3I3FA

Hypothetical protein from giardia lamblia gl50803_14299
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
GMPTPTFLVCPDVVKFENVGQIAVVNGMVYLGGSVGIDKSGTLHKGLEEQTRQTFDNIRKCLEYANSGLDYIVSLNIFLSTSLSDSEEARFNELYREVFCVPATRPCRCCVRAQLQEGLLVEVVNVVAAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical protein from Giardia lamblia GL50803_14299
rcsb
source organism Giardia lamblia
molecule tags Unknown function
molecule keywords Hypothetical protein
total genus 41
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3i3fA00
1FNJA 3D01A 2OTMA 3I3FA 3K0TA 3KJJA 3LMEA 1PF5A 2CHTA 3L7QA 3I7TA 1JD1A 2UYNB 3LYBA 2CVLA 2IG8A 2UYNA 1NQ3A 1UFYA 1QAHA 3R0PA 3V4DA 3M1XA 4NWOB 2UYKA 1J7HA 3MQWA 3VCZA 3KJKA 3M4SA 2B33A 1XHOA 3QUWA 3ZP4A 5HP8A 2EWCA 1QD9A 1COMA 1QU9A 2CHSA 2CSLA 1UI9A 1DBFA 2DYYA 1XRGA 2UYPA 3ZO8A 5HP7A 2UYJA 3GTZA 3K12A 1FNKA 1X25A 2CW4A 2CWJA 3ZOPA 4ZK7A 1ODEA 3ZP7A 1ONIA
chains in the Genus database with same CATH superfamily
4X3MA 4B62A 5B8FA 4O4LB 4ERHA 5GONA 4X1IA 3L7QA 2AIFA 4IIJB 1CK2A 4BY9D 1QVGF 1IV4A 3HJWC 4KWEA 4C4WC 2LBXA 1X7PA 4I50A 3OW2F 4C8IA 3C9RA 1Q86H 2GZLA 4BT6A 4LNUB 4ZHYB 2CHSA 2JNBA 3JALB 3RYIA 1M90H 3E22B 1RQ7A 4O2AB 1RLGA 2HP0A 4BVTA 2BTOA 4DXDA 3QHDA 5CB4B 3JVHA 3WGJA 3KJJA 5C8YA 1YJNF 5A2QM 1E7KA 1GO0A 1TUBA 3S02A 2RHLA 1QAHA 2RB9A 4ZOLA 1TUBB 2HP3A 4TZZA 3QUWA 1RLUA 3TD4A 4NUTA 3VIUA 3JASA 5LYJA 5HWEA 3JAMM 3ZO8A 3GTZA 4C8GA 3VYUC 1SDSA 4RQOA 2Q1YA 1W42A 4DRXA 4E6EA 2FGYA 3HKDB 1X52A 2UZHA 4O4HB 3MDOA 2AMTA 3LYBA 3CD6F 1JY8A 2ALEA 5FNVB 3RA5A 1W5FA 1YHQF 3VCZA 3TD5A 5HXUA 3KJKA 4TUYA 3DDNA 1SZQA 1NMUB 2MQEA 4WBNB 4YJ2A 4G4VA 4B46A 3LWOC 2DT4A 3O85A 3WGKA 1YIJF 3P4EA 5EWRA 3F0EA 3S0HA 3VO8A 2OZBA 2YXZA 4HNAA 1W3EX 3CPQA 3CMAF 3LWQC 2Z1FA 5HY1A 2Q1XA 2PHNA 4X20A 3J81M 1W40A 1JD1A 3NK7A 4O4IA 1JFFB 2VAPA 3FPIA 4EB6B 2OTJF 5IT9M 1W5BA 3I55F 2ZF8A 3D54A 3MQWA 1YI2F 1YQNA 1XV2A 3T80A 1FSZA 2B33A 4X1KA 3MCQA 3V7QA 5LP6C 3JARA 1VQ5F 3ERNA 4BVQA 1VH8A 2LCAA 1UI9A 3LWRC 1VQMF 2P6YA 5EYPB 3VI6A 3C9TA 3ZOPA 3B6NA 1ODEA 3S03A 3I3FA 3NMUC 5G4UC 4LNUA 5KMGB 3PAFA 1W5EA 5ITZB 5IYZB 3LWPC 4ZHQA 4O2BB 5J2UB 3MCAB 3MBMA 4ZHQB 2KTVA 4O2BA 3S0YA 4LCKA 4U3JA 1Z5VA 3JATA 1W57A 4X1IB 2HX0A 3VYSC 4BVRA 3IMPA 4I55B 3IEQA 3K14A 1CLIA 4B5CA 1FNJA 1U43A 4ZOLB 1R1MA 2IAFA 2R751 2QEXF 4M8IA 1H48A 1VQPF 3I7TA 1T0KB 4EI7A 2QI2A 5EB0A 4ZHVA 4EI8A 4IHJB 5IJ9B 3C9SA 3CCUF 5JCOA 2V9YA 3D00A 1Q82H 1K73H 2Z01A 3JAWA 5FLXM 3CYPB 3LFOA 2NMUA 5JH7B 4FFBB 1VQNF 3ZP7A 1VQ9F 2H8CA 3WPWA 2RHJA 2CHTA 2HS4A 4NQ3A 1GZ0A 1SA0A 1W2BF 3WPXA 3N2KB 4O4HA 3KE1A 5EIBC 4BT3A 3WGNA 3CCSF 1N8RH 2ZOVA 5LXTB 3F6MA 5IJ0A 4EI9A 1QU9A 5JQGB 3U0OA 4DRXB 3VOAA 4ZHWA 4BT2A 5LA6A 2QA4F 3N2GA 3ON1A 2BO1A 2VAMA 2HVYD 5EYPA 4ZK7A 4XCQA 4BT5A 2Z1UA 2OTMA 3EORA 2OTLF 2IQQA 3VMFB 3ELCA 4PWTA 3OONA 1GO1A 3CYQA 4IHJA 3GHZA 5GINC 1KD1H 2CZWA 5HXZA 1J7HA 3WGMA 1VK3A 2Z1EA 1YGYA 2I6DA 2EWCA 2KGWA 3E22A 1IV1A 3K12A 4G4ZA 1FNKA 1X25A 1H7MA 2HP0B 3QTYA 3N2GB 4U3JB 1ONIA 2F9ZC 3JALA 4YJ2B 3RYIB 5GANK 3SIVA 2VAWA 3NK6A 2H8EA 2K1SA 3IEWA 2VXYA 3VTIC 1S72F 2UYNB 3R0PA 1UFYA 2GLZA 2QTPA 5FNVA 1H47A 1OFUA 3KHNA 5AVMA 4BT4A 3G71F 1IV3A 4IIJA 1Q81H 2PMPA 5HP8A 2GVIA 4FFBA 1U3PA 2AIZP 3HKCB 1RA4A 2KG4A 5CA0A 3JARB 1YJ9F 3CPWF 3HKEB 3HWUA 3JAKB 4YJ3A 4X1KB 2VGNA 3K2XA 3JAWB 3J80M 3CCEF 1KC8H 3WXMB 4G88A 3JCMM 3CCQF 5J2TB 3S0WA 5DCVA 4X1YA 1K9MH 3VOBA 3M1XA 2HQSC 1JN1A 1TVKB 1RQ2A 3IR9A 4X20B 5C8YB 5HY2A 5J2TA 3I56F 1VQKF 5KX5A 1QD9A 3TD3A 1U40A 2YYEA 3F0DA 5HP7A 1DBFA 2UYJA 2FC3A 4R40B 3S06A 2N48A 5JQGA 3D01A 4BW0B 4TUYB 5BMVA 1IPAA 4I50B 1Q7YH 1NJIH 2HRYA 4WBNA 2W8BC 3E20B 5J2UA 3VYTC 4O4JB 2HRUA 1PXWA 2ZODA 1W581 1ZWZA 3FD5A 5BMVB 3HKDA 1SA0B 3F0GA 1VQLF 4O4LA 3CCLF 2R6R1 4ZI7A 1CN7A 3G6EF 3J7AR 5JH7A 5GONB 3SIUA 2I6RA 3CC7F 2DYYA 3N4ZA 3RYHB 4BVSA 1W59A 5LOVA 5EB1B 3UT5B 1KQSF 4C8EA 1PF5A 2VGMA 3CCJF 2OHWA 1Q8RA 3WJQA 3RYCB 2RHHA 3FD6A 1JJ2F 1FFXA 4G4WA 3Q8HA 3RE3A 1JFFA 4O4IB 4EB6A 3G4SF 3M4SA 5JVDA 3V7EA 3GYQA 1W55A 3ESJA 2G9IA 1COMA 1KNKA 5LP6A 5CA0B 5EZYA 3NVIB 2ZVYA 5LOVB 3WJRA 5LA6B 5LXTA 1GX1A 3HKCA 3K0TA 3HAXD 4G4XA 5IJ0B 3JATB 4ZI7B 5EAZA 5EIBD 3IKEA 4TV9A 3CB2A 4NWOB 3RA6A 5CA1A 1VQ7F 1U3LA 3PLAC 1XHOA 3ZP4A 5HY0A 3CXCF 2KTUA 2RHOA 4C82A 5HY4A 4I4TB 2CSLA 4F6RB 3CMEF 3DC2A 3FFMA 2WALA 3JASB 5LYJB 4B45A 5EZYB 1VQ8F 3NVKE 1W5AA 1K8AH 2HS0A 5MN5A 5GAPK 3P0ZA 2ZVZA 1YITF 1DT9A 3P10A 5KX5B 5EO3A 1FFXB 1W41A 3V3TA 1TVKA 1X7OA 2Z1TA 5MN4A 3HKBB 3CCMF 2ZAUA 3LWVC 2HS3A 4X1YB 5GIOC 4RHAA 4TV8A 2BTUA 3CC2F 3WJPA 1XBIA 5JCOC 3OBWA 3FBAA 1VQVA 3CG6A 4YJ3B 2UYPA 1M1KH 1T0AA 4I55A 4I4TA 1VHAA 3RYHA 1Z5WA 4BT7A 3C9UA 5MN6A 5CA1B 5G4VC 3CCVF 3N2KA 4O4JA 4X3LA 2IG8A 2UYNA 2UYKA 1YJWF 4TV9B 5IYZA 1VQOF 4U39A 5ITZA 3LDTA 5KMGA 1IV2A 3CCRF 3HTNA 2L26A 2CW4A 2CWJA 3AGKA 3RYFA 5LP6B 5JVDB 2H6LA 5IJ9A 3LMEA 3HKBA 3KIZA 2LBTA 4TV8B 5FJ4C 3V4DA 2CVLA 1VQ4F 1NQ3A 3BYQA 2LBWA 3CC4F 1OAPA 3F0FA 3M84A 3RYCA 1QVFF 3OBYA 2BTQB 3UT5A 3HKEA 3JAKA 1KNJA 3C8LA 3N4YA 1VQ6F 4O2AA 4C81A 4G4YA 5GIPC 3WGLA 1XRGA 3IKFA 4F6RA 5CB4A 3RYFB 4HNAB 3E1YA
chains in the Genus database with same CATH topology
1FNJA 3D01A 2OTMA 3I3FA 3K0TA 3KJJA 3LMEA 1PF5A 2CHTA 3L7QA 3I7TA 1JD1A 2UYNB 3LYBA 2CVLA 2IG8A 2UYNA 1NQ3A 1UFYA 1QAHA 3R0PA 3V4DA 3M1XA 4NWOB 2UYKA 1J7HA 3MQWA 3VCZA 3KJKA 3M4SA 2B33A 1XHOA 3QUWA 3ZP4A 5HP8A 2EWCA 1QD9A 1COMA 1QU9A 2CHSA 2CSLA 1UI9A 1DBFA 2DYYA 1XRGA 2UYPA 3ZO8A 5HP7A 2UYJA 3GTZA 3K12A 1FNKA 1X25A 2CW4A 2CWJA 3ZOPA 4ZK7A 1ODEA 3ZP7A 1ONIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNJ A;  3D01 A;  2OTM A;  3I3F A;  3K0T A;  3KJJ A;  3LME A;  1PF5 A;  2CHT A;  3L7Q A;  3I7T A;  1JD1 A;  2UYN B;  3LYB A;  2CVL A;  2IG8 A;  2UYN A;  1NQ3 A;  1UFY A;  1QAH A;  3R0P A;  3V4D A;  3M1X A;  4NWO B;  2UYK A;  1J7H A;  3MQW A;  3VCZ A;  3KJK A;  3M4S A;  2B33 A;  1XHO A;  3QUW A;  3ZP4 A;  5HP8 A;  2EWC A;  1QD9 A;  1COM A;  1QU9 A;  2CHS A;  2CSL A;  1UI9 A;  1DBF A;  2DYY A;  1XRG A;  2UYP A;  3ZO8 A;  5HP7 A;  2UYJ A;  3GTZ A;  3K12 A;  1FNK A;  1X25 A;  2CW4 A;  2CWJ A;  3ZOP A;  4ZK7 A;  1ODE A;  3ZP7 A;  1ONI A; 
#chains in the Genus database with same CATH topology
 4X3M A;  4B62 A;  5B8F A;  4O4L B;  4ERH A;  5GON A;  4X1I A;  3L7Q A;  2AIF A;  4IIJ B;  1CK2 A;  4BY9 D;  1QVG F;  1IV4 A;  3HJW C;  4KWE A;  4C4W C;  2LBX A;  1X7P A;  4I50 A;  3OW2 F;  4C8I A;  3C9R A;  1Q86 H;  2GZL A;  4BT6 A;  4LNU B;  4ZHY B;  2CHS A;  2JNB A;  3JAL B;  3RYI A;  1M90 H;  3E22 B;  1RQ7 A;  4O2A B;  1RLG A;  2HP0 A;  4BVT A;  2BTO A;  4DXD A;  3QHD A;  5CB4 B;  3JVH A;  3WGJ A;  3KJJ A;  5C8Y A;  1YJN F;  5A2Q M;  1E7K A;  1GO0 A;  1TUB A;  3S02 A;  2RHL A;  1QAH A;  2RB9 A;  4ZOL A;  1TUB B;  2HP3 A;  4TZZ A;  3QUW A;  1RLU A;  3TD4 A;  4NUT A;  3VIU A;  3JAS A;  5LYJ A;  5HWE A;  3JAM M;  3ZO8 A;  3GTZ A;  4C8G A;  3VYU C;  1SDS A;  4RQO A;  2Q1Y A;  1W42 A;  4DRX A;  4E6E A;  2FGY A;  3HKD B;  1X52 A;  2UZH A;  4O4H B;  3MDO A;  2AMT A;  3LYB A;  3CD6 F;  1JY8 A;  2ALE A;  5FNV B;  3RA5 A;  1W5F A;  1YHQ F;  3VCZ A;  3TD5 A;  5HXU A;  3KJK A;  4TUY A;  3DDN A;  1SZQ A;  1NMU B;  2MQE A;  4WBN B;  4YJ2 A;  4G4V A;  4B46 A;  3LWO C;  2DT4 A;  3O85 A;  3WGK A;  1YIJ F;  3P4E A;  5EWR A;  3F0E A;  3S0H A;  3VO8 A;  2OZB A;  2YXZ A;  4HNA A;  1W3E X;  3CPQ A;  3CMA F;  3LWQ C;  2Z1F A;  5HY1 A;  2Q1X A;  2PHN A;  4X20 A;  3J81 M;  1W40 A;  1JD1 A;  3NK7 A;  4O4I A;  1JFF B;  2VAP A;  3FPI A;  4EB6 B;  2OTJ F;  5IT9 M;  1W5B A;  3I55 F;  2ZF8 A;  3D54 A;  3MQW A;  1YI2 F;  1YQN A;  1XV2 A;  3T80 A;  1FSZ A;  2B33 A;  4X1K A;  3MCQ A;  3V7Q A;  5LP6 C;  3JAR A;  1VQ5 F;  3ERN A;  4BVQ A;  1VH8 A;  2LCA A;  1UI9 A;  3LWR C;  1VQM F;  2P6Y A;  5EYP B;  3VI6 A;  3C9T A;  3ZOP A;  3B6N A;  1ODE A;  3S03 A;  3I3F A;  3NMU C;  5G4U C;  4LNU A;  5KMG B;  3PAF A;  1W5E A;  5ITZ B;  5IYZ B;  3LWP C;  4ZHQ A;  4O2B B;  5J2U B;  3MCA B;  3MBM A;  4ZHQ B;  2KTV A;  4O2B A;  3S0Y A;  4LCK A;  4U3J A;  1Z5V A;  3JAT A;  1W57 A;  4X1I B;  2HX0 A;  3VYS C;  4BVR A;  3IMP A;  4I55 B;  3IEQ A;  3K14 A;  1CLI A;  4B5C A;  1FNJ A;  1U43 A;  4ZOL B;  1R1M A;  2IAF A;  2R75 1;  2QEX F;  4M8I A;  1H48 A;  1VQP F;  3I7T A;  1T0K B;  4EI7 A;  2QI2 A;  5EB0 A;  4ZHV A;  4EI8 A;  4IHJ B;  5IJ9 B;  3C9S A;  3CCU F;  5JCO A;  2V9Y A;  3D00 A;  1Q82 H;  1K73 H;  2Z01 A;  3JAW A;  5FLX M;  3CYP B;  3LFO A;  2NMU A;  5JH7 B;  4FFB B;  1VQN F;  3ZP7 A;  1VQ9 F;  2H8C A;  3WPW A;  2RHJ A;  2CHT A;  2HS4 A;  4NQ3 A;  1GZ0 A;  1SA0 A;  1W2B F;  3WPX A;  3N2K B;  4O4H A;  3KE1 A;  5EIB C;  4BT3 A;  3WGN A;  3CCS F;  1N8R H;  2ZOV A;  5LXT B;  3F6M A;  5IJ0 A;  4EI9 A;  1QU9 A;  5JQG B;  3U0O A;  4DRX B;  3VOA A;  4ZHW A;  4BT2 A;  5LA6 A;  2QA4 F;  3N2G A;  3ON1 A;  2BO1 A;  2VAM A;  2HVY D;  5EYP A;  4ZK7 A;  4XCQ A;  4BT5 A;  2Z1U A;  2OTM A;  3EOR A;  2OTL F;  2IQQ A;  3VMF B;  3ELC A;  4PWT A;  3OON A;  1GO1 A;  3CYQ A;  4IHJ A;  3GHZ A;  5GIN C;  1KD1 H;  2CZW A;  5HXZ A;  1J7H A;  3WGM A;  1VK3 A;  2Z1E A;  1YGY A;  2I6D A;  2EWC A;  2KGW A;  3E22 A;  1IV1 A;  3K12 A;  4G4Z A;  1FNK A;  1X25 A;  1H7M A;  2HP0 B;  3QTY A;  3N2G B;  4U3J B;  1ONI A;  2F9Z C;  3JAL A;  4YJ2 B;  3RYI B;  5GAN K;  3SIV A;  2VAW A;  3NK6 A;  2H8E A;  2K1S A;  3IEW A;  2VXY A;  3VTI C;  1S72 F;  2UYN B;  3R0P A;  1UFY A;  2GLZ A;  2QTP A;  5FNV A;  1H47 A;  1OFU A;  3KHN A;  5AVM A;  4BT4 A;  3G71 F;  1IV3 A;  4IIJ A;  1Q81 H;  2PMP A;  5HP8 A;  2GVI A;  4FFB A;  1U3P A;  2AIZ P;  3HKC B;  1RA4 A;  2KG4 A;  5CA0 A;  3JAR B;  1YJ9 F;  3CPW F;  3HKE B;  3HWU A;  3JAK B;  4YJ3 A;  4X1K B;  2VGN A;  3K2X A;  3JAW B;  3J80 M;  3CCE F;  1KC8 H;  3WXM B;  4G88 A;  3JCM M;  3CCQ F;  5J2T B;  3S0W A;  5DCV A;  4X1Y A;  1K9M H;  3VOB A;  3M1X A;  2HQS C;  1JN1 A;  1TVK B;  1RQ2 A;  3IR9 A;  4X20 B;  5C8Y B;  5HY2 A;  5J2T A;  3I56 F;  1VQK F;  5KX5 A;  1QD9 A;  3TD3 A;  1U40 A;  2YYE A;  3F0D A;  5HP7 A;  1DBF A;  2UYJ A;  2FC3 A;  4R40 B;  3S06 A;  2N48 A;  5JQG A;  3D01 A;  4BW0 B;  4TUY B;  5BMV A;  1IPA A;  4I50 B;  1Q7Y H;  1NJI H;  2HRY A;  4WBN A;  2W8B C;  3E20 B;  5J2U A;  3VYT C;  4O4J B;  2HRU A;  1PXW A;  2ZOD A;  1W58 1;  1ZWZ A;  3FD5 A;  5BMV B;  3HKD A;  1SA0 B;  3F0G A;  1VQL F;  4O4L A;  3CCL F;  2R6R 1;  4ZI7 A;  1CN7 A;  3G6E F;  3J7A R;  5JH7 A;  5GON B;  3SIU A;  2I6R A;  3CC7 F;  2DYY A;  3N4Z A;  3RYH B;  4BVS A;  1W59 A;  5LOV A;  5EB1 B;  3UT5 B;  1KQS F;  4C8E A;  1PF5 A;  2VGM A;  3CCJ F;  2OHW A;  1Q8R A;  3WJQ A;  3RYC B;  2RHH A;  3FD6 A;  1JJ2 F;  1FFX A;  4G4W A;  3Q8H A;  3RE3 A;  1JFF A;  4O4I B;  4EB6 A;  3G4S F;  3M4S A;  5JVD A;  3V7E A;  3GYQ A;  1W55 A;  3ESJ A;  2G9I A;  1COM A;  1KNK A;  5LP6 A;  5CA0 B;  5EZY A;  3NVI B;  2ZVY A;  5LOV B;  3WJR A;  5LA6 B;  5LXT A;  1GX1 A;  3HKC A;  3K0T A;  3HAX D;  4G4X A;  5IJ0 B;  3JAT B;  4ZI7 B;  5EAZ A;  5EIB D;  3IKE A;  4TV9 A;  3CB2 A;  4NWO B;  3RA6 A;  5CA1 A;  1VQ7 F;  1U3L A;  3PLA C;  1XHO A;  3ZP4 A;  5HY0 A;  3CXC F;  2KTU A;  2RHO A;  4C82 A;  5HY4 A;  4I4T B;  2CSL A;  4F6R B;  3CME F;  3DC2 A;  3FFM A;  2WAL A;  3JAS B;  5LYJ B;  4B45 A;  5EZY B;  1VQ8 F;  3NVK E;  1W5A A;  1K8A H;  2HS0 A;  5MN5 A;  5GAP K;  3P0Z A;  2ZVZ A;  1YIT F;  1DT9 A;  3P10 A;  5KX5 B;  5EO3 A;  1FFX B;  1W41 A;  3V3T A;  1TVK A;  1X7O A;  2Z1T A;  5MN4 A;  3HKB B;  3CCM F;  2ZAU A;  3LWV C;  2HS3 A;  4X1Y B;  5GIO C;  4RHA A;  4TV8 A;  2BTU A;  3CC2 F;  3WJP A;  1XBI A;  5JCO C;  3OBW A;  3FBA A;  1VQV A;  3CG6 A;  4YJ3 B;  2UYP A;  1M1K H;  1T0A A;  4I55 A;  4I4T A;  1VHA A;  3RYH A;  1Z5W A;  4BT7 A;  3C9U A;  5MN6 A;  5CA1 B;  5G4V C;  3CCV F;  3N2K A;  4O4J A;  4X3L A;  2IG8 A;  2UYN A;  2UYK A;  1YJW F;  4TV9 B;  5IYZ A;  1VQO F;  4U39 A;  5ITZ A;  3LDT A;  5KMG A;  1IV2 A;  3CCR F;  3HTN A;  2L26 A;  2CW4 A;  2CWJ A;  3AGK A;  3RYF A;  5LP6 B;  5JVD B;  2H6L A;  5IJ9 A;  3LME A;  3HKB A;  3KIZ A;  2LBT A;  4TV8 B;  5FJ4 C;  3V4D A;  2CVL A;  1VQ4 F;  1NQ3 A;  3BYQ A;  2LBW A;  3CC4 F;  1OAP A;  3F0F A;  3M84 A;  3RYC A;  1QVF F;  3OBY A;  2BTQ B;  3UT5 A;  3HKE A;  3JAK A;  1KNJ A;  3C8L A;  3N4Y A;  1VQ6 F;  4O2A A;  4C81 A;  4G4Y A;  5GIP C;  3WGL A;  1XRG A;  3IKF A;  4F6R A;  5CB4 A;  3RYF B;  4HNA B;  3E1Y A; 
#chains in the Genus database with same CATH homology
 1FNJ A;  3D01 A;  2OTM A;  3I3F A;  3K0T A;  3KJJ A;  3LME A;  1PF5 A;  2CHT A;  3L7Q A;  3I7T A;  1JD1 A;  2UYN B;  3LYB A;  2CVL A;  2IG8 A;  2UYN A;  1NQ3 A;  1UFY A;  1QAH A;  3R0P A;  3V4D A;  3M1X A;  4NWO B;  2UYK A;  1J7H A;  3MQW A;  3VCZ A;  3KJK A;  3M4S A;  2B33 A;  1XHO A;  3QUW A;  3ZP4 A;  5HP8 A;  2EWC A;  1QD9 A;  1COM A;  1QU9 A;  2CHS A;  2CSL A;  1UI9 A;  1DBF A;  2DYY A;  1XRG A;  2UYP A;  3ZO8 A;  5HP7 A;  2UYJ A;  3GTZ A;  3K12 A;  1FNK A;  1X25 A;  2CW4 A;  2CWJ A;  3ZOP A;  4ZK7 A;  1ODE A;  3ZP7 A;  1ONI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...