3I3FA

Hypothetical protein from giardia lamblia gl50803_14299
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
GMPTPTFLVCPDVVKFENVGQIAVVNGMVYLGGSVGIDKSGTLHKGLEEQTRQTFDNIRKCLEYANSGLDYIVSLNIFLSTSLSDSEEARFNELYREVFCVPATRPCRCCVRAQLQEGLLVEVVNVVAAQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hypothetical protein from Giardia lamblia GL50803_14299
rcsb
source organism Giardia lamblia
molecule tags Unknown function
molecule keywords Hypothetical protein
total genus 41
structure length 131
sequence length 131
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01042 Ribonuc_L-PSP Endoribonuclease L-PSP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.40 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; RutC-like 3i3fA00
1COMA 3ZP4A 1ODEA 3KJJA 5HP7A 3LMEA 2UYNA 3ZP7A 3V4DA 2CW4A 3L7QA 1QAHA 3M4SA 1XHOA 3I3FA 2B33A 1FNKA 4NWOB 1J7HA 1FNJA 3M1XA 3I7TA 3KJKA 3K0TA 3MQWA 3ZO8A 2UYNB 1UI9A 2UYJA 3QUWA 3D01A 4ZK7A 3LYBA 5HP8A 1JD1A 1QU9A 3GTZA 3K12A 2CHSA 3VCZA 2CHTA 1ONIA 2CSLA 2EWCA 1QD9A 2CVLA 1XRGA 2CWJA 2UYKA 1NQ3A 2OTMA 2UYPA 3ZOPA 2IG8A 1X25A 1DBFA 1PF5A 2DYYA 1UFYA 3R0PA
chains in the Genus database with same CATH superfamily
4ZHWA 1RA4A 4ZHQB 5HXZA 5ITZB 2BTOA 2BTQB 1Z5VA 5J2UB 2AIZP 1YJWF 4IHJB 3CCQF 4I55A 3VOBA 3KIZA 4M8IA 1TUBB 1SDSA 5C8YA 1JD1A 4F6RB 2LBTA 1JJ2F 4C8IA 1K9MH 2OTLF 3LDTA 3JCMM 3ERNA 2UZHA 2VAPA 1RLGA 1KNJA 2HX0A 4F6RA 3K14A 4LNUA 3ESJA 5LA6A 3WJPA 1IV2A 5HP7A 3WGKA 3MCQA 1W41A 3O85A 5LYJB 2HQSC 5EWRA 4EI8A 2UYNB 1UI9A 1W2BF 3QUWA 1NMUB 4BVRA 4TZZA 1R1MA 2FC3A 1IPAA 2LBWA 3CYQA 3DC2A 1H48A 4E6EA 3IKEA 3C9TA 3P4EA 3ZOPA 1VQVA 1FFXB 3CCLF 1X25A 1COMA 3HKEA 3CCEF 3ZP7A 5EB1B 3J81M 2N48A 3C8LA 5HY1A 3M4SA 1JFFB 1VHAA 3IMPA 2B33A 4EB6A 1IV4A 4G88A 5EO3A 2P6YA 2YXZA 1VQPF 4X1YB 1W40A 4KWEA 4WBNA 5A2QM 3GHZA 5IJ9A 3CCRF 1TVKA 4ZK7A 2OTJF 3KE1A 3WJQA 5G4VC 5GONA 1VQKF 1M1KH 3OW2F 5J2TB 4O4LB 1E7KA 5JH7A 1KD1H 1IV3A 5JVDA 3N2KB 3FPIA 3LMEA 2HP3A 3RYHA 4BT4A 2HS3A 5LXTA 3L7QA 2OHWA 2I6DA 1VQOF 3HWUA 2ZVZA 1W5EA 3B6NA 1Q81H 4YJ2B 1VQ5F 4U3JA 3NK6A 5IJ0A 4G4VA 4ERHA 3P0ZA 3V7EA 4B5CA 3K2XA 4O4LA 1VQ6F 3TD4A 2LBXA 3MCAB 2CVLA 4EI9A 4DRXA 2MQEA 5MN5A 3ELCA 1VQ7F 2DT4A 2VXYA 3QHDA 4ZI7A 5LP6C 5CB4A 3I56F 4BT6A 1ODEA 5HWEA 2Q1XA 2H8CA 3RA5A 3IR9A 2BTUA 3M1XA 1YQNA 1U3LA 3U0OA 3F6MA 3G6EF 3CC4F 1YIJF 5MN6A 3C9UA 1S72F 3CG6A 1XBIA 3RA6A 1CLIA 2VAWA 1OFUA 2HVYD 4ZHYB 4X3LA 4G4YA 1XV2A 5JVDB 1XRGA 3V3TA 3I55F 4BT7A 4X1IA 4X20B 1PF5A 3CPWF 4PWTA 4BVTA 4G4WA 2KG4A 2PMPA 2UYNA 5EYPB 3S02A 2FGYA 1Q86H 1QAHA 3HKBB 1W5FA 3WPXA 3CCVF 3ZO8A 3K0TA 3WGLA 3WPWA 4I50A 4C4WC 1W55A 4EI7A 3WGNA 4YJ2A 1NJIH 3CCJF 3RE3A 2CHSA 2KTUA 3HKEB 3N2KA 3OONA 5FNVB 1T0KB 4XCQA 3CMAF 3JAWB 5EB0A 3OBWA 3D54A 1U43A 3E20B 4IHJA 1VQ8F 3F0FA 4TUYB 3VYSC 5J2UA 2CZWA 4X1KB 4DXDA 5KMGB 5EAZA 5CA0B 1TVKB 2PHNA 5ITZA 5HY0A 2HRYA 3TD5A 2Z1FA 4HNAA 5KMGA 1X52A 4X1KA 3CMEF 4X1YA 5LYJA 5EZYA 1RQ7A 4B45A 3S03A 1ONIA 1SZQA 2CSLA 2WALA 5LA6B 2Z1TA 4BT3A 1VQLF 1VH8A 2CWJA 2UYKA 3QTYA 4FFBA 1RLUA 3JAMM 5MN4A 1U40A 2NMUA 5LP6B 2HS4A 2RHJA 3RYFB 1X7PA 1TUBA 1QVFF 3IKFA 3C9RA 3JVHA 3MBMA 4O4JA 4LCKA 4O4IB 1VQ4F 2AIFA 5G4UC 3NK7A 3WJRA 3JAKB 1QU9A 4BT5A 2EWCA 1JN1A 2I6RA 3PLAC 2H8EA 3D00A 3FBAA 3LWRC 4LNUB 1GO0A 4O2BA 3RYFA 4O4HB 3HTNA 3S0WA 3WGJA 5LOVA 2GZLA 5GINC 3WGMA 3CXCF 3JATB 3N2GB 3ZP4A 3VMFB 3HKDA 4FFBB 1YHQF 3TD3A 5GANK 3HKCB 5C8YB 4C81A 5EIBD 3I7TA 5FJ4C 5CA1A 1W59A 1YJ9F 4BW0B 3HKBA 3JALA 3ON1A 2L26A 1ZWZA 3P10A 2ZAUA 3GYQA 3K12A 3VCZA 1QD9A 5AVMA 4X20A 2GVIA 3S06A 4ZHQA 3Q8HA 2ZF8A 5HY2A 4G4ZA 3AGKA 2RHOA 3IEQA 3CYPB 3UT5A 3KJJA 5KX5A 3JAWA 4U39A 2G9IA 3N4YA 2CW4A 1KC8H 3FD6A 2RHLA 3SIUA 4O2AA 2YYEA 3LWQC 1H47A 2ALEA 2K1SA 4RHAA 2ZVYA 4YJ3A 1YITF 1Q7YH 2ZOVA 3M84A 4NUTA 2IQQA 1W5BA 2Z1UA 3E22A 3JASA 4B46A 3GTZA 1CN7A 3BYQA 3LFOA 1VQMF 4BVSA 1KQSF 5EYPA 1YI2F 4DRXB 1DBFA 1SA0A 3OBYA 5JCOC 1YJNF 2HP0A 2W8BC 4X1IB 2VAMA 1IV1A 1W5AA 1FSZA 2LCAA 5FLXM 2VGMA 3SIVA 1FNJA 3FFMA 4TV9A 4BT2A 5GIPC 3LWVC 5GIOC 4NQ3A 3LYBA 1OAPA 3CPQA 4YJ3B 2KGWA 3NVKE 2JNBA 3G4SF 1Q82H 1W3EX 3J80M 1GO1A 3HJWC 3E1YA 2RHHA 1VQNF 2Z01A 3UT5B 3VI6A 5GONB 3CB2A 2IAFA 3VTIC 3IEWA 3N4ZA 5JQGB 4HNAB 3I3FA 3G71F 3RYCA 5IJ9B 3MQWA 1KNKA 3EORA 5JQGA 3FD5A 1QVGF 1RQ2A 1T0AA 2HRUA 4TUYA 5BMVA 3J7AR 4EB6B 2HS0A 3CC2F 5IJ0B 1W57A 3T80A 4U3JB 2AMTA 2CHTA 1DT9A 1Q8RA 3C9SA 5JCOA 3RYIB 3DDNA 3F0DA 3HKDB 5LXTB 3LWPC 3S0YA 5JH7B 3F0GA 4TV9B 5J2TA 4I50B 5BMVB 2HP0B 2ZODA 5EIBC 3VYTC 3D01A 2QTPA 3MDOA 4B62A 4O4JB 4WBNB 3S0HA 3CCSF 1K73H 1NQ3A 2OTMA 2UYPA 5LP6A 2F9ZC 4BVQA 1K8AH 3RYIA 2GLZA 4BY9D 4TV8A 2Q1YA 1YGYA 4I55B 3KJKA 2QEXF 1X7OA 2UYJA 1N8RH 2RB9A 4IIJA 1U3PA 2QI2A 4C8EA 5HP8A 3RYCB 3NMUC 5CA0A 5CB4B 1H7MA 3VOAA 1W581 4ZI7B 5IYZA 1SA0B 2V9YA 3JALB 3JARB 4C82A 5IT9M 2DYYA 4I4TB 3PAFA 1GZ0A 1CK2A 5FNVA 2BO1A 5CA1B 3JASB 2R751 4NWOB 1J7HA 5HY4A 4C8GA 1M90H 2VGNA 3RYHB 3LWOC 5LOVB 4O4HA 4O2BB 4I4TA 1W42A 4RQOA 1JY8A 2R6R1 1Z5WA 3CCMF 2OZBA 3V7QA 3JAKA 4ZHVA 1VK3A 4R40B 5IYZB 1PXWA 3CCUF 2KTVA 1GX1A 5B8FA 5DCVA 4O4IA 4ZOLB 5GAPK 3V4DA 2QA4F 1XHOA 3CD6F 1FNKA 3KHNA 4IIJB 3E22B 1VQ9F 3VO8A 1JFFA 4TV8B 2Z1EA 3F0EA 3HKCA 4O2AB 3CC7F 3NVIB 1FFXA 4X3MA 3VIUA 3JATA 3N2GA 3WXMB 5HXUA 3VYUC 5KX5B 3JARA 3HAXD 4G4XA 2H6LA 2IG8A 5EZYB 4ZOLA 1UFYA 3R0PA
chains in the Genus database with same CATH topology
1COMA 3ZP4A 1ODEA 3KJJA 5HP7A 3LMEA 2UYNA 3ZP7A 3V4DA 2CW4A 3L7QA 1QAHA 3M4SA 1XHOA 3I3FA 2B33A 1FNKA 4NWOB 1J7HA 1FNJA 3M1XA 3I7TA 3KJKA 3K0TA 3MQWA 3ZO8A 2UYNB 1UI9A 2UYJA 3QUWA 3D01A 4ZK7A 3LYBA 5HP8A 1JD1A 1QU9A 3GTZA 3K12A 2CHSA 3VCZA 2CHTA 1ONIA 2CSLA 2EWCA 1QD9A 2CVLA 1XRGA 2CWJA 2UYKA 1NQ3A 2OTMA 2UYPA 3ZOPA 2IG8A 1X25A 1DBFA 1PF5A 2DYYA 1UFYA 3R0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COM A;  3ZP4 A;  1ODE A;  3KJJ A;  5HP7 A;  3LME A;  2UYN A;  3ZP7 A;  3V4D A;  2CW4 A;  3L7Q A;  1QAH A;  3M4S A;  1XHO A;  3I3F A;  2B33 A;  1FNK A;  4NWO B;  1J7H A;  1FNJ A;  3M1X A;  3I7T A;  3KJK A;  3K0T A;  3MQW A;  3ZO8 A;  2UYN B;  1UI9 A;  2UYJ A;  3QUW A;  3D01 A;  4ZK7 A;  3LYB A;  5HP8 A;  1JD1 A;  1QU9 A;  3GTZ A;  3K12 A;  2CHS A;  3VCZ A;  2CHT A;  1ONI A;  2CSL A;  2EWC A;  1QD9 A;  2CVL A;  1XRG A;  2CWJ A;  2UYK A;  1NQ3 A;  2OTM A;  2UYP A;  3ZOP A;  2IG8 A;  1X25 A;  1DBF A;  1PF5 A;  2DYY A;  1UFY A;  3R0P A; 
#chains in the Genus database with same CATH topology
 4ZHW A;  1RA4 A;  4ZHQ B;  5HXZ A;  5ITZ B;  2BTO A;  2BTQ B;  1Z5V A;  5J2U B;  2AIZ P;  1YJW F;  4IHJ B;  3CCQ F;  4I55 A;  3VOB A;  3KIZ A;  4M8I A;  1TUB B;  1SDS A;  5C8Y A;  1JD1 A;  4F6R B;  2LBT A;  1JJ2 F;  4C8I A;  1K9M H;  2OTL F;  3LDT A;  3JCM M;  3ERN A;  2UZH A;  2VAP A;  1RLG A;  1KNJ A;  2HX0 A;  4F6R A;  3K14 A;  4LNU A;  3ESJ A;  5LA6 A;  3WJP A;  1IV2 A;  5HP7 A;  3WGK A;  3MCQ A;  1W41 A;  3O85 A;  5LYJ B;  2HQS C;  5EWR A;  4EI8 A;  2UYN B;  1UI9 A;  1W2B F;  3QUW A;  1NMU B;  4BVR A;  4TZZ A;  1R1M A;  2FC3 A;  1IPA A;  2LBW A;  3CYQ A;  3DC2 A;  1H48 A;  4E6E A;  3IKE A;  3C9T A;  3P4E A;  3ZOP A;  1VQV A;  1FFX B;  3CCL F;  1X25 A;  1COM A;  3HKE A;  3CCE F;  3ZP7 A;  5EB1 B;  3J81 M;  2N48 A;  3C8L A;  5HY1 A;  3M4S A;  1JFF B;  1VHA A;  3IMP A;  2B33 A;  4EB6 A;  1IV4 A;  4G88 A;  5EO3 A;  2P6Y A;  2YXZ A;  1VQP F;  4X1Y B;  1W40 A;  4KWE A;  4WBN A;  5A2Q M;  3GHZ A;  5IJ9 A;  3CCR F;  1TVK A;  4ZK7 A;  2OTJ F;  3KE1 A;  3WJQ A;  5G4V C;  5GON A;  1VQK F;  1M1K H;  3OW2 F;  5J2T B;  4O4L B;  1E7K A;  5JH7 A;  1KD1 H;  1IV3 A;  5JVD A;  3N2K B;  3FPI A;  3LME A;  2HP3 A;  3RYH A;  4BT4 A;  2HS3 A;  5LXT A;  3L7Q A;  2OHW A;  2I6D A;  1VQO F;  3HWU A;  2ZVZ A;  1W5E A;  3B6N A;  1Q81 H;  4YJ2 B;  1VQ5 F;  4U3J A;  3NK6 A;  5IJ0 A;  4G4V A;  4ERH A;  3P0Z A;  3V7E A;  4B5C A;  3K2X A;  4O4L A;  1VQ6 F;  3TD4 A;  2LBX A;  3MCA B;  2CVL A;  4EI9 A;  4DRX A;  2MQE A;  5MN5 A;  3ELC A;  1VQ7 F;  2DT4 A;  2VXY A;  3QHD A;  4ZI7 A;  5LP6 C;  5CB4 A;  3I56 F;  4BT6 A;  1ODE A;  5HWE A;  2Q1X A;  2H8C A;  3RA5 A;  3IR9 A;  2BTU A;  3M1X A;  1YQN A;  1U3L A;  3U0O A;  3F6M A;  3G6E F;  3CC4 F;  1YIJ F;  5MN6 A;  3C9U A;  1S72 F;  3CG6 A;  1XBI A;  3RA6 A;  1CLI A;  2VAW A;  1OFU A;  2HVY D;  4ZHY B;  4X3L A;  4G4Y A;  1XV2 A;  5JVD B;  1XRG A;  3V3T A;  3I55 F;  4BT7 A;  4X1I A;  4X20 B;  1PF5 A;  3CPW F;  4PWT A;  4BVT A;  4G4W A;  2KG4 A;  2PMP A;  2UYN A;  5EYP B;  3S02 A;  2FGY A;  1Q86 H;  1QAH A;  3HKB B;  1W5F A;  3WPX A;  3CCV F;  3ZO8 A;  3K0T A;  3WGL A;  3WPW A;  4I50 A;  4C4W C;  1W55 A;  4EI7 A;  3WGN A;  4YJ2 A;  1NJI H;  3CCJ F;  3RE3 A;  2CHS A;  2KTU A;  3HKE B;  3N2K A;  3OON A;  5FNV B;  1T0K B;  4XCQ A;  3CMA F;  3JAW B;  5EB0 A;  3OBW A;  3D54 A;  1U43 A;  3E20 B;  4IHJ A;  1VQ8 F;  3F0F A;  4TUY B;  3VYS C;  5J2U A;  2CZW A;  4X1K B;  4DXD A;  5KMG B;  5EAZ A;  5CA0 B;  1TVK B;  2PHN A;  5ITZ A;  5HY0 A;  2HRY A;  3TD5 A;  2Z1F A;  4HNA A;  5KMG A;  1X52 A;  4X1K A;  3CME F;  4X1Y A;  5LYJ A;  5EZY A;  1RQ7 A;  4B45 A;  3S03 A;  1ONI A;  1SZQ A;  2CSL A;  2WAL A;  5LA6 B;  2Z1T A;  4BT3 A;  1VQL F;  1VH8 A;  2CWJ A;  2UYK A;  3QTY A;  4FFB A;  1RLU A;  3JAM M;  5MN4 A;  1U40 A;  2NMU A;  5LP6 B;  2HS4 A;  2RHJ A;  3RYF B;  1X7P A;  1TUB A;  1QVF F;  3IKF A;  3C9R A;  3JVH A;  3MBM A;  4O4J A;  4LCK A;  4O4I B;  1VQ4 F;  2AIF A;  5G4U C;  3NK7 A;  3WJR A;  3JAK B;  1QU9 A;  4BT5 A;  2EWC A;  1JN1 A;  2I6R A;  3PLA C;  2H8E A;  3D00 A;  3FBA A;  3LWR C;  4LNU B;  1GO0 A;  4O2B A;  3RYF A;  4O4H B;  3HTN A;  3S0W A;  3WGJ A;  5LOV A;  2GZL A;  5GIN C;  3WGM A;  3CXC F;  3JAT B;  3N2G B;  3ZP4 A;  3VMF B;  3HKD A;  4FFB B;  1YHQ F;  3TD3 A;  5GAN K;  3HKC B;  5C8Y B;  4C81 A;  5EIB D;  3I7T A;  5FJ4 C;  5CA1 A;  1W59 A;  1YJ9 F;  4BW0 B;  3HKB A;  3JAL A;  3ON1 A;  2L26 A;  1ZWZ A;  3P10 A;  2ZAU A;  3GYQ A;  3K12 A;  3VCZ A;  1QD9 A;  5AVM A;  4X20 A;  2GVI A;  3S06 A;  4ZHQ A;  3Q8H A;  2ZF8 A;  5HY2 A;  4G4Z A;  3AGK A;  2RHO A;  3IEQ A;  3CYP B;  3UT5 A;  3KJJ A;  5KX5 A;  3JAW A;  4U39 A;  2G9I A;  3N4Y A;  2CW4 A;  1KC8 H;  3FD6 A;  2RHL A;  3SIU A;  4O2A A;  2YYE A;  3LWQ C;  1H47 A;  2ALE A;  2K1S A;  4RHA A;  2ZVY A;  4YJ3 A;  1YIT F;  1Q7Y H;  2ZOV A;  3M84 A;  4NUT A;  2IQQ A;  1W5B A;  2Z1U A;  3E22 A;  3JAS A;  4B46 A;  3GTZ A;  1CN7 A;  3BYQ A;  3LFO A;  1VQM F;  4BVS A;  1KQS F;  5EYP A;  1YI2 F;  4DRX B;  1DBF A;  1SA0 A;  3OBY A;  5JCO C;  1YJN F;  2HP0 A;  2W8B C;  4X1I B;  2VAM A;  1IV1 A;  1W5A A;  1FSZ A;  2LCA A;  5FLX M;  2VGM A;  3SIV A;  1FNJ A;  3FFM A;  4TV9 A;  4BT2 A;  5GIP C;  3LWV C;  5GIO C;  4NQ3 A;  3LYB A;  1OAP A;  3CPQ A;  4YJ3 B;  2KGW A;  3NVK E;  2JNB A;  3G4S F;  1Q82 H;  1W3E X;  3J80 M;  1GO1 A;  3HJW C;  3E1Y A;  2RHH A;  1VQN F;  2Z01 A;  3UT5 B;  3VI6 A;  5GON B;  3CB2 A;  2IAF A;  3VTI C;  3IEW A;  3N4Z A;  5JQG B;  4HNA B;  3I3F A;  3G71 F;  3RYC A;  5IJ9 B;  3MQW A;  1KNK A;  3EOR A;  5JQG A;  3FD5 A;  1QVG F;  1RQ2 A;  1T0A A;  2HRU A;  4TUY A;  5BMV A;  3J7A R;  4EB6 B;  2HS0 A;  3CC2 F;  5IJ0 B;  1W57 A;  3T80 A;  4U3J B;  2AMT A;  2CHT A;  1DT9 A;  1Q8R A;  3C9S A;  5JCO A;  3RYI B;  3DDN A;  3F0D A;  3HKD B;  5LXT B;  3LWP C;  3S0Y A;  5JH7 B;  3F0G A;  4TV9 B;  5J2T A;  4I50 B;  5BMV B;  2HP0 B;  2ZOD A;  5EIB C;  3VYT C;  3D01 A;  2QTP A;  3MDO A;  4B62 A;  4O4J B;  4WBN B;  3S0H A;  3CCS F;  1K73 H;  1NQ3 A;  2OTM A;  2UYP A;  5LP6 A;  2F9Z C;  4BVQ A;  1K8A H;  3RYI A;  2GLZ A;  4BY9 D;  4TV8 A;  2Q1Y A;  1YGY A;  4I55 B;  3KJK A;  2QEX F;  1X7O A;  2UYJ A;  1N8R H;  2RB9 A;  4IIJ A;  1U3P A;  2QI2 A;  4C8E A;  5HP8 A;  3RYC B;  3NMU C;  5CA0 A;  5CB4 B;  1H7M A;  3VOA A;  1W58 1;  4ZI7 B;  5IYZ A;  1SA0 B;  2V9Y A;  3JAL B;  3JAR B;  4C82 A;  5IT9 M;  2DYY A;  4I4T B;  3PAF A;  1GZ0 A;  1CK2 A;  5FNV A;  2BO1 A;  5CA1 B;  3JAS B;  2R75 1;  4NWO B;  1J7H A;  5HY4 A;  4C8G A;  1M90 H;  2VGN A;  3RYH B;  3LWO C;  5LOV B;  4O4H A;  4O2B B;  4I4T A;  1W42 A;  4RQO A;  1JY8 A;  2R6R 1;  1Z5W A;  3CCM F;  2OZB A;  3V7Q A;  3JAK A;  4ZHV A;  1VK3 A;  4R40 B;  5IYZ B;  1PXW A;  3CCU F;  2KTV A;  1GX1 A;  5B8F A;  5DCV A;  4O4I A;  4ZOL B;  5GAP K;  3V4D A;  2QA4 F;  1XHO A;  3CD6 F;  1FNK A;  3KHN A;  4IIJ B;  3E22 B;  1VQ9 F;  3VO8 A;  1JFF A;  4TV8 B;  2Z1E A;  3F0E A;  3HKC A;  4O2A B;  3CC7 F;  3NVI B;  1FFX A;  4X3M A;  3VIU A;  3JAT A;  3N2G A;  3WXM B;  5HXU A;  3VYU C;  5KX5 B;  3JAR A;  3HAX D;  4G4X A;  2H6L A;  2IG8 A;  5EZY B;  4ZOL A;  1UFY A;  3R0P A; 
#chains in the Genus database with same CATH homology
 1COM A;  3ZP4 A;  1ODE A;  3KJJ A;  5HP7 A;  3LME A;  2UYN A;  3ZP7 A;  3V4D A;  2CW4 A;  3L7Q A;  1QAH A;  3M4S A;  1XHO A;  3I3F A;  2B33 A;  1FNK A;  4NWO B;  1J7H A;  1FNJ A;  3M1X A;  3I7T A;  3KJK A;  3K0T A;  3MQW A;  3ZO8 A;  2UYN B;  1UI9 A;  2UYJ A;  3QUW A;  3D01 A;  4ZK7 A;  3LYB A;  5HP8 A;  1JD1 A;  1QU9 A;  3GTZ A;  3K12 A;  2CHS A;  3VCZ A;  2CHT A;  1ONI A;  2CSL A;  2EWC A;  1QD9 A;  2CVL A;  1XRG A;  2CWJ A;  2UYK A;  1NQ3 A;  2OTM A;  2UYP A;  3ZOP A;  2IG8 A;  1X25 A;  1DBF A;  1PF5 A;  2DYY A;  1UFY A;  3R0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...