3I3JA

Crystal structure of the bromodomain of human ep300
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
114
structure length
114
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase p300
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3i3jA00
4YBTA 4YYJA 5FG4A 4QSQA 4AKNA 5DFDA 4KV4A 3O37A 3HMHA 4O7EA 4CLBA 5CQAA 2RNWA 4YYGA 5D26A 5F25A 4HXRA 4NYWA 4IOQA 4UIYA 4N4HA 5E9VA 3ZYUA 3IU5A 4LYWA 4TTEA 4QYLA 4O7FA 5F61A 2R0VA 4QSTA 3MULA 4ALGA 5KTXA 3G0LA 3JVKA 4NR9A 5L98A 5CFWA 3Q2FA 2GRCA 2H60A 4ALHA 4BW1A 4O7BA 4TQNA 5ENHA 5HQ6A 2YQDA 5CRMA 4QSRA 5E9YA 5EWHA 2FSAA 4NR8A 4UIZA 4YYDA 3UVDA 4Z6HA 5DKCA 5LJ2A 5E9MA 4NRBA 2RNXA 5E7DA 4CURA 5EWVA 4YY6A 5C85A 4GPJA 5CZGA 4A9LA 4N3WA 5BT4A 5I88A 4IR6A 5ENGA 3UW9A 4N4FA 5II1A 3LXJA 4QC3A 5LVRA 4O7AA 5I1QA 5CU8A 3JVMA 5JWMA 3UV5A 3P1EA 4NS5A 5I83A 3P1CA 3UVXA 2KTBB 4QR4A 4TT4A 5HQ7A 4QY4A 3SVHA 5D25A 3DAIA 4CL9A 2I7KA 2L85A 3Q2EA 5I29A 2MJVB 4QSWA 5EGUA 4YH4A 5EA1A 4QEWA 4HXMA 5LVQA 5FE7A 3UV4A 5EPSA 3SVGA 4Q0OA 4UYEA 5F1LA 5DW1A 5E9IA 4NYVA 4O70A 4QEUA 4J0SA 3P1DA 5FE4A 5AD3A 5FB1A 4XY9A 5LJ0A 5I80A 4KCXA 2R0SA 5K29A 4OUFA 3HMFA 5KTUA 4HXOA 5C8GA 5IIDA 4YYMA 3AADA 2RFJA 1WUMA 5F5ZA 4TT6A 5EISA 4TZ8A 4LC2A 4MR5A 2DKWA 4QSSA 2WP1A 4CUQA 4PCIA 5A5QA 4BW4A 4YBMA 2RI7A 4YBSA 4HXLA 5D3PA 5A5RA 4IR4A 4WHWA 5ENFA 4QR3A 2DVRA 5CQ5A 4IORA 4MENA 3ONIA 4YH3A 5DY7A 5FE9A 3LQHA 4A9KA 5LUUA 4UYGA 2DVVA 3QZSA 5F63A 5IG6A 5KHMA 5C4QA 5COIA 4NR5A 5BT5A 5FE5A 5C7NA 3NXBA 2YYNA 5G4SA 4YYIA 4CFLA 5D7XA 5CGPA 5EM3A 3UV2A 4PS5A 5CUEA 5LKUA 2E7OA 5HFQA 4NR6A 5L99A 3QZTA 1N72A 4PCEA 5C87A 5CY9A 5I40A 5EWCA 2LSPB 5EI4A 5E9KA 5EICA 3JVJA 5I7XA 4YY4A 4YADA 2YELA 3U5KA 4NRAA 4UYFA 3MB3A 4UYDA 5CS8A 5HELA 3S92A 3U5LA 5D3LA 5DKDA 5DFBA 3U5OA 4O74A 5BT3A 5LKTA 5I7YA 4UYHA 4QBMA 2G4AA 4YYKA 4LZ2A 5JI8A 5ACYA 5CUAA 2DATA 5L8TA 5FBXA 4QEVA 3G0JA 5FE0A 5HQ5A 2I8NA 5F36A 5ENCA 5E9LA 5CUBA 5CUGA 4XUAA 5D3NA 4HXPA 5F3AA 4DONA 5FFVA 5FE8A 5CQ4A 5A5NA 5A85A 5HLSA 4IR5A 5AMEA 5FH6A 4KV1A 3U5NA 5FFYA 1F68A 5DLZA 5ETBA 2R0YA 5ENEA 4XY8A 4HXKA 4IR3A 4NR7A 2N9GA 4E96A 3QZVA 5DBMA 4Z6IA 1JM4B 5CQ7A 4LRGA 4A9IA 3D7CA 2OO1A 2WP2A 4J1PA 2DVQA 4Z93A 4QSPA 5E3GA 5AMFA 5DW2A 4BW2A 2RS9B 5I89A 5G4RA 2DVSA 4N4IA 4UITA 4XUBA 5A5OA 2L5EA 4QR5A 5E0RA 4TS8A 3IU6A 4WIVA 2D82A 4UIUA 4A9HA 5ETDA 5F60A 4O75A 4ZC9A 4Z1SA 4BW3A 4PTBA 5FE6A 5FE2A 5HM0A 4UYFB 5EPRA 5CQ3A 5EQ1A 4OGIA 4NYXA 4QSVA 4O72A 5EVAA 5EU1A 4QC1A 5D24A 5EWWA 5IGMA 3LJWA 3O36A 4NQMA 4QYDA 3FKMX 5EK9A 5FB0A 1X0JA 3AQAA 4CUPA 4CUTA 3JVLA 5KTWA 3TLPA 2OSSA 5L97A 3S91A 4NRCA 4O78A 5H1TA 4NUEA 2OUOA 2D9EA 5KO4A 4YC9A 5DYCA 5ENBA 4A9JA 4CUSA 4QSUA 4Y03A 5HRXA 5D3SA 5DYAA 4J0RA 4CFKA 5HCLA 4MEPA 2RO1A 5EP7A 5D0CA 4QZSA 4PKLA 3U5JA 5A5PA 4NUDA 4YK0A 5LKZA 4QSXA 5F62A 2YEKA 4TU6A 4ZW1A 4QUTA 1ZS5A 2L84A 2F6NA 5A82A 3O35A 3K2JA 4WHUA 4A9NA 4TZ2A 5D3JA 4BJXA 5E73A 1E6IA 4MR3A 4O76A 5L8UA 5CPEA 4HBWA 5II2A 3RCWA 5J0DA 5TB6A 4HBXA 3MQMA 3HMEA 4BHWA 5CQ6A 2R10A 3O34A 5AD2A 4QUUA 4LYIA 4O7CA 4TYLA 5ENIA 2E3KA 5D3TA 3SVFA 5IGNA 4X2IA 5HRWA 4J3IA 4Z1QA 5KU3A 4MR6A 5EV9A 5F1HA 5DLXA 4HXNA 4O71A 4PY6A 4LDFA 4UIVA 4HBVA 4Q0NA 5IGLA 4NUCA 5LKXA 5CTLA 4YABA 4TU4A 4YYNA 5FG5A 4QB3A 5F2PA 4YAXA 4NQNA 5DYUA 5HJCA 3LQJA 5EPBA 3UVWA 3O33A 4TT2A 3I3JA 5CQ8A 3LQIA 5FH7A 3MB4A 3MXFA 4LYSA 5IGKA 2RNYA 5HENA 2YW5A 4O77A 4CUUA 5LJ1A 5IBNA 5E3DA 4N4GA 5DYXA 3UVYA 5CP5A 5A81A 4A9FA 3MUKA 4YYHA 5DKHA 2NXBA 5CRZA 2F6JA 4HXSA 5TCMA 4MR4A 4MEOA 4YATA 5FE1A 4MEQA 5HEMA 1JSPB 3DWYA 5C89A 4F3IA 4FLPA 5HRVA 4A9MA 2YEMA 4LZRA 4QNSA 5FG6A 5FDZA 4IOOA 4RVRA 5D3RA 4ZQLA 5HFRA 5EWDA 5H1UA 5H85A 5E74A 4A9OA 4LZSA 4C67A 3U5MA 3GG3A 4NR4A 4OGJA 5L96A 5CQTA 5H1VA 4NXJA 3P1FA 4XYAA 5DX4A 2E7NA 5A5SA 5D3HA 5FE3A 1EQFA 4LR6A 3P5OA 4A9EA 4UIXA 4C66A 5A83A 5CUDA 5CUCA 5DFCA 5ENJA 1WUGA 2YDWA 5I86A 3U5PA 2DWWA 5A7CA 5FFWA 4HBYA 4UIWA 5FH8A
chains in the Genus database with same CATH superfamily
4YBTA 4YYJA 5FG4A 4QSQA 4AKNA 5DFDA 4KV4A 3O37A 3HMHA 3D1DA 4O7EA 4CLBA 5CQAA 2RNWA 4YYGA 5D26A 5F25A 4HXRA 4NYWA 4IOQA 4UIYA 4N4HA 5E9VA 3ZYUA 3IU5A 4LYWA 4TTEA 4QYLA 4O7FA 5F61A 2R0VA 4QSTA 3MULA 4ALGA 5KTXA 3G0LA 3JVKA 4NR9A 5L98A 5CFWA 3Q2FA 2GRCA 2H60A 4ALHA 4BW1A 4O7BA 4TQNA 5ENHA 5HQ6A 2YQDA 5CRMA 4QSRA 5E9YA 5EWHA 2FSAA 4NR8A 4UIZA 4YYDA 3UVDA 4Z6HA 5DKCA 5LJ2A 5E9MA 4NRBA 2RNXA 2EJNA 5E7DA 5EWVA 4CURA 4YY6A 5C85A 4GPJA 5CZGA 4A9LA 4N3WA 5BT4A 5I88A 4IR6A 5ENGA 3UW9A 4N4FA 5II1A 3LXJA 4QC3A 5LVRA 4O7AA 5I1QA 5CU8A 3JVMA 5JWMA 3UV5A 3P1EA 4NS5A 5I83A 3P1CA 3UVXA 2KTBB 4QR4A 4TT4A 5HQ7A 4QY4A 3SVHA 5D25A 3DAIA 4CL9A 4AKGA 2I7KA 2L85A 3Q2EA 5I29A 4QSWA 2MJVB 5EGUA 4YH4A 5EA1A 4QEWA 4HXMA 5LVQA 5FE7A 3UV4A 5EPSA 3SVGA 4Q0OA 4UYEA 5F1LA 5DW1A 5E9IA 4NYVA 4O70A 4QEUA 4J0SA 3P1DA 5FE4A 5AD3A 5FB1A 4XY9A 5LJ0A 5I80A 4KCXA 2R0SA 5K29A 4OUFA 3HMFA 5KTUA 4HXOA 5C8GA 5IIDA 4YYMA 3AADA 2RFJA 1WUMA 5F5ZA 4TT6A 5EISA 4TZ8A 4LC2A 4MR5A 2DKWA 4QSSA 2WP1A 4CUQA 4PCIA 5A5QA 4BW4A 4YBMA 2RI7A 4YBSA 4HXLA 5D3PA 5A5RA 4IR4A 4WHWA 5ENFA 4QR3A 2DVRA 5CQ5A 4IORA 4MENA 3ONIA 4YH3A 5DY7A 5FE9A 3LQHA 1ZKRA 4A9KA 5LUUA 4UYGA 2DVVA 3QZSA 5F63A 5IG6A 5KHMA 5C4QA 5COIA 4NR5A 5BT5A 5FE5A 5C7NA 3NXBA 2YYNA 5G4SA 4YYIA 4CFLA 5D7XA 5CGPA 5EM3A 3UV2A 4PS5A 5CUEA 5LKUA 2E7OA 5HFQA 4NR6A 5L99A 3QZTA 1N72A 4PCEA 5C87A 5CY9A 5I40A 5EWCA 2LSPB 5EI4A 5E9KA 5EICA 3JVJA 5I7XA 4YY4A 4YADA 2YELA 3U5KA 4NRAA 4UYFA 3MB3A 4UYDA 5CS8A 5HELA 3S92A 3U5LA 5D3LA 5DKDA 5DFBA 3U5OA 4O74A 5BT3A 5LKTA 5I7YA 4UYHA 4QBMA 2G4AA 4YYKA 4LZ2A 5JI8A 5ACYA 5CUAA 2DATA 5L8TA 5FBXA 4QEVA 3G0JA 5FE0A 5HQ5A 2I8NA 5F36A 5ENCA 5E9LA 5CUBA 5CUGA 4XUAA 5D3NA 4HXPA 5F3AA 4DONA 5FFVA 5FE8A 5CQ4A 5A5NA 5A85A 5HLSA 4IR5A 5AMEA 5FH6A 4KV1A 3U5NA 5FFYA 1F68A 5DLZA 5ETBA 2R0YA 5ENEA 4XY8A 4HXKA 4IR3A 4NR7A 2N9GA 4E96A 3QZVA 5DBMA 4Z6IA 1JM4B 5CQ7A 4LRGA 4A9IA 3D7CA 2OO1A 2WP2A 4J1PA 1PUOA 2DVQA 4Z93A 4QSPA 5E3GA 5AMFA 5DW2A 4BW2A 2RS9B 5I89A 5G4RA 2DVSA 4N4IA 4UITA 4XUBA 5A5OA 2L5EA 4QR5A 5E0RA 4TS8A 3IU6A 4WIVA 2D82A 4UIUA 4A9HA 5ETDA 5F60A 4O75A 4ZC9A 4Z1SA 4BW3A 4PTBA 5FE6A 5FE2A 5HM0A 4UYFB 5EPRA 5CQ3A 5EQ1A 4OGIA 4NYXA 4QSVA 4O72A 5EVAA 5EU1A 4QC1A 5D24A 5EWWA 5IGMA 3LJWA 3O36A 4NQMA 4QYDA 3FKMX 5EK9A 5FB0A 1X0JA 3AQAA 4CUPA 4CUTA 3JVLA 5KTWA 3TLPA 2OSSA 5L97A 3S91A 4NRCA 4O78A 5H1TA 4NUEA 2OUOA 2D9EA 5KO4A 4YC9A 5DYCA 5ENBA 4A9JA 4CUSA 4QSUA 4Y03A 5HRXA 5D3SA 5DYAA 4J0RA 4CFKA 5HCLA 4MEPA 2RO1A 5EP7A 5D0CA 4QZSA 4PKLA 3U5JA 5A5PA 4NUDA 4YK0A 5LKZA 4QSXA 5F62A 2YEKA 4TU6A 4ZW1A 4QUTA 1ZS5A 2L84A 2F6NA 5A82A 3O35A 3K2JA 4WHUA 4A9NA 4TZ2A 5D3JA 4BJXA 5E73A 1E6IA 4AI6A 4MR3A 4O76A 5L8UA 5CPEA 4HBWA 5II2A 3RCWA 5J0DA 5TB6A 4HBXA 3MQMA 3HMEA 4BHWA 4AKHA 5CQ6A 2R10A 3O34A 5AD2A 4QUUA 4LYIA 4O7CA 4TYLA 5ENIA 2E3KA 5D3TA 3SVFA 5IGNA 4X2IA 5HRWA 4J3IA 4Z1QA 5KU3A 4MR6A 5EV9A 5F1HA 5DLXA 4HXNA 4O71A 4PY6A 4LDFA 4UIVA 4HBVA 4Q0NA 5IGLA 4NUCA 5LKXA 5CTLA 4YABA 4TU4A 4YYNA 5FG5A 4QB3A 5F2PA 4YAXA 4NQNA 5DYUA 5HJCA 3VKHA 3ERRA 3LQJA 5EPBA 3UVWA 3O33A 4TT2A 3I3JA 5CQ8A 3LQIA 5FH7A 3MB4A 3MXFA 4LYSA 5IGKA 2RNYA 4AKIA 5HENA 2YW5A 4O77A 4CUUA 5LJ1A 5IBNA 5E3DA 4N4GA 5DYXA 3UVYA 5CP5A 5A81A 4A9FA 3MUKA 4YYHA 5DKHA 2NXBA 5CRZA 2F6JA 4HXSA 5TCMA 4MR4A 4MEOA 4YATA 5FE1A 4MEQA 5HEMA 1JSPB 3DWYA 5C89A 4F3IA 3VKGA 4FLPA 5HRVA 4A9MA 2YEMA 4LZRA 4QNSA 5FG6A 5FDZA 4IOOA 4RVRA 5D3RA 4ZQLA 5HFRA 5EWDA 5H1UA 5H85A 5E74A 4A9OA 4LZSA 4C67A 3U5MA 3GG3A 4NR4A 4OGJA 5L96A 5CQTA 5H1VA 4NXJA 3P1FA 4XYAA 5DX4A 2E7NA 3D1BA 5A5SA 5D3HA 5FE3A 1EQFA 4LR6A 3P5OA 4A9EA 4UIXA 4C66A 5A83A 5CUDA 5CUCA 5DFCA 5ENJA 1WUGA 2YDWA 5I86A 3U5PA 2DWWA 5A7CA 5FFWA 4HBYA 4UIWA 5FH8A
chains in the Genus database with same CATH topology
4YBTA 4YYJA 5FG4A 4QSQA 4AKNA 5DFDA 4KV4A 3O37A 3HMHA 4O7EA 4CLBA 5CQAA 2RNWA 4YYGA 5D26A 5F25A 4HXRA 4NYWA 4IOQA 4UIYA 4N4HA 5E9VA 3ZYUA 3IU5A 4LYWA 4TTEA 4QYLA 4O7FA 5F61A 2R0VA 4QSTA 3MULA 4ALGA 5KTXA 3G0LA 3JVKA 4NR9A 5L98A 5CFWA 3Q2FA 2GRCA 2H60A 4ALHA 4BW1A 4O7BA 4TQNA 5ENHA 5HQ6A 2YQDA 5CRMA 4QSRA 5E9YA 5EWHA 2FSAA 4NR8A 4UIZA 4YYDA 3UVDA 4Z6HA 5DKCA 5LJ2A 5E9MA 4NRBA 2RNXA 5E7DA 4CURA 5EWVA 4YY6A 5C85A 4GPJA 5CZGA 4A9LA 4N3WA 5BT4A 5I88A 4IR6A 5ENGA 3UW9A 4N4FA 5II1A 3LXJA 4QC3A 5LVRA 4O7AA 5I1QA 5CU8A 3JVMA 5JWMA 3UV5A 3P1EA 4NS5A 5I83A 3P1CA 3UVXA 2KTBB 4QR4A 4TT4A 5HQ7A 4QY4A 3SVHA 5D25A 3DAIA 4CL9A 2I7KA 2L85A 3Q2EA 5I29A 2MJVB 4QSWA 5EGUA 4YH4A 5EA1A 4QEWA 4HXMA 5LVQA 5FE7A 3UV4A 5EPSA 3SVGA 4Q0OA 4UYEA 5F1LA 5DW1A 5E9IA 4NYVA 4O70A 4QEUA 4J0SA 3P1DA 5FE4A 5AD3A 5FB1A 4XY9A 5LJ0A 5I80A 4KCXA 2R0SA 5K29A 4OUFA 3HMFA 5KTUA 4HXOA 5C8GA 5IIDA 4YYMA 3AADA 2RFJA 1WUMA 5F5ZA 4TT6A 5EISA 4TZ8A 4LC2A 4MR5A 2DKWA 4QSSA 2WP1A 4CUQA 4PCIA 5A5QA 4BW4A 4YBMA 2RI7A 4YBSA 4HXLA 5D3PA 5A5RA 4IR4A 4WHWA 5ENFA 4QR3A 2DVRA 5CQ5A 4IORA 4MENA 3ONIA 4YH3A 5DY7A 5FE9A 3LQHA 4A9KA 5LUUA 4UYGA 2DVVA 3QZSA 5F63A 5IG6A 5KHMA 5C4QA 5COIA 4NR5A 5BT5A 5FE5A 5C7NA 3NXBA 2YYNA 5G4SA 4YYIA 4CFLA 5D7XA 5CGPA 5EM3A 3UV2A 4PS5A 5CUEA 5LKUA 2E7OA 5HFQA 4NR6A 5L99A 3QZTA 1N72A 4PCEA 5C87A 5CY9A 5I40A 5EWCA 2LSPB 5EI4A 5E9KA 5EICA 3JVJA 5I7XA 4YY4A 4YADA 2YELA 3U5KA 4NRAA 4UYFA 3MB3A 4UYDA 5CS8A 5HELA 3S92A 3U5LA 5D3LA 5DKDA 5DFBA 3U5OA 4O74A 5BT3A 5LKTA 5I7YA 4UYHA 4QBMA 2G4AA 4YYKA 4LZ2A 5JI8A 5ACYA 5CUAA 2DATA 5L8TA 5FBXA 4QEVA 3G0JA 5FE0A 5HQ5A 2I8NA 5F36A 5ENCA 5E9LA 5CUBA 5CUGA 4XUAA 5D3NA 4HXPA 5F3AA 4DONA 5FFVA 5FE8A 5CQ4A 5A5NA 5A85A 5HLSA 4IR5A 5AMEA 5FH6A 4KV1A 3U5NA 5FFYA 1F68A 5DLZA 5ETBA 2R0YA 5ENEA 4XY8A 4HXKA 4IR3A 4NR7A 2N9GA 4E96A 3QZVA 5DBMA 4Z6IA 1JM4B 5CQ7A 4LRGA 4A9IA 3D7CA 2OO1A 2WP2A 4J1PA 2DVQA 4Z93A 4QSPA 5E3GA 5AMFA 5DW2A 4BW2A 2RS9B 5I89A 5G4RA 2DVSA 4N4IA 4UITA 4XUBA 5A5OA 2L5EA 4QR5A 5E0RA 4TS8A 3IU6A 4WIVA 2D82A 4UIUA 4A9HA 5ETDA 5F60A 4O75A 4ZC9A 4Z1SA 4BW3A 4PTBA 5FE6A 5FE2A 5HM0A 4UYFB 5EPRA 5CQ3A 5EQ1A 4OGIA 4NYXA 4QSVA 4O72A 5EVAA 5EU1A 4QC1A 5D24A 5EWWA 5IGMA 3LJWA 3O36A 4NQMA 4QYDA 3FKMX 5EK9A 5FB0A 1X0JA 3AQAA 4CUPA 4CUTA 3JVLA 5KTWA 3TLPA 2OSSA 5L97A 3S91A 4NRCA 4O78A 5H1TA 4NUEA 2OUOA 2D9EA 5KO4A 4YC9A 5DYCA 5ENBA 4A9JA 4CUSA 4QSUA 4Y03A 5HRXA 5D3SA 5DYAA 4J0RA 4CFKA 5HCLA 4MEPA 2RO1A 5EP7A 5D0CA 4QZSA 4PKLA 3U5JA 5A5PA 4NUDA 4YK0A 5LKZA 4QSXA 5F62A 2YEKA 4TU6A 4ZW1A 4QUTA 1ZS5A 2L84A 2F6NA 5A82A 3O35A 3K2JA 4WHUA 4A9NA 4TZ2A 5D3JA 4BJXA 5E73A 1E6IA 4MR3A 4O76A 5L8UA 5CPEA 4HBWA 5II2A 3RCWA 5J0DA 5TB6A 4HBXA 3MQMA 3HMEA 4BHWA 5CQ6A 2R10A 3O34A 5AD2A 4QUUA 4LYIA 4O7CA 4TYLA 5ENIA 2E3KA 5D3TA 3SVFA 5IGNA 4X2IA 5HRWA 4J3IA 4Z1QA 5KU3A 4MR6A 5EV9A 5F1HA 5DLXA 4HXNA 4O71A 4PY6A 4LDFA 4UIVA 4HBVA 4Q0NA 5IGLA 4NUCA 5LKXA 5CTLA 4YABA 4TU4A 4YYNA 5FG5A 4QB3A 5F2PA 4YAXA 4NQNA 5DYUA 5HJCA 3LQJA 5EPBA 3UVWA 3O33A 4TT2A 3I3JA 5CQ8A 3LQIA 5FH7A 3MB4A 3MXFA 4LYSA 5IGKA 2RNYA 5HENA 2YW5A 4O77A 4CUUA 5LJ1A 5IBNA 5E3DA 4N4GA 5DYXA 3UVYA 5CP5A 5A81A 4A9FA 3MUKA 4YYHA 5DKHA 2NXBA 5CRZA 2F6JA 4HXSA 5TCMA 4MR4A 4MEOA 4YATA 5FE1A 4MEQA 5HEMA 1JSPB 3DWYA 5C89A 4F3IA 4FLPA 5HRVA 4A9MA 2YEMA 4LZRA 4QNSA 5FG6A 5FDZA 4IOOA 4RVRA 5D3RA 4ZQLA 5HFRA 5EWDA 5H1UA 5H85A 5E74A 4A9OA 4LZSA 4C67A 3U5MA 3GG3A 4NR4A 4OGJA 5L96A 5CQTA 5H1VA 4NXJA 3P1FA 4XYAA 5DX4A 2E7NA 5A5SA 5D3HA 5FE3A 1EQFA 4LR6A 3P5OA 4A9EA 4UIXA 4C66A 5A83A 5CUDA 5CUCA 5DFCA 5ENJA 1WUGA 2YDWA 5I86A 3U5PA 2DWWA 5A7CA 5FFWA 4HBYA 4UIWA 5FH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YBT A;  4YYJ A;  5FG4 A;  4QSQ A;  4AKN A;  5DFD A;  4KV4 A;  3O37 A;  3HMH A;  4O7E A;  4CLB A;  5CQA A;  2RNW A;  4YYG A;  5D26 A;  5F25 A;  4HXR A;  4NYW A;  4IOQ A;  4UIY A;  4N4H A;  5E9V A;  3ZYU A;  3IU5 A;  4LYW A;  4TTE A;  4QYL A;  4O7F A;  5F61 A;  2R0V A;  4QST A;  3MUL A;  4ALG A;  5KTX A;  3G0L A;  3JVK A;  4NR9 A;  5L98 A;  5CFW A;  3Q2F A;  2GRC A;  2H60 A;  4ALH A;  4BW1 A;  4O7B A;  4TQN A;  5ENH A;  5HQ6 A;  2YQD A;  5CRM A;  4QSR A;  5E9Y A;  5EWH A;  2FSA A;  4NR8 A;  4UIZ A;  4YYD A;  3UVD A;  4Z6H A;  5DKC A;  5LJ2 A;  5E9M A;  4NRB A;  2RNX A;  5E7D A;  4CUR A;  5EWV A;  4YY6 A;  5C85 A;  4GPJ A;  5CZG A;  4A9L A;  4N3W A;  5BT4 A;  5I88 A;  4IR6 A;  5ENG A;  3UW9 A;  4N4F A;  5II1 A;  3LXJ A;  4QC3 A;  5LVR A;  4O7A A;  5I1Q A;  5CU8 A;  3JVM A;  5JWM A;  3UV5 A;  3P1E A;  4NS5 A;  5I83 A;  3P1C A;  3UVX A;  2KTB B;  4QR4 A;  4TT4 A;  5HQ7 A;  4QY4 A;  3SVH A;  5D25 A;  3DAI A;  4CL9 A;  2I7K A;  2L85 A;  3Q2E A;  5I29 A;  2MJV B;  4QSW A;  5EGU A;  4YH4 A;  5EA1 A;  4QEW A;  4HXM A;  5LVQ A;  5FE7 A;  3UV4 A;  5EPS A;  3SVG A;  4Q0O A;  4UYE A;  5F1L A;  5DW1 A;  5E9I A;  4NYV A;  4O70 A;  4QEU A;  4J0S A;  3P1D A;  5FE4 A;  5AD3 A;  5FB1 A;  4XY9 A;  5LJ0 A;  5I80 A;  4KCX A;  2R0S A;  5K29 A;  4OUF A;  3HMF A;  5KTU A;  4HXO A;  5C8G A;  5IID A;  4YYM A;  3AAD A;  2RFJ A;  1WUM A;  5F5Z A;  4TT6 A;  5EIS A;  4TZ8 A;  4LC2 A;  4MR5 A;  2DKW A;  4QSS A;  2WP1 A;  4CUQ A;  4PCI A;  5A5Q A;  4BW4 A;  4YBM A;  2RI7 A;  4YBS A;  4HXL A;  5D3P A;  5A5R A;  4IR4 A;  4WHW A;  5ENF A;  4QR3 A;  2DVR A;  5CQ5 A;  4IOR A;  4MEN A;  3ONI A;  4YH3 A;  5DY7 A;  5FE9 A;  3LQH A;  4A9K A;  5LUU A;  4UYG A;  2DVV A;  3QZS A;  5F63 A;  5IG6 A;  5KHM A;  5C4Q A;  5COI A;  4NR5 A;  5BT5 A;  5FE5 A;  5C7N A;  3NXB A;  2YYN A;  5G4S A;  4YYI A;  4CFL A;  5D7X A;  5CGP A;  5EM3 A;  3UV2 A;  4PS5 A;  5CUE A;  5LKU A;  2E7O A;  5HFQ A;  4NR6 A;  5L99 A;  3QZT A;  1N72 A;  4PCE A;  5C87 A;  5CY9 A;  5I40 A;  5EWC A;  2LSP B;  5EI4 A;  5E9K A;  5EIC A;  3JVJ A;  5I7X A;  4YY4 A;  4YAD A;  2YEL A;  3U5K A;  4NRA A;  4UYF A;  3MB3 A;  4UYD A;  5CS8 A;  5HEL A;  3S92 A;  3U5L A;  5D3L A;  5DKD A;  5DFB A;  3U5O A;  4O74 A;  5BT3 A;  5LKT A;  5I7Y A;  4UYH A;  4QBM A;  2G4A A;  4YYK A;  4LZ2 A;  5JI8 A;  5ACY A;  5CUA A;  2DAT A;  5L8T A;  5FBX A;  4QEV A;  3G0J A;  5FE0 A;  5HQ5 A;  2I8N A;  5F36 A;  5ENC A;  5E9L A;  5CUB A;  5CUG A;  4XUA A;  5D3N A;  4HXP A;  5F3A A;  4DON A;  5FFV A;  5FE8 A;  5CQ4 A;  5A5N A;  5A85 A;  5HLS A;  4IR5 A;  5AME A;  5FH6 A;  4KV1 A;  3U5N A;  5FFY A;  1F68 A;  5DLZ A;  5ETB A;  2R0Y A;  5ENE A;  4XY8 A;  4HXK A;  4IR3 A;  4NR7 A;  2N9G A;  4E96 A;  3QZV A;  5DBM A;  4Z6I A;  1JM4 B;  5CQ7 A;  4LRG A;  4A9I A;  3D7C A;  2OO1 A;  2WP2 A;  4J1P A;  2DVQ A;  4Z93 A;  4QSP A;  5E3G A;  5AMF A;  5DW2 A;  4BW2 A;  2RS9 B;  5I89 A;  5G4R A;  2DVS A;  4N4I A;  4UIT A;  4XUB A;  5A5O A;  2L5E A;  4QR5 A;  5E0R A;  4TS8 A;  3IU6 A;  4WIV A;  2D82 A;  4UIU A;  4A9H A;  5ETD A;  5F60 A;  4O75 A;  4ZC9 A;  4Z1S A;  4BW3 A;  4PTB A;  5FE6 A;  5FE2 A;  5HM0 A;  4UYF B;  5EPR A;  5CQ3 A;  5EQ1 A;  4OGI A;  4NYX A;  4QSV A;  4O72 A;  5EVA A;  5EU1 A;  4QC1 A;  5D24 A;  5EWW A;  5IGM A;  3LJW A;  3O36 A;  4NQM A;  4QYD A;  3FKM X;  5EK9 A;  5FB0 A;  1X0J A;  3AQA A;  4CUP A;  4CUT A;  3JVL A;  5KTW A;  3TLP A;  2OSS A;  5L97 A;  3S91 A;  4NRC A;  4O78 A;  5H1T A;  4NUE A;  2OUO A;  2D9E A;  5KO4 A;  4YC9 A;  5DYC A;  5ENB A;  4A9J A;  4CUS A;  4QSU A;  4Y03 A;  5HRX A;  5D3S A;  5DYA A;  4J0R A;  4CFK A;  5HCL A;  4MEP A;  2RO1 A;  5EP7 A;  5D0C A;  4QZS A;  4PKL A;  3U5J A;  5A5P A;  4NUD A;  4YK0 A;  5LKZ A;  4QSX A;  5F62 A;  2YEK A;  4TU6 A;  4ZW1 A;  4QUT A;  1ZS5 A;  2L84 A;  2F6N A;  5A82 A;  3O35 A;  3K2J A;  4WHU A;  4A9N A;  4TZ2 A;  5D3J A;  4BJX A;  5E73 A;  1E6I A;  4MR3 A;  4O76 A;  5L8U A;  5CPE A;  4HBW A;  5II2 A;  3RCW A;  5J0D A;  5TB6 A;  4HBX A;  3MQM A;  3HME A;  4BHW A;  5CQ6 A;  2R10 A;  3O34 A;  5AD2 A;  4QUU A;  4LYI A;  4O7C A;  4TYL A;  5ENI A;  2E3K A;  5D3T A;  3SVF A;  5IGN A;  4X2I A;  5HRW A;  4J3I A;  4Z1Q A;  5KU3 A;  4MR6 A;  5EV9 A;  5F1H A;  5DLX A;  4HXN A;  4O71 A;  4PY6 A;  4LDF A;  4UIV A;  4HBV A;  4Q0N A;  5IGL A;  4NUC A;  5LKX A;  5CTL A;  4YAB A;  4TU4 A;  4YYN A;  5FG5 A;  4QB3 A;  5F2P A;  4YAX A;  4NQN A;  5DYU A;  5HJC A;  3LQJ A;  5EPB A;  3UVW A;  3O33 A;  4TT2 A;  3I3J A;  5CQ8 A;  3LQI A;  5FH7 A;  3MB4 A;  3MXF A;  4LYS A;  5IGK A;  2RNY A;  5HEN A;  2YW5 A;  4O77 A;  4CUU A;  5LJ1 A;  5IBN A;  5E3D A;  4N4G A;  5DYX A;  3UVY A;  5CP5 A;  5A81 A;  4A9F A;  3MUK A;  4YYH A;  5DKH A;  2NXB A;  5CRZ A;  2F6J A;  4HXS A;  5TCM A;  4MR4 A;  4MEO A;  4YAT A;  5FE1 A;  4MEQ A;  5HEM A;  1JSP B;  3DWY A;  5C89 A;  4F3I A;  4FLP A;  5HRV A;  4A9M A;  2YEM A;  4LZR A;  4QNS A;  5FG6 A;  5FDZ A;  4IOO A;  4RVR A;  5D3R A;  4ZQL A;  5HFR A;  5EWD A;  5H1U A;  5H85 A;  5E74 A;  4A9O A;  4LZS A;  4C67 A;  3U5M A;  3GG3 A;  4NR4 A;  4OGJ A;  5L96 A;  5CQT A;  5H1V A;  4NXJ A;  3P1F A;  4XYA A;  5DX4 A;  2E7N A;  5A5S A;  5D3H A;  5FE3 A;  1EQF A;  4LR6 A;  3P5O A;  4A9E A;  4UIX A;  4C66 A;  5A83 A;  5CUD A;  5CUC A;  5DFC A;  5ENJ A;  1WUG A;  2YDW A;  5I86 A;  3U5P A;  2DWW A;  5A7C A;  5FFW A;  4HBY A;  4UIW A;  5FH8 A; 
#chains in the Genus database with same CATH topology
 4YBT A;  4YYJ A;  5FG4 A;  4QSQ A;  4AKN A;  5DFD A;  4KV4 A;  3O37 A;  3HMH A;  3D1D A;  4O7E A;  4CLB A;  5CQA A;  2RNW A;  4YYG A;  5D26 A;  5F25 A;  4HXR A;  4NYW A;  4IOQ A;  4UIY A;  4N4H A;  5E9V A;  3ZYU A;  3IU5 A;  4LYW A;  4TTE A;  4QYL A;  4O7F A;  5F61 A;  2R0V A;  4QST A;  3MUL A;  4ALG A;  5KTX A;  3G0L A;  3JVK A;  4NR9 A;  5L98 A;  5CFW A;  3Q2F A;  2GRC A;  2H60 A;  4ALH A;  4BW1 A;  4O7B A;  4TQN A;  5ENH A;  5HQ6 A;  2YQD A;  5CRM A;  4QSR A;  5E9Y A;  5EWH A;  2FSA A;  4NR8 A;  4UIZ A;  4YYD A;  3UVD A;  4Z6H A;  5DKC A;  5LJ2 A;  5E9M A;  4NRB A;  2RNX A;  2EJN A;  5E7D A;  5EWV A;  4CUR A;  4YY6 A;  5C85 A;  4GPJ A;  5CZG A;  4A9L A;  4N3W A;  5BT4 A;  5I88 A;  4IR6 A;  5ENG A;  3UW9 A;  4N4F A;  5II1 A;  3LXJ A;  4QC3 A;  5LVR A;  4O7A A;  5I1Q A;  5CU8 A;  3JVM A;  5JWM A;  3UV5 A;  3P1E A;  4NS5 A;  5I83 A;  3P1C A;  3UVX A;  2KTB B;  4QR4 A;  4TT4 A;  5HQ7 A;  4QY4 A;  3SVH A;  5D25 A;  3DAI A;  4CL9 A;  4AKG A;  2I7K A;  2L85 A;  3Q2E A;  5I29 A;  4QSW A;  2MJV B;  5EGU A;  4YH4 A;  5EA1 A;  4QEW A;  4HXM A;  5LVQ A;  5FE7 A;  3UV4 A;  5EPS A;  3SVG A;  4Q0O A;  4UYE A;  5F1L A;  5DW1 A;  5E9I A;  4NYV A;  4O70 A;  4QEU A;  4J0S A;  3P1D A;  5FE4 A;  5AD3 A;  5FB1 A;  4XY9 A;  5LJ0 A;  5I80 A;  4KCX A;  2R0S A;  5K29 A;  4OUF A;  3HMF A;  5KTU A;  4HXO A;  5C8G A;  5IID A;  4YYM A;  3AAD A;  2RFJ A;  1WUM A;  5F5Z A;  4TT6 A;  5EIS A;  4TZ8 A;  4LC2 A;  4MR5 A;  2DKW A;  4QSS A;  2WP1 A;  4CUQ A;  4PCI A;  5A5Q A;  4BW4 A;  4YBM A;  2RI7 A;  4YBS A;  4HXL A;  5D3P A;  5A5R A;  4IR4 A;  4WHW A;  5ENF A;  4QR3 A;  2DVR A;  5CQ5 A;  4IOR A;  4MEN A;  3ONI A;  4YH3 A;  5DY7 A;  5FE9 A;  3LQH A;  1ZKR A;  4A9K A;  5LUU A;  4UYG A;  2DVV A;  3QZS A;  5F63 A;  5IG6 A;  5KHM A;  5C4Q A;  5COI A;  4NR5 A;  5BT5 A;  5FE5 A;  5C7N A;  3NXB A;  2YYN A;  5G4S A;  4YYI A;  4CFL A;  5D7X A;  5CGP A;  5EM3 A;  3UV2 A;  4PS5 A;  5CUE A;  5LKU A;  2E7O A;  5HFQ A;  4NR6 A;  5L99 A;  3QZT A;  1N72 A;  4PCE A;  5C87 A;  5CY9 A;  5I40 A;  5EWC A;  2LSP B;  5EI4 A;  5E9K A;  5EIC A;  3JVJ A;  5I7X A;  4YY4 A;  4YAD A;  2YEL A;  3U5K A;  4NRA A;  4UYF A;  3MB3 A;  4UYD A;  5CS8 A;  5HEL A;  3S92 A;  3U5L A;  5D3L A;  5DKD A;  5DFB A;  3U5O A;  4O74 A;  5BT3 A;  5LKT A;  5I7Y A;  4UYH A;  4QBM A;  2G4A A;  4YYK A;  4LZ2 A;  5JI8 A;  5ACY A;  5CUA A;  2DAT A;  5L8T A;  5FBX A;  4QEV A;  3G0J A;  5FE0 A;  5HQ5 A;  2I8N A;  5F36 A;  5ENC A;  5E9L A;  5CUB A;  5CUG A;  4XUA A;  5D3N A;  4HXP A;  5F3A A;  4DON A;  5FFV A;  5FE8 A;  5CQ4 A;  5A5N A;  5A85 A;  5HLS A;  4IR5 A;  5AME A;  5FH6 A;  4KV1 A;  3U5N A;  5FFY A;  1F68 A;  5DLZ A;  5ETB A;  2R0Y A;  5ENE A;  4XY8 A;  4HXK A;  4IR3 A;  4NR7 A;  2N9G A;  4E96 A;  3QZV A;  5DBM A;  4Z6I A;  1JM4 B;  5CQ7 A;  4LRG A;  4A9I A;  3D7C A;  2OO1 A;  2WP2 A;  4J1P A;  1PUO A;  2DVQ A;  4Z93 A;  4QSP A;  5E3G A;  5AMF A;  5DW2 A;  4BW2 A;  2RS9 B;  5I89 A;  5G4R A;  2DVS A;  4N4I A;  4UIT A;  4XUB A;  5A5O A;  2L5E A;  4QR5 A;  5E0R A;  4TS8 A;  3IU6 A;  4WIV A;  2D82 A;  4UIU A;  4A9H A;  5ETD A;  5F60 A;  4O75 A;  4ZC9 A;  4Z1S A;  4BW3 A;  4PTB A;  5FE6 A;  5FE2 A;  5HM0 A;  4UYF B;  5EPR A;  5CQ3 A;  5EQ1 A;  4OGI A;  4NYX A;  4QSV A;  4O72 A;  5EVA A;  5EU1 A;  4QC1 A;  5D24 A;  5EWW A;  5IGM A;  3LJW A;  3O36 A;  4NQM A;  4QYD A;  3FKM X;  5EK9 A;  5FB0 A;  1X0J A;  3AQA A;  4CUP A;  4CUT A;  3JVL A;  5KTW A;  3TLP A;  2OSS A;  5L97 A;  3S91 A;  4NRC A;  4O78 A;  5H1T A;  4NUE A;  2OUO A;  2D9E A;  5KO4 A;  4YC9 A;  5DYC A;  5ENB A;  4A9J A;  4CUS A;  4QSU A;  4Y03 A;  5HRX A;  5D3S A;  5DYA A;  4J0R A;  4CFK A;  5HCL A;  4MEP A;  2RO1 A;  5EP7 A;  5D0C A;  4QZS A;  4PKL A;  3U5J A;  5A5P A;  4NUD A;  4YK0 A;  5LKZ A;  4QSX A;  5F62 A;  2YEK A;  4TU6 A;  4ZW1 A;  4QUT A;  1ZS5 A;  2L84 A;  2F6N A;  5A82 A;  3O35 A;  3K2J A;  4WHU A;  4A9N A;  4TZ2 A;  5D3J A;  4BJX A;  5E73 A;  1E6I A;  4AI6 A;  4MR3 A;  4O76 A;  5L8U A;  5CPE A;  4HBW A;  5II2 A;  3RCW A;  5J0D A;  5TB6 A;  4HBX A;  3MQM A;  3HME A;  4BHW A;  4AKH A;  5CQ6 A;  2R10 A;  3O34 A;  5AD2 A;  4QUU A;  4LYI A;  4O7C A;  4TYL A;  5ENI A;  2E3K A;  5D3T A;  3SVF A;  5IGN A;  4X2I A;  5HRW A;  4J3I A;  4Z1Q A;  5KU3 A;  4MR6 A;  5EV9 A;  5F1H A;  5DLX A;  4HXN A;  4O71 A;  4PY6 A;  4LDF A;  4UIV A;  4HBV A;  4Q0N A;  5IGL A;  4NUC A;  5LKX A;  5CTL A;  4YAB A;  4TU4 A;  4YYN A;  5FG5 A;  4QB3 A;  5F2P A;  4YAX A;  4NQN A;  5DYU A;  5HJC A;  3VKH A;  3ERR A;  3LQJ A;  5EPB A;  3UVW A;  3O33 A;  4TT2 A;  3I3J A;  5CQ8 A;  3LQI A;  5FH7 A;  3MB4 A;  3MXF A;  4LYS A;  5IGK A;  2RNY A;  4AKI A;  5HEN A;  2YW5 A;  4O77 A;  4CUU A;  5LJ1 A;  5IBN A;  5E3D A;  4N4G A;  5DYX A;  3UVY A;  5CP5 A;  5A81 A;  4A9F A;  3MUK A;  4YYH A;  5DKH A;  2NXB A;  5CRZ A;  2F6J A;  4HXS A;  5TCM A;  4MR4 A;  4MEO A;  4YAT A;  5FE1 A;  4MEQ A;  5HEM A;  1JSP B;  3DWY A;  5C89 A;  4F3I A;  3VKG A;  4FLP A;  5HRV A;  4A9M A;  2YEM A;  4LZR A;  4QNS A;  5FG6 A;  5FDZ A;  4IOO A;  4RVR A;  5D3R A;  4ZQL A;  5HFR A;  5EWD A;  5H1U A;  5H85 A;  5E74 A;  4A9O A;  4LZS A;  4C67 A;  3U5M A;  3GG3 A;  4NR4 A;  4OGJ A;  5L96 A;  5CQT A;  5H1V A;  4NXJ A;  3P1F A;  4XYA A;  5DX4 A;  2E7N A;  3D1B A;  5A5S A;  5D3H A;  5FE3 A;  1EQF A;  4LR6 A;  3P5O A;  4A9E A;  4UIX A;  4C66 A;  5A83 A;  5CUD A;  5CUC A;  5DFC A;  5ENJ A;  1WUG A;  2YDW A;  5I86 A;  3U5P A;  2DWW A;  5A7C A;  5FFW A;  4HBY A;  4UIW A;  5FH8 A; 
#chains in the Genus database with same CATH homology
 4YBT A;  4YYJ A;  5FG4 A;  4QSQ A;  4AKN A;  5DFD A;  4KV4 A;  3O37 A;  3HMH A;  4O7E A;  4CLB A;  5CQA A;  2RNW A;  4YYG A;  5D26 A;  5F25 A;  4HXR A;  4NYW A;  4IOQ A;  4UIY A;  4N4H A;  5E9V A;  3ZYU A;  3IU5 A;  4LYW A;  4TTE A;  4QYL A;  4O7F A;  5F61 A;  2R0V A;  4QST A;  3MUL A;  4ALG A;  5KTX A;  3G0L A;  3JVK A;  4NR9 A;  5L98 A;  5CFW A;  3Q2F A;  2GRC A;  2H60 A;  4ALH A;  4BW1 A;  4O7B A;  4TQN A;  5ENH A;  5HQ6 A;  2YQD A;  5CRM A;  4QSR A;  5E9Y A;  5EWH A;  2FSA A;  4NR8 A;  4UIZ A;  4YYD A;  3UVD A;  4Z6H A;  5DKC A;  5LJ2 A;  5E9M A;  4NRB A;  2RNX A;  5E7D A;  4CUR A;  5EWV A;  4YY6 A;  5C85 A;  4GPJ A;  5CZG A;  4A9L A;  4N3W A;  5BT4 A;  5I88 A;  4IR6 A;  5ENG A;  3UW9 A;  4N4F A;  5II1 A;  3LXJ A;  4QC3 A;  5LVR A;  4O7A A;  5I1Q A;  5CU8 A;  3JVM A;  5JWM A;  3UV5 A;  3P1E A;  4NS5 A;  5I83 A;  3P1C A;  3UVX A;  2KTB B;  4QR4 A;  4TT4 A;  5HQ7 A;  4QY4 A;  3SVH A;  5D25 A;  3DAI A;  4CL9 A;  2I7K A;  2L85 A;  3Q2E A;  5I29 A;  2MJV B;  4QSW A;  5EGU A;  4YH4 A;  5EA1 A;  4QEW A;  4HXM A;  5LVQ A;  5FE7 A;  3UV4 A;  5EPS A;  3SVG A;  4Q0O A;  4UYE A;  5F1L A;  5DW1 A;  5E9I A;  4NYV A;  4O70 A;  4QEU A;  4J0S A;  3P1D A;  5FE4 A;  5AD3 A;  5FB1 A;  4XY9 A;  5LJ0 A;  5I80 A;  4KCX A;  2R0S A;  5K29 A;  4OUF A;  3HMF A;  5KTU A;  4HXO A;  5C8G A;  5IID A;  4YYM A;  3AAD A;  2RFJ A;  1WUM A;  5F5Z A;  4TT6 A;  5EIS A;  4TZ8 A;  4LC2 A;  4MR5 A;  2DKW A;  4QSS A;  2WP1 A;  4CUQ A;  4PCI A;  5A5Q A;  4BW4 A;  4YBM A;  2RI7 A;  4YBS A;  4HXL A;  5D3P A;  5A5R A;  4IR4 A;  4WHW A;  5ENF A;  4QR3 A;  2DVR A;  5CQ5 A;  4IOR A;  4MEN A;  3ONI A;  4YH3 A;  5DY7 A;  5FE9 A;  3LQH A;  4A9K A;  5LUU A;  4UYG A;  2DVV A;  3QZS A;  5F63 A;  5IG6 A;  5KHM A;  5C4Q A;  5COI A;  4NR5 A;  5BT5 A;  5FE5 A;  5C7N A;  3NXB A;  2YYN A;  5G4S A;  4YYI A;  4CFL A;  5D7X A;  5CGP A;  5EM3 A;  3UV2 A;  4PS5 A;  5CUE A;  5LKU A;  2E7O A;  5HFQ A;  4NR6 A;  5L99 A;  3QZT A;  1N72 A;  4PCE A;  5C87 A;  5CY9 A;  5I40 A;  5EWC A;  2LSP B;  5EI4 A;  5E9K A;  5EIC A;  3JVJ A;  5I7X A;  4YY4 A;  4YAD A;  2YEL A;  3U5K A;  4NRA A;  4UYF A;  3MB3 A;  4UYD A;  5CS8 A;  5HEL A;  3S92 A;  3U5L A;  5D3L A;  5DKD A;  5DFB A;  3U5O A;  4O74 A;  5BT3 A;  5LKT A;  5I7Y A;  4UYH A;  4QBM A;  2G4A A;  4YYK A;  4LZ2 A;  5JI8 A;  5ACY A;  5CUA A;  2DAT A;  5L8T A;  5FBX A;  4QEV A;  3G0J A;  5FE0 A;  5HQ5 A;  2I8N A;  5F36 A;  5ENC A;  5E9L A;  5CUB A;  5CUG A;  4XUA A;  5D3N A;  4HXP A;  5F3A A;  4DON A;  5FFV A;  5FE8 A;  5CQ4 A;  5A5N A;  5A85 A;  5HLS A;  4IR5 A;  5AME A;  5FH6 A;  4KV1 A;  3U5N A;  5FFY A;  1F68 A;  5DLZ A;  5ETB A;  2R0Y A;  5ENE A;  4XY8 A;  4HXK A;  4IR3 A;  4NR7 A;  2N9G A;  4E96 A;  3QZV A;  5DBM A;  4Z6I A;  1JM4 B;  5CQ7 A;  4LRG A;  4A9I A;  3D7C A;  2OO1 A;  2WP2 A;  4J1P A;  2DVQ A;  4Z93 A;  4QSP A;  5E3G A;  5AMF A;  5DW2 A;  4BW2 A;  2RS9 B;  5I89 A;  5G4R A;  2DVS A;  4N4I A;  4UIT A;  4XUB A;  5A5O A;  2L5E A;  4QR5 A;  5E0R A;  4TS8 A;  3IU6 A;  4WIV A;  2D82 A;  4UIU A;  4A9H A;  5ETD A;  5F60 A;  4O75 A;  4ZC9 A;  4Z1S A;  4BW3 A;  4PTB A;  5FE6 A;  5FE2 A;  5HM0 A;  4UYF B;  5EPR A;  5CQ3 A;  5EQ1 A;  4OGI A;  4NYX A;  4QSV A;  4O72 A;  5EVA A;  5EU1 A;  4QC1 A;  5D24 A;  5EWW A;  5IGM A;  3LJW A;  3O36 A;  4NQM A;  4QYD A;  3FKM X;  5EK9 A;  5FB0 A;  1X0J A;  3AQA A;  4CUP A;  4CUT A;  3JVL A;  5KTW A;  3TLP A;  2OSS A;  5L97 A;  3S91 A;  4NRC A;  4O78 A;  5H1T A;  4NUE A;  2OUO A;  2D9E A;  5KO4 A;  4YC9 A;  5DYC A;  5ENB A;  4A9J A;  4CUS A;  4QSU A;  4Y03 A;  5HRX A;  5D3S A;  5DYA A;  4J0R A;  4CFK A;  5HCL A;  4MEP A;  2RO1 A;  5EP7 A;  5D0C A;  4QZS A;  4PKL A;  3U5J A;  5A5P A;  4NUD A;  4YK0 A;  5LKZ A;  4QSX A;  5F62 A;  2YEK A;  4TU6 A;  4ZW1 A;  4QUT A;  1ZS5 A;  2L84 A;  2F6N A;  5A82 A;  3O35 A;  3K2J A;  4WHU A;  4A9N A;  4TZ2 A;  5D3J A;  4BJX A;  5E73 A;  1E6I A;  4MR3 A;  4O76 A;  5L8U A;  5CPE A;  4HBW A;  5II2 A;  3RCW A;  5J0D A;  5TB6 A;  4HBX A;  3MQM A;  3HME A;  4BHW A;  5CQ6 A;  2R10 A;  3O34 A;  5AD2 A;  4QUU A;  4LYI A;  4O7C A;  4TYL A;  5ENI A;  2E3K A;  5D3T A;  3SVF A;  5IGN A;  4X2I A;  5HRW A;  4J3I A;  4Z1Q A;  5KU3 A;  4MR6 A;  5EV9 A;  5F1H A;  5DLX A;  4HXN A;  4O71 A;  4PY6 A;  4LDF A;  4UIV A;  4HBV A;  4Q0N A;  5IGL A;  4NUC A;  5LKX A;  5CTL A;  4YAB A;  4TU4 A;  4YYN A;  5FG5 A;  4QB3 A;  5F2P A;  4YAX A;  4NQN A;  5DYU A;  5HJC A;  3LQJ A;  5EPB A;  3UVW A;  3O33 A;  4TT2 A;  3I3J A;  5CQ8 A;  3LQI A;  5FH7 A;  3MB4 A;  3MXF A;  4LYS A;  5IGK A;  2RNY A;  5HEN A;  2YW5 A;  4O77 A;  4CUU A;  5LJ1 A;  5IBN A;  5E3D A;  4N4G A;  5DYX A;  3UVY A;  5CP5 A;  5A81 A;  4A9F A;  3MUK A;  4YYH A;  5DKH A;  2NXB A;  5CRZ A;  2F6J A;  4HXS A;  5TCM A;  4MR4 A;  4MEO A;  4YAT A;  5FE1 A;  4MEQ A;  5HEM A;  1JSP B;  3DWY A;  5C89 A;  4F3I A;  4FLP A;  5HRV A;  4A9M A;  2YEM A;  4LZR A;  4QNS A;  5FG6 A;  5FDZ A;  4IOO A;  4RVR A;  5D3R A;  4ZQL A;  5HFR A;  5EWD A;  5H1U A;  5H85 A;  5E74 A;  4A9O A;  4LZS A;  4C67 A;  3U5M A;  3GG3 A;  4NR4 A;  4OGJ A;  5L96 A;  5CQT A;  5H1V A;  4NXJ A;  3P1F A;  4XYA A;  5DX4 A;  2E7N A;  5A5S A;  5D3H A;  5FE3 A;  1EQF A;  4LR6 A;  3P5O A;  4A9E A;  4UIX A;  4C66 A;  5A83 A;  5CUD A;  5CUC A;  5DFC A;  5ENJ A;  1WUG A;  2YDW A;  5I86 A;  3U5P A;  2DWW A;  5A7C A;  5FFW A;  4HBY A;  4UIW A;  5FH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...