3I3JA

Crystal structure of the bromodomain of human ep300
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
114
structure length
114
Chain Sequence
KIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase p300
publication title Histone recognition and large-scale structural analysis of the human bromodomain family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2009-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3i3jA00
5LKXA 4MR5A 5AD3A 4LZRA 4QC3A 5I83A 5LJ2A 5F61A 5L8UA 4CUQA 3MQMA 3QZSA 4TS8A 4NR8A 5F5ZA 2DWWA 2F6JA 3O35A 2DVSA 4NUCA 5HLSA 5C87A 4NUEA 4O76A 4QSRA 4C66A 4MENA 4YAXA 5D3PA 4QR5A 4HBXA 3MULA 4J0RA 4E96A 5KHMA 4NXJA 4HXSA 5DW1A 2YDWA 5E0RA 4NYWA 5FE9A 5L8TA 4YYMA 2N9GA 5DLZA 2E7NA 5E9MA 5FFYA 5HEMA 4PY6A 4BW2A 4BW4A 4LYIA 5AMEA 5CQ8A 5L96A 4QSUA 4CUSA 4ZW1A 4NYXA 2I7KA 2YW5A 5JWMA 4IR5A 5LUUA 5CRMA 4QZSA 5C8GA 4QEUA 5FH6A 4C67A 4Z1SA 3O34A 4O7CA 3AQAA 4MR3A 5FG5A 5CFWA 4CUUA 5D0CA 3S91A 4F3IA 2KTBB 1WUMA 2H60A 3U5KA 5DKDA 5A81A 4NRCA 2YEKA 1JSPB 4AKNA 5D26A 5DKCA 1EQFA 5FE5A 5KTWA 5COIA 3MUKA 4IR6A 4CURA 4KV1A 4HBWA 4UYEA 3I3JA 4UIVA 4TZ2A 4NR5A 3D7CA 4WHWA 5HRVA 3HMEA 5CUDA 4MR6A 4TQNA 3P1CA 5DYAA 4MEOA 5A7CA 4HXPA 1ZS5A 2R0SA 5CUEA 3U5OA 4A9HA 4BJXA 4YH3A 5D25A 2L85A 4ALGA 5FE1A 4UYGA 5FFWA 4QNSA 5I88A 5HRXA 3GG3A 2RFJA 4NYVA 2R10A 5FB1A 2YELA 4TT2A 3NXBA 5HFRA 3O33A 4UYDA 5LJ1A 5FE6A 4ZC9A 5TB6A 4YYIA 5ETBA 3SVGA 2DVRA 5FG4A 2DATA 5CP5A 5EVAA 4UITA 4MR4A 5D3JA 3UV5A 4XUBA 5DLXA 5II2A 4PCIA 5CU8A 5E9YA 5EWVA 5CGPA 4CFLA 4LRGA 5H1TA 5EWCA 4A9EA 5DW2A 4UYHA 3LQIA 5ENFA 4J1PA 5EK9A 2MJVB 5A85A 4UIUA 4OGIA 5I86A 2DVQA 3JVLA 4IR4A 5FH8A 3S92A 3Q2EA 5DX4A 4LDFA 5D3HA 2RS9B 4CUPA 5G4RA 5F63A 4O7FA 4QB3A 5EISA 5CQAA 3Q2FA 5IGMA 5LVQA 4N4FA 4BW3A 3LQHA 5DFBA 5G4SA 2WP2A 4YK0A 4XY9A 4NR7A 3U5JA 4KCXA 4XY8A 2YQDA 4O70A 3UV4A 4YYDA 4Q0OA 3UV2A 3UVWA 4CFKA 5ETDA 3O37A 5FE4A 2RNYA 4LZ2A 3HMFA 2OSSA 5ENCA 4WHUA 4OUFA 5A5PA 3JVKA 5I7YA 3QZVA 5CQ6A 3O36A 3U5PA 2NXBA 4O7EA 4O78A 2OUOA 3P1FA 3SVHA 5IG6A 5BT5A 5F1LA 4YC9A 5HQ7A 2RI7A 5F60A 5HRWA 4YY6A 5E9LA 4Q0NA 1F68A 5FE0A 4HXMA 2RO1A 5AMFA 2R0VA 4QR3A 5E3GA 4TU6A 5DYXA 3IU5A 5CUGA 4J3IA 3DAIA 3TLPA 5EWWA 1JM4B 3FKMX 4O75A 2E7OA 5F3AA 3U5NA 4YYGA 5CUCA 2I8NA 5E7DA 2D82A 5KO4A 4A9FA 4HBVA 5JI8A 4X2IA 5DY7A 4NR4A 4QSVA 5EGUA 5EI4A 5ENJA 4QC1A 4IOQA 4PKLA 5BT4A 5EP7A 4YYKA 5FFVA 1X0JA 4O7AA 5F36A 4LZSA 2WP1A 3AADA 5LKTA 3UVDA 4NRAA 5D24A 4HXKA 5CS8A 5FB0A 3UVXA 4A9NA 4UYFB 4NS5A 2LSPB 3P5OA 4UIWA 5C85A 4IORA 5FG6A 5ACYA 4Z6HA 5LKZA 4QSQA 5FDZA 3DWYA 4QEWA 3LXJA 4NRBA 4N4GA 2L84A 4CLBA 5A5RA 4YABA 4YYJA 4LYWA 5L99A 4J0SA 5DYCA 5KTUA 5CY9A 4YYNA 5F25A 2L5EA 3LJWA 4HBYA 4YBTA 4TT6A 5BT3A 4N3WA 4NUDA 4A9JA 5CQ3A 2GRCA 5I7XA 4O71A 5DBMA 4HXOA 5FE8A 4HXRA 4UYFA 4BHWA 2YYNA 3U5LA 3UW9A 4O74A 4LYSA 5HQ5A 5IIDA 4KV4A 4IR3A 5F1HA 3IU6A 5FH7A 5HM0A 4QEVA 5E9IA 5D3SA 4QSSA 5EWDA 3P1EA 4YATA 5KTXA 5C4QA 4RVRA 4A9KA 3QZTA 5A5NA 5C7NA 3MB3A 4NR9A 4MEQA 5E9KA 5E3DA 4CUTA 4DONA 4ZQLA 5EPSA 4FLPA 4UIZA 3RCWA 2OO1A 5ENGA 5IGKA 4QUTA 5CQ5A 4TT4A 5H85A 4QSPA 5FE3A 4QR4A 4HXNA 5CRZA 5A5QA 5HENA 4IOOA 5A5SA 5I80A 4PCEA 5I89A 4QY4A 1N72A 5H1VA 5HELA 4NQNA 4UIYA 3MB4A 4MEPA 3UVYA 4XYAA 5EA1A 5ENBA 3SVFA 5EQ1A 4O7BA 5LKUA 4QSXA 5D3RA 5DYUA 5C89A 4Y03A 4QYLA 3JVJA 5TCMA 4YY4A 4XUAA 5A5OA 5EM3A 1WUGA 5EWHA 4QSTA 4WIVA 5L97A 5EPRA 4TZ8A 4A9OA 5A82A 4QUUA 5I1QA 4QSWA 3JVMA 5D3LA 5EPBA 5CUBA 4GPJA 5IBNA 5LJ0A 5DFCA 3ZYUA 4CL9A 3U5MA 4YH4A 5L98A 4BW1A 5I40A 4YADA 5CPEA 3K2JA 5EICA 4ALHA 5A83A 5HFQA 5HJCA 2YEMA 4YBSA 4LR6A 2D9EA 5CQ7A 5ENEA 5HQ6A 2DVVA 5E73A 2RNWA 5ENHA 5CQTA 3MXFA 4HXLA 5H1UA 4A9LA 3P1DA 5EU1A 5II1A 4QYDA 4TTEA 5DKHA 5IGNA 4TYLA 3ONIA 2FSAA 4Z1QA 2E3KA 5E74A 5F2PA 5E9VA 3LQJA 4N4IA 4YYHA 5FE7A 2DKWA 3HMHA 5F62A 4NR6A 5HCLA 5D7XA 5J0DA 5CTLA 5FBXA 4QBMA 2G4AA 4NQMA 5K29A 4A9IA 5D3NA 4A9MA 4Z6IA 3G0LA 2RNXA 4PS5A 5I29A 5KU3A 4PTBA 4OGJA 5ENIA 4YBMA 4UIXA 4O77A 5DFDA 5LVRA 5EV9A 3G0JA 1E6IA 2F6NA 4LC2A 4TU4A 5FE2A 5CUAA 5IGLA 4N4HA 2R0YA 5D3TA 4Z93A 4O72A 5AD2A 5CZGA 5CQ4A
chains in the Genus database with same CATH superfamily
1PUOA 5LKXA 4MR5A 5AD3A 4LZRA 4QC3A 5I83A 5LJ2A 5F61A 5L8UA 4CUQA 3MQMA 3QZSA 4TS8A 4NR8A 5F5ZA 2DWWA 2F6JA 3O35A 2DVSA 4NUCA 5HLSA 5C87A 4NUEA 4O76A 4QSRA 4C66A 4MENA 4YAXA 5D3PA 4QR5A 4HBXA 3MULA 4J0RA 4E96A 5KHMA 4NXJA 4HXSA 5DW1A 2YDWA 5E0RA 4NYWA 5FE9A 5L8TA 3ERRA 4YYMA 2N9GA 5DLZA 2E7NA 5E9MA 5FFYA 5HEMA 4PY6A 4BW2A 4BW4A 4LYIA 5AMEA 5CQ8A 5L96A 4QSUA 4CUSA 4ZW1A 4NYXA 2I7KA 2YW5A 5JWMA 4IR5A 4AKGA 5LUUA 5CRMA 4QZSA 5C8GA 4QEUA 5FH6A 4C67A 4Z1SA 3O34A 4O7CA 3AQAA 4MR3A 5FG5A 5CFWA 4CUUA 5D0CA 3S91A 4F3IA 2KTBB 1WUMA 2H60A 3U5KA 5DKDA 5A81A 4NRCA 2YEKA 1JSPB 4AKNA 5D26A 5DKCA 1EQFA 5FE5A 5KTWA 5COIA 3MUKA 4IR6A 4CURA 4KV1A 4HBWA 4UYEA 3I3JA 4UIVA 4TZ2A 4NR5A 3D7CA 4WHWA 5HRVA 3HMEA 5CUDA 4MR6A 4TQNA 3P1CA 5DYAA 4MEOA 5A7CA 4HXPA 1ZS5A 2R0SA 5CUEA 3U5OA 4A9HA 4BJXA 4YH3A 5D25A 2L85A 4ALGA 5FE1A 4UYGA 5FFWA 4QNSA 5I88A 5HRXA 3GG3A 2EJNA 2RFJA 4NYVA 2R10A 5FB1A 2YELA 4TT2A 3NXBA 5HFRA 4AI6A 3O33A 4UYDA 5LJ1A 5FE6A 4ZC9A 5TB6A 4YYIA 5ETBA 3SVGA 2DVRA 5FG4A 2DATA 5CP5A 5EVAA 4UITA 4MR4A 5D3JA 3UV5A 4XUBA 5DLXA 5II2A 4PCIA 5CU8A 5E9YA 5EWVA 5CGPA 4CFLA 4LRGA 5H1TA 5EWCA 4A9EA 5DW2A 4UYHA 3LQIA 5ENFA 4J1PA 5EK9A 2MJVB 5A85A 4UIUA 4OGIA 5I86A 2DVQA 3JVLA 4IR4A 5FH8A 3S92A 3Q2EA 5DX4A 4LDFA 5D3HA 2RS9B 4CUPA 5G4RA 5F63A 4O7FA 4QB3A 5EISA 3VKGA 5CQAA 3Q2FA 5IGMA 5LVQA 4N4FA 4BW3A 3LQHA 5DFBA 5G4SA 2WP2A 4YK0A 4XY9A 4NR7A 3U5JA 4KCXA 4XY8A 2YQDA 4O70A 3UV4A 4YYDA 4Q0OA 3UV2A 3UVWA 4CFKA 5ETDA 3O37A 5FE4A 2RNYA 4LZ2A 3HMFA 2OSSA 5ENCA 4WHUA 4OUFA 5A5PA 3D1DA 3JVKA 5I7YA 3QZVA 5CQ6A 3O36A 3U5PA 2NXBA 4O7EA 4O78A 2OUOA 4AKIA 3P1FA 3SVHA 5IG6A 5BT5A 5F1LA 4YC9A 5HQ7A 2RI7A 5F60A 5HRWA 4YY6A 5E9LA 4Q0NA 1F68A 5FE0A 4HXMA 2RO1A 5AMFA 2R0VA 4QR3A 5E3GA 4TU6A 5DYXA 3IU5A 5CUGA 4J3IA 3DAIA 3TLPA 5EWWA 1JM4B 3FKMX 4O75A 2E7OA 5F3AA 3U5NA 1ZKRA 4YYGA 5CUCA 2I8NA 5E7DA 2D82A 5KO4A 4A9FA 4HBVA 5JI8A 4X2IA 5DY7A 4NR4A 4QSVA 5EGUA 5EI4A 5ENJA 4QC1A 4IOQA 4PKLA 5BT4A 5EP7A 4AKHA 4YYKA 5FFVA 1X0JA 4O7AA 5F36A 4LZSA 2WP1A 3AADA 5LKTA 3UVDA 4NRAA 5D24A 4HXKA 5CS8A 5FB0A 3UVXA 4A9NA 4UYFB 4NS5A 2LSPB 3P5OA 3VKHA 4UIWA 5C85A 4IORA 5FG6A 5ACYA 4Z6HA 5LKZA 4QSQA 5FDZA 3DWYA 4QEWA 3LXJA 4NRBA 4N4GA 2L84A 4CLBA 5A5RA 4YABA 4YYJA 4LYWA 5L99A 4J0SA 5DYCA 5KTUA 5CY9A 4YYNA 5F25A 2L5EA 3LJWA 4HBYA 4YBTA 4TT6A 5BT3A 4N3WA 4NUDA 4A9JA 5CQ3A 2GRCA 5I7XA 4O71A 5DBMA 4HXOA 5FE8A 4HXRA 4UYFA 4BHWA 2YYNA 3U5LA 3UW9A 4O74A 4LYSA 5HQ5A 5IIDA 4KV4A 4IR3A 5F1HA 3IU6A 5FH7A 5HM0A 4QEVA 5E9IA 5D3SA 4QSSA 5EWDA 3P1EA 4YATA 5KTXA 5C4QA 4RVRA 4A9KA 3QZTA 5A5NA 5C7NA 3MB3A 4NR9A 4MEQA 5E9KA 5E3DA 4CUTA 4DONA 4ZQLA 5EPSA 4FLPA 4UIZA 3RCWA 2OO1A 5ENGA 5IGKA 4QUTA 5CQ5A 4TT4A 5H85A 4QSPA 5FE3A 4QR4A 4HXNA 5CRZA 5A5QA 5HENA 4IOOA 5A5SA 3D1BA 5I80A 4PCEA 5I89A 4QY4A 1N72A 5H1VA 5HELA 4NQNA 4UIYA 3MB4A 4MEPA 3UVYA 4XYAA 5EA1A 5ENBA 3SVFA 5EQ1A 4O7BA 5LKUA 4QSXA 5D3RA 5DYUA 5C89A 4Y03A 4QYLA 3JVJA 5TCMA 4YY4A 4XUAA 5A5OA 5EM3A 1WUGA 5EWHA 4QSTA 4WIVA 5L97A 5EPRA 4TZ8A 4A9OA 5A82A 4QUUA 5I1QA 4QSWA 3JVMA 5D3LA 5EPBA 5CUBA 4GPJA 5IBNA 5LJ0A 5DFCA 3ZYUA 4CL9A 3U5MA 4YH4A 5L98A 4BW1A 5I40A 4YADA 5CPEA 3K2JA 5EICA 4ALHA 5A83A 5HFQA 5HJCA 2YEMA 4YBSA 4LR6A 2D9EA 5CQ7A 5ENEA 5HQ6A 2DVVA 5E73A 2RNWA 5ENHA 5CQTA 3MXFA 4HXLA 5H1UA 4A9LA 3P1DA 5EU1A 5II1A 4QYDA 4TTEA 5DKHA 5IGNA 4TYLA 3ONIA 2FSAA 4Z1QA 2E3KA 5E74A 5F2PA 5E9VA 3LQJA 4N4IA 4YYHA 5FE7A 2DKWA 3HMHA 5F62A 4NR6A 5HCLA 5D7XA 5J0DA 5CTLA 5FBXA 4QBMA 2G4AA 4NQMA 5K29A 4A9IA 5D3NA 4A9MA 4Z6IA 3G0LA 2RNXA 4PS5A 5I29A 5KU3A 4PTBA 4OGJA 5ENIA 4YBMA 4UIXA 4O77A 5DFDA 5LVRA 5EV9A 3G0JA 1E6IA 2F6NA 4LC2A 4TU4A 5FE2A 5CUAA 5IGLA 4N4HA 2R0YA 5D3TA 4Z93A 4O72A 5AD2A 5CZGA 5CQ4A
chains in the Genus database with same CATH topology
5LKXA 4MR5A 5AD3A 4LZRA 4QC3A 5I83A 5LJ2A 5F61A 5L8UA 4CUQA 3MQMA 3QZSA 4TS8A 4NR8A 5F5ZA 2DWWA 2F6JA 3O35A 2DVSA 4NUCA 5HLSA 5C87A 4NUEA 4O76A 4QSRA 4C66A 4MENA 4YAXA 5D3PA 4QR5A 4HBXA 3MULA 4J0RA 4E96A 5KHMA 4NXJA 4HXSA 5DW1A 2YDWA 5E0RA 4NYWA 5FE9A 5L8TA 4YYMA 2N9GA 5DLZA 2E7NA 5E9MA 5FFYA 5HEMA 4PY6A 4BW2A 4BW4A 4LYIA 5AMEA 5CQ8A 5L96A 4QSUA 4CUSA 4ZW1A 4NYXA 2I7KA 2YW5A 5JWMA 4IR5A 5LUUA 5CRMA 4QZSA 5C8GA 4QEUA 5FH6A 4C67A 4Z1SA 3O34A 4O7CA 3AQAA 4MR3A 5FG5A 5CFWA 4CUUA 5D0CA 3S91A 4F3IA 2KTBB 1WUMA 2H60A 3U5KA 5DKDA 5A81A 4NRCA 2YEKA 1JSPB 4AKNA 5D26A 5DKCA 1EQFA 5FE5A 5KTWA 5COIA 3MUKA 4IR6A 4CURA 4KV1A 4HBWA 4UYEA 3I3JA 4UIVA 4TZ2A 4NR5A 3D7CA 4WHWA 5HRVA 3HMEA 5CUDA 4MR6A 4TQNA 3P1CA 5DYAA 4MEOA 5A7CA 4HXPA 1ZS5A 2R0SA 5CUEA 3U5OA 4A9HA 4BJXA 4YH3A 5D25A 2L85A 4ALGA 5FE1A 4UYGA 5FFWA 4QNSA 5I88A 5HRXA 3GG3A 2RFJA 4NYVA 2R10A 5FB1A 2YELA 4TT2A 3NXBA 5HFRA 3O33A 4UYDA 5LJ1A 5FE6A 4ZC9A 5TB6A 4YYIA 5ETBA 3SVGA 2DVRA 5FG4A 2DATA 5CP5A 5EVAA 4UITA 4MR4A 5D3JA 3UV5A 4XUBA 5DLXA 5II2A 4PCIA 5CU8A 5E9YA 5EWVA 5CGPA 4CFLA 4LRGA 5H1TA 5EWCA 4A9EA 5DW2A 4UYHA 3LQIA 5ENFA 4J1PA 5EK9A 2MJVB 5A85A 4UIUA 4OGIA 5I86A 2DVQA 3JVLA 4IR4A 5FH8A 3S92A 3Q2EA 5DX4A 4LDFA 5D3HA 2RS9B 4CUPA 5G4RA 5F63A 4O7FA 4QB3A 5EISA 5CQAA 3Q2FA 5IGMA 5LVQA 4N4FA 4BW3A 3LQHA 5DFBA 5G4SA 2WP2A 4YK0A 4XY9A 4NR7A 3U5JA 4KCXA 4XY8A 2YQDA 4O70A 3UV4A 4YYDA 4Q0OA 3UV2A 3UVWA 4CFKA 5ETDA 3O37A 5FE4A 2RNYA 4LZ2A 3HMFA 2OSSA 5ENCA 4WHUA 4OUFA 5A5PA 3JVKA 5I7YA 3QZVA 5CQ6A 3O36A 3U5PA 2NXBA 4O7EA 4O78A 2OUOA 3P1FA 3SVHA 5IG6A 5BT5A 5F1LA 4YC9A 5HQ7A 2RI7A 5F60A 5HRWA 4YY6A 5E9LA 4Q0NA 1F68A 5FE0A 4HXMA 2RO1A 5AMFA 2R0VA 4QR3A 5E3GA 4TU6A 5DYXA 3IU5A 5CUGA 4J3IA 3DAIA 3TLPA 5EWWA 1JM4B 3FKMX 4O75A 2E7OA 5F3AA 3U5NA 4YYGA 5CUCA 2I8NA 5E7DA 2D82A 5KO4A 4A9FA 4HBVA 5JI8A 4X2IA 5DY7A 4NR4A 4QSVA 5EGUA 5EI4A 5ENJA 4QC1A 4IOQA 4PKLA 5BT4A 5EP7A 4YYKA 5FFVA 1X0JA 4O7AA 5F36A 4LZSA 2WP1A 3AADA 5LKTA 3UVDA 4NRAA 5D24A 4HXKA 5CS8A 5FB0A 3UVXA 4A9NA 4UYFB 4NS5A 2LSPB 3P5OA 4UIWA 5C85A 4IORA 5FG6A 5ACYA 4Z6HA 5LKZA 4QSQA 5FDZA 3DWYA 4QEWA 3LXJA 4NRBA 4N4GA 2L84A 4CLBA 5A5RA 4YABA 4YYJA 4LYWA 5L99A 4J0SA 5DYCA 5KTUA 5CY9A 4YYNA 5F25A 2L5EA 3LJWA 4HBYA 4YBTA 4TT6A 5BT3A 4N3WA 4NUDA 4A9JA 5CQ3A 2GRCA 5I7XA 4O71A 5DBMA 4HXOA 5FE8A 4HXRA 4UYFA 4BHWA 2YYNA 3U5LA 3UW9A 4O74A 4LYSA 5HQ5A 5IIDA 4KV4A 4IR3A 5F1HA 3IU6A 5FH7A 5HM0A 4QEVA 5E9IA 5D3SA 4QSSA 5EWDA 3P1EA 4YATA 5KTXA 5C4QA 4RVRA 4A9KA 3QZTA 5A5NA 5C7NA 3MB3A 4NR9A 4MEQA 5E9KA 5E3DA 4CUTA 4DONA 4ZQLA 5EPSA 4FLPA 4UIZA 3RCWA 2OO1A 5ENGA 5IGKA 4QUTA 5CQ5A 4TT4A 5H85A 4QSPA 5FE3A 4QR4A 4HXNA 5CRZA 5A5QA 5HENA 4IOOA 5A5SA 5I80A 4PCEA 5I89A 4QY4A 1N72A 5H1VA 5HELA 4NQNA 4UIYA 3MB4A 4MEPA 3UVYA 4XYAA 5EA1A 5ENBA 3SVFA 5EQ1A 4O7BA 5LKUA 4QSXA 5D3RA 5DYUA 5C89A 4Y03A 4QYLA 3JVJA 5TCMA 4YY4A 4XUAA 5A5OA 5EM3A 1WUGA 5EWHA 4QSTA 4WIVA 5L97A 5EPRA 4TZ8A 4A9OA 5A82A 4QUUA 5I1QA 4QSWA 3JVMA 5D3LA 5EPBA 5CUBA 4GPJA 5IBNA 5LJ0A 5DFCA 3ZYUA 4CL9A 3U5MA 4YH4A 5L98A 4BW1A 5I40A 4YADA 5CPEA 3K2JA 5EICA 4ALHA 5A83A 5HFQA 5HJCA 2YEMA 4YBSA 4LR6A 2D9EA 5CQ7A 5ENEA 5HQ6A 2DVVA 5E73A 2RNWA 5ENHA 5CQTA 3MXFA 4HXLA 5H1UA 4A9LA 3P1DA 5EU1A 5II1A 4QYDA 4TTEA 5DKHA 5IGNA 4TYLA 3ONIA 2FSAA 4Z1QA 2E3KA 5E74A 5F2PA 5E9VA 3LQJA 4N4IA 4YYHA 5FE7A 2DKWA 3HMHA 5F62A 4NR6A 5HCLA 5D7XA 5J0DA 5CTLA 5FBXA 4QBMA 2G4AA 4NQMA 5K29A 4A9IA 5D3NA 4A9MA 4Z6IA 3G0LA 2RNXA 4PS5A 5I29A 5KU3A 4PTBA 4OGJA 5ENIA 4YBMA 4UIXA 4O77A 5DFDA 5LVRA 5EV9A 3G0JA 1E6IA 2F6NA 4LC2A 4TU4A 5FE2A 5CUAA 5IGLA 4N4HA 2R0YA 5D3TA 4Z93A 4O72A 5AD2A 5CZGA 5CQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LKX A;  4MR5 A;  5AD3 A;  4LZR A;  4QC3 A;  5I83 A;  5LJ2 A;  5F61 A;  5L8U A;  4CUQ A;  3MQM A;  3QZS A;  4TS8 A;  4NR8 A;  5F5Z A;  2DWW A;  2F6J A;  3O35 A;  2DVS A;  4NUC A;  5HLS A;  5C87 A;  4NUE A;  4O76 A;  4QSR A;  4C66 A;  4MEN A;  4YAX A;  5D3P A;  4QR5 A;  4HBX A;  3MUL A;  4J0R A;  4E96 A;  5KHM A;  4NXJ A;  4HXS A;  5DW1 A;  2YDW A;  5E0R A;  4NYW A;  5FE9 A;  5L8T A;  4YYM A;  2N9G A;  5DLZ A;  2E7N A;  5E9M A;  5FFY A;  5HEM A;  4PY6 A;  4BW2 A;  4BW4 A;  4LYI A;  5AME A;  5CQ8 A;  5L96 A;  4QSU A;  4CUS A;  4ZW1 A;  4NYX A;  2I7K A;  2YW5 A;  5JWM A;  4IR5 A;  5LUU A;  5CRM A;  4QZS A;  5C8G A;  4QEU A;  5FH6 A;  4C67 A;  4Z1S A;  3O34 A;  4O7C A;  3AQA A;  4MR3 A;  5FG5 A;  5CFW A;  4CUU A;  5D0C A;  3S91 A;  4F3I A;  2KTB B;  1WUM A;  2H60 A;  3U5K A;  5DKD A;  5A81 A;  4NRC A;  2YEK A;  1JSP B;  4AKN A;  5D26 A;  5DKC A;  1EQF A;  5FE5 A;  5KTW A;  5COI A;  3MUK A;  4IR6 A;  4CUR A;  4KV1 A;  4HBW A;  4UYE A;  3I3J A;  4UIV A;  4TZ2 A;  4NR5 A;  3D7C A;  4WHW A;  5HRV A;  3HME A;  5CUD A;  4MR6 A;  4TQN A;  3P1C A;  5DYA A;  4MEO A;  5A7C A;  4HXP A;  1ZS5 A;  2R0S A;  5CUE A;  3U5O A;  4A9H A;  4BJX A;  4YH3 A;  5D25 A;  2L85 A;  4ALG A;  5FE1 A;  4UYG A;  5FFW A;  4QNS A;  5I88 A;  5HRX A;  3GG3 A;  2RFJ A;  4NYV A;  2R10 A;  5FB1 A;  2YEL A;  4TT2 A;  3NXB A;  5HFR A;  3O33 A;  4UYD A;  5LJ1 A;  5FE6 A;  4ZC9 A;  5TB6 A;  4YYI A;  5ETB A;  3SVG A;  2DVR A;  5FG4 A;  2DAT A;  5CP5 A;  5EVA A;  4UIT A;  4MR4 A;  5D3J A;  3UV5 A;  4XUB A;  5DLX A;  5II2 A;  4PCI A;  5CU8 A;  5E9Y A;  5EWV A;  5CGP A;  4CFL A;  4LRG A;  5H1T A;  5EWC A;  4A9E A;  5DW2 A;  4UYH A;  3LQI A;  5ENF A;  4J1P A;  5EK9 A;  2MJV B;  5A85 A;  4UIU A;  4OGI A;  5I86 A;  2DVQ A;  3JVL A;  4IR4 A;  5FH8 A;  3S92 A;  3Q2E A;  5DX4 A;  4LDF A;  5D3H A;  2RS9 B;  4CUP A;  5G4R A;  5F63 A;  4O7F A;  4QB3 A;  5EIS A;  5CQA A;  3Q2F A;  5IGM A;  5LVQ A;  4N4F A;  4BW3 A;  3LQH A;  5DFB A;  5G4S A;  2WP2 A;  4YK0 A;  4XY9 A;  4NR7 A;  3U5J A;  4KCX A;  4XY8 A;  2YQD A;  4O70 A;  3UV4 A;  4YYD A;  4Q0O A;  3UV2 A;  3UVW A;  4CFK A;  5ETD A;  3O37 A;  5FE4 A;  2RNY A;  4LZ2 A;  3HMF A;  2OSS A;  5ENC A;  4WHU A;  4OUF A;  5A5P A;  3JVK A;  5I7Y A;  3QZV A;  5CQ6 A;  3O36 A;  3U5P A;  2NXB A;  4O7E A;  4O78 A;  2OUO A;  3P1F A;  3SVH A;  5IG6 A;  5BT5 A;  5F1L A;  4YC9 A;  5HQ7 A;  2RI7 A;  5F60 A;  5HRW A;  4YY6 A;  5E9L A;  4Q0N A;  1F68 A;  5FE0 A;  4HXM A;  2RO1 A;  5AMF A;  2R0V A;  4QR3 A;  5E3G A;  4TU6 A;  5DYX A;  3IU5 A;  5CUG A;  4J3I A;  3DAI A;  3TLP A;  5EWW A;  1JM4 B;  3FKM X;  4O75 A;  2E7O A;  5F3A A;  3U5N A;  4YYG A;  5CUC A;  2I8N A;  5E7D A;  2D82 A;  5KO4 A;  4A9F A;  4HBV A;  5JI8 A;  4X2I A;  5DY7 A;  4NR4 A;  4QSV A;  5EGU A;  5EI4 A;  5ENJ A;  4QC1 A;  4IOQ A;  4PKL A;  5BT4 A;  5EP7 A;  4YYK A;  5FFV A;  1X0J A;  4O7A A;  5F36 A;  4LZS A;  2WP1 A;  3AAD A;  5LKT A;  3UVD A;  4NRA A;  5D24 A;  4HXK A;  5CS8 A;  5FB0 A;  3UVX A;  4A9N A;  4UYF B;  4NS5 A;  2LSP B;  3P5O A;  4UIW A;  5C85 A;  4IOR A;  5FG6 A;  5ACY A;  4Z6H A;  5LKZ A;  4QSQ A;  5FDZ A;  3DWY A;  4QEW A;  3LXJ A;  4NRB A;  4N4G A;  2L84 A;  4CLB A;  5A5R A;  4YAB A;  4YYJ A;  4LYW A;  5L99 A;  4J0S A;  5DYC A;  5KTU A;  5CY9 A;  4YYN A;  5F25 A;  2L5E A;  3LJW A;  4HBY A;  4YBT A;  4TT6 A;  5BT3 A;  4N3W A;  4NUD A;  4A9J A;  5CQ3 A;  2GRC A;  5I7X A;  4O71 A;  5DBM A;  4HXO A;  5FE8 A;  4HXR A;  4UYF A;  4BHW A;  2YYN A;  3U5L A;  3UW9 A;  4O74 A;  4LYS A;  5HQ5 A;  5IID A;  4KV4 A;  4IR3 A;  5F1H A;  3IU6 A;  5FH7 A;  5HM0 A;  4QEV A;  5E9I A;  5D3S A;  4QSS A;  5EWD A;  3P1E A;  4YAT A;  5KTX A;  5C4Q A;  4RVR A;  4A9K A;  3QZT A;  5A5N A;  5C7N A;  3MB3 A;  4NR9 A;  4MEQ A;  5E9K A;  5E3D A;  4CUT A;  4DON A;  4ZQL A;  5EPS A;  4FLP A;  4UIZ A;  3RCW A;  2OO1 A;  5ENG A;  5IGK A;  4QUT A;  5CQ5 A;  4TT4 A;  5H85 A;  4QSP A;  5FE3 A;  4QR4 A;  4HXN A;  5CRZ A;  5A5Q A;  5HEN A;  4IOO A;  5A5S A;  5I80 A;  4PCE A;  5I89 A;  4QY4 A;  1N72 A;  5H1V A;  5HEL A;  4NQN A;  4UIY A;  3MB4 A;  4MEP A;  3UVY A;  4XYA A;  5EA1 A;  5ENB A;  3SVF A;  5EQ1 A;  4O7B A;  5LKU A;  4QSX A;  5D3R A;  5DYU A;  5C89 A;  4Y03 A;  4QYL A;  3JVJ A;  5TCM A;  4YY4 A;  4XUA A;  5A5O A;  5EM3 A;  1WUG A;  5EWH A;  4QST A;  4WIV A;  5L97 A;  5EPR A;  4TZ8 A;  4A9O A;  5A82 A;  4QUU A;  5I1Q A;  4QSW A;  3JVM A;  5D3L A;  5EPB A;  5CUB A;  4GPJ A;  5IBN A;  5LJ0 A;  5DFC A;  3ZYU A;  4CL9 A;  3U5M A;  4YH4 A;  5L98 A;  4BW1 A;  5I40 A;  4YAD A;  5CPE A;  3K2J A;  5EIC A;  4ALH A;  5A83 A;  5HFQ A;  5HJC A;  2YEM A;  4YBS A;  4LR6 A;  2D9E A;  5CQ7 A;  5ENE A;  5HQ6 A;  2DVV A;  5E73 A;  2RNW A;  5ENH A;  5CQT A;  3MXF A;  4HXL A;  5H1U A;  4A9L A;  3P1D A;  5EU1 A;  5II1 A;  4QYD A;  4TTE A;  5DKH A;  5IGN A;  4TYL A;  3ONI A;  2FSA A;  4Z1Q A;  2E3K A;  5E74 A;  5F2P A;  5E9V A;  3LQJ A;  4N4I A;  4YYH A;  5FE7 A;  2DKW A;  3HMH A;  5F62 A;  4NR6 A;  5HCL A;  5D7X A;  5J0D A;  5CTL A;  5FBX A;  4QBM A;  2G4A A;  4NQM A;  5K29 A;  4A9I A;  5D3N A;  4A9M A;  4Z6I A;  3G0L A;  2RNX A;  4PS5 A;  5I29 A;  5KU3 A;  4PTB A;  4OGJ A;  5ENI A;  4YBM A;  4UIX A;  4O77 A;  5DFD A;  5LVR A;  5EV9 A;  3G0J A;  1E6I A;  2F6N A;  4LC2 A;  4TU4 A;  5FE2 A;  5CUA A;  5IGL A;  4N4H A;  2R0Y A;  5D3T A;  4Z93 A;  4O72 A;  5AD2 A;  5CZG A;  5CQ4 A; 
#chains in the Genus database with same CATH topology
 1PUO A;  5LKX A;  4MR5 A;  5AD3 A;  4LZR A;  4QC3 A;  5I83 A;  5LJ2 A;  5F61 A;  5L8U A;  4CUQ A;  3MQM A;  3QZS A;  4TS8 A;  4NR8 A;  5F5Z A;  2DWW A;  2F6J A;  3O35 A;  2DVS A;  4NUC A;  5HLS A;  5C87 A;  4NUE A;  4O76 A;  4QSR A;  4C66 A;  4MEN A;  4YAX A;  5D3P A;  4QR5 A;  4HBX A;  3MUL A;  4J0R A;  4E96 A;  5KHM A;  4NXJ A;  4HXS A;  5DW1 A;  2YDW A;  5E0R A;  4NYW A;  5FE9 A;  5L8T A;  3ERR A;  4YYM A;  2N9G A;  5DLZ A;  2E7N A;  5E9M A;  5FFY A;  5HEM A;  4PY6 A;  4BW2 A;  4BW4 A;  4LYI A;  5AME A;  5CQ8 A;  5L96 A;  4QSU A;  4CUS A;  4ZW1 A;  4NYX A;  2I7K A;  2YW5 A;  5JWM A;  4IR5 A;  4AKG A;  5LUU A;  5CRM A;  4QZS A;  5C8G A;  4QEU A;  5FH6 A;  4C67 A;  4Z1S A;  3O34 A;  4O7C A;  3AQA A;  4MR3 A;  5FG5 A;  5CFW A;  4CUU A;  5D0C A;  3S91 A;  4F3I A;  2KTB B;  1WUM A;  2H60 A;  3U5K A;  5DKD A;  5A81 A;  4NRC A;  2YEK A;  1JSP B;  4AKN A;  5D26 A;  5DKC A;  1EQF A;  5FE5 A;  5KTW A;  5COI A;  3MUK A;  4IR6 A;  4CUR A;  4KV1 A;  4HBW A;  4UYE A;  3I3J A;  4UIV A;  4TZ2 A;  4NR5 A;  3D7C A;  4WHW A;  5HRV A;  3HME A;  5CUD A;  4MR6 A;  4TQN A;  3P1C A;  5DYA A;  4MEO A;  5A7C A;  4HXP A;  1ZS5 A;  2R0S A;  5CUE A;  3U5O A;  4A9H A;  4BJX A;  4YH3 A;  5D25 A;  2L85 A;  4ALG A;  5FE1 A;  4UYG A;  5FFW A;  4QNS A;  5I88 A;  5HRX A;  3GG3 A;  2EJN A;  2RFJ A;  4NYV A;  2R10 A;  5FB1 A;  2YEL A;  4TT2 A;  3NXB A;  5HFR A;  4AI6 A;  3O33 A;  4UYD A;  5LJ1 A;  5FE6 A;  4ZC9 A;  5TB6 A;  4YYI A;  5ETB A;  3SVG A;  2DVR A;  5FG4 A;  2DAT A;  5CP5 A;  5EVA A;  4UIT A;  4MR4 A;  5D3J A;  3UV5 A;  4XUB A;  5DLX A;  5II2 A;  4PCI A;  5CU8 A;  5E9Y A;  5EWV A;  5CGP A;  4CFL A;  4LRG A;  5H1T A;  5EWC A;  4A9E A;  5DW2 A;  4UYH A;  3LQI A;  5ENF A;  4J1P A;  5EK9 A;  2MJV B;  5A85 A;  4UIU A;  4OGI A;  5I86 A;  2DVQ A;  3JVL A;  4IR4 A;  5FH8 A;  3S92 A;  3Q2E A;  5DX4 A;  4LDF A;  5D3H A;  2RS9 B;  4CUP A;  5G4R A;  5F63 A;  4O7F A;  4QB3 A;  5EIS A;  3VKG A;  5CQA A;  3Q2F A;  5IGM A;  5LVQ A;  4N4F A;  4BW3 A;  3LQH A;  5DFB A;  5G4S A;  2WP2 A;  4YK0 A;  4XY9 A;  4NR7 A;  3U5J A;  4KCX A;  4XY8 A;  2YQD A;  4O70 A;  3UV4 A;  4YYD A;  4Q0O A;  3UV2 A;  3UVW A;  4CFK A;  5ETD A;  3O37 A;  5FE4 A;  2RNY A;  4LZ2 A;  3HMF A;  2OSS A;  5ENC A;  4WHU A;  4OUF A;  5A5P A;  3D1D A;  3JVK A;  5I7Y A;  3QZV A;  5CQ6 A;  3O36 A;  3U5P A;  2NXB A;  4O7E A;  4O78 A;  2OUO A;  4AKI A;  3P1F A;  3SVH A;  5IG6 A;  5BT5 A;  5F1L A;  4YC9 A;  5HQ7 A;  2RI7 A;  5F60 A;  5HRW A;  4YY6 A;  5E9L A;  4Q0N A;  1F68 A;  5FE0 A;  4HXM A;  2RO1 A;  5AMF A;  2R0V A;  4QR3 A;  5E3G A;  4TU6 A;  5DYX A;  3IU5 A;  5CUG A;  4J3I A;  3DAI A;  3TLP A;  5EWW A;  1JM4 B;  3FKM X;  4O75 A;  2E7O A;  5F3A A;  3U5N A;  1ZKR A;  4YYG A;  5CUC A;  2I8N A;  5E7D A;  2D82 A;  5KO4 A;  4A9F A;  4HBV A;  5JI8 A;  4X2I A;  5DY7 A;  4NR4 A;  4QSV A;  5EGU A;  5EI4 A;  5ENJ A;  4QC1 A;  4IOQ A;  4PKL A;  5BT4 A;  5EP7 A;  4AKH A;  4YYK A;  5FFV A;  1X0J A;  4O7A A;  5F36 A;  4LZS A;  2WP1 A;  3AAD A;  5LKT A;  3UVD A;  4NRA A;  5D24 A;  4HXK A;  5CS8 A;  5FB0 A;  3UVX A;  4A9N A;  4UYF B;  4NS5 A;  2LSP B;  3P5O A;  3VKH A;  4UIW A;  5C85 A;  4IOR A;  5FG6 A;  5ACY A;  4Z6H A;  5LKZ A;  4QSQ A;  5FDZ A;  3DWY A;  4QEW A;  3LXJ A;  4NRB A;  4N4G A;  2L84 A;  4CLB A;  5A5R A;  4YAB A;  4YYJ A;  4LYW A;  5L99 A;  4J0S A;  5DYC A;  5KTU A;  5CY9 A;  4YYN A;  5F25 A;  2L5E A;  3LJW A;  4HBY A;  4YBT A;  4TT6 A;  5BT3 A;  4N3W A;  4NUD A;  4A9J A;  5CQ3 A;  2GRC A;  5I7X A;  4O71 A;  5DBM A;  4HXO A;  5FE8 A;  4HXR A;  4UYF A;  4BHW A;  2YYN A;  3U5L A;  3UW9 A;  4O74 A;  4LYS A;  5HQ5 A;  5IID A;  4KV4 A;  4IR3 A;  5F1H A;  3IU6 A;  5FH7 A;  5HM0 A;  4QEV A;  5E9I A;  5D3S A;  4QSS A;  5EWD A;  3P1E A;  4YAT A;  5KTX A;  5C4Q A;  4RVR A;  4A9K A;  3QZT A;  5A5N A;  5C7N A;  3MB3 A;  4NR9 A;  4MEQ A;  5E9K A;  5E3D A;  4CUT A;  4DON A;  4ZQL A;  5EPS A;  4FLP A;  4UIZ A;  3RCW A;  2OO1 A;  5ENG A;  5IGK A;  4QUT A;  5CQ5 A;  4TT4 A;  5H85 A;  4QSP A;  5FE3 A;  4QR4 A;  4HXN A;  5CRZ A;  5A5Q A;  5HEN A;  4IOO A;  5A5S A;  3D1B A;  5I80 A;  4PCE A;  5I89 A;  4QY4 A;  1N72 A;  5H1V A;  5HEL A;  4NQN A;  4UIY A;  3MB4 A;  4MEP A;  3UVY A;  4XYA A;  5EA1 A;  5ENB A;  3SVF A;  5EQ1 A;  4O7B A;  5LKU A;  4QSX A;  5D3R A;  5DYU A;  5C89 A;  4Y03 A;  4QYL A;  3JVJ A;  5TCM A;  4YY4 A;  4XUA A;  5A5O A;  5EM3 A;  1WUG A;  5EWH A;  4QST A;  4WIV A;  5L97 A;  5EPR A;  4TZ8 A;  4A9O A;  5A82 A;  4QUU A;  5I1Q A;  4QSW A;  3JVM A;  5D3L A;  5EPB A;  5CUB A;  4GPJ A;  5IBN A;  5LJ0 A;  5DFC A;  3ZYU A;  4CL9 A;  3U5M A;  4YH4 A;  5L98 A;  4BW1 A;  5I40 A;  4YAD A;  5CPE A;  3K2J A;  5EIC A;  4ALH A;  5A83 A;  5HFQ A;  5HJC A;  2YEM A;  4YBS A;  4LR6 A;  2D9E A;  5CQ7 A;  5ENE A;  5HQ6 A;  2DVV A;  5E73 A;  2RNW A;  5ENH A;  5CQT A;  3MXF A;  4HXL A;  5H1U A;  4A9L A;  3P1D A;  5EU1 A;  5II1 A;  4QYD A;  4TTE A;  5DKH A;  5IGN A;  4TYL A;  3ONI A;  2FSA A;  4Z1Q A;  2E3K A;  5E74 A;  5F2P A;  5E9V A;  3LQJ A;  4N4I A;  4YYH A;  5FE7 A;  2DKW A;  3HMH A;  5F62 A;  4NR6 A;  5HCL A;  5D7X A;  5J0D A;  5CTL A;  5FBX A;  4QBM A;  2G4A A;  4NQM A;  5K29 A;  4A9I A;  5D3N A;  4A9M A;  4Z6I A;  3G0L A;  2RNX A;  4PS5 A;  5I29 A;  5KU3 A;  4PTB A;  4OGJ A;  5ENI A;  4YBM A;  4UIX A;  4O77 A;  5DFD A;  5LVR A;  5EV9 A;  3G0J A;  1E6I A;  2F6N A;  4LC2 A;  4TU4 A;  5FE2 A;  5CUA A;  5IGL A;  4N4H A;  2R0Y A;  5D3T A;  4Z93 A;  4O72 A;  5AD2 A;  5CZG A;  5CQ4 A; 
#chains in the Genus database with same CATH homology
 5LKX A;  4MR5 A;  5AD3 A;  4LZR A;  4QC3 A;  5I83 A;  5LJ2 A;  5F61 A;  5L8U A;  4CUQ A;  3MQM A;  3QZS A;  4TS8 A;  4NR8 A;  5F5Z A;  2DWW A;  2F6J A;  3O35 A;  2DVS A;  4NUC A;  5HLS A;  5C87 A;  4NUE A;  4O76 A;  4QSR A;  4C66 A;  4MEN A;  4YAX A;  5D3P A;  4QR5 A;  4HBX A;  3MUL A;  4J0R A;  4E96 A;  5KHM A;  4NXJ A;  4HXS A;  5DW1 A;  2YDW A;  5E0R A;  4NYW A;  5FE9 A;  5L8T A;  4YYM A;  2N9G A;  5DLZ A;  2E7N A;  5E9M A;  5FFY A;  5HEM A;  4PY6 A;  4BW2 A;  4BW4 A;  4LYI A;  5AME A;  5CQ8 A;  5L96 A;  4QSU A;  4CUS A;  4ZW1 A;  4NYX A;  2I7K A;  2YW5 A;  5JWM A;  4IR5 A;  5LUU A;  5CRM A;  4QZS A;  5C8G A;  4QEU A;  5FH6 A;  4C67 A;  4Z1S A;  3O34 A;  4O7C A;  3AQA A;  4MR3 A;  5FG5 A;  5CFW A;  4CUU A;  5D0C A;  3S91 A;  4F3I A;  2KTB B;  1WUM A;  2H60 A;  3U5K A;  5DKD A;  5A81 A;  4NRC A;  2YEK A;  1JSP B;  4AKN A;  5D26 A;  5DKC A;  1EQF A;  5FE5 A;  5KTW A;  5COI A;  3MUK A;  4IR6 A;  4CUR A;  4KV1 A;  4HBW A;  4UYE A;  3I3J A;  4UIV A;  4TZ2 A;  4NR5 A;  3D7C A;  4WHW A;  5HRV A;  3HME A;  5CUD A;  4MR6 A;  4TQN A;  3P1C A;  5DYA A;  4MEO A;  5A7C A;  4HXP A;  1ZS5 A;  2R0S A;  5CUE A;  3U5O A;  4A9H A;  4BJX A;  4YH3 A;  5D25 A;  2L85 A;  4ALG A;  5FE1 A;  4UYG A;  5FFW A;  4QNS A;  5I88 A;  5HRX A;  3GG3 A;  2RFJ A;  4NYV A;  2R10 A;  5FB1 A;  2YEL A;  4TT2 A;  3NXB A;  5HFR A;  3O33 A;  4UYD A;  5LJ1 A;  5FE6 A;  4ZC9 A;  5TB6 A;  4YYI A;  5ETB A;  3SVG A;  2DVR A;  5FG4 A;  2DAT A;  5CP5 A;  5EVA A;  4UIT A;  4MR4 A;  5D3J A;  3UV5 A;  4XUB A;  5DLX A;  5II2 A;  4PCI A;  5CU8 A;  5E9Y A;  5EWV A;  5CGP A;  4CFL A;  4LRG A;  5H1T A;  5EWC A;  4A9E A;  5DW2 A;  4UYH A;  3LQI A;  5ENF A;  4J1P A;  5EK9 A;  2MJV B;  5A85 A;  4UIU A;  4OGI A;  5I86 A;  2DVQ A;  3JVL A;  4IR4 A;  5FH8 A;  3S92 A;  3Q2E A;  5DX4 A;  4LDF A;  5D3H A;  2RS9 B;  4CUP A;  5G4R A;  5F63 A;  4O7F A;  4QB3 A;  5EIS A;  5CQA A;  3Q2F A;  5IGM A;  5LVQ A;  4N4F A;  4BW3 A;  3LQH A;  5DFB A;  5G4S A;  2WP2 A;  4YK0 A;  4XY9 A;  4NR7 A;  3U5J A;  4KCX A;  4XY8 A;  2YQD A;  4O70 A;  3UV4 A;  4YYD A;  4Q0O A;  3UV2 A;  3UVW A;  4CFK A;  5ETD A;  3O37 A;  5FE4 A;  2RNY A;  4LZ2 A;  3HMF A;  2OSS A;  5ENC A;  4WHU A;  4OUF A;  5A5P A;  3JVK A;  5I7Y A;  3QZV A;  5CQ6 A;  3O36 A;  3U5P A;  2NXB A;  4O7E A;  4O78 A;  2OUO A;  3P1F A;  3SVH A;  5IG6 A;  5BT5 A;  5F1L A;  4YC9 A;  5HQ7 A;  2RI7 A;  5F60 A;  5HRW A;  4YY6 A;  5E9L A;  4Q0N A;  1F68 A;  5FE0 A;  4HXM A;  2RO1 A;  5AMF A;  2R0V A;  4QR3 A;  5E3G A;  4TU6 A;  5DYX A;  3IU5 A;  5CUG A;  4J3I A;  3DAI A;  3TLP A;  5EWW A;  1JM4 B;  3FKM X;  4O75 A;  2E7O A;  5F3A A;  3U5N A;  4YYG A;  5CUC A;  2I8N A;  5E7D A;  2D82 A;  5KO4 A;  4A9F A;  4HBV A;  5JI8 A;  4X2I A;  5DY7 A;  4NR4 A;  4QSV A;  5EGU A;  5EI4 A;  5ENJ A;  4QC1 A;  4IOQ A;  4PKL A;  5BT4 A;  5EP7 A;  4YYK A;  5FFV A;  1X0J A;  4O7A A;  5F36 A;  4LZS A;  2WP1 A;  3AAD A;  5LKT A;  3UVD A;  4NRA A;  5D24 A;  4HXK A;  5CS8 A;  5FB0 A;  3UVX A;  4A9N A;  4UYF B;  4NS5 A;  2LSP B;  3P5O A;  4UIW A;  5C85 A;  4IOR A;  5FG6 A;  5ACY A;  4Z6H A;  5LKZ A;  4QSQ A;  5FDZ A;  3DWY A;  4QEW A;  3LXJ A;  4NRB A;  4N4G A;  2L84 A;  4CLB A;  5A5R A;  4YAB A;  4YYJ A;  4LYW A;  5L99 A;  4J0S A;  5DYC A;  5KTU A;  5CY9 A;  4YYN A;  5F25 A;  2L5E A;  3LJW A;  4HBY A;  4YBT A;  4TT6 A;  5BT3 A;  4N3W A;  4NUD A;  4A9J A;  5CQ3 A;  2GRC A;  5I7X A;  4O71 A;  5DBM A;  4HXO A;  5FE8 A;  4HXR A;  4UYF A;  4BHW A;  2YYN A;  3U5L A;  3UW9 A;  4O74 A;  4LYS A;  5HQ5 A;  5IID A;  4KV4 A;  4IR3 A;  5F1H A;  3IU6 A;  5FH7 A;  5HM0 A;  4QEV A;  5E9I A;  5D3S A;  4QSS A;  5EWD A;  3P1E A;  4YAT A;  5KTX A;  5C4Q A;  4RVR A;  4A9K A;  3QZT A;  5A5N A;  5C7N A;  3MB3 A;  4NR9 A;  4MEQ A;  5E9K A;  5E3D A;  4CUT A;  4DON A;  4ZQL A;  5EPS A;  4FLP A;  4UIZ A;  3RCW A;  2OO1 A;  5ENG A;  5IGK A;  4QUT A;  5CQ5 A;  4TT4 A;  5H85 A;  4QSP A;  5FE3 A;  4QR4 A;  4HXN A;  5CRZ A;  5A5Q A;  5HEN A;  4IOO A;  5A5S A;  5I80 A;  4PCE A;  5I89 A;  4QY4 A;  1N72 A;  5H1V A;  5HEL A;  4NQN A;  4UIY A;  3MB4 A;  4MEP A;  3UVY A;  4XYA A;  5EA1 A;  5ENB A;  3SVF A;  5EQ1 A;  4O7B A;  5LKU A;  4QSX A;  5D3R A;  5DYU A;  5C89 A;  4Y03 A;  4QYL A;  3JVJ A;  5TCM A;  4YY4 A;  4XUA A;  5A5O A;  5EM3 A;  1WUG A;  5EWH A;  4QST A;  4WIV A;  5L97 A;  5EPR A;  4TZ8 A;  4A9O A;  5A82 A;  4QUU A;  5I1Q A;  4QSW A;  3JVM A;  5D3L A;  5EPB A;  5CUB A;  4GPJ A;  5IBN A;  5LJ0 A;  5DFC A;  3ZYU A;  4CL9 A;  3U5M A;  4YH4 A;  5L98 A;  4BW1 A;  5I40 A;  4YAD A;  5CPE A;  3K2J A;  5EIC A;  4ALH A;  5A83 A;  5HFQ A;  5HJC A;  2YEM A;  4YBS A;  4LR6 A;  2D9E A;  5CQ7 A;  5ENE A;  5HQ6 A;  2DVV A;  5E73 A;  2RNW A;  5ENH A;  5CQT A;  3MXF A;  4HXL A;  5H1U A;  4A9L A;  3P1D A;  5EU1 A;  5II1 A;  4QYD A;  4TTE A;  5DKH A;  5IGN A;  4TYL A;  3ONI A;  2FSA A;  4Z1Q A;  2E3K A;  5E74 A;  5F2P A;  5E9V A;  3LQJ A;  4N4I A;  4YYH A;  5FE7 A;  2DKW A;  3HMH A;  5F62 A;  4NR6 A;  5HCL A;  5D7X A;  5J0D A;  5CTL A;  5FBX A;  4QBM A;  2G4A A;  4NQM A;  5K29 A;  4A9I A;  5D3N A;  4A9M A;  4Z6I A;  3G0L A;  2RNX A;  4PS5 A;  5I29 A;  5KU3 A;  4PTB A;  4OGJ A;  5ENI A;  4YBM A;  4UIX A;  4O77 A;  5DFD A;  5LVR A;  5EV9 A;  3G0J A;  1E6I A;  2F6N A;  4LC2 A;  4TU4 A;  5FE2 A;  5CUA A;  5IGL A;  4N4H A;  2R0Y A;  5D3T A;  4Z93 A;  4O72 A;  5AD2 A;  5CZG A;  5CQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...