3I3FA

Hypothetical protein from giardia lamblia gl50803_14299
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
GMPTPTFLVCPDVVKFENVGQIAVVNGMVYLGGSVGIDKSGTLHKGLEEQTRQTFDNIRKCLEYANSGLDYIVSLNIFLSTSLSDSEEARFNELYREVFCVPATRPCRCCVRAQLQEGLLVEVVNVVAAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
publication title Hypothetical protein from Giardia lamblia GL50803_14299
rcsb
source organism Giardia lamblia
molecule tags Unknown function
total genus 41
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3i3fA00
2CW4A 3D01A 1FNJA 1JD1A 1QAHA 3M4SA 3ZOPA 1XRGA 3ZO8A 3ZP7A 2OTMA 1FNKA 3MQWA 1PF5A 4NWOB 5HP7A 3LMEA 1COMA 5HP8A 1NQ3A 2CSLA 3I3FA 2IG8A 2UYNB 2UYNA 3LYBA 3R0PA 3K12A 3KJJA 1UI9A 2UYKA 1X25A 1ONIA 2B33A 2DYYA 2CVLA 1QU9A 2CWJA 2CHSA 2EWCA 3L7QA 1ODEA 2UYPA 3ZP4A 2UYJA 3K0TA 3KJKA 1XHOA 1QD9A 3I7TA 2CHTA 3QUWA 3V4DA 4ZK7A 1J7HA 1DBFA 3GTZA 1UFYA 3VCZA 3M1XA
chains in the Genus database with same CATH superfamily
3WJQA 1RQ7A 4G4YA 3HKCB 3ZP7A 5JVDA 3JAWB 2AIZP 3Q8HA 2HS4A 4X1IB 1PF5A 5JCOA 4ZHQB 4NUTA 4WBNA 3F6MA 1W42A 2VGMA 3N2GA 4C82A 3N4YA 3KIZA 5J2TA 2G9IA 4O4HB 5FNVA 4BT4A 3PAFA 4I50A 5GONB 5IJ0B 5G4VC 2WALA 3CG6A 4M8IA 2VAMA 1QD9A 3FBAA 3CCSF 1J7HA 1YHQF 1FNJA 3LWQC 4LNUB 3LWOC 5BMVB 4G4XA 4R40B 1CN7A 3IEWA 2P6YA 3DDNA 1YJ9F 3GHZA 1W57A 2ZODA 5GINC 5HP8A 3RYFA 3C8LA 4I4TA 5LXTA 3WGKA 3P10A 4X1KA 4G4ZA 2GVIA 3F0FA 4BT3A 2DYYA 3IKFA 2CHSA 4G88A 2VXYA 3HKEB 4IIJA 5JQGA 2QI2A 3K0TA 4X1YB 2RB9A 2HP0B 4O4JA 2DT4A 5CB4A 5JH7A 3TD3A 1W41A 4ZI7A 3M1XA 5A2QM 2BO1A 4ZOLA 4TV9B 1GZ0A 1VQ8F 3HJWC 4I55A 3RYIA 3ZOPA 5EYPB 3MQWA 3LMEA 1YI2F 3JARB 3P0ZA 4O4IA 3S0HA 5LP6C 3T80A 1RLUA 1X7OA 2F9ZC 3WGJA 3U0OA 4F6RB 3VTIC 2LCAA 3FD5A 1W3EX 3S0WA 2K1SA 2FGYA 3ZP4A 3F0DA 1QVGF 3KJKA 5LOVA 1DT9A 2RHOA 1JFFA 5KMGA 4YJ2A 5EAZA 3KHNA 4ZK7A 1DBFA 2I6DA 3VCZA 3S0YA 3CC7F 4BW0B 2CW4A 3CCVF 2OTJF 3J81M 3IEQA 5FJ4C 1KNJA 3VOAA 4TZZA 4C8IA 2AMTA 2HRUA 1TUBB 2AIFA 2GZLA 2MQEA 2Z1UA 4NQ3A 3WJPA 1Z5VA 3CB2A 1K8AH 2QTPA 4IHJB 3VOBA 3J80M 4YJ3B 1ZWZA 5EO3A 5IYZA 2ZOVA 2KTVA 1NMUB 4E6EA 1JN1A 1SDSA 4O4LA 1GX1A 1SA0A 3TD4A 3V4DA 3CPQA 1UFYA 4ERHA 1K9MH 1Z5WA 3HWUA 3JATB 3HKCA 3VIUA 3JAWA 4X20B 1FNKA 4X1IA 1W5FA 4ZHQA 3FFMA 3PLAC 3CCLF 4DXDA 3MCQA 3E1YA 2LBWA 3VYTC 3C9TA 4X3MA 5EB0A 1VQOF 1VQ4F 5EIBD 4O4HA 5IJ0A 5GONA 1Q86H 4KWEA 2VAPA 3L7QA 4BVTA 5FLXM 1XHOA 1YGYA 2HRYA 2VAWA 4BVQA 1VHAA 4U39A 4DRXB 2BTUA 5J2UB 3WPWA 5ITZB 4LNUA 2H8CA 3ZO8A 5BMVA 3F0GA 2OTMA 4BT5A 3HKBB 1KD1H 3N4ZA 2OTLF 4HNAB 5HP7A 5MN6A 4G4VA 4C8EA 1W59A 2UYNB 4BT7A 3K12A 2JNBA 4XCQA 1TVKB 1FFXB 1VQMF 3I55F 3HKEA 1H7MA 4X1YA 2HP0A 3QUWA 3G6EF 4TV8B 1KQSF 4B46A 5KX5B 4TV9A 1X52A 3FPIA 2KGWA 5EYPA 1IV3A 5EZYB 1N8RH 3S06A 3CPWF 2UZHA 1R1MA 3JARA 3JAMM 2HVYD 3R0PA 3KE1A 4F6RA 3N2KB 4RHAA 3CCRF 3IR9A 1CK2A 2EWCA 2UYPA 2V9YA 3GYQA 2RHLA 3UT5B 1NJIH 3CYQA 1JY8A 3JASB 2H6LA 3RYHB 1YITF 1KNKA 4O2AB 5GAPK 2ALEA 1VH8A 3S03A 2ZVZA 3I56F 3CYPB 5B8FA 4RQOA 3HTNA 5EWRA 3SIUA 3CCEF 1TUBA 2W8BC 3CCMF 1H48A 4IHJA 3S02A 1SZQA 4YJ3A 3TD5A 3RE3A 3RA5A 1VQ9F 1W55A 3ESJA 5GIOC 1U43A 3EORA 3JATA 2GLZA 4EB6B 4X20A 3CD6F 4G4WA 5HWEA 3DC2A 3M84A 1RQ2A 1PXWA 4EI8A 2QA4F 3JCMM 1W581 3F0EA 1X25A 2Z1FA 5HXZA 3CMAF 3LWRC 2CWJA 1Q82H 4LCKA 5LA6B 3VMFB 5CA1B 3JALB 5CA0B 1E7KA 4BVSA 4TUYB 5HY0A 5EIBC 4DRXA 5J2UA 1JD1A 2IAFA 5ITZA 3MDOA 3LDTA 1XRGA 3VYUC 1IV1A 4BT6A 3HKBA 4HNAA 5HY2A 1M1KH 3CCQF 2ZAUA 3CC2F 1VQ5F 1NQ3A 3QHDA 2IG8A 2UYNA 2Z1EA 3V3TA 5LP6B 2N48A 3LWPC 1S72F 1TVKA 1IV2A 3BYQA 2FC3A 1YJWF 1FFXA 4U3JB 1ODEA 3WGLA 2PHNA 3VO8A 3E20B 3JAKB 3WJRA 1YJNF 3C9SA 4TV8A 4FFBB 2L26A 1YIJF 3B6NA 5KX5A 1W5EA 2QEXF 3E22B 3V7QA 1IV4A 3NK6A 3WPXA 2Q1XA 5JCOC 5EZYA 1W5AA 3HKDB 1VQKF 3CC4F 2OHWA 4C4WC 3JVHA 1RA4A 3LYBA 3WGMA 5GIPC 1UI9A 2KG4A 3N2KA 5IJ9B 3NK7A 2B33A 4B62A 2R751 2BTOA 5GANK 3CMEF 4O2BB 4C81A 3UT5A 1GO1A 2Q1YA 1OAPA 3IKEA 5AVMA 3JASA 2ZVYA 3RYHA 1JJ2F 3D01A 2H8EA 3G4SF 4O2AA 4ZHWA 4C8GA 5HY4A 5LYJB 2LBTA 3D00A 1VQ6F 1COMA 3C9UA 3G71F 2R6R1 1YQNA 3LWVC 1FSZA 5IT9M 2HX0A 5C8YB 2UYKA 3FD6A 1H47A 3RA6A 3HAXD 2CVLA 3CCUF 2I6RA 3WXMB 2HP3A 3I7TA 3CXCF 1XV2A 2HS0A 5MN4A 3RYCB 1Q81H 2RHHA 1VQNF 1QAHA 2CZWA 5JVDB 1VQPF 3NMUC 3SIVA 4EB6A 4BY9D 4NWOB 4WBNB 3J7AR 3N2GB 1QVFF 4PWTA 5J2TB 1IPAA 5FNVB 4I50B 4BT2A 3ERNA 5HY1A 2Z01A 3K2XA 2Z1TA 5LA6A 5CA1A 3JALA 2CHTA 5CA0A 4TUYA 1T0KB 3AGKA 1VQLF 3IMPA 2BTQB 1K73H 3OW2F 2HQSC 1U3LA 3OONA 1W2BF 2CSLA 3I3FA 3RYFB 4I4TB 5LXTB 4X1KB 4ZHYB 3ON1A 5LP6A 4B5CA 2ZF8A 4U3JA 5DCVA 4IIJB 5JQGB 2UYJA 3JAKA 4O4JB 1VK3A 5CB4B 5JH7B 3V7EA 3LFOA 4FFBA 5G4UC 3K14A 4ZI7B 3WGNA 4ZOLB 3E22A 4I55B 3RYIB 1T0AA 4X3LA 1M90H 1Q7YH 3HKDA 3MBMA 5HXUA 4O4IB 3C9RA 3ELCA 2NMUA 3OBYA 2RHJA 3KJJA 1U40A 5IJ9A 1X7PA 3P4EA 1QU9A 1OFUA 2IQQA 3VYSC 2LBXA 5LOVB 3D54A 4O2BA 5KMGB 1JFFB 1W5BA 4YJ2B 4EI9A 3GTZA 1XBIA 4BVRA 1W40A 4B45A 3NVIB 3QTYA 3NVKE 1RLGA 1VQ7F 5MN5A 3M4SA 1CLIA 5LYJA 2PMPA 2VGNA 4EI7A 3VI6A 3OBWA 5EB1B 5C8YA 1Q8RA 1ONIA 5IYZB 2OZBA 3O85A 2HS3A 2KTUA 3CCJF 2YXZA 1VQVA 1U3PA 1GO0A 2YYEA 4O4LB 4ZHVA 3MCAB 1SA0B 1KC8H 3RYCA
chains in the Genus database with same CATH topology
2CW4A 3D01A 1FNJA 1JD1A 1QAHA 3M4SA 3ZOPA 1XRGA 3ZO8A 3ZP7A 2OTMA 1FNKA 3MQWA 1PF5A 4NWOB 5HP7A 3LMEA 1COMA 5HP8A 1NQ3A 2CSLA 3I3FA 2IG8A 2UYNB 2UYNA 3LYBA 3R0PA 3K12A 3KJJA 1UI9A 2UYKA 1X25A 1ONIA 2B33A 2DYYA 2CVLA 1QU9A 2CWJA 2CHSA 2EWCA 3L7QA 1ODEA 2UYPA 3ZP4A 2UYJA 3K0TA 3KJKA 1XHOA 1QD9A 3I7TA 2CHTA 3QUWA 3V4DA 4ZK7A 1J7HA 1DBFA 3GTZA 1UFYA 3VCZA 3M1XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW4 A;  3D01 A;  1FNJ A;  1JD1 A;  1QAH A;  3M4S A;  3ZOP A;  1XRG A;  3ZO8 A;  3ZP7 A;  2OTM A;  1FNK A;  3MQW A;  1PF5 A;  4NWO B;  5HP7 A;  3LME A;  1COM A;  5HP8 A;  1NQ3 A;  2CSL A;  3I3F A;  2IG8 A;  2UYN B;  2UYN A;  3LYB A;  3R0P A;  3K12 A;  3KJJ A;  1UI9 A;  2UYK A;  1X25 A;  1ONI A;  2B33 A;  2DYY A;  2CVL A;  1QU9 A;  2CWJ A;  2CHS A;  2EWC A;  3L7Q A;  1ODE A;  2UYP A;  3ZP4 A;  2UYJ A;  3K0T A;  3KJK A;  1XHO A;  1QD9 A;  3I7T A;  2CHT A;  3QUW A;  3V4D A;  4ZK7 A;  1J7H A;  1DBF A;  3GTZ A;  1UFY A;  3VCZ A;  3M1X A; 
#chains in the Genus database with same CATH topology
 3WJQ A;  1RQ7 A;  4G4Y A;  3HKC B;  3ZP7 A;  5JVD A;  3JAW B;  2AIZ P;  3Q8H A;  2HS4 A;  4X1I B;  1PF5 A;  5JCO A;  4ZHQ B;  4NUT A;  4WBN A;  3F6M A;  1W42 A;  2VGM A;  3N2G A;  4C82 A;  3N4Y A;  3KIZ A;  5J2T A;  2G9I A;  4O4H B;  5FNV A;  4BT4 A;  3PAF A;  4I50 A;  5GON B;  5IJ0 B;  5G4V C;  2WAL A;  3CG6 A;  4M8I A;  2VAM A;  1QD9 A;  3FBA A;  3CCS F;  1J7H A;  1YHQ F;  1FNJ A;  3LWQ C;  4LNU B;  3LWO C;  5BMV B;  4G4X A;  4R40 B;  1CN7 A;  3IEW A;  2P6Y A;  3DDN A;  1YJ9 F;  3GHZ A;  1W57 A;  2ZOD A;  5GIN C;  5HP8 A;  3RYF A;  3C8L A;  4I4T A;  5LXT A;  3WGK A;  3P10 A;  4X1K A;  4G4Z A;  2GVI A;  3F0F A;  4BT3 A;  2DYY A;  3IKF A;  2CHS A;  4G88 A;  2VXY A;  3HKE B;  4IIJ A;  5JQG A;  2QI2 A;  3K0T A;  4X1Y B;  2RB9 A;  2HP0 B;  4O4J A;  2DT4 A;  5CB4 A;  5JH7 A;  3TD3 A;  1W41 A;  4ZI7 A;  3M1X A;  5A2Q M;  2BO1 A;  4ZOL A;  4TV9 B;  1GZ0 A;  1VQ8 F;  3HJW C;  4I55 A;  3RYI A;  3ZOP A;  5EYP B;  3MQW A;  3LME A;  1YI2 F;  3JAR B;  3P0Z A;  4O4I A;  3S0H A;  5LP6 C;  3T80 A;  1RLU A;  1X7O A;  2F9Z C;  3WGJ A;  3U0O A;  4F6R B;  3VTI C;  2LCA A;  3FD5 A;  1W3E X;  3S0W A;  2K1S A;  2FGY A;  3ZP4 A;  3F0D A;  1QVG F;  3KJK A;  5LOV A;  1DT9 A;  2RHO A;  1JFF A;  5KMG A;  4YJ2 A;  5EAZ A;  3KHN A;  4ZK7 A;  1DBF A;  2I6D A;  3VCZ A;  3S0Y A;  3CC7 F;  4BW0 B;  2CW4 A;  3CCV F;  2OTJ F;  3J81 M;  3IEQ A;  5FJ4 C;  1KNJ A;  3VOA A;  4TZZ A;  4C8I A;  2AMT A;  2HRU A;  1TUB B;  2AIF A;  2GZL A;  2MQE A;  2Z1U A;  4NQ3 A;  3WJP A;  1Z5V A;  3CB2 A;  1K8A H;  2QTP A;  4IHJ B;  3VOB A;  3J80 M;  4YJ3 B;  1ZWZ A;  5EO3 A;  5IYZ A;  2ZOV A;  2KTV A;  1NMU B;  4E6E A;  1JN1 A;  1SDS A;  4O4L A;  1GX1 A;  1SA0 A;  3TD4 A;  3V4D A;  3CPQ A;  1UFY A;  4ERH A;  1K9M H;  1Z5W A;  3HWU A;  3JAT B;  3HKC A;  3VIU A;  3JAW A;  4X20 B;  1FNK A;  4X1I A;  1W5F A;  4ZHQ A;  3FFM A;  3PLA C;  3CCL F;  4DXD A;  3MCQ A;  3E1Y A;  2LBW A;  3VYT C;  3C9T A;  4X3M A;  5EB0 A;  1VQO F;  1VQ4 F;  5EIB D;  4O4H A;  5IJ0 A;  5GON A;  1Q86 H;  4KWE A;  2VAP A;  3L7Q A;  4BVT A;  5FLX M;  1XHO A;  1YGY A;  2HRY A;  2VAW A;  4BVQ A;  1VHA A;  4U39 A;  4DRX B;  2BTU A;  5J2U B;  3WPW A;  5ITZ B;  4LNU A;  2H8C A;  3ZO8 A;  5BMV A;  3F0G A;  2OTM A;  4BT5 A;  3HKB B;  1KD1 H;  3N4Z A;  2OTL F;  4HNA B;  5HP7 A;  5MN6 A;  4G4V A;  4C8E A;  1W59 A;  2UYN B;  4BT7 A;  3K12 A;  2JNB A;  4XCQ A;  1TVK B;  1FFX B;  1VQM F;  3I55 F;  3HKE A;  1H7M A;  4X1Y A;  2HP0 A;  3QUW A;  3G6E F;  4TV8 B;  1KQS F;  4B46 A;  5KX5 B;  4TV9 A;  1X52 A;  3FPI A;  2KGW A;  5EYP A;  1IV3 A;  5EZY B;  1N8R H;  3S06 A;  3CPW F;  2UZH A;  1R1M A;  3JAR A;  3JAM M;  2HVY D;  3R0P A;  3KE1 A;  4F6R A;  3N2K B;  4RHA A;  3CCR F;  3IR9 A;  1CK2 A;  2EWC A;  2UYP A;  2V9Y A;  3GYQ A;  2RHL A;  3UT5 B;  1NJI H;  3CYQ A;  1JY8 A;  3JAS B;  2H6L A;  3RYH B;  1YIT F;  1KNK A;  4O2A B;  5GAP K;  2ALE A;  1VH8 A;  3S03 A;  2ZVZ A;  3I56 F;  3CYP B;  5B8F A;  4RQO A;  3HTN A;  5EWR A;  3SIU A;  3CCE F;  1TUB A;  2W8B C;  3CCM F;  1H48 A;  4IHJ A;  3S02 A;  1SZQ A;  4YJ3 A;  3TD5 A;  3RE3 A;  3RA5 A;  1VQ9 F;  1W55 A;  3ESJ A;  5GIO C;  1U43 A;  3EOR A;  3JAT A;  2GLZ A;  4EB6 B;  4X20 A;  3CD6 F;  4G4W A;  5HWE A;  3DC2 A;  3M84 A;  1RQ2 A;  1PXW A;  4EI8 A;  2QA4 F;  3JCM M;  1W58 1;  3F0E A;  1X25 A;  2Z1F A;  5HXZ A;  3CMA F;  3LWR C;  2CWJ A;  1Q82 H;  4LCK A;  5LA6 B;  3VMF B;  5CA1 B;  3JAL B;  5CA0 B;  1E7K A;  4BVS A;  4TUY B;  5HY0 A;  5EIB C;  4DRX A;  5J2U A;  1JD1 A;  2IAF A;  5ITZ A;  3MDO A;  3LDT A;  1XRG A;  3VYU C;  1IV1 A;  4BT6 A;  3HKB A;  4HNA A;  5HY2 A;  1M1K H;  3CCQ F;  2ZAU A;  3CC2 F;  1VQ5 F;  1NQ3 A;  3QHD A;  2IG8 A;  2UYN A;  2Z1E A;  3V3T A;  5LP6 B;  2N48 A;  3LWP C;  1S72 F;  1TVK A;  1IV2 A;  3BYQ A;  2FC3 A;  1YJW F;  1FFX A;  4U3J B;  1ODE A;  3WGL A;  2PHN A;  3VO8 A;  3E20 B;  3JAK B;  3WJR A;  1YJN F;  3C9S A;  4TV8 A;  4FFB B;  2L26 A;  1YIJ F;  3B6N A;  5KX5 A;  1W5E A;  2QEX F;  3E22 B;  3V7Q A;  1IV4 A;  3NK6 A;  3WPX A;  2Q1X A;  5JCO C;  5EZY A;  1W5A A;  3HKD B;  1VQK F;  3CC4 F;  2OHW A;  4C4W C;  3JVH A;  1RA4 A;  3LYB A;  3WGM A;  5GIP C;  1UI9 A;  2KG4 A;  3N2K A;  5IJ9 B;  3NK7 A;  2B33 A;  4B62 A;  2R75 1;  2BTO A;  5GAN K;  3CME F;  4O2B B;  4C81 A;  3UT5 A;  1GO1 A;  2Q1Y A;  1OAP A;  3IKE A;  5AVM A;  3JAS A;  2ZVY A;  3RYH A;  1JJ2 F;  3D01 A;  2H8E A;  3G4S F;  4O2A A;  4ZHW A;  4C8G A;  5HY4 A;  5LYJ B;  2LBT A;  3D00 A;  1VQ6 F;  1COM A;  3C9U A;  3G71 F;  2R6R 1;  1YQN A;  3LWV C;  1FSZ A;  5IT9 M;  2HX0 A;  5C8Y B;  2UYK A;  3FD6 A;  1H47 A;  3RA6 A;  3HAX D;  2CVL A;  3CCU F;  2I6R A;  3WXM B;  2HP3 A;  3I7T A;  3CXC F;  1XV2 A;  2HS0 A;  5MN4 A;  3RYC B;  1Q81 H;  2RHH A;  1VQN F;  1QAH A;  2CZW A;  5JVD B;  1VQP F;  3NMU C;  3SIV A;  4EB6 A;  4BY9 D;  4NWO B;  4WBN B;  3J7A R;  3N2G B;  1QVF F;  4PWT A;  5J2T B;  1IPA A;  5FNV B;  4I50 B;  4BT2 A;  3ERN A;  5HY1 A;  2Z01 A;  3K2X A;  2Z1T A;  5LA6 A;  5CA1 A;  3JAL A;  2CHT A;  5CA0 A;  4TUY A;  1T0K B;  3AGK A;  1VQL F;  3IMP A;  2BTQ B;  1K73 H;  3OW2 F;  2HQS C;  1U3L A;  3OON A;  1W2B F;  2CSL A;  3I3F A;  3RYF B;  4I4T B;  5LXT B;  4X1K B;  4ZHY B;  3ON1 A;  5LP6 A;  4B5C A;  2ZF8 A;  4U3J A;  5DCV A;  4IIJ B;  5JQG B;  2UYJ A;  3JAK A;  4O4J B;  1VK3 A;  5CB4 B;  5JH7 B;  3V7E A;  3LFO A;  4FFB A;  5G4U C;  3K14 A;  4ZI7 B;  3WGN A;  4ZOL B;  3E22 A;  4I55 B;  3RYI B;  1T0A A;  4X3L A;  1M90 H;  1Q7Y H;  3HKD A;  3MBM A;  5HXU A;  4O4I B;  3C9R A;  3ELC A;  2NMU A;  3OBY A;  2RHJ A;  3KJJ A;  1U40 A;  5IJ9 A;  1X7P A;  3P4E A;  1QU9 A;  1OFU A;  2IQQ A;  3VYS C;  2LBX A;  5LOV B;  3D54 A;  4O2B A;  5KMG B;  1JFF B;  1W5B A;  4YJ2 B;  4EI9 A;  3GTZ A;  1XBI A;  4BVR A;  1W40 A;  4B45 A;  3NVI B;  3QTY A;  3NVK E;  1RLG A;  1VQ7 F;  5MN5 A;  3M4S A;  1CLI A;  5LYJ A;  2PMP A;  2VGN A;  4EI7 A;  3VI6 A;  3OBW A;  5EB1 B;  5C8Y A;  1Q8R A;  1ONI A;  5IYZ B;  2OZB A;  3O85 A;  2HS3 A;  2KTU A;  3CCJ F;  2YXZ A;  1VQV A;  1U3P A;  1GO0 A;  2YYE A;  4O4L B;  4ZHV A;  3MCA B;  1SA0 B;  1KC8 H;  3RYC A; 
#chains in the Genus database with same CATH homology
 2CW4 A;  3D01 A;  1FNJ A;  1JD1 A;  1QAH A;  3M4S A;  3ZOP A;  1XRG A;  3ZO8 A;  3ZP7 A;  2OTM A;  1FNK A;  3MQW A;  1PF5 A;  4NWO B;  5HP7 A;  3LME A;  1COM A;  5HP8 A;  1NQ3 A;  2CSL A;  3I3F A;  2IG8 A;  2UYN B;  2UYN A;  3LYB A;  3R0P A;  3K12 A;  3KJJ A;  1UI9 A;  2UYK A;  1X25 A;  1ONI A;  2B33 A;  2DYY A;  2CVL A;  1QU9 A;  2CWJ A;  2CHS A;  2EWC A;  3L7Q A;  1ODE A;  2UYP A;  3ZP4 A;  2UYJ A;  3K0T A;  3KJK A;  1XHO A;  1QD9 A;  3I7T A;  2CHT A;  3QUW A;  3V4D A;  4ZK7 A;  1J7H A;  1DBF A;  3GTZ A;  1UFY A;  3VCZ A;  3M1X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...