;  3OWF A;  3QOJ A;  5CGK A;  3KBG A;  1CZW A;  2EYH A;  1SEB D;  3DXJ C;  1A6X A;  1DYQ A;  3OPO A;  3VYS A;  1E2V A;  1SAP A;  2L5T A;  2HDL A;  4HN7 A;  4QB4 A;  1I4H A;  2LFN A;  2F0M A;  4GZY C;  5EKI A;  1CQF A;  3HEJ A;  4XYO A;  2QF7 A;  2KVM A;  3SHL A;  4KJO A;  4S3S A;  2KQ3 A;  2E74 C;  5C4J B;  3M7N A;  1MSG A;  2NZ1 D;  2SNM A;  4ID6 A;  3I8Z A;  4MHE A;  2ZT9 C;  1RTO A;  2CW0 D;  3V05 A;  1AZQ A;  1ENA A;  5DEH A;  5FO9 B;  5A2Q E;  4XT1 B;  4KD4 A;  5IGE A;  1HA5 A;  2HQE A;  1LT3 D;  1LLR D;  5C3W A;  1PMR A;  2K5W A;  1H9R A;  1KDB A;  2EOT A;  4WJW A;  1CHQ D;  5M5W B;  2N55 A;  3FEW X;  1IKM A;  4KKT A;  1LAC A;  3C1E A;  2F3V A;  2A6H D;  4XQQ A;  1EIH A;  2AWO A;  3WDN A;  2SNS A;  4H0L C;  5EPJ A;  2EVB A;  1LT6 D;  2JA5 B;  2B2V C;  4G57 A;  3EVQ A;  3C2P A;  1NUC A;  3Q22 A;  5FLX E;  4C3H B;  2B2T C;  2EYP A;  1EEI D;  2DN8 A;  1BCP C;  1SE3 A;  3JAM L;  3H3V C;  3QWN A;  3VA5 A;  2F0H A;  5M5X B;  3NXW A;  4KY6 A;  1R4P B;  2QCP X;  4CJ0 B;  1SNQ A;  2OF1 A;  4IUT A;  1BOS A;  2MP1 A;  1STE A;  1HPC A;  1BCP D;  3A8K E;  2X6L A;  1PTO B;  2A6E C;  1F9S A;  2XNA C;  3A55 A;  2AQ2 B;  3TP5 A;  1K8O A;  2A6E D;  1QE6 A;  2ICI A;  1CI3 M;  4TRD A;  5D14 A;  2RDH A;  3SR1 A;  1SYG A;  3KUP A;  5FLX L;  2PPB C;  4PMC A;  5CV9 A;  2B63 B;  4HMI A;  1D5X C;  5I9P A;  1R9T B;  1DM0 B;  5COY A;  1IKL A;  1A3T A;  3OOC A;  1QCB D;  1Z6H A;  5KGU A;  2KA7 A;  1MGS A;  5KYL A;  1TS5 A;  4TSS A;  2M9V A;  2SEB D;  3I3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...