3I3MA

Crystal structure of alkb in complex with mn(ii), 2-oxoglutarate and methylated trinucleotide t-mec-t
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
200
structure length
200
Chain Sequence
LAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Enzymological and structural studies of the mechanism of promiscuous substrate recognition by the oxidative DNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/dna
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB
total genus 49
structure length 200
sequence length 200
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3i3mA00
4NRMA 4IE7A 4NRQA 3O1TA 3H8RA 3RZJA 4MG2A 3S57A 4JHTA 4NIIA 4ZHNA 3H8XA 3RZMA 3BIEA 4ZS3A 5DABA 5F8PA 4NPLA 3O1UA 4O61A 3I2OA 4MGTA 2FDJA 4NIHA 3BI3A 4OCTA 3I49A 4NIGA 4IE5A 3RZHA 3T3YA 4CXXA 2FDFA 4QKDA 2FDGA 3S5AA 3BTXA 4QHOA 4NPMA 4NROA 4IE0A 4RFRB 3RZGA 3BU0A 3O1PA 4IE4A 4NIDA 2FDIA 4QKNA 3O1OA 3BTZA 3O1MA 3O1SA 2IUWA 4O7XA 2FD8A 3BUCA 3I3QA 4QKFA 3LFMA 3O1VA 3T4VA 4NJ4A 3H8OA 4IE6A 3RZKA 4ZS2A 4NRPA 4IDZA 3O1RA 3KHCA 3T4HB 3BTYA 3RZLA 2FDHA 3BKZA 2FDKA 4CXWA 3KHBA 4CXYA 3I3MA 4QKBA
chains in the Genus database with same CATH superfamily
2KD7A 3RZJA 1FPN3 2HWB1 1COV1 3DYMA 2G19A 4LA3A 1IPKA 5D1IA 3KCXA 1UCXA 1RC6A 3E5XA 1A78A 4H14A 3IM0A 4O61A 4OUEA 4JTNA 3WSOA 3HQRA 5BY5A 5CFCB 4A7YA 1PO21 5IVCA 2WJSA 2BQPA 3CJIA 1UMIA 2DF7A 2WBKA 1MPXA 3VN4A 2QJVA 3PUQA 5EIYB 3ZSKA 5KC5A 3H3ZA 3POJA 1ZZ6A 2CYFA 2EXJA 2KM2A 2WL1A 1W6OB 1XE8A 1VMJA 3G6JB 3VD3A 2FD8A 2JDNA 2PHLA 3HAGA 4JC1A 5F37A 1LB2A 4FSJA 4NJ4A 1ZZBA 1NYWA 3HIFA 5JOXA 4UT5A 4Y33A 5GZDA 2NM1A 4UF0A 1QEXA 1Q8QA 3T2TA 4XILA 3HNYM 3AJZA 4N9IA 5CKMA 1KEXA 3NQHA 4YW6A 3U4XA 5F3CA 1BMV1 4W6WA 4FTSA 3ZMOA 4QX5A 1XXNA 4GB33 1R1A2 2R062 3SH3A 3ZSEA 1HXS1 5BNPA 4CEYA 3POWA 3NL1A 4DIQA 1HB2A 3I59B 1NG0A 1VBE1 2DCYA 3VBSA 4QKFA 2P3YA 1RVF3 2DV9A 4AHWA 1MVEA 4N43A 4AVBA 4CDXA 5C3PA 3KWVA 3TEXA 3O5SA 2KXLA 5LY1A 4BYYA 4QHZA 2V4AA 4PBOA 4Y3OA 4M3CA 5F6LB 4GMP0 5FFOC 2BPA2 4MSVA 5A3WA 1SLLA 1WBLA 2JG8A 3FX3A 3I2IA 1L7LA 2P1BA 3RZHA 1AR62 2GMEA 2GC3A 3ETPA 4P9GA 4AZZA 4GJZA 1W0PA 2VZVA 3JBG3 4RFRB 3VGIA 2E51A 1GQPA 1HLCA 1PMJX 1R082 1ZRDA 2B4KA 2YDEA 3TYJA 1FMD3 1NCQC 2J1TA 3VDAA 2PHWA 2EIGA 2WNVB 4URTA 2X53S 3BUCA 2W94A 3B7MA 3I2DA 3VBSC 1QJX3 3PURA 4KNCA 2QZ3A 1RL3A 2OZJA 4QX7A 3C7OA 2ZHKA 1RUE1 3OYWA 2IFRA 4XJWA 1RUF2 1X8MA 3IWZA 4ORFA 4C0BA 2EALA 4GIQA 3ZYPA 4PF5A 1OD3A 1AJKA 4WVMA 4HONA 1QJU2 5FP3A 4IEQA 4XZUG 1JN2P 4HKOA 4L9BA 3USSA 1ODNA 1D4M2 1IHMA 2DFCA 5I91A 3RSJA 4I30A 4CU9A 4AEDB 1OQDA 1W6QA 1RUC2 4CDQB 4A45A 1W2OA 3IZOA 3SNMA 5FZ8A 1JYCA 3AP5A 3WEZA 4ES9A 1V6MA 2BFUS 3ITQA 2ADDA 4KH9A 2V72A 1H8TA 2BV4A 2ZHMA 1WCQA 1YI7A 2VMDA 5A7WB 4FVVA 5JPMB 4HPKB 4IE7A 3VDBA 4EE2A 2V4VA 4XBNA 3WR0A 3H8XA 3RWKX 2W2IA 2R30A 3OUIA 2D6PA 4AEMA 3UYJA 2A3XA 5JWPA 2TBVA 3K4AA 5DZGA 2VPVA 1BQPA 5A7SA 1WMXA 1WLTA 5A7WA 3SHRA 1CVNA 4A7KA 2VMGA 1MZ5A 3J9SA 3OJBA 2XLAA 3AJYA 4LEJA 3NMBA 3RZGA 3VBUA 2JECA 2RDSA 1UF2C 5IHRA 3U07A 1ZX5A 2DCTA 3IIIA 4JX0A 4B29A 1W99A 2VZUA 2A1XA 3C7HA 1X82A 3T4HB 5LEJA 3O7OA 3OB8A 3QLQA 3ZXKA 1LOFC 4QQHA 1JXNA 4QWNA 1K5MA 2BRTA 4CDWB 1YQ5A 4YARA 4QDSA 3ZXGA 1YHFA 4AEDC 4EN8B 4TN7A 5K8SA 4UOJA 1IS4A 3P1IA 3AXEA 1YFWA 2YBSA 4FOQA 3DN7A 4UXAA 1VPHA 3VZMA 3CBNA 2VUDA 4MGZE 4DOUA 1LODA 1F4AA 4Z2WA 4RQPB 2Q30A 2XXZA 1HW5A 4YVSC 5C8CA 1GQGA 2ILMA 1I5ZA 1R093 3KVBA 1JOBA 2VNOA 3DECA 3DYOA 2XONA 3DF0A 5FLIA 3KHBA 4M0NA 3UGHA 1O5UA 3OSDA 2A6XA 4F7ZA 2EXHA 2DU0A 2WNUB 3ALQA 1LOBA 3PIJA 1GANA 1N1YA 1NCQB 3NO8A 4OI2A 3NKGA 2WZEA 4XACA 4HSLA 2CDOA 1PGL1 4N53C 5KC6A 5LBFA 3FLTA 3KGZA 1UWWA 1YUDA 2JXAA 3BB6A 1IPJA 1WKYA 2BGOA 2DVAA 2BERA 3M70A 3OBTA 5B4XA 5HBAA 3ASIA 2EAKA 3A4UA 4QQOA 5EFUA 3ZN5A 2QFEA 1RJ7A 3BN6A 3IPVB 3PUIA 4QQLA 1NE4A 5D2AA 5BUVA 1RUOA 3R4UA 4LBNA 1ENXA 3U75A 2FDIA 1LOAA 4BK4A 1WZXA 1WCDJ 4R52A 1RUD3 1ZYBA 2D6MA 3BALA 1F8VA 1MEC1 1XJAA 3HNMA 2Q8EA 5K0UC 1OUSA 4LR4A 2B46X 2JENA 2HJIA 4UWDA 1S0GA 3U1XA 4BISA 4CYDA 2XH6A 4QPGA 4EN0A 1S2BA 4ZXKA 3ZYIB 2OUJA 4JHTA 1H9WA 4FI9A 1K42A 3ZFEA 2ZKLA 4JGYB 5C3OA 3DUIA 5A3MA 4CU8A 4JQTA 5FBZA 1LU2A 2AACA 1ENSA 3KT7A 2VQUA 1QJU1 2XHKA 2X5IB 1M06G 3TB0A 5BNNB 1AX0A 2XWBB 1OOPA 4B1MA 5FMCA 4W6YA 3LCPA 4UW4A 2PXJA 3WDTA 3T4VA 4XIKA 1HV0A 1RUE3 1HRI1 4CE8A 4PDWB 4Q4V2 1JBCA 1NT0A 3A23A 3HN3A 4CDWA 3SEPA 3TNPB 5T3NA 3WQ7A 3HWJA 2K46A 1CONA 4LULA 1N1TA 3DYPA 4HZFA 2P2KA 1KXGA 1RUJ2 4INDA 1LNSA 4GH4B 4I3PA 1ND2C 3J4UH 5DDJ2 1UY4A 3GALA 4YFWA 2QQLA 4C91A 3DXTA 1SLIA 3VB9A 1F2NA 1NZIA 2OKXA 1JZ3A 1YYNA 3T0DA 2BW8A 1FV2A 2ZX3A 3BPZA 2BNMA 4QQ2A 2Q4SA 5ACA3 3U10A 1CAWA 2VTFA 3LDBA 2WNOA 3AMNA 4KQ7A 1RUG1 4QKNA 4LA2A 3NW4A 3A0NA 3WZ1A 1GQHA 4E2SA 4KU8A 5L7OA 3J7HA 2JKBA 3M4FA 3LF7A 5LCWL 3VBHA 2VVEA 2A73B 1OH3A 2O1QA 4Q26A 3TEZA 3M3OA 5JOWA 1FI2A 1CQ9A 1R1A1 3OGJA 3ZFFB 2VZPA 1V9U1 5FXVA 5FZOA 2GC1A 4UW6A 3WNLA 3I49A 5K4LA 2VJXA 5FYCA 1W8WA 1IKPA 1G9BA 4AFAA 4XTPA 5DPNA 2EA7A 2EVXA 4IEXA 2LW8A 3SITA 3IN9A 1FV3A 2E26A 1XSQA 2D6LX 2ZZJA 1X36A 3AP6A 4IV1B 2W92A 4TLFA 5J36A 3I3QA 4RD7A 1AR82 2LS6A 5JIAA 3TN93 3UJQA 3W5MA 4J1WA 1E5RA 4XHXA 3IMMA 5DUXA 4LT5A 1VBD2 2DVBA 5IVEA 3CJXA 3OPZA 3VZLA 2C6SA 4GKXA 1FX5A 5C5TA 2XVKA 3PVBB 4OCTA 1YI9A 2D43A 5F6KA 4K9SA 2FDFA 2YHJA 2JB4A 4E27A 4BJ0A 4D94A 5A7QA 4AHZA 1AYN2 1W03A 2W9XA 3WG1A 5IATA 2JWPA 4AFBA 1AR81 4LKFA 4GJYA 2VVDA 5CB7A 4K3UA 5DMYA 1OLQA 1W9SA 2NMNA 2AZ5A 4J1XA 2QNKA 3LDKA 1OD5A 4CPBA 1LHOA 4Y1VA 3LA2A 4CCNA 3RYPA 4CP2A 5J48A 5FO8B 3WP3A 3N35A 4BPZA 1JH5A 1YO8A 3WNKA 2PELA 2W1SA 4U2AA 3SCFA 1CX1A 1RHI3 4HT1T 4OI1A 2N7GA 3QBQA 3HBZA 4IE5A 5FZBA 4HMZA 2ADEA 3ZYBA 5CKQA 3U11A 5IVJA 3ZKUA 3EB7A 3M2MA 1RXGA 1POV3 1ZNPA 4FFIA 4OFGA 2EXKA 1E5SA 3J7LA 5I93A 1RUD1 4E2GA 1RVF1 3GYDA 3PUHA 1ZRRA 1C4RA 1ULEA 5L9VA 5EYYA 4UFHA 3ZVXA 2WC2A 4QXCA 2VTXJ 1AX1A 3NV1A 1X50A 5KXCA 4AQSA 3ZLIA 3GZAA 4EQVA 1LULA 2RE9A 2JG8C 1B09A 3IDBB 2ZGKA 1NX9A 4GH4C 5K7PA 1Q8SA 4ZS3A 3KVAA 5BXXA 1UOGA 1Z7S3 5J1XA 4NIHA 3VBOC 5C3SA 2B45X 5C33A 3T3YA 1Y9QA 2PFWA 2WO1A 3VHRA 3ZYHA 4D69A 4YVWC 1RINA 2QDRA 3LPGA 4JCKA 1UL9A 2BZDA 1HRI2 4NROA 3UK9A 1L7RA 1XRUA 2DVGA 3LSEA 3O14A 2JJ6A 4SLIA 4B4PA 2NZ9A 3MIFA 3C2UA 1XNDA 3LWCA 2QKDA 3N7MA 3C8XA 3IDEA 4AVVA 1S0FA 3AZYA 2XJRA 3K77A 2WFPA 3KB5A 4QB6A 3THCA 2WAOA 4XFIA 4UI9L 4BQYA 4CEWA 2NQYA 2W87A 1S55A 2D7FA 4LITA 4N9HA 5I8YA 3ZN6B 1T6GC 1AL22 1KITA 2WZR1 1FAYA 1FYUA 3OGVA 1GP4A 3POFA 3WNMA 3OUJA 1JZ2A 5DG1A 3AL5A 3FJSA 2F6BA 1ZM1A 3JXSA 3MUY1 4DRRA 5DAVA 1WA4A 3WF2A 3FLPA 4MADA 3KD4A 5LK5A 2BP6A 5HCBA 5I0TA 1Q3EA 1CZSA 1DGWA 2W52A 3GNEA 1VBB1 1Z7S1 2R6QA 2R1DA 4AXOA 4BXFA 1MQTA 3EJKA 1RUD2 4MYEA 5JSRA 5ERLA 3BYWA 4ET7A 5FKCA 1QJEA 2V5YA 2GP5A 1IQAA 3CZUA 3GZUC 3MUZ1 2HYKA 4Q8KA 2IUWA 2WS91 4G4FA 4UFIA 5FZDA 2PHXA 2BNNA 2ZCWA 4DEQA 4Q4Y1 3VBFB 4XFGA 3T1MA 4QD2A 4DS0A 4CUCA 2WKKA 2B9VA 2WYSA 1PGW2 2E7TA 3D0JA 1SDDB 5F3GA 1HQWA 1OFSA 3VV1A 1W9FA 4AW7A 2HEVF 1H1IA 1HV1A 2R043 3MBWA 4RSUA 3H8UA 3LEKA 3THTA 2VAUA 2ET1A 5I0UA 3WF1A 4RL7A 1XE7A 4CP1A 5C5UA 4QDQA 2YMZA 5EYXA 4UW3A 1H9PA 2ES3A 3VBOB 3KV5A 1WBFA 2XWJB 4HLTA 3O1PA 2NLRA 5J98B 1GOFA 3PVNA 1VBB3 3O1MA 3E6DA 4LIVA 4XXPA 5T5LA 1YFYA 5TSWA 2D97A 5AC92 1BEV3 2WO7A 1KFUL 2AENA 2GAUA 1GZWB 1PO12 3GZEA 4LO4B 1UX6A 4Y22A 3I3DA 1OHFA 2VE1A 1HRV1 5JXIA 3AYEA 5BNQA 5CVRA 2VW1A 3HQXA 3ACGA 3LFIA 4P9XA 4BQ4A 2XOMA 3SH5A 1JUHA 3GGLA 4E4HA 1ONAA 5GLVA 3VDDC 2MEV1 4YW7A 3S7IA 3RYRA 2RR13 1OMIA 3MHZA 3AMPA 5FPAA 1N3PA 1US2A 2CNAA 1ZRCA 4WV8A 3E5QA 4IV1A 4QM8A 1ACCA 3HT2A 1XU1A 2J1SA 2J42A 2XKPA 3CNAA 1H4HA 1ZRFA 2QQPA 2QDNA 1A8MA 2R042 4D6QA 4Q0PA 5E16A 3ECQA 4P5HA 1YJLA 4BM8A 5LK7B 3NKTA 3RZMA 3W58A 4BU2A 2P17A 4TXWA 3ZSMA 5LRSA 1J83A 3H7YA 2J1AA 1IPSA 4NPRA 1CAXA 4Y20A 3ZKYA 3FHIB 4RFT0 1YQ8A 4TYSA 5FYYA 1LTEA 2YC4A 3ILFA 2CWMA 1W8TA 5DUWA 4YVSB 5APAA 3DEMA 1VMFA 4HFSA 1WLDA 4I0AA 3LIGA 1QJFA 2LUWA 3VD7A 1RUC3 1WMFA 1MS0A 4EWAA 5C3QA 4OHXA 4BQWA 2AYHA 4LO7A 1OVSA 4RR3B 1Q5OA 2W5FA 1FNYA 2RMU1 2PHFA 4IE6A 4GH4A 4H7LA 4R9BA 5ANNA 5A32B 2QTWB 3RMYA 1D7PM 4HKLA 2ZX0A 4FOWA 4JDNA 1OFNA 1V6IA 4Q4X2 2XQRA 4XMIA 4AVCA 4CXWA 4LJHA 2WFF3 1PGSA 2GZWA 2WNEA 2O14A 1DHKB 1OA3A 5C71A 4RN5A 3THDA 2VZTA 4LIUA 5DAXA 3LDRA 1FT9A 4IUGA 1JYNA 4DPNA 2ORXA 2RG4A 3BI3A 1QDCA 3RQ0A 4NOTA 3UKNA 5FJKA 2KR2A 4QMAA 4DY5A 3BTAA 3H7JA 3SH4A 3PTRB 1SLAA 2G9FA 3AVRA 3WV6A 1ZVFA 5LBEA 3Q9OA 5CAZA 4G3YC 3RVHA 1UOFA 3ZSLA 5HPOA 4CDWC 5EXOA 4I09A 3VDDB 3WW1A 5BNOC 5A3UA 2JDPA 4LHNA 4Y1XA 4YW4A 1W9TA 2ZGQA 1LGNA 2A3YA 3I2HA 3FFZA 4G9SB 3E97A 1B35A 1VAKA 5DDJ3 1K3IA 2RMU2 2VOVA 2UYBA 5HI0A 1L3JA 4GULA 2WO2A 2LTNA 3HEIA 4A3ZA 1CAUB 3BU7A 3ZFEB 3LAGA 4ZXEA 1QHDA 2Y6JA 1RUI3 2QVSB 3MGUA 4CCMA 4UBHA 1TMF3 3FBMA 1PM4A 4CP0A 4W50A 3KQRA 4GAZA 2XL9A 1DLCA 1NLRA 1VIWB 2A75A 4IE0A 4XCAA 3IBMA 5DAQA 4B7EA 1QMJA 4O9EA 1JYVA 1JW6A 5F32A 1HB3A 3F95A 1WCSA 5J7MA 4R8HA 2BVVA 1QJX1 4XUNA 1BLZA 4CPBD 2Y6LA 2P3IA 2LROA 1EUTA 2VTXA 4FPYA 2AEZA 4KMQA 1F31A 3N36A 4LBOA 4COWA 4CVUA 5BNOA 2R041 2BTVC 1UU4A 1IQDC 3RFRA 2WNUA 3WDXA 3WNXA 1W6NB 1H2NA 5FZ0A 1BMV2 3AP7A 3ZXDA 1CPNA 1GV9A 2VCBA 1KQRA 4FOYA 4V1PA 5IYYA 2HWC1 4FQ4A 5FY0A 1SCRA 1G9CA 3MDPA 3C7FA 5FMOL 4PCRA 4YGEA 2A3WA 1OI6A 3WNPA 2FDGA 2G9ZA 2VNVA 1VB4A 2FHRA 3VBRC 1W8NA 2XL7A 4TLGA 3MLJA 4A42A 1APNA 1IOAA 4QX3A 3LEIA 5FK7A 3OY8B 2B39A 2DTWA 4RQPA 5FMBA 1Y4WA 4NIAA 4LHSA 4O9GA 4WM8C 5T54A 5JI9A 1HX6A 4PI2A 2ZEXA 3DKWA 1AR91 2FZ1A 3ST7A 4XUPA 2YFZA 3AX4A 2A7AA 3GM8A 5F3EA 5FTTC 1F4HA 1VB2A 3RGBA 3ZYJB 4BLIA 4MG2A 1I3HA 1UIKA 2BGPA 4CCLA 5FXZA 4EZ4A 4MGTA 1UPIA 4BQ2A 1ZZ8A 1Y9GA 2BBAA 3I3EA 3TWIA 1OOPB 1K5MB 5EWSA 1RMU1 2G9GA 2V73A 1LEMA 4GQ7A 3ABZA 2BBVA 1W9WA 4XFBA 5L9RA 4MOAA 2R7EB 1LOCA 1AHSA 2RR12 1N1SA 1N47A 3O12A 4DO0A 1JZ4A 2CSGA 1JU4A 3BCWA 3RYKA 2I07B 4YRDA 4Q4W3 4DUWA 3PVEA 5LA2A 1O8PA 5FY7A 2GMMA 2VM9A 2XLFA 4H55A 5E1RA 4OHZA 3T09A 4GMP1 2JX9A 1S0EA 1UY0A 1UIJA 3CO2A 3FMGA 3UL2A 3D82A 1VAVA 5A7OA 3M7AA 1OPOA 5A6XA 1JU3A 1POV1 1UXXX 1VBC2 3O0WA 1BEV2 2QQVA 3AL6A 4I02A 4YG3A 3LGRA 4QPIA 4B3NA 2GNDA 4KBBA 1LKNA 4LBKA 3Q8FA 1VBB2 2W1UA 1NQJA 4NHMA 3SCHA 1JYIA 1AYM1 2OPKA 1PX3A 4XF9A 3MFCA 3DPRA 4QPYA 1VR3A 3BIWE 4XQWA 1TG7A 1QQP3 4BE3A 1O91A 3AZXA 1H1AA 4NO4A 1XC6A 2ET7A 1HJFA 4ZS2A 2PMWB 3FWEA 5FKBA 4JDMA 4KGQA 5HCFA 4PLMA 5GZFA 2VCMA 4PQ9A 1D0HA 1H0BA 4AGVA 3J7NA 1C1LA 2VVFA 4PIYA 1DQ1A 4GZ9A 1E5IA 4LO6B 4WVMB 2AUYA 4Q4W1 4NHYA 2VZ3A 4PT6A 3BIEA 4CP9B 1PIV1 1UU6A 4AR2A 3OYWB 4KWUA 3D6EA 2I45A 1BVP1 5CNAA 3E6CC 1NKGA 1AJOA 1DQ0A 4OUSA 1W05A 1W2TA 4FQZA 3T0BA 1POV0 3LA3A 4QPIC 2GNTA 2YBKA 3NJZA 3OCPA 3OOXA 5I0RA 4CUAA 2OPWA 1C8M1 1AR61 2GU9A 3NSTA 3T2QA 1RUH2 1SBDA 4ZZ8A 1S4CA 4ISQA 1SEFA 1LCLA 4DXZA 3ZDVA 3H0OA 5JMCA 3FUQA 5FZ6A 2QQJA 3VD5A 1FXZA 2P3JA 4KWKA 2Y6KA 3UKVA 1MQTC 1QNYA 3SC7X 4YW2A 1VBE2 1O59A 2E7QA 1BHGA 4MGYE 1CESA 5D8AB 3FBYA 5FV3A 5M0TA 5FXXA 4LE4A 3W5NA 1S0CA 2ZA9A 5FIXA 2JDYA 1KS5A 3NVCA 4RHV1 3VKNA 5A32A 2XPJA 2WIIB 1WCUA 2J7MA 2ORZA 1HRI3 1HIXA 1QDOA 1FMD2 2XJUA 3OG2A 4UFLA 5FJHA 5FP9A 1VBA1 3I59A 5FBJA 3VBSB 4AGRA 5CISA 3R4SA 4JDOA 2X29A 3BTYA 1U5XA 1UZ0A 1AR63 5LY2A 2YU1A 2CAVA 4QX1A 3J7MA 4ZU4A 2PAKA 5LATA 5GZCA 5JXJA 3ZDSA 3KCCA 2WZ8A 4U36A 1REEA 4YGCA 3GBFA 4COVA 1PZ7A 2CAUA 1K5MC 5JCTA 1ULGA 1SLCA 1FPN1 2HWB3 5FPXA 5FUPA 1W6QB 4CDQA 1SLTA 1AYN1 2VOXA 4MO3M 1GP6A 2XJVA 5C7GA 1WWYA 4AI2A 4LBMA 4Q8LA 5FR3A 5T55A 5KBFA 4IESA 1W8ZA 4BOWA 5IJRA 3VKOA 1C1FA 2R0HA 3V56A 5CFCA 3R6SA 3NV3A 5IFTA 2ZTNA 1NLQA 4I0BA 4XABA 2VULA 2WAAA 3AYAA 1R1A3 4M3CE 4YW5A 5BYNA 3KS7A 3KHCA 4FPOB 2A6WA 1XNTA 1COV2 2HWB2 4WVZA 5FPBA 1DGWX 4BIOA 4BZ4A 1MS1A 3CU7A 4D8MA 5FO7B 3V64A 5JZGB 3OY8A 5FZFA 3WQ0A 1GZCA 3QCWA 2YB7A 2GN7A 1GZ9A 1IS6A 1LESA 3I2FA 5IVBA 5K9YA 1JODA 3A22A 4Z07A 2DWRA 4CSWA 2P5BA 3WINE 1Q56A 1XYOA 1AYN3 3W9AA 4EWDA 1EV11 2K0GA 4XW3A 5A7NA 2VXRA 3WCRA 1DYOA 3OGGA 5F7UA 5FOBB 2VOTA 1S0BA 3ZFFC 1K45A 4LO5B 2RS33 5FQ0A 1F15A 4CDXB 1KJLA 1UOBA 4E8DA 1BK1A 3PJQA 4N43B 3WQ1A 4NR1A 1FPN2 4K21A 1AYM3 1CR7A 3GJAA 1J1TA 3DCQA 5EJ3A 4CUGA 3DPRC 2C0ZA 2K2SA 4BH9A 5CFDB 2GDFA 1OPMA 4FO9A 3VBFC 3WX5A 3N9LA 2XLGA 4N7UA 3NRUA 3LIHA 4COYA 2WA4A 5CIRA 3I2KA 4ZKTB 1KDKA 3JB8A 1RUJ1 2WFF1 4QPWA 2IWGB 4FPFA 4LBQA 1TNRA 2Y0IA 2D5HA 1VBA2 4QU1A 5LEKA 2XMLA 3AZZA 3ETQA 1QY4A 5F39A 3VZNA 1QH6A 1YRZA 4FFGA 2OS2A 4Q4V1 4RHV2 4AI8A 4LTAA 1JI6A 3AKQA 5FAXA 5JZGA 1DIWA 5A6QA 2CL2A 3ZMNA 2ZMKA 2UY8A 1PNFA 4K1ZA 2HBTA 2ZEZA 3UNPA 1RUNA 5FUNA 2P6HA 4UFJA 1W6OA 3AZWA 3VL9A 2QQWA 5IK4A 5GM0A 2ARAA 4Q1RA 2AR6A 3Q8BA 4YYOA 5KXDA 3NAPC 5JDBA 3MYXA 3B69A 4DZGA 1PX4A 1MZFA 1OSGA 5H9QA 1RUH1 3JBG1 4IW3A 2I74A 1MACA 5A33A 5FOJB 3TBDA 5ABJB 2WSVA 4FXGB 4GALA 5C9AA 1GNZA 1RUJ3 1UX7A 1SPPA 1LEDA 1MR5A 3E6BA 4DMIA 4I01A 1DQ6A 4JRLA 2PN5A 4A7ZA 2XUMA 5FYSA 1ND3C 2J1UA 1NUKA 5G04L 1YQCA 1W06A 3ZXEA 2B9UA 4B8EA 1Q8PA 2F4LA 4FT8A 5B2GB 1V9U3 3S5AA 1FOD2 1S2KA 2NYYA 4JRAA 5IW0A 4CCOA 3WY6A 1LOEA 3RI9A 4ZONA 4PJYA 5L36A 4EN6B 1PGL2 4BCUA 3H1WA 3TEYA 1TE1B 1PVC1 1DQ2A 1QWRA 4IV3C 3HVDA 2R1BA 1DDLA 2Y33A 3WW4A 3LQCA 5FY8A 3WUCA 5GLUA 4IGPA 4IEZA 2OYZA 4LK7A 4DXTA 1QIQA 3AYDA 1FNZA 4HN1A 5EJZB 4CDQC 5KWRA 2FDJA 1IKQA 2GSYA 2E9QA 3VBRA 4AAXA 1NZCA 4IXLA 3ZPOA 4HANA 4DB5A 2GH2A 5FP8A 3RNSA 1BXHA 2C4XA 3AXDA 3V65A 3CLPA 2BOIA 1GBGA 2FCVA 3B5LB 2VH9A 3D4KA 4LUKA 4QXBA 4RS5A 4ZPIA 3RJRA 1P8JA 2EF6A 2W3JA 5GLZA 1YFXA 2QQOA 2H0VA 2F4PA 2GP3A 2WN3A 3MEPA 3LFMA 1W6MB 4P00B 5D21A 4CCEA 3CMGA 1V6KA 5T52A 2W39A 1VRBA 3W59A 5FYTA 1OLME 2OQ7A 4FCAA 1Q8OA 3SKJE 2XUEA 1PK6C 2VMFA 4M4PA 5JLVA 2VUCA 5KHKA 4WVWA 4LBQB 3POSA 1LOFA 2VMIA 4BQ3A 2QZ2A 2PLV2 4M01A 4OI0A 2R0FA 1COV3 4K1YA 2VQ0A 4JQRA 4Y5SA 3BTXA 2WWSA 4QHOA 5LASA 5BV6A 5FCCA 1W6MA 1WUVA 1AR92 3WD5A 1ASJ1 2A5ZA 2Y8KA 4NIDA 4YZ4A 2X5IC 5C4WA 3PJYA 3K75B 1OF3A 1TME1 1ULFA 4AVSA 4QDRA 3UGGA 1PMIA 3IPVA 3MW4A 3WHTA 4PBPA 2UY9A 1BKZA 1RUI2 4CU6A 1S0IA 1O3TA 3PMSA 2D3PA 3ZR6A 2YC0A 1UZVA 5K0UA 2Y6HA 3U4SA 2Q0AA 3O0XA 3VBFA 1US3A 1H8VA 3JUUA 3GHMA 2W1WA 3JD71 1JMUB 4XUTA 5DZFA 2EIBA 4AI1A 2Q1FA 5T50A 1R64A 1ZZ9A 4KG8A 1LAJA 3RI8A 3NNMA 4LE3A 4XIOA 1MQTB 1QJY3 5IWFA 4YVSA 4AI3A 1QNWA 1RXFA 3GXUA 4H7MA 2CU5A 5L73A 5E8AA 1GFF2 1RUF1 4SBVA 1CX4A 2P6CA 2R16A 2XHNA 4Y5Z0 2OVUA 2WABA 1REFA 3O1VA 4XQ4A 3D3AA 1H2KA 4A44A 1BBT2 4D6RA 1HB1A 1DGLA 3HOBA 4P08A 4NPLA 3ZFGA 2ZBJA 1CAVA 1SFYA 4XF3A 1W3XA 3K3OA 1UKRA 4PIZA 4WM8B 4CCKA 2BEOA 1CZTA 2K9ZA 2LRPA 4BB3A 3GBGA 1TZOA 3HJRA 1LOGA 5A33B 1J3QA 1D4M3 3VKLA 1NA1C 4EZHA 4DXSA 2RVAA 1QJU3 5LWBA 4Q0UA 2ZKNA 1OF4A 5HXVA 4OHVA 1JZ6A 1O6UA 2VU9A 4N53B 1JZ7A 1RUF3 2DUQA 4ZU5A 2IVJA 3ZYGA 4LORA 2RS32 3BVCA 1C5IA 4QX8A 3ZOIA 1O3RA 3SXWA 2HYXA 1YQ6A 2VCAA 4V2VA 1BBT1 3OEBA 4QB1A 4LNVA 3CKHA 4HK8A 5BNNC 4JGYA 4WM7C 2D93A 4NIGA 1UQXA 2PHTA 2VGDA 2YUEA 5JR2A 2WWJA 2R061 3OBAA 2L9LA 2JKXA 2I2SA 4Y26A 5LA9A 3ZIXA 5FZIA 3WDYA 4IV3A 1V0AA 2GMPA 1IG3A 4YWAA 1DQ4A 4KWLA 4CUBA 3OEAA 4Q4X1 1JS9A 2EIEA 5D8AA 5LBBA 1OKQA 3D8CA 5AVPA 2DUOA 2Y6FA 1G9DA 4OMDA 2C1FA 4XMAA 5ACA1 2FDKA 2B7YA 2JD4A 3TNQA 3KM5A 5A1FA 4CXYA 2EAAA 4XDPA 4XQDA 4IETA 1RUI1 1CJPA 1UAIA 1W8OA 2VY0A 4X6QB 2NPIA 2W08A 5KXBA 1W6PA 2XVGA 3VDCA 4DXRA 1TME2 3P6BA 2TUNA 1PO13 1W8FA 4AEKA 5C3RA 2DCJA 1O4YA 2XBO3 1TQ5A 5KHHA 3SKVA 2DCKA 1XYNA 3B3QE 1PO22 1ODMA 3I3BA 2VQTA 3VLBB 2AC1A 4GWMA 3J26N 4R4ZA 3UGFA 3L9JT 2WNUC 4LO8A 2VNRA 3I7DA 5C6CA 1ZZCA 2VBPA 1ST8A 1DF0A 1GWMA 1PK6A 3ATGA 3IB3A 1DP0A 4M4RA 4RGGA 5F5CA 2YPJA 3BKZA 3ZN6A 2JB8A 3VUOA 1YIPA 3AZVA 4LUMA 3SQOA 3TN91 3B01A 4NAOA 3S57A 3HN1A 5EJ1B 4GB31 3AFGA 4P9JA 4OMCA 1HXS3 3WF0A 4MVTA 5JSOA 1EP0A 2ZMNA 2YY1A 1DGRA 1BJQA 3FE5A 1AUYA 1NE6A 1OKOA 2E63A 3RZZA 4FAHA 1XBFA 2OQ6A 1GU3A 2VMHA 2WINB 1WGPA 5FZCA 4XURA 4XCBA 1F5JA 1G9AA 4ITCA 2RM21 4WZCA 2OW4A 1UMZA 4F83A 3HMYA 1AR72 3ZXAC 4C90A 5FP4A 5FZOB 1UMHA 4IEWA 4TTGA 3K48A 2P34A 1V6LA 4LKDA 2Z69A 2XQXA 5JIUA 4HOOA 3ZYFA 1JYWA 1QXPA 1LHVA 2YG0A 1AXKA 2RJKA 1EY2A 3LE0A 1LGBA 1XNCA 3WG2A 5KHJA 1O4TA 4XFCA 3NNGA 1I1EA 1RHI1 3MF9A 2XDVA 1N1VA 2WT2A 4JKLA 4N53A 5CKNA 2LALA 3IT8A 1A3KA 5FY9A 4YLZA 2W95A 4ASMB 4QXHA 1DZTA 1UOJA 4AL9A 4E4DX 5CA6A 2X8KA 4JKMA 2WS92 3Q8EA 4NWWA 4R9CA 1G8WA 1SQ4A 2ZAHA 1TMF2 1JOPA 1W2UA 1PVXA 2DBNA 3FZ3A 4HKWA 4LOSA 4PI0A 4PIXA 5FZAA 1ALYA 1DU3D 4QQPA 1MZEA 4W6XA 4DRVA 3EBRA 3WW2A 1Z7S2 2CDPA 1SHWB 4S2FA 5BPXA 3BODA 3INAA 3WUDA 3LD8A 1S2EA 3POEA 4IQPA 3ILRA 3K51A 3KCYA 4IGOA 1UXZA 2A6YA 4YZ2A 3BOWA 5JZGC 2YC2A 1VALA 2CV6A 2ZGPA 4MZUA 2JIGA 4I3GA 1ULPA 5EQUA 3WF4A 2EXIA 1C3HA 1YFUA 1AXZA 2A70A 5FZGA 3RPQA 5FPVA 1JOJA 1TMF1 4C0HA 4XAEA 4BQ1A 4QAWA 3IKWA 3ZIWA 2GNMA 1SMVA 3K4ZA 5JVVA 2YYOA 1HN1A 4NN0A 4AK3A 1VBC3 5FZ7A 3H1MA 4YVWB 2JEMA 4FFHA 3SISA 1IG0A 1UZZA 1E57A 1TVGA 3AKPA 4M3CF 2NMOA 1H30A 2WNVC 5CFDA 2DVDA 3WP4A 2RS52 5CG8A 1RHI2 4CDUB 5DABA 3I2OA 2CGPA 1W6PB 1H6XA 1EAH2 1UYXA 5FRAA 4Q4W2 3VZKA 2WZR3 1C5HA 1WD4A 2ZMLA 4Q4X3 2HEWF 4IEPA 3WCSA 2KA3A 3LPFA 1PVC3 3C3VA 1PHMA 4S2HA 1U5IA 1X9TA 4W4ZA 3WG4A 3V0AB 1XE0A 4QGLA 4AAPA 1CGPA 1ZREA 1WW7A 4E2QA 1AR71 1NCRA 1LU1A 4DFSA 4ARYA 1RIRA 3N4MA 3DPRB 1AYM2 3ROUA 3PTYA 4CDUA 1CD3G 3RZLA 1YWKA 3SMHA 4A3XA 2ZGOA 3WG3A 5LA1A 3CZJA 3KGLA 2OT7A 2ZS6B 3H3LA 1B35B 1ZBE1 3NNFA 4MH0E 4RQPC 4BWOA 4B4QA 1HDKA 1VBC1 3NJYA 2XBO1 2RM22 3VBHB 5FLJA 1WA6X 4M0HA 5J37A 1EV12 4BQ5A 1OVPA 1Z0HA 3T2PA 4C8DA 1GNYA 1JHJA 3TN92 1REDA 5H9SA 5C8WA 1R091 1DCSA 1S0JA 3JQXA 5FDBA 1KD7A 1UPSA 4AFCA 1K12A 5I0SA 4XVHA 4CZSA 1Y43B 3VDDA 1UY2A 2ERFA 3NV2A 3PU3A 4YFZA 4LKSA 2Z5WA 2OXBA 3OTFA 4Q0SA 1SCSA 2HWE1 1OURA 3GF6A 4XFFA 3OPWA 4UAPA 3ZXJA 2ZZQA 4CCDA 2GC0A 5CG9A 1F9KA 4CU7A 3O1TA 3ILNA 1W2NA 5CBLA 3CJIC 4OZXA 1WLWA 3L2HA 2YV8A 1ZBA2 3AP9A 3ES1A 3PL0A 3T08A 3FC0A 5C70A 2YPDA 2FMYA 4LMFA 1ZBE3 1UY1A 1UYPA 1KRIA 2X5IA 5C4WC 3EO6A 1HQNA 3FUOA 4Z1VA 4N43C 1MEC3 2HWD2 4TZDA 4CDXC 1CIWA 3Q8AA 4KI5M 5ACA2 1YQ2A 3G7DA 3K3NA 5JUVA 2Q8OA 4C1XA 3KF3A 3N7KA 3WW3A 2IXKA 5BNOB 4ES8A 3PHMA 5AFEA 2Y38A 4XETA 4QPGB 2YXSA 2O0OA 2HWF1 4Y20B 4JGZC 5JAXA 1X33A 2CY6A 2WDBA 4LXLA 3O1UA 1XOYA 2Z4FA 4OVEA 3WVJA 1ZRIA 4N90A 1NCRB 3N9OA 2VMEA 3LSDA 1VLNA 5FYBA 2W46A 5ANQA 2RS12 4CEYC 4LK6A 3KT1A 2IXLA 3BGAA 2R49A 4ARXA 1KGYA 1J3RA 4XPVA 2ZGUA 5F2SA 5FY5A 2VG9A 1POQA 1O4ZA 3HPNA 5EPAA 5A3LA 2QCSB 1E5HA 2IZWA 3X29B 4QT6A 4F3JA 3CEWA 5E6HA 3UKTA 4OQ8A 5GJ6A 4GWJA 3VKMA 3M3QA 5EHDA 1C8M3 3K4DA 3N9PA 1OLRA 3OGRA 1S1AA 3I3MA 1NXD1 1LJ7A 1TNFA 4XBLA 3HR9A 2JG9B 3B00A 3HBKA 5LA0A 2NP0A 1OUXA 5FLHA 1ULDA 1PK6B 3KV6A 3KMHA 2HWF3 4UYBA 4FPCA 4MGSA 2WLPA 3E1F1 4Y22B 4MHUA 1W8UA 1RUG3 5FP7A 5FY4A 5T5JA 4W65A 1K5JA 1YJKA 3VBOA 3CQOA 4AFMA 4C1WA 1NOVA 2ARCA 4ONUA 4S2GA 2XR4A 2ID4A 4KL1A 4DUXA 3IMNA 3MLKA 3TEWA 1GYKA 3WP5A 5FUIA 3WNNA 1DLLA 4Q1PA 2ARBA 2QQUA 2JICA 1X9PA 3AMQA 2BWCA 5IAVA 3P3NA 4MXWB 1YXWA 1WW4A 2RS11 2RDNA 2YGLA 3WT3A 3ZSJA 2BYVE 4CEWC 4ZZ5A 1VAMA 4Z82A 3JD72 2C26A 4P9LA 3U37A 4E4SA 2W47A 3I54A 1BCXA 5DN2A 2UWAA 3VBUC 4AVTA 3MPBA 1DYKA 3NAPA 1U12A 4XJZA 5D8AC 1HKDA 4FFFA 4WM7B 3RS6A 1BVVA 1SG3A 5DG2A 2RJ2A 2JDAA 2BU9A 4LBLA 1GKBA 5HXMA 5JXGA 1NCRC 2WO3A 1Y7BA 3NNLA 1MS8A 3VHPA 5FMDA 3SEEA 4Q0VA 4OI4A 1V6OA 3RJ2X 1URXA 1GMMA 2RJLA 1CAXB 4YW3A 5CYYA 4Y5TA 4CTEA 2JDHA 2DVFA 1NY71 2EIDA 3CHXA 4R4XA 3FN9A 1HB4A 2Q8CA 2VUJA 2J22A 4NRQA 2DURA 3T30A 1ZBA3 3JB4C 4N7IA 4XF1A 4NIIA 5F5AA 4MGQA 1W0OA 4EJRA 2R072 2JDUA 5AC93 3ZXFA 3MIEA 2PQSA 1LRHA 2J1RA 3S0MA 4NVPA 3GBWA 2GH8A 5FZKA 1VRH2 4YG0A 4NMIA 1MVQA 3ZXLA 2HWE2 2H0BA 2H6BA 1WLCA 5IAXA 3MW3A 2D6OX 1VRH1 2G4IA 2WQZC 3OPTA 3T0AA 1W3VA 1A8DA 5FY1A 3M1HA 4NHXA 1ENRA 1SZBA 2R32A 1GUIA 1F35A 1WW6A 3R05A 1ULCA 2JE8A 5A3TA 2J1VA 2MEV2 1EV13 1KDMA 4L2NA 4IGQA 1NY72 4AEJA 1W04A 4GMP3 1HRV2 1VBD3 2V5DA 3ZYRA 5DUUA 5EV7A 3EXUA 2XVLA 1HN0A 1YNAA 1KS4A 1XNBA 1OH4A 1GWKA 1O3QA 5LW9A 3AB0A 5GLWA 1H4GA 4ASKA 3BOPA 5A70A 3N7LA 2MNGA 3MIBA 1OLMA 1DQ5A 3S30A 1DG6A 4KWJA 4QPGC 4Y1YA 2VZQA 5IK7A 2VQAA 1PVC2 4Y1UA 4JGZA 1VRH3 1LGCA 1PM7A 2A6ZA 3OD4A 4K40A 5FYZA 5A3OA 3QH7A 5IVVA 4XE9A 4GKYA 5LB6A 4XEZA 3PIGA 2E31A 1ENQA 4GA9A 4AGGA 1V00A 2BDRA 4R9AA 2RS53 2VCCA 4KU7A 1T2XA 5BNPC 5C4WB 1SDWA 1SFNA 3IDAA 3ES4A 2JDZA 1QJX2 1Q43A 2E7AA 2WA3A 4M00A 4IEUA 1ASJ3 4MXWA 3HQUA 4UFKA 3OBZA 4NPMA 2X09A 1GOHA 5GZEA 1I5PA 4GWIA 4HG6B 3IAQA 3MV11 2D3RA 3JQWA 3LKJA 5A6ZA 3MV01 3JBG2 2ZX1A 2IXHA 3OBRA 5H9RA 2XJPA 4QXKA 1UYZA 1OXCA 1RTVA 4NE9A 3ZFEC 2DU1A 1RUC1 2B42B 5I8TA 1QKQA 2GALA 1ND2A 4UF0B 3FHAA 3MO4A 2C24A 5F5IA 5JOYA 4GWNA 4RYDA 2RMU3 1DYPA 1JHNA 3CDZB 3FHQA 3JD73 2VXJA 4K20A 4XF4A 4YNIA 1UYYA 4CEWB 2RV9A 4FAGA 5FWJA 2JDKA 2ZAAA 4CP9A 2PHRA 4AI0A 2BGCA 1LHUA 1AL21 2JG9A 4H3WA 3ZX7A 1L7QA 5FK8A 5G05L 3PDQA 3ZO0B 3LA7A 1GNHA 4Y1ZA 2Y6GA 2D44A 2FCTA 5CZKA 2PHUA 3POYA 5E89A 3WXPA 1YC61 2VL4A 3GJBA 5EP9A 4P9YA 4GXLA 4BDVB 5JXHA 2YZ4A 5JI7A 4L97A 3ZFGB 3OF1A 4RR3C 2HKXA 3J8F1 5L19A 3O1RA 3FFQA 2DBIA 1W90A 4XUQA 4QPIB 2WFF2 3O0VA 3OUHA 4HN0A 4LHKA 2XB6C 5F8PA 2XG3A 4HL0A 4KG0A 3UESA 4BK5A 4Z92B 1QGLA 2ZGNA 4Q29A 5F5QA 2XJQA 4ATEA 1QOSA 1DZRA 2DTYA 1SBEA 1NA1A 2ZGTA 1STMA 2Q1ZB 4Q0QA 5DAWA 4IEYA 3E5UA 1JTZX 3D5OA 1JUIA 2C9AA 1CJDA 2DDUA 2PA7A 4YZ5A 1I9RA 2FCUA 2EICA 3PNAA 3W21A 4QX0A 1QU0A 1U5YA 2ZGMA 4LLFA 3O1SA 1AL0G 3KLSA 2BFUL 4X8NA 2ZJCA 4XDOA 1H2MA 2WR9A 1HRV3 4MGKE 4CCJA 1ZBA1 4IDZA 3URFA 4OULA 1AX2A 2WT0A 1ND3B 4K6BA 4WM7A 4CEYB 4QKBA 2PHDA 2Y26A 4XFAA 1HXS2 2ZEYA 1EPWA 4OZOA 2UYAA 5C9AB 3V0BA 5ABJA 3J8F3 4XAAA 4EN7B 4F8AA 3JZVA 2MEV3 2FQPA 2P37A 4HVRA 4K7JA 2DYCA 2ZGSA 1U0AA 3ACIA 4XJ9A 5FMOS 1AR83 4P02B 4DINB 2JIJA 4P5YA 4JAAA 3UT0A 4IV1C 5IT6A 4EV0A 1R092 1Y3TA 3MIGA 3KT4A 1GZTA 2IFWA 1LR5A 3ON7A 1SLBA 3POBA 4GD4A 2VNGA 3MF6A 4YPJA 1VP6A 4XUOA 2Q1MA 4QGMA 4PQQA 4OHWA 3S7EA 1QJZA 2XBO2 3H9AA 1M4WA 4HVOA 2O8QA 2Z42A 2IXJA 2P3KA 2ATFA 1PO11 5LRRA 3ORJA 4PLOA 1C8NA 2ZGRA 1TEIA 4XJUA 4AOCA 1UN1A 1C28A 2BJSA 2C9KA 3W20A 5E88A 1W39A 2CWSA 1W6NA 4LHLA 5C8CC 3APBA 1RB8G 2DCZA 2YBPA 2TEPA 4JVAA 4H2AA 3NV4A 5AVAA 3B94A 4CCCA 4YZ3A 2HBUA 3FL7A 1AZDA 4XOGA 3SCGA 3THPA 3V0AA 3MW2A 3RZKA 2VOKA 3AC0A 3MICA 4FPHA 1FMD1 1NCQA 2CGNA 2RS51 3A7QA 4BLJA 3PLQA 3J8F2 3WQBA 3RWNA 4AF9A 5B4NA 2WN2A 5FYVA 3JCIA 2UURA 3H8RA 1UZWA 4MHRA 4RGKA 4YVWA 4QGNA 1V6NA 1AVBA 2IXCA 4YM2A 3ACLA 4DUVA 4Q4V3 5L7OB 2YROA 3ME2A 4I0WB 3ZFFA 3H3UA 2RS31 1OQ1A 2J1EA 1C57A 2RDRA 3C7EA 3GZTB 1CAWB 4D6SA 3NWKA 3A21A 4YW1A 1RYYA 2QBXA 2UU8A 3M3EA 4FPGA 3K2OA 1OC1A 1RUG2 1ZZ7A 4TSVA 1B35C 1JYTA 1QXJA 4O65A 4FP3A 1W2AX 4JV4A 3DXUA 4Z8BA 1QQP1 2D3SA 2MHFA 3NJVA 4Y4YA 3N9MA 1GSLA 1SPPB 1AL23 3WHUA 1YEWA 4PLNA 1H8TC 4PDWA 4UBGA 3LOBA 1C8M2 1D0GA 1FATA 1H6YA 2HH9A 1BK0A 2W1QA 5DZEA 3ACFA 3V0BB 4ISRA 3CIHA 3EYPA 1BBT3 4TWTA 4D0QA 1OT5A 4EN9B 5BNNA 1ND3A 2AGSA 5FO9B 1OQEA 5CADA 2WSUA 2VZRA 4Q5OA 4P14A 3RRDA 3WDWA 2VBBA 1XYPA 1RGSA 4RR3A 5GALA 2WLQA 2OX0A 3N9NA 4COUA 4LBJA 5IK5A 2WWUA 1R083 1J58A 2YFUA 3N9QA 1QJY2 5DQ0A 2D6KA 2VBDA 2OIIA 2JD9A 4NRPA 2BOJA 2ZEWA 2VW0A 3S6PA 2XJTA 3CL1A 3P5BA 3PVOA 4XTMA 1WMDA 1NQDA 1O5LA 1LHWA 1WW5A 4ZHNA 2WRAA 4D7YA 4BQXA 1XU2A 5HCHA 4XFHA 1XNAA 2DUPA 4N8MA 1MS4A 2X10A 3B9CA 4AEDA 3U0ZA 4AYUA 1RJ8A 2C5DA 2WS93 3CF6E 2HWD3 1MEC2 4FTEA 1XQNA 4XXAA 3VBHC 1BEV1 4HXCA 1AR93 1ASJ2 4ZY9A 3ZR5A 5H9PA 4B1LA 2P4EA 2AREA 3MIDA 2XJSA 2FDHA 5FYIA 4E8CA 1MS9A 5JMOA 4QB2A 3H50A 3A0KA 3PU8A 2PLV1 4K8FA 5FZHA 4XJ8A 1RMU2 3B02A 2H6CA 2AEYA 2E53A 1CAUA 2O8OA 2D98A 2UWBA 2RR11 3LEGA 5J3UA 1QH7A 5C8CB 3HT1A 3PUAA 2VR4A 2XGXA 1VE0A 3L2YA 3N3HA 4YGDA 1AR73 4L11A 4FBFA 1GICA 3R0RA 4KGGA 5I8SA 4OQ9A 3UJOA 2R071 2WQ4A 3GHNA 3U78A 2W91A 2HEYF 2JG8B 3AKRA 3NJXA 1DZQA 1PZ9A 3MI8A 3D0SA 3H1YA 5FZ9A 1UW8A 4M3CB 3P3PA 1QOTA 2CGOA 2VOWA 2FMDA 1W9YA 5JOZA 4LQRA 1YLLA 2WZPP 1J3PA 4NRMA 2A6VA 2ETEA 4AWDA 1VBD1 4ZU7A 3QH6A 2VW2A 3VZOA 4YZ1A 4WVVA 4B7KA 2VC9A 5IK8A 4MUVA 4ASLA 4NHKA 3EQEA 2ZHLA 3RG0A 2HWC2 4FPEA 4FPKA 5AFBA 2WUHA 5T5PA 5KR7A 3WF3A 4X8PA 4IV3B 4A6SA 3VL8A 4JGZB 3WP6A 5GZGA 1VMHA 2HWE3 1CIYA 2HLEA 5F3IA 2QQNA 2CTVA 5FPZA 5FZEA 3WDVA 2D40A 2D5FA 2VZ1A 4MGIE 5FREA 5FXWA 4BMBA 4LBQD 4AHXA 5A1AA 5FPLA 3VBUB 1QF3A 2G1MA 1EAH3 1MS3A 4HK9A 1V9U2 4BIFA 2R073 4L99A 4CRQA 4DY3A 5L9BA 4HPKA 1HQLA 3LEMA 4XJAA 4PF1A 1TME3 4A41A 2QQIA 4MXVA 1O8SA 4AI9A 4JKKA 1H8TB 2XKOA 1T6BX 4UFMA 5CEHA 3EHKA 2B8MA 3C7GA 3KF5A 5KXEA 3MLLA 4LKEA 1YCIA 4K8RB 2E6VA 4AHYA 5F2WA 4AVAA 2V09A 4QKDA 4RA0A 1CZVA 4E9KA 3VZJA 1GWLA 4HETA 2ZPXA 2VZOA 2WT1A 4FPJA 4OUMA 4B4RA 2WQ8A 4P9WA 3T1LA 3TOJA 5FPUA 4HBNA 1WMEA 1H2LA 4IEOA 5KHIA 5FZMA 3H8OA 5DDJ1 4XHBA 5I0DA 1D4M1 2VECA 1UO9A 2SLIA 4J6GA 4PDWC 2B5HA 5FYMA 1ULOA 3UETA 4X6RB 3VKFC 1DFQA 2YGMA 1HJGA 3CJIB 4L92A 1ZA7A 5L7OC 2FBEA 5DUVA 2JG9C 3MIHA 1V70A 5HV4A 3AYCA 4Q27A 5F1RA 4J25A 4AQ6A 2OUHA 2VZSA 3TAYA 1NXMA 3DGTA 4BHPA 1UNBA 1RUE2 4YGBA 1IS3A 2PQQA 4YSFA 2WNVA 5CFDC 2ZHNA 3WNOA 4OHYA 1IZ3A 1UD1A 1X8EA 3IAPA 1GZWA 1SFPA 3I97A 1VBA3 4IEVA 5FZLA 4JGYC 4BXSV 4JTOA 4D7SA 4D7TA 4AG4A 2IC1A 4ATFA 1Q8VA 4QHBA 1QOOA 4RGAA 1A34A 3HD8B 4LPLA 4QM9A 5IVYA 5HCAA 4OLLA 4XBQA 4XYXA 1J59A 5A80A 2HWF2 4FP2A 3AP4A 3OGSA 2HWC3 3EMRA 3NNJA 4YM1A 2W68A 3QACA 1OA2A 3DKQA 2OA2A 4IERA 4Z2AA 1EUUA 5J96B 4CDUC 4A2UA 3N7JA 3DV8A 2UWCA 3AVSA 1O7FA 2HWD1 5K0UB 3ZPYA 2ZGLA 1JZ5A 3I4IA 1OA4A 2AH2A 1XNKA 5GLTA 2GN3A 3ELNA 3RDIA 2YU2A 2Y0OA 4AFDA 5CFCC 4NHLA 3WOGA 1CWPA 1J84A 4AQ2A 4A6OA 4QX2A 4BMEA 1D4VB 3O1OA 5FYUA 2D6NA 2VO5A 4FTBA 1GOGA 2RS13 4MX3A 2JE7A 1LHNA 5ABJC 5BNPB 4NAMA 1G6NA 4BA6A 1VJ2A 2ENRA 2W0XA 3AK0A 5DXDA 3AKSA 1W28A 1PNGA 1PMHX 3USUB 2VUAA 1RMU3 2IVIB 1IGOA 1D2SA 5HV0A 3I2GA 4KBZA 2JDMA 2NN8A 2ZXQA 3PUSA 2Z79A 5LBCA 1U5ZA 3GDBA 5SV8A 4RS5B 3KQ4B 2PAEA 3QD6A 1W8HA 2E32A 1LENA 4Y4RA 2E33A 3KSCA 3T2OA 1PO23 3AFKA 1G9FA 2Y60A 3LZZA 1WCKA 5FZ1A 3BU0A 4WM8A 2QQMA 2WYFA 4WBBA 5FYHA 1CN1A 4O7XA 5A6YA 1CAVB 4CA9A 3TRSB 1BZWA 1ZBE2 3U14A 1DGRN 1A6CA 1DBNA 3POGA 1KFXL 1GR3A 2DFBA 2PYTA 4OYUA 4Q2FA 5J09A 2IXIA 4YM0A 4D3WA 5AC91 5A3NA 2JE9A 2Q5TA 4HSJA 4URAA 3H42B 1S0DA 4XC9A 2ARXA 4NWVA 5JSPA 1BYHA 3ACHA 4P9IA 2PAMA 3VHNA 3OD0A 1LECA 3ENRA 1UZYA 4AQTA 4FXKB 2BNOA 1IS5A 4L0PA 2LM3A 3AKTA 2QQKA 1FOD1 4IE4A 1EAH1 2ZX4A 1AXYA 4S2DA 5F9TA 1N3OA 3GCXA 5KHGA 1J1LA 1W0NA 3AMMA 1MZ6A 2FZ2A 1F5FA 4NUBA 3M8LA 2Q8DA 1WD3A 3WDUA 2MPFA 2Z2SB 4XF0A 1PGW1 1PIV3 5SV5A 2RM23 4IL7A 1VBE3 3VD4A 3I2JA 1RITA 3ZM8A 1SBFA 3NAPB 4Q4Y2 1XPWA 3ZN4A 5IVFA 4MLOA 1MS5A 2VD7A 2VMCA 3KZ4C 1UKGA 1XB9A 1R1ZA 2BUKA 4MV2A 5A7PA 3IIAA 2CHHA 4R9DA 1YIFA 4CXXA 2SBAA 4FOVA 3KV4A 4FPLA 3LB9A 3MPPG 3S5QA 2QE3A 5EZWA 3MZHA 3HNBM 4YM3A 1XSRA 1RUH3 3WLUA 2QUOA 4W8JA 4COZA 5T5OA 1JZ8A 2PTMA 1H1MA 5JR7B 1QXRA 3PMEA 2ZX2A 5C9AC 1QJY1 3POIA 2WZR2 1EYBA 3VHOA 1GP5A 1UU5A 1FOD3 2Y64A 1JYXA 3SLIA 1OOPC 2ZACA 3USUA 3M3IA 4JHZA 1D2QA 2Y34A 1ND2B 2RHPA 3KV9A 4Q4Y3 5FWEA 1SACA 4E4ZA 1NLSA 1ZA4A 2OZ6A 5IFPA 3FLRA 4JZRA 4DNYA 5LZ6A 5ISLA 1PIV2 5IUQA 2BVBA 5DAPA 2F17A 4LLOA 3UV9A 3VD9A 4EYUA 5A3PA 3JU9A 5FZ4A 2BWAA 4A4AA 3ZFGC 4V2WA 4WZFA 1R081 4PHZA 4HVQA 3B9IA 3AMHA 4EROA 3Q8CA 1QQP2 3R4DB 3BPSA 1X7NA 1Y9MA 4I2OA 3I8TA 3DL3A 2TNFA 4META 3VBRB 4UW5A 4DEVA 5CU1A 2GNBA 3QOPA 1V6JA 3F2ZA 5JPNB 4DQAA 1I6XA 1G86A 3MFAA 1EPZA 4EWEA 1G7YA 4XZPA 4L8QA 1KJRA 4QU2A 2ZOEB 4LOTA 3LOIA 2X05A 1AF9A 1RVF2 4RHV3 5FQ0B 1GLHA 4RS5C 1Z78A 1CPMA 5A1LA 4XDQA 2ZABA 5FZ3A 3AM2A 4Y24A 1NA1B 2R063 4GB32 3B93A 2RDQA 1NAEA 3BTZA 3K46A 2PLV3 2GC2A 3M3CA 5GKAC 1O3SA 3IDCB 4AE2A 1OBNA 1PZ8A 1UY3A 1N3QA 2A71A 3GCWA 4YG6A 3RMXA
chains in the Genus database with same CATH topology
4NRMA 4IE7A 4NRQA 3O1TA 3H8RA 3RZJA 4MG2A 3S57A 4JHTA 4NIIA 4ZHNA 3H8XA 3RZMA 3BIEA 4ZS3A 5DABA 5F8PA 4NPLA 3O1UA 4O61A 3I2OA 4MGTA 2FDJA 4NIHA 3BI3A 4OCTA 3I49A 4NIGA 4IE5A 3RZHA 3T3YA 4CXXA 2FDFA 4QKDA 2FDGA 3S5AA 3BTXA 4QHOA 4NPMA 4NROA 4IE0A 4RFRB 3RZGA 3BU0A 3O1PA 4IE4A 4NIDA 2FDIA 4QKNA 3O1OA 3BTZA 3O1MA 3O1SA 2IUWA 4O7XA 2FD8A 3BUCA 3I3QA 4QKFA 3LFMA 3O1VA 3T4VA 4NJ4A 3H8OA 4IE6A 3RZKA 4ZS2A 4NRPA 4IDZA 3O1RA 3KHCA 3T4HB 3BTYA 3RZLA 2FDHA 3BKZA 2FDKA 4CXWA 3KHBA 4CXYA 3I3MA 4QKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRM A;  4IE7 A;  4NRQ A;  3O1T A;  3H8R A;  3RZJ A;  4MG2 A;  3S57 A;  4JHT A;  4NII A;  4ZHN A;  3H8X A;  3RZM A;  3BIE A;  4ZS3 A;  5DAB A;  5F8P A;  4NPL A;  3O1U A;  4O61 A;  3I2O A;  4MGT A;  2FDJ A;  4NIH A;  3BI3 A;  4OCT A;  3I49 A;  4NIG A;  4IE5 A;  3RZH A;  3T3Y A;  4CXX A;  2FDF A;  4QKD A;  2FDG A;  3S5A A;  3BTX A;  4QHO A;  4NPM A;  4NRO A;  4IE0 A;  4RFR B;  3RZG A;  3BU0 A;  3O1P A;  4IE4 A;  4NID A;  2FDI A;  4QKN A;  3O1O A;  3BTZ A;  3O1M A;  3O1S A;  2IUW A;  4O7X A;  2FD8 A;  3BUC A;  3I3Q A;  4QKF A;  3LFM A;  3O1V A;  3T4V A;  4NJ4 A;  3H8O A;  4IE6 A;  3RZK A;  4ZS2 A;  4NRP A;  4IDZ A;  3O1R A;  3KHC A;  3T4H B;  3BTY A;  3RZL A;  2FDH A;  3BKZ A;  2FDK A;  4CXW A;  3KHB A;  4CXY A;  3I3M A;  4QKB A; 
#chains in the Genus database with same CATH topology
 2KD7 A;  3RZJ A;  1FPN 3;  2HWB 1;  1COV 1;  3DYM A;  2G19 A;  4LA3 A;  1IPK A;  5D1I A;  3KCX A;  1UCX A;  1RC6 A;  3E5X A;  1A78 A;  4H14 A;  3IM0 A;  4O61 A;  4OUE A;  4JTN A;  3WSO A;  3HQR A;  5BY5 A;  5CFC B;  4A7Y A;  1PO2 1;  5IVC A;  2WJS A;  2BQP A;  3CJI A;  1UMI A;  2DF7 A;  2WBK A;  1MPX A;  3VN4 A;  2QJV A;  3PUQ A;  5EIY B;  3ZSK A;  5KC5 A;  3H3Z A;  3POJ A;  1ZZ6 A;  2CYF A;  2EXJ A;  2KM2 A;  2WL1 A;  1W6O B;  1XE8 A;  1VMJ A;  3G6J B;  3VD3 A;  2FD8 A;  2JDN A;  2PHL A;  3HAG A;  4JC1 A;  5F37 A;  1LB2 A;  4FSJ A;  4NJ4 A;  1ZZB A;  1NYW A;  3HIF A;  5JOX A;  4UT5 A;  4Y33 A;  5GZD A;  2NM1 A;  4UF0 A;  1QEX A;  1Q8Q A;  3T2T A;  4XIL A;  3HNY M;  3AJZ A;  4N9I A;  5CKM A;  1KEX A;  3NQH A;  4YW6 A;  3U4X A;  5F3C A;  1BMV 1;  4W6W A;  4FTS A;  3ZMO A;  4QX5 A;  1XXN A;  4GB3 3;  1R1A 2;  2R06 2;  3SH3 A;  3ZSE A;  1HXS 1;  5BNP A;  4CEY A;  3POW A;  3NL1 A;  4DIQ A;  1HB2 A;  3I59 B;  1NG0 A;  1VBE 1;  2DCY A;  3VBS A;  4QKF A;  2P3Y A;  1RVF 3;  2DV9 A;  4AHW A;  1MVE A;  4N43 A;  4AVB A;  4CDX A;  5C3P A;  3KWV A;  3TEX A;  3O5S A;  2KXL A;  5LY1 A;  4BYY A;  4QHZ A;  2V4A A;  4PBO A;  4Y3O A;  4M3C A;  5F6L B;  4GMP 0;  5FFO C;  2BPA 2;  4MSV A;  5A3W A;  1SLL A;  1WBL A;  2JG8 A;  3FX3 A;  3I2I A;  1L7L A;  2P1B A;  3RZH A;  1AR6 2;  2GME A;  2GC3 A;  3ETP A;  4P9G A;  4AZZ A;  4GJZ A;  1W0P A;  2VZV A;  3JBG 3;  4RFR B;  3VGI A;  2E51 A;  1GQP A;  1HLC A;  1PMJ X;  1R08 2;  1ZRD A;  2B4K A;  2YDE A;  3TYJ A;  1FMD 3;  1NCQ C;  2J1T A;  3VDA A;  2PHW A;  2EIG A;  2WNV B;  4URT A;  2X53 S;  3BUC A;  2W94 A;  3B7M A;  3I2D A;  3VBS C;  1QJX 3;  3PUR A;  4KNC A;  2QZ3 A;  1RL3 A;  2OZJ A;  4QX7 A;  3C7O A;  2ZHK A;  1RUE 1;  3OYW A;  2IFR A;  4XJW A;  1RUF 2;  1X8M A;  3IWZ A;  4ORF A;  4C0B A;  2EAL A;  4GIQ A;  3ZYP A;  4PF5 A;  1OD3 A;  1AJK A;  4WVM A;  4HON A;  1QJU 2;  5FP3 A;  4IEQ A;  4XZU G;  1JN2 P;  4HKO A;  4L9B A;  3USS A;  1ODN A;  1D4M 2;  1IHM A;  2DFC A;  5I91 A;  3RSJ A;  4I30 A;  4CU9 A;  4AED B;  1OQD A;  1W6Q A;  1RUC 2;  4CDQ B;  4A45 A;  1W2O A;  3IZO A;  3SNM A;  5FZ8 A;  1JYC A;  3AP5 A;  3WEZ A;  4ES9 A;  1V6M A;  2BFU S;  3ITQ A;  2ADD A;  4KH9 A;  2V72 A;  1H8T A;  2BV4 A;  2ZHM A;  1WCQ A;  1YI7 A;  2VMD A;  5A7W B;  4FVV A;  5JPM B;  4HPK B;  4IE7 A;  3VDB A;  4EE2 A;  2V4V A;  4XBN A;  3WR0 A;  3H8X A;  3RWK X;  2W2I A;  2R30 A;  3OUI A;  2D6P A;  4AEM A;  3UYJ A;  2A3X A;  5JWP A;  2TBV A;  3K4A A;  5DZG A;  2VPV A;  1BQP A;  5A7S A;  1WMX A;  1WLT A;  5A7W A;  3SHR A;  1CVN A;  4A7K A;  2VMG A;  1MZ5 A;  3J9S A;  3OJB A;  2XLA A;  3AJY A;  4LEJ A;  3NMB A;  3RZG A;  3VBU A;  2JEC A;  2RDS A;  1UF2 C;  5IHR A;  3U07 A;  1ZX5 A;  2DCT A;  3III A;  4JX0 A;  4B29 A;  1W99 A;  2VZU A;  2A1X A;  3C7H A;  1X82 A;  3T4H B;  5LEJ A;  3O7O A;  3OB8 A;  3QLQ A;  3ZXK A;  1LOF C;  4QQH A;  1JXN A;  4QWN A;  1K5M A;  2BRT A;  4CDW B;  1YQ5 A;  4YAR A;  4QDS A;  3ZXG A;  1YHF A;  4AED C;  4EN8 B;  4TN7 A;  5K8S A;  4UOJ A;  1IS4 A;  3P1I A;  3AXE A;  1YFW A;  2YBS A;  4FOQ A;  3DN7 A;  4UXA A;  1VPH A;  3VZM A;  3CBN A;  2VUD A;  4MGZ E;  4DOU A;  1LOD A;  1F4A A;  4Z2W A;  4RQP B;  2Q30 A;  2XXZ A;  1HW5 A;  4YVS C;  5C8C A;  1GQG A;  2ILM A;  1I5Z A;  1R09 3;  3KVB A;  1JOB A;  2VNO A;  3DEC A;  3DYO A;  2XON A;  3DF0 A;  5FLI A;  3KHB A;  4M0N A;  3UGH A;  1O5U A;  3OSD A;  2A6X A;  4F7Z A;  2EXH A;  2DU0 A;  2WNU B;  3ALQ A;  1LOB A;  3PIJ A;  1GAN A;  1N1Y A;  1NCQ B;  3NO8 A;  4OI2 A;  3NKG A;  2WZE A;  4XAC A;  4HSL A;  2CDO A;  1PGL 1;  4N53 C;  5KC6 A;  5LBF A;  3FLT A;  3KGZ A;  1UWW A;  1YUD A;  2JXA A;  3BB6 A;  1IPJ A;  1WKY A;  2BGO A;  2DVA A;  2BER A;  3M70 A;  3OBT A;  5B4X A;  5HBA A;  3ASI A;  2EAK A;  3A4U A;  4QQO A;  5EFU A;  3ZN5 A;  2QFE A;  1RJ7 A;  3BN6 A;  3IPV B;  3PUI A;  4QQL A;  1NE4 A;  5D2A A;  5BUV A;  1RUO A;  3R4U A;  4LBN A;  1ENX A;  3U75 A;  2FDI A;  1LOA A;  4BK4 A;  1WZX A;  1WCD J;  4R52 A;  1RUD 3;  1ZYB A;  2D6M A;  3BAL A;  1F8V A;  1MEC 1;  1XJA A;  3HNM A;  2Q8E A;  5K0U C;  1OUS A;  4LR4 A;  2B46 X;  2JEN A;  2HJI A;  4UWD A;  1S0G A;  3U1X A;  4BIS A;  4CYD A;  2XH6 A;  4QPG A;  4EN0 A;  1S2B A;  4ZXK A;  3ZYI B;  2OUJ A;  4JHT A;  1H9W A;  4FI9 A;  1K42 A;  3ZFE A;  2ZKL A;  4JGY B;  5C3O A;  3DUI A;  5A3M A;  4CU8 A;  4JQT A;  5FBZ A;  1LU2 A;  2AAC A;  1ENS A;  3KT7 A;  2VQU A;  1QJU 1;  2XHK A;  2X5I B;  1M06 G;  3TB0 A;  5BNN B;  1AX0 A;  2XWB B;  1OOP A;  4B1M A;  5FMC A;  4W6Y A;  3LCP A;  4UW4 A;  2PXJ A;  3WDT A;  3T4V A;  4XIK A;  1HV0 A;  1RUE 3;  1HRI 1;  4CE8 A;  4PDW B;  4Q4V 2;  1JBC A;  1NT0 A;  3A23 A;  3HN3 A;  4CDW A;  3SEP A;  3TNP B;  5T3N A;  3WQ7 A;  3HWJ A;  2K46 A;  1CON A;  4LUL A;  1N1T A;  3DYP A;  4HZF A;  2P2K A;  1KXG A;  1RUJ 2;  4IND A;  1LNS A;  4GH4 B;  4I3P A;  1ND2 C;  3J4U H;  5DDJ 2;  1UY4 A;  3GAL A;  4YFW A;  2QQL A;  4C91 A;  3DXT A;  1SLI A;  3VB9 A;  1F2N A;  1NZI A;  2OKX A;  1JZ3 A;  1YYN A;  3T0D A;  2BW8 A;  1FV2 A;  2ZX3 A;  3BPZ A;  2BNM A;  4QQ2 A;  2Q4S A;  5ACA 3;  3U10 A;  1CAW A;  2VTF A;  3LDB A;  2WNO A;  3AMN A;  4KQ7 A;  1RUG 1;  4QKN A;  4LA2 A;  3NW4 A;  3A0N A;  3WZ1 A;  1GQH A;  4E2S A;  4KU8 A;  5L7O A;  3J7H A;  2JKB A;  3M4F A;  3LF7 A;  5LCW L;  3VBH A;  2VVE A;  2A73 B;  1OH3 A;  2O1Q A;  4Q26 A;  3TEZ A;  3M3O A;  5JOW A;  1FI2 A;  1CQ9 A;  1R1A 1;  3OGJ A;  3ZFF B;  2VZP A;  1V9U 1;  5FXV A;  5FZO A;  2GC1 A;  4UW6 A;  3WNL A;  3I49 A;  5K4L A;  2VJX A;  5FYC A;  1W8W A;  1IKP A;  1G9B A;  4AFA A;  4XTP A;  5DPN A;  2EA7 A;  2EVX A;  4IEX A;  2LW8 A;  3SIT A;  3IN9 A;  1FV3 A;  2E26 A;  1XSQ A;  2D6L X;  2ZZJ A;  1X36 A;  3AP6 A;  4IV1 B;  2W92 A;  4TLF A;  5J36 A;  3I3Q A;  4RD7 A;  1AR8 2;  2LS6 A;  5JIA A;  3TN9 3;  3UJQ A;  3W5M A;  4J1W A;  1E5R A;  4XHX A;  3IMM A;  5DUX A;  4LT5 A;  1VBD 2;  2DVB A;  5IVE A;  3CJX A;  3OPZ A;  3VZL A;  2C6S A;  4GKX A;  1FX5 A;  5C5T A;  2XVK A;  3PVB B;  4OCT A;  1YI9 A;  2D43 A;  5F6K A;  4K9S A;  2FDF A;  2YHJ A;  2JB4 A;  4E27 A;  4BJ0 A;  4D94 A;  5A7Q A;  4AHZ A;  1AYN 2;  1W03 A;  2W9X A;  3WG1 A;  5IAT A;  2JWP A;  4AFB A;  1AR8 1;  4LKF A;  4GJY A;  2VVD A;  5CB7 A;  4K3U A;  5DMY A;  1OLQ A;  1W9S A;  2NMN A;  2AZ5 A;  4J1X A;  2QNK A;  3LDK A;  1OD5 A;  4CPB A;  1LHO A;  4Y1V A;  3LA2 A;  4CCN A;  3RYP A;  4CP2 A;  5J48 A;  5FO8 B;  3WP3 A;  3N35 A;  4BPZ A;  1JH5 A;  1YO8 A;  3WNK A;  2PEL A;  2W1S A;  4U2A A;  3SCF A;  1CX1 A;  1RHI 3;  4HT1 T;  4OI1 A;  2N7G A;  3QBQ A;  3HBZ A;  4IE5 A;  5FZB A;  4HMZ A;  2ADE A;  3ZYB A;  5CKQ A;  3U11 A;  5IVJ A;  3ZKU A;  3EB7 A;  3M2M A;  1RXG A;  1POV 3;  1ZNP A;  4FFI A;  4OFG A;  2EXK A;  1E5S A;  3J7L A;  5I93 A;  1RUD 1;  4E2G A;  1RVF 1;  3GYD A;  3PUH A;  1ZRR A;  1C4R A;  1ULE A;  5L9V A;  5EYY A;  4UFH A;  3ZVX A;  2WC2 A;  4QXC A;  2VTX J;  1AX1 A;  3NV1 A;  1X50 A;  5KXC A;  4AQS A;  3ZLI A;  3GZA A;  4EQV A;  1LUL A;  2RE9 A;  2JG8 C;  1B09 A;  3IDB B;  2ZGK A;  1NX9 A;  4GH4 C;  5K7P A;  1Q8S A;  4ZS3 A;  3KVA A;  5BXX A;  1UOG A;  1Z7S 3;  5J1X A;  4NIH A;  3VBO C;  5C3S A;  2B45 X;  5C33 A;  3T3Y A;  1Y9Q A;  2PFW A;  2WO1 A;  3VHR A;  3ZYH A;  4D69 A;  4YVW C;  1RIN A;  2QDR A;  3LPG A;  4JCK A;  1UL9 A;  2BZD A;  1HRI 2;  4NRO A;  3UK9 A;  1L7R A;  1XRU A;  2DVG A;  3LSE A;  3O14 A;  2JJ6 A;  4SLI A;  4B4P A;  2NZ9 A;  3MIF A;  3C2U A;  1XND A;  3LWC A;  2QKD A;  3N7M A;  3C8X A;  3IDE A;  4AVV A;  1S0F A;  3AZY A;  2XJR A;  3K77 A;  2WFP A;  3KB5 A;  4QB6 A;  3THC A;  2WAO A;  4XFI A;  4UI9 L;  4BQY A;  4CEW A;  2NQY A;  2W87 A;  1S55 A;  2D7F A;  4LIT A;  4N9H A;  5I8Y A;  3ZN6 B;  1T6G C;  1AL2 2;  1KIT A;  2WZR 1;  1FAY A;  1FYU A;  3OGV A;  1GP4 A;  3POF A;  3WNM A;  3OUJ A;  1JZ2 A;  5DG1 A;  3AL5 A;  3FJS A;  2F6B A;  1ZM1 A;  3JXS A;  3MUY 1;  4DRR A;  5DAV A;  1WA4 A;  3WF2 A;  3FLP A;  4MAD A;  3KD4 A;  5LK5 A;  2BP6 A;  5HCB A;  5I0T A;  1Q3E A;  1CZS A;  1DGW A;  2W52 A;  3GNE A;  1VBB 1;  1Z7S 1;  2R6Q A;  2R1D A;  4AXO A;  4BXF A;  1MQT A;  3EJK A;  1RUD 2;  4MYE A;  5JSR A;  5ERL A;  3BYW A;  4ET7 A;  5FKC A;  1QJE A;  2V5Y A;  2GP5 A;  1IQA A;  3CZU A;  3GZU C;  3MUZ 1;  2HYK A;  4Q8K A;  2IUW A;  2WS9 1;  4G4F A;  4UFI A;  5FZD A;  2PHX A;  2BNN A;  2ZCW A;  4DEQ A;  4Q4Y 1;  3VBF B;  4XFG A;  3T1M A;  4QD2 A;  4DS0 A;  4CUC A;  2WKK A;  2B9V A;  2WYS A;  1PGW 2;  2E7T A;  3D0J A;  1SDD B;  5F3G A;  1HQW A;  1OFS A;  3VV1 A;  1W9F A;  4AW7 A;  2HEV F;  1H1I A;  1HV1 A;  2R04 3;  3MBW A;  4RSU A;  3H8U A;  3LEK A;  3THT A;  2VAU A;  2ET1 A;  5I0U A;  3WF1 A;  4RL7 A;  1XE7 A;  4CP1 A;  5C5U A;  4QDQ A;  2YMZ A;  5EYX A;  4UW3 A;  1H9P A;  2ES3 A;  3VBO B;  3KV5 A;  1WBF A;  2XWJ B;  4HLT A;  3O1P A;  2NLR A;  5J98 B;  1GOF A;  3PVN A;  1VBB 3;  3O1M A;  3E6D A;  4LIV A;  4XXP A;  5T5L A;  1YFY A;  5TSW A;  2D97 A;  5AC9 2;  1BEV 3;  2WO7 A;  1KFU L;  2AEN A;  2GAU A;  1GZW B;  1PO1 2;  3GZE A;  4LO4 B;  1UX6 A;  4Y22 A;  3I3D A;  1OHF A;  2VE1 A;  1HRV 1;  5JXI A;  3AYE A;  5BNQ A;  5CVR A;  2VW1 A;  3HQX A;  3ACG A;  3LFI A;  4P9X A;  4BQ4 A;  2XOM A;  3SH5 A;  1JUH A;  3GGL A;  4E4H A;  1ONA A;  5GLV A;  3VDD C;  2MEV 1;  4YW7 A;  3S7I A;  3RYR A;  2RR1 3;  1OMI A;  3MHZ A;  3AMP A;  5FPA A;  1N3P A;  1US2 A;  2CNA A;  1ZRC A;  4WV8 A;  3E5Q A;  4IV1 A;  4QM8 A;  1ACC A;  3HT2 A;  1XU1 A;  2J1S A;  2J42 A;  2XKP A;  3CNA A;  1H4H A;  1ZRF A;  2QQP A;  2QDN A;  1A8M A;  2R04 2;  4D6Q A;  4Q0P A;  5E16 A;  3ECQ A;  4P5H A;  1YJL A;  4BM8 A;  5LK7 B;  3NKT A;  3RZM A;  3W58 A;  4BU2 A;  2P17 A;  4TXW A;  3ZSM A;  5LRS A;  1J83 A;  3H7Y A;  2J1A A;  1IPS A;  4NPR A;  1CAX A;  4Y20 A;  3ZKY A;  3FHI B;  4RFT 0;  1YQ8 A;  4TYS A;  5FYY A;  1LTE A;  2YC4 A;  3ILF A;  2CWM A;  1W8T A;  5DUW A;  4YVS B;  5APA A;  3DEM A;  1VMF A;  4HFS A;  1WLD A;  4I0A A;  3LIG A;  1QJF A;  2LUW A;  3VD7 A;  1RUC 3;  1WMF A;  1MS0 A;  4EWA A;  5C3Q A;  4OHX A;  4BQW A;  2AYH A;  4LO7 A;  1OVS A;  4RR3 B;  1Q5O A;  2W5F A;  1FNY A;  2RMU 1;  2PHF A;  4IE6 A;  4GH4 A;  4H7L A;  4R9B A;  5ANN A;  5A32 B;  2QTW B;  3RMY A;  1D7P M;  4HKL A;  2ZX0 A;  4FOW A;  4JDN A;  1OFN A;  1V6I A;  4Q4X 2;  2XQR A;  4XMI A;  4AVC A;  4CXW A;  4LJH A;  2WFF 3;  1PGS A;  2GZW A;  2WNE A;  2O14 A;  1DHK B;  1OA3 A;  5C71 A;  4RN5 A;  3THD A;  2VZT A;  4LIU A;  5DAX A;  3LDR A;  1FT9 A;  4IUG A;  1JYN A;  4DPN A;  2ORX A;  2RG4 A;  3BI3 A;  1QDC A;  3RQ0 A;  4NOT A;  3UKN A;  5FJK A;  2KR2 A;  4QMA A;  4DY5 A;  3BTA A;  3H7J A;  3SH4 A;  3PTR B;  1SLA A;  2G9F A;  3AVR A;  3WV6 A;  1ZVF A;  5LBE A;  3Q9O A;  5CAZ A;  4G3Y C;  3RVH A;  1UOF A;  3ZSL A;  5HPO A;  4CDW C;  5EXO A;  4I09 A;  3VDD B;  3WW1 A;  5BNO C;  5A3U A;  2JDP A;  4LHN A;  4Y1X A;  4YW4 A;  1W9T A;  2ZGQ A;  1LGN A;  2A3Y A;  3I2H A;  3FFZ A;  4G9S B;  3E97 A;  1B35 A;  1VAK A;  5DDJ 3;  1K3I A;  2RMU 2;  2VOV A;  2UYB A;  5HI0 A;  1L3J A;  4GUL A;  2WO2 A;  2LTN A;  3HEI A;  4A3Z A;  1CAU B;  3BU7 A;  3ZFE B;  3LAG A;  4ZXE A;  1QHD A;  2Y6J A;  1RUI 3;  2QVS B;  3MGU A;  4CCM A;  4UBH A;  1TMF 3;  3FBM A;  1PM4 A;  4CP0 A;  4W50 A;  3KQR A;  4GAZ A;  2XL9 A;  1DLC A;  1NLR A;  1VIW B;  2A75 A;  4IE0 A;  4XCA A;  3IBM A;  5DAQ A;  4B7E A;  1QMJ A;  4O9E A;  1JYV A;  1JW6 A;  5F32 A;  1HB3 A;  3F95 A;  1WCS A;  5J7M A;  4R8H A;  2BVV A;  1QJX 1;  4XUN A;  1BLZ A;  4CPB D;  2Y6L A;  2P3I A;  2LRO A;  1EUT A;  2VTX A;  4FPY A;  2AEZ A;  4KMQ A;  1F31 A;  3N36 A;  4LBO A;  4COW A;  4CVU A;  5BNO A;  2R04 1;  2BTV C;  1UU4 A;  1IQD C;  3RFR A;  2WNU A;  3WDX A;  3WNX A;  1W6N B;  1H2N A;  5FZ0 A;  1BMV 2;  3AP7 A;  3ZXD A;  1CPN A;  1GV9 A;  2VCB A;  1KQR A;  4FOY A;  4V1P A;  5IYY A;  2HWC 1;  4FQ4 A;  5FY0 A;  1SCR A;  1G9C A;  3MDP A;  3C7F A;  5FMO L;  4PCR A;  4YGE A;  2A3W A;  1OI6 A;  3WNP A;  2FDG A;  2G9Z A;  2VNV A;  1VB4 A;  2FHR A;  3VBR C;  1W8N A;  2XL7 A;  4TLG A;  3MLJ A;  4A42 A;  1APN A;  1IOA A;  4QX3 A;  3LEI A;  5FK7 A;  3OY8 B;  2B39 A;  2DTW A;  4RQP A;  5FMB A;  1Y4W A;  4NIA A;  4LHS A;  4O9G A;  4WM8 C;  5T54 A;  5JI9 A;  1HX6 A;  4PI2 A;  2ZEX A;  3DKW A;  1AR9 1;  2FZ1 A;  3ST7 A;  4XUP A;  2YFZ A;  3AX4 A;  2A7A A;  3GM8 A;  5F3E A;  5FTT C;  1F4H A;  1VB2 A;  3RGB A;  3ZYJ B;  4BLI A;  4MG2 A;  1I3H A;  1UIK A;  2BGP A;  4CCL A;  5FXZ A;  4EZ4 A;  4MGT A;  1UPI A;  4BQ2 A;  1ZZ8 A;  1Y9G A;  2BBA A;  3I3E A;  3TWI A;  1OOP B;  1K5M B;  5EWS A;  1RMU 1;  2G9G A;  2V73 A;  1LEM A;  4GQ7 A;  3ABZ A;  2BBV A;  1W9W A;  4XFB A;  5L9R A;  4MOA A;  2R7E B;  1LOC A;  1AHS A;  2RR1 2;  1N1S A;  1N47 A;  3O12 A;  4DO0 A;  1JZ4 A;  2CSG A;  1JU4 A;  3BCW A;  3RYK A;  2I07 B;  4YRD A;  4Q4W 3;  4DUW A;  3PVE A;  5LA2 A;  1O8P A;  5FY7 A;  2GMM A;  2VM9 A;  2XLF A;  4H55 A;  5E1R A;  4OHZ A;  3T09 A;  4GMP 1;  2JX9 A;  1S0E A;  1UY0 A;  1UIJ A;  3CO2 A;  3FMG A;  3UL2 A;  3D82 A;  1VAV A;  5A7O A;  3M7A A;  1OPO A;  5A6X A;  1JU3 A;  1POV 1;  1UXX X;  1VBC 2;  3O0W A;  1BEV 2;  2QQV A;  3AL6 A;  4I02 A;  4YG3 A;  3LGR A;  4QPI A;  4B3N A;  2GND A;  4KBB A;  1LKN A;  4LBK A;  3Q8F A;  1VBB 2;  2W1U A;  1NQJ A;  4NHM A;  3SCH A;  1JYI A;  1AYM 1;  2OPK A;  1PX3 A;  4XF9 A;  3MFC A;  3DPR A;  4QPY A;  1VR3 A;  3BIW E;  4XQW A;  1TG7 A;  1QQP 3;  4BE3 A;  1O91 A;  3AZX A;  1H1A A;  4NO4 A;  1XC6 A;  2ET7 A;  1HJF A;  4ZS2 A;  2PMW B;  3FWE A;  5FKB A;  4JDM A;  4KGQ A;  5HCF A;  4PLM A;  5GZF A;  2VCM A;  4PQ9 A;  1D0H A;  1H0B A;  4AGV A;  3J7N A;  1C1L A;  2VVF A;  4PIY A;  1DQ1 A;  4GZ9 A;  1E5I A;  4LO6 B;  4WVM B;  2AUY A;  4Q4W 1;  4NHY A;  2VZ3 A;  4PT6 A;  3BIE A;  4CP9 B;  1PIV 1;  1UU6 A;  4AR2 A;  3OYW B;  4KWU A;  3D6E A;  2I45 A;  1BVP 1;  5CNA A;  3E6C C;  1NKG A;  1AJO A;  1DQ0 A;  4OUS A;  1W05 A;  1W2T A;  4FQZ A;  3T0B A;  1POV 0;  3LA3 A;  4QPI C;  2GNT A;  2YBK A;  3NJZ A;  3OCP A;  3OOX A;  5I0R A;  4CUA A;  2OPW A;  1C8M 1;  1AR6 1;  2GU9 A;  3NST A;  3T2Q A;  1RUH 2;  1SBD A;  4ZZ8 A;  1S4C A;  4ISQ A;  1SEF A;  1LCL A;  4DXZ A;  3ZDV A;  3H0O A;  5JMC A;  3FUQ A;  5FZ6 A;  2QQJ A;  3VD5 A;  1FXZ A;  2P3J A;  4KWK A;  2Y6K A;  3UKV A;  1MQT C;  1QNY A;  3SC7 X;  4YW2 A;  1VBE 2;  1O59 A;  2E7Q A;  1BHG A;  4MGY E;  1CES A;  5D8A B;  3FBY A;  5FV3 A;  5M0T A;  5FXX A;  4LE4 A;  3W5N A;  1S0C A;  2ZA9 A;  5FIX A;  2JDY A;  1KS5 A;  3NVC A;  4RHV 1;  3VKN A;  5A32 A;  2XPJ A;  2WII B;  1WCU A;  2J7M A;  2ORZ A;  1HRI 3;  1HIX A;  1QDO A;  1FMD 2;  2XJU A;  3OG2 A;  4UFL A;  5FJH A;  5FP9 A;  1VBA 1;  3I59 A;  5FBJ A;  3VBS B;  4AGR A;  5CIS A;  3R4S A;  4JDO A;  2X29 A;  3BTY A;  1U5X A;  1UZ0 A;  1AR6 3;  5LY2 A;  2YU1 A;  2CAV A;  4QX1 A;  3J7M A;  4ZU4 A;  2PAK A;  5LAT A;  5GZC A;  5JXJ A;  3ZDS A;  3KCC A;  2WZ8 A;  4U36 A;  1REE A;  4YGC A;  3GBF A;  4COV A;  1PZ7 A;  2CAU A;  1K5M C;  5JCT A;  1ULG A;  1SLC A;  1FPN 1;  2HWB 3;  5FPX A;  5FUP A;  1W6Q B;  4CDQ A;  1SLT A;  1AYN 1;  2VOX A;  4MO3 M;  1GP6 A;  2XJV A;  5C7G A;  1WWY A;  4AI2 A;  4LBM A;  4Q8L A;  5FR3 A;  5T55 A;  5KBF A;  4IES A;  1W8Z A;  4BOW A;  5IJR A;  3VKO A;  1C1F A;  2R0H A;  3V56 A;  5CFC A;  3R6S A;  3NV3 A;  5IFT A;  2ZTN A;  1NLQ A;  4I0B A;  4XAB A;  2VUL A;  2WAA A;  3AYA A;  1R1A 3;  4M3C E;  4YW5 A;  5BYN A;  3KS7 A;  3KHC A;  4FPO B;  2A6W A;  1XNT A;  1COV 2;  2HWB 2;  4WVZ A;  5FPB A;  1DGW X;  4BIO A;  4BZ4 A;  1MS1 A;  3CU7 A;  4D8M A;  5FO7 B;  3V64 A;  5JZG B;  3OY8 A;  5FZF A;  3WQ0 A;  1GZC A;  3QCW A;  2YB7 A;  2GN7 A;  1GZ9 A;  1IS6 A;  1LES A;  3I2F A;  5IVB A;  5K9Y A;  1JOD A;  3A22 A;  4Z07 A;  2DWR A;  4CSW A;  2P5B A;  3WIN E;  1Q56 A;  1XYO A;  1AYN 3;  3W9A A;  4EWD A;  1EV1 1;  2K0G A;  4XW3 A;  5A7N A;  2VXR A;  3WCR A;  1DYO A;  3OGG A;  5F7U A;  5FOB B;  2VOT A;  1S0B A;  3ZFF C;  1K45 A;  4LO5 B;  2RS3 3;  5FQ0 A;  1F15 A;  4CDX B;  1KJL A;  1UOB A;  4E8D A;  1BK1 A;  3PJQ A;  4N43 B;  3WQ1 A;  4NR1 A;  1FPN 2;  4K21 A;  1AYM 3;  1CR7 A;  3GJA A;  1J1T A;  3DCQ A;  5EJ3 A;  4CUG A;  3DPR C;  2C0Z A;  2K2S A;  4BH9 A;  5CFD B;  2GDF A;  1OPM A;  4FO9 A;  3VBF C;  3WX5 A;  3N9L A;  2XLG A;  4N7U A;  3NRU A;  3LIH A;  4COY A;  2WA4 A;  5CIR A;  3I2K A;  4ZKT B;  1KDK A;  3JB8 A;  1RUJ 1;  2WFF 1;  4QPW A;  2IWG B;  4FPF A;  4LBQ A;  1TNR A;  2Y0I A;  2D5H A;  1VBA 2;  4QU1 A;  5LEK A;  2XML A;  3AZZ A;  3ETQ A;  1QY4 A;  5F39 A;  3VZN A;  1QH6 A;  1YRZ A;  4FFG A;  2OS2 A;  4Q4V 1;  4RHV 2;  4AI8 A;  4LTA A;  1JI6 A;  3AKQ A;  5FAX A;  5JZG A;  1DIW A;  5A6Q A;  2CL2 A;  3ZMN A;  2ZMK A;  2UY8 A;  1PNF A;  4K1Z A;  2HBT A;  2ZEZ A;  3UNP A;  1RUN A;  5FUN A;  2P6H A;  4UFJ A;  1W6O A;  3AZW A;  3VL9 A;  2QQW A;  5IK4 A;  5GM0 A;  2ARA A;  4Q1R A;  2AR6 A;  3Q8B A;  4YYO A;  5KXD A;  3NAP C;  5JDB A;  3MYX A;  3B69 A;  4DZG A;  1PX4 A;  1MZF A;  1OSG A;  5H9Q A;  1RUH 1;  3JBG 1;  4IW3 A;  2I74 A;  1MAC A;  5A33 A;  5FOJ B;  3TBD A;  5ABJ B;  2WSV A;  4FXG B;  4GAL A;  5C9A A;  1GNZ A;  1RUJ 3;  1UX7 A;  1SPP A;  1LED A;  1MR5 A;  3E6B A;  4DMI A;  4I01 A;  1DQ6 A;  4JRL A;  2PN5 A;  4A7Z A;  2XUM A;  5FYS A;  1ND3 C;  2J1U A;  1NUK A;  5G04 L;  1YQC A;  1W06 A;  3ZXE A;  2B9U A;  4B8E A;  1Q8P A;  2F4L A;  4FT8 A;  5B2G B;  1V9U 3;  3S5A A;  1FOD 2;  1S2K A;  2NYY A;  4JRA A;  5IW0 A;  4CCO A;  3WY6 A;  1LOE A;  3RI9 A;  4ZON A;  4PJY A;  5L36 A;  4EN6 B;  1PGL 2;  4BCU A;  3H1W A;  3TEY A;  1TE1 B;  1PVC 1;  1DQ2 A;  1QWR A;  4IV3 C;  3HVD A;  2R1B A;  1DDL A;  2Y33 A;  3WW4 A;  3LQC A;  5FY8 A;  3WUC A;  5GLU A;  4IGP A;  4IEZ A;  2OYZ A;  4LK7 A;  4DXT A;  1QIQ A;  3AYD A;  1FNZ A;  4HN1 A;  5EJZ B;  4CDQ C;  5KWR A;  2FDJ A;  1IKQ A;  2GSY A;  2E9Q A;  3VBR A;  4AAX A;  1NZC A;  4IXL A;  3ZPO A;  4HAN A;  4DB5 A;  2GH2 A;  5FP8 A;  3RNS A;  1BXH A;  2C4X A;  3AXD A;  3V65 A;  3CLP A;  2BOI A;  1GBG A;  2FCV A;  3B5L B;  2VH9 A;  3D4K A;  4LUK A;  4QXB A;  4RS5 A;  4ZPI A;  3RJR A;  1P8J A;  2EF6 A;  2W3J A;  5GLZ A;  1YFX A;  2QQO A;  2H0V A;  2F4P A;  2GP3 A;  2WN3 A;  3MEP A;  3LFM A;  1W6M B;  4P00 B;  5D21 A;  4CCE A;  3CMG A;  1V6K A;  5T52 A;  2W39 A;  1VRB A;  3W59 A;  5FYT A;  1OLM E;  2OQ7 A;  4FCA A;  1Q8O A;  3SKJ E;  2XUE A;  1PK6 C;  2VMF A;  4M4P A;  5JLV A;  2VUC A;  5KHK A;  4WVW A;  4LBQ B;  3POS A;  1LOF A;  2VMI A;  4BQ3 A;  2QZ2 A;  2PLV 2;  4M01 A;  4OI0 A;  2R0F A;  1COV 3;  4K1Y A;  2VQ0 A;  4JQR A;  4Y5S A;  3BTX A;  2WWS A;  4QHO A;  5LAS A;  5BV6 A;  5FCC A;  1W6M A;  1WUV A;  1AR9 2;  3WD5 A;  1ASJ 1;  2A5Z A;  2Y8K A;  4NID A;  4YZ4 A;  2X5I C;  5C4W A;  3PJY A;  3K75 B;  1OF3 A;  1TME 1;  1ULF A;  4AVS A;  4QDR A;  3UGG A;  1PMI A;  3IPV A;  3MW4 A;  3WHT A;  4PBP A;  2UY9 A;  1BKZ A;  1RUI 2;  4CU6 A;  1S0I A;  1O3T A;  3PMS A;  2D3P A;  3ZR6 A;  2YC0 A;  1UZV A;  5K0U A;  2Y6H A;  3U4S A;  2Q0A A;  3O0X A;  3VBF A;  1US3 A;  1H8V A;  3JUU A;  3GHM A;  2W1W A;  3JD7 1;  1JMU B;  4XUT A;  5DZF A;  2EIB A;  4AI1 A;  2Q1F A;  5T50 A;  1R64 A;  1ZZ9 A;  4KG8 A;  1LAJ A;  3RI8 A;  3NNM A;  4LE3 A;  4XIO A;  1MQT B;  1QJY 3;  5IWF A;  4YVS A;  4AI3 A;  1QNW A;  1RXF A;  3GXU A;  4H7M A;  2CU5 A;  5L73 A;  5E8A A;  1GFF 2;  1RUF 1;  4SBV A;  1CX4 A;  2P6C A;  2R16 A;  2XHN A;  4Y5Z 0;  2OVU A;  2WAB A;  1REF A;  3O1V A;  4XQ4 A;  3D3A A;  1H2K A;  4A44 A;  1BBT 2;  4D6R A;  1HB1 A;  1DGL A;  3HOB A;  4P08 A;  4NPL A;  3ZFG A;  2ZBJ A;  1CAV A;  1SFY A;  4XF3 A;  1W3X A;  3K3O A;  1UKR A;  4PIZ A;  4WM8 B;  4CCK A;  2BEO A;  1CZT A;  2K9Z A;  2LRP A;  4BB3 A;  3GBG A;  1TZO A;  3HJR A;  1LOG A;  5A33 B;  1J3Q A;  1D4M 3;  3VKL A;  1NA1 C;  4EZH A;  4DXS A;  2RVA A;  1QJU 3;  5LWB A;  4Q0U A;  2ZKN A;  1OF4 A;  5HXV A;  4OHV A;  1JZ6 A;  1O6U A;  2VU9 A;  4N53 B;  1JZ7 A;  1RUF 3;  2DUQ A;  4ZU5 A;  2IVJ A;  3ZYG A;  4LOR A;  2RS3 2;  3BVC A;  1C5I A;  4QX8 A;  3ZOI A;  1O3R A;  3SXW A;  2HYX A;  1YQ6 A;  2VCA A;  4V2V A;  1BBT 1;  3OEB A;  4QB1 A;  4LNV A;  3CKH A;  4HK8 A;  5BNN C;  4JGY A;  4WM7 C;  2D93 A;  4NIG A;  1UQX A;  2PHT A;  2VGD A;  2YUE A;  5JR2 A;  2WWJ A;  2R06 1;  3OBA A;  2L9L A;  2JKX A;  2I2S A;  4Y26 A;  5LA9 A;  3ZIX A;  5FZI A;  3WDY A;  4IV3 A;  1V0A A;  2GMP A;  1IG3 A;  4YWA A;  1DQ4 A;  4KWL A;  4CUB A;  3OEA A;  4Q4X 1;  1JS9 A;  2EIE A;  5D8A A;  5LBB A;  1OKQ A;  3D8C A;  5AVP A;  2DUO A;  2Y6F A;  1G9D A;  4OMD A;  2C1F A;  4XMA A;  5ACA 1;  2FDK A;  2B7Y A;  2JD4 A;  3TNQ A;  3KM5 A;  5A1F A;  4CXY A;  2EAA A;  4XDP A;  4XQD A;  4IET A;  1RUI 1;  1CJP A;  1UAI A;  1W8O A;  2VY0 A;  4X6Q B;  2NPI A;  2W08 A;  5KXB A;  1W6P A;  2XVG A;  3VDC A;  4DXR A;  1TME 2;  3P6B A;  2TUN A;  1PO1 3;  1W8F A;  4AEK A;  5C3R A;  2DCJ A;  1O4Y A;  2XBO 3;  1TQ5 A;  5KHH A;  3SKV A;  2DCK A;  1XYN A;  3B3Q E;  1PO2 2;  1ODM A;  3I3B A;  2VQT A;  3VLB B;  2AC1 A;  4GWM A;  3J26 N;  4R4Z A;  3UGF A;  3L9J T;  2WNU C;  4LO8 A;  2VNR A;  3I7D A;  5C6C A;  1ZZC A;  2VBP A;  1ST8 A;  1DF0 A;  1GWM A;  1PK6 A;  3ATG A;  3IB3 A;  1DP0 A;  4M4R A;  4RGG A;  5F5C A;  2YPJ A;  3BKZ A;  3ZN6 A;  2JB8 A;  3VUO A;  1YIP A;  3AZV A;  4LUM A;  3SQO A;  3TN9 1;  3B01 A;  4NAO A;  3S57 A;  3HN1 A;  5EJ1 B;  4GB3 1;  3AFG A;  4P9J A;  4OMC A;  1HXS 3;  3WF0 A;  4MVT A;  5JSO A;  1EP0 A;  2ZMN A;  2YY1 A;  1DGR A;  1BJQ A;  3FE5 A;  1AUY A;  1NE6 A;  1OKO A;  2E63 A;  3RZZ A;  4FAH A;  1XBF A;  2OQ6 A;  1GU3 A;  2VMH A;  2WIN B;  1WGP A;  5FZC A;  4XUR A;  4XCB A;  1F5J A;  1G9A A;  4ITC A;  2RM2 1;  4WZC A;  2OW4 A;  1UMZ A;  4F83 A;  3HMY A;  1AR7 2;  3ZXA C;  4C90 A;  5FP4 A;  5FZO B;  1UMH A;  4IEW A;  4TTG A;  3K48 A;  2P34 A;  1V6L A;  4LKD A;  2Z69 A;  2XQX A;  5JIU A;  4HOO A;  3ZYF A;  1JYW A;  1QXP A;  1LHV A;  2YG0 A;  1AXK A;  2RJK A;  1EY2 A;  3LE0 A;  1LGB A;  1XNC A;  3WG2 A;  5KHJ A;  1O4T A;  4XFC A;  3NNG A;  1I1E A;  1RHI 1;  3MF9 A;  2XDV A;  1N1V A;  2WT2 A;  4JKL A;  4N53 A;  5CKN A;  2LAL A;  3IT8 A;  1A3K A;  5FY9 A;  4YLZ A;  2W95 A;  4ASM B;  4QXH A;  1DZT A;  1UOJ A;  4AL9 A;  4E4D X;  5CA6 A;  2X8K A;  4JKM A;  2WS9 2;  3Q8E A;  4NWW A;  4R9C A;  1G8W A;  1SQ4 A;  2ZAH A;  1TMF 2;  1JOP A;  1W2U A;  1PVX A;  2DBN A;  3FZ3 A;  4HKW A;  4LOS A;  4PI0 A;  4PIX A;  5FZA A;  1ALY A;  1DU3 D;  4QQP A;  1MZE A;  4W6X A;  4DRV A;  3EBR A;  3WW2 A;  1Z7S 2;  2CDP A;  1SHW B;  4S2F A;  5BPX A;  3BOD A;  3INA A;  3WUD A;  3LD8 A;  1S2E A;  3POE A;  4IQP A;  3ILR A;  3K51 A;  3KCY A;  4IGO A;  1UXZ A;  2A6Y A;  4YZ2 A;  3BOW A;  5JZG C;  2YC2 A;  1VAL A;  2CV6 A;  2ZGP A;  4MZU A;  2JIG A;  4I3G A;  1ULP A;  5EQU A;  3WF4 A;  2EXI A;  1C3H A;  1YFU A;  1AXZ A;  2A70 A;  5FZG A;  3RPQ A;  5FPV A;  1JOJ A;  1TMF 1;  4C0H A;  4XAE A;  4BQ1 A;  4QAW A;  3IKW A;  3ZIW A;  2GNM A;  1SMV A;  3K4Z A;  5JVV A;  2YYO A;  1HN1 A;  4NN0 A;  4AK3 A;  1VBC 3;  5FZ7 A;  3H1M A;  4YVW B;  2JEM A;  4FFH A;  3SIS A;  1IG0 A;  1UZZ A;  1E57 A;  1TVG A;  3AKP A;  4M3C F;  2NMO A;  1H30 A;  2WNV C;  5CFD A;  2DVD A;  3WP4 A;  2RS5 2;  5CG8 A;  1RHI 2;  4CDU B;  5DAB A;  3I2O A;  2CGP A;  1W6P B;  1H6X A;  1EAH 2;  1UYX A;  5FRA A;  4Q4W 2;  3VZK A;  2WZR 3;  1C5H A;  1WD4 A;  2ZML A;  4Q4X 3;  2HEW F;  4IEP A;  3WCS A;  2KA3 A;  3LPF A;  1PVC 3;  3C3V A;  1PHM A;  4S2H A;  1U5I A;  1X9T A;  4W4Z A;  3WG4 A;  3V0A B;  1XE0 A;  4QGL A;  4AAP A;  1CGP A;  1ZRE A;  1WW7 A;  4E2Q A;  1AR7 1;  1NCR A;  1LU1 A;  4DFS A;  4ARY A;  1RIR A;  3N4M A;  3DPR B;  1AYM 2;  3ROU A;  3PTY A;  4CDU A;  1CD3 G;  3RZL A;  1YWK A;  3SMH A;  4A3X A;  2ZGO A;  3WG3 A;  5LA1 A;  3CZJ A;  3KGL A;  2OT7 A;  2ZS6 B;  3H3L A;  1B35 B;  1ZBE 1;  3NNF A;  4MH0 E;  4RQP C;  4BWO A;  4B4Q A;  1HDK A;  1VBC 1;  3NJY A;  2XBO 1;  2RM2 2;  3VBH B;  5FLJ A;  1WA6 X;  4M0H A;  5J37 A;  1EV1 2;  4BQ5 A;  1OVP A;  1Z0H A;  3T2P A;  4C8D A;  1GNY A;  1JHJ A;  3TN9 2;  1RED A;  5H9S A;  5C8W A;  1R09 1;  1DCS A;  1S0J A;  3JQX A;  5FDB A;  1KD7 A;  1UPS A;  4AFC A;  1K12 A;  5I0S A;  4XVH A;  4CZS A;  1Y43 B;  3VDD A;  1UY2 A;  2ERF A;  3NV2 A;  3PU3 A;  4YFZ A;  4LKS A;  2Z5W A;  2OXB A;  3OTF A;  4Q0S A;  1SCS A;  2HWE 1;  1OUR A;  3GF6 A;  4XFF A;  3OPW A;  4UAP A;  3ZXJ A;  2ZZQ A;  4CCD A;  2GC0 A;  5CG9 A;  1F9K A;  4CU7 A;  3O1T A;  3ILN A;  1W2N A;  5CBL A;  3CJI C;  4OZX A;  1WLW A;  3L2H A;  2YV8 A;  1ZBA 2;  3AP9 A;  3ES1 A;  3PL0 A;  3T08 A;  3FC0 A;  5C70 A;  2YPD A;  2FMY A;  4LMF A;  1ZBE 3;  1UY1 A;  1UYP A;  1KRI A;  2X5I A;  5C4W C;  3EO6 A;  1HQN A;  3FUO A;  4Z1V A;  4N43 C;  1MEC 3;  2HWD 2;  4TZD A;  4CDX C;  1CIW A;  3Q8A A;  4KI5 M;  5ACA 2;  1YQ2 A;  3G7D A;  3K3N A;  5JUV A;  2Q8O A;  4C1X A;  3KF3 A;  3N7K A;  3WW3 A;  2IXK A;  5BNO B;  4ES8 A;  3PHM A;  5AFE A;  2Y38 A;  4XET A;  4QPG B;  2YXS A;  2O0O A;  2HWF 1;  4Y20 B;  4JGZ C;  5JAX A;  1X33 A;  2CY6 A;  2WDB A;  4LXL A;  3O1U A;  1XOY A;  2Z4F A;  4OVE A;  3WVJ A;  1ZRI A;  4N90 A;  1NCR B;  3N9O A;  2VME A;  3LSD A;  1VLN A;  5FYB A;  2W46 A;  5ANQ A;  2RS1 2;  4CEY C;  4LK6 A;  3KT1 A;  2IXL A;  3BGA A;  2R49 A;  4ARX A;  1KGY A;  1J3R A;  4XPV A;  2ZGU A;  5F2S A;  5FY5 A;  2VG9 A;  1POQ A;  1O4Z A;  3HPN A;  5EPA A;  5A3L A;  2QCS B;  1E5H A;  2IZW A;  3X29 B;  4QT6 A;  4F3J A;  3CEW A;  5E6H A;  3UKT A;  4OQ8 A;  5GJ6 A;  4GWJ A;  3VKM A;  3M3Q A;  5EHD A;  1C8M 3;  3K4D A;  3N9P A;  1OLR A;  3OGR A;  1S1A A;  3I3M A;  1NXD 1;  1LJ7 A;  1TNF A;  4XBL A;  3HR9 A;  2JG9 B;  3B00 A;  3HBK A;  5LA0 A;  2NP0 A;  1OUX A;  5FLH A;  1ULD A;  1PK6 B;  3KV6 A;  3KMH A;  2HWF 3;  4UYB A;  4FPC A;  4MGS A;  2WLP A;  3E1F 1;  4Y22 B;  4MHU A;  1W8U A;  1RUG 3;  5FP7 A;  5FY4 A;  5T5J A;  4W65 A;  1K5J A;  1YJK A;  3VBO A;  3CQO A;  4AFM A;  4C1W A;  1NOV A;  2ARC A;  4ONU A;  4S2G A;  2XR4 A;  2ID4 A;  4KL1 A;  4DUX A;  3IMN A;  3MLK A;  3TEW A;  1GYK A;  3WP5 A;  5FUI A;  3WNN A;  1DLL A;  4Q1P A;  2ARB A;  2QQU A;  2JIC A;  1X9P A;  3AMQ A;  2BWC A;  5IAV A;  3P3N A;  4MXW B;  1YXW A;  1WW4 A;  2RS1 1;  2RDN A;  2YGL A;  3WT3 A;  3ZSJ A;  2BYV E;  4CEW C;  4ZZ5 A;  1VAM A;  4Z82 A;  3JD7 2;  2C26 A;  4P9L A;  3U37 A;  4E4S A;  2W47 A;  3I54 A;  1BCX A;  5DN2 A;  2UWA A;  3VBU C;  4AVT A;  3MPB A;  1DYK A;  3NAP A;  1U12 A;  4XJZ A;  5D8A C;  1HKD A;  4FFF A;  4WM7 B;  3RS6 A;  1BVV A;  1SG3 A;  5DG2 A;  2RJ2 A;  2JDA A;  2BU9 A;  4LBL A;  1GKB A;  5HXM A;  5JXG A;  1NCR C;  2WO3 A;  1Y7B A;  3NNL A;  1MS8 A;  3VHP A;  5FMD A;  3SEE A;  4Q0V A;  4OI4 A;  1V6O A;  3RJ2 X;  1URX A;  1GMM A;  2RJL A;  1CAX B;  4YW3 A;  5CYY A;  4Y5T A;  4CTE A;  2JDH A;  2DVF A;  1NY7 1;  2EID A;  3CHX A;  4R4X A;  3FN9 A;  1HB4 A;  2Q8C A;  2VUJ A;  2J22 A;  4NRQ A;  2DUR A;  3T30 A;  1ZBA 3;  3JB4 C;  4N7I A;  4XF1 A;  4NII A;  5F5A A;  4MGQ A;  1W0O A;  4EJR A;  2R07 2;  2JDU A;  5AC9 3;  3ZXF A;  3MIE A;  2PQS A;  1LRH A;  2J1R A;  3S0M A;  4NVP A;  3GBW A;  2GH8 A;  5FZK A;  1VRH 2;  4YG0 A;  4NMI A;  1MVQ A;  3ZXL A;  2HWE 2;  2H0B A;  2H6B A;  1WLC A;  5IAX A;  3MW3 A;  2D6O X;  1VRH 1;  2G4I A;  2WQZ C;  3OPT A;  3T0A A;  1W3V A;  1A8D A;  5FY1 A;  3M1H A;  4NHX A;  1ENR A;  1SZB A;  2R32 A;  1GUI A;  1F35 A;  1WW6 A;  3R05 A;  1ULC A;  2JE8 A;  5A3T A;  2J1V A;  2MEV 2;  1EV1 3;  1KDM A;  4L2N A;  4IGQ A;  1NY7 2;  4AEJ A;  1W04 A;  4GMP 3;  1HRV 2;  1VBD 3;  2V5D A;  3ZYR A;  5DUU A;  5EV7 A;  3EXU A;  2XVL A;  1HN0 A;  1YNA A;  1KS4 A;  1XNB A;  1OH4 A;  1GWK A;  1O3Q A;  5LW9 A;  3AB0 A;  5GLW A;  1H4G A;  4ASK A;  3BOP A;  5A70 A;  3N7L A;  2MNG A;  3MIB A;  1OLM A;  1DQ5 A;  3S30 A;  1DG6 A;  4KWJ A;  4QPG C;  4Y1Y A;  2VZQ A;  5IK7 A;  2VQA A;  1PVC 2;  4Y1U A;  4JGZ A;  1VRH 3;  1LGC A;  1PM7 A;  2A6Z A;  3OD4 A;  4K40 A;  5FYZ A;  5A3O A;  3QH7 A;  5IVV A;  4XE9 A;  4GKY A;  5LB6 A;  4XEZ A;  3PIG A;  2E31 A;  1ENQ A;  4GA9 A;  4AGG A;  1V00 A;  2BDR A;  4R9A A;  2RS5 3;  2VCC A;  4KU7 A;  1T2X A;  5BNP C;  5C4W B;  1SDW A;  1SFN A;  3IDA A;  3ES4 A;  2JDZ A;  1QJX 2;  1Q43 A;  2E7A A;  2WA3 A;  4M00 A;  4IEU A;  1ASJ 3;  4MXW A;  3HQU A;  4UFK A;  3OBZ A;  4NPM A;  2X09 A;  1GOH A;  5GZE A;  1I5P A;  4GWI A;  4HG6 B;  3IAQ A;  3MV1 1;  2D3R A;  3JQW A;  3LKJ A;  5A6Z A;  3MV0 1;  3JBG 2;  2ZX1 A;  2IXH A;  3OBR A;  5H9R A;  2XJP A;  4QXK A;  1UYZ A;  1OXC A;  1RTV A;  4NE9 A;  3ZFE C;  2DU1 A;  1RUC 1;  2B42 B;  5I8T A;  1QKQ A;  2GAL A;  1ND2 A;  4UF0 B;  3FHA A;  3MO4 A;  2C24 A;  5F5I A;  5JOY A;  4GWN A;  4RYD A;  2RMU 3;  1DYP A;  1JHN A;  3CDZ B;  3FHQ A;  3JD7 3;  2VXJ A;  4K20 A;  4XF4 A;  4YNI A;  1UYY A;  4CEW B;  2RV9 A;  4FAG A;  5FWJ A;  2JDK A;  2ZAA A;  4CP9 A;  2PHR A;  4AI0 A;  2BGC A;  1LHU A;  1AL2 1;  2JG9 A;  4H3W A;  3ZX7 A;  1L7Q A;  5FK8 A;  5G05 L;  3PDQ A;  3ZO0 B;  3LA7 A;  1GNH A;  4Y1Z A;  2Y6G A;  2D44 A;  2FCT A;  5CZK A;  2PHU A;  3POY A;  5E89 A;  3WXP A;  1YC6 1;  2VL4 A;  3GJB A;  5EP9 A;  4P9Y A;  4GXL A;  4BDV B;  5JXH A;  2YZ4 A;  5JI7 A;  4L97 A;  3ZFG B;  3OF1 A;  4RR3 C;  2HKX A;  3J8F 1;  5L19 A;  3O1R A;  3FFQ A;  2DBI A;  1W90 A;  4XUQ A;  4QPI B;  2WFF 2;  3O0V A;  3OUH A;  4HN0 A;  4LHK A;  2XB6 C;  5F8P A;  2XG3 A;  4HL0 A;  4KG0 A;  3UES A;  4BK5 A;  4Z92 B;  1QGL A;  2ZGN A;  4Q29 A;  5F5Q A;  2XJQ A;  4ATE A;  1QOS A;  1DZR A;  2DTY A;  1SBE A;  1NA1 A;  2ZGT A;  1STM A;  2Q1Z B;  4Q0Q A;  5DAW A;  4IEY A;  3E5U A;  1JTZ X;  3D5O A;  1JUI A;  2C9A A;  1CJD A;  2DDU A;  2PA7 A;  4YZ5 A;  1I9R A;  2FCU A;  2EIC A;  3PNA A;  3W21 A;  4QX0 A;  1QU0 A;  1U5Y A;  2ZGM A;  4LLF A;  3O1S A;  1AL0 G;  3KLS A;  2BFU L;  4X8N A;  2ZJC A;  4XDO A;  1H2M A;  2WR9 A;  1HRV 3;  4MGK E;  4CCJ A;  1ZBA 1;  4IDZ A;  3URF A;  4OUL A;  1AX2 A;  2WT0 A;  1ND3 B;  4K6B A;  4WM7 A;  4CEY B;  4QKB A;  2PHD A;  2Y26 A;  4XFA A;  1HXS 2;  2ZEY A;  1EPW A;  4OZO A;  2UYA A;  5C9A B;  3V0B A;  5ABJ A;  3J8F 3;  4XAA A;  4EN7 B;  4F8A A;  3JZV A;  2MEV 3;  2FQP A;  2P37 A;  4HVR A;  4K7J A;  2DYC A;  2ZGS A;  1U0A A;  3ACI A;  4XJ9 A;  5FMO S;  1AR8 3;  4P02 B;  4DIN B;  2JIJ A;  4P5Y A;  4JAA A;  3UT0 A;  4IV1 C;  5IT6 A;  4EV0 A;  1R09 2;  1Y3T A;  3MIG A;  3KT4 A;  1GZT A;  2IFW A;  1LR5 A;  3ON7 A;  1SLB A;  3POB A;  4GD4 A;  2VNG A;  3MF6 A;  4YPJ A;  1VP6 A;  4XUO A;  2Q1M A;  4QGM A;  4PQQ A;  4OHW A;  3S7E A;  1QJZ A;  2XBO 2;  3H9A A;  1M4W A;  4HVO A;  2O8Q A;  2Z42 A;  2IXJ A;  2P3K A;  2ATF A;  1PO1 1;  5LRR A;  3ORJ A;  4PLO A;  1C8N A;  2ZGR A;  1TEI A;  4XJU A;  4AOC A;  1UN1 A;  1C28 A;  2BJS A;  2C9K A;  3W20 A;  5E88 A;  1W39 A;  2CWS A;  1W6N A;  4LHL A;  5C8C C;  3APB A;  1RB8 G;  2DCZ A;  2YBP A;  2TEP A;  4JVA A;  4H2A A;  3NV4 A;  5AVA A;  3B94 A;  4CCC A;  4YZ3 A;  2HBU A;  3FL7 A;  1AZD A;  4XOG A;  3SCG A;  3THP A;  3V0A A;  3MW2 A;  3RZK A;  2VOK A;  3AC0 A;  3MIC A;  4FPH A;  1FMD 1;  1NCQ A;  2CGN A;  2RS5 1;  3A7Q A;  4BLJ A;  3PLQ A;  3J8F 2;  3WQB A;  3RWN A;  4AF9 A;  5B4N A;  2WN2 A;  5FYV A;  3JCI A;  2UUR A;  3H8R A;  1UZW A;  4MHR A;  4RGK A;  4YVW A;  4QGN A;  1V6N A;  1AVB A;  2IXC A;  4YM2 A;  3ACL A;  4DUV A;  4Q4V 3;  5L7O B;  2YRO A;  3ME2 A;  4I0W B;  3ZFF A;  3H3U A;  2RS3 1;  1OQ1 A;  2J1E A;  1C57 A;  2RDR A;  3C7E A;  3GZT B;  1CAW B;  4D6S A;  3NWK A;  3A21 A;  4YW1 A;  1RYY A;  2QBX A;  2UU8 A;  3M3E A;  4FPG A;  3K2O A;  1OC1 A;  1RUG 2;  1ZZ7 A;  4TSV A;  1B35 C;  1JYT A;  1QXJ A;  4O65 A;  4FP3 A;  1W2A X;  4JV4 A;  3DXU A;  4Z8B A;  1QQP 1;  2D3S A;  2MHF A;  3NJV A;  4Y4Y A;  3N9M A;  1GSL A;  1SPP B;  1AL2 3;  3WHU A;  1YEW A;  4PLN A;  1H8T C;  4PDW A;  4UBG A;  3LOB A;  1C8M 2;  1D0G A;  1FAT A;  1H6Y A;  2HH9 A;  1BK0 A;  2W1Q A;  5DZE A;  3ACF A;  3V0B B;  4ISR A;  3CIH A;  3EYP A;  1BBT 3;  4TWT A;  4D0Q A;  1OT5 A;  4EN9 B;  5BNN A;  1ND3 A;  2AGS A;  5FO9 B;  1OQE A;  5CAD A;  2WSU A;  2VZR A;  4Q5O A;  4P14 A;  3RRD A;  3WDW A;  2VBB A;  1XYP A;  1RGS A;  4RR3 A;  5GAL A;  2WLQ A;  2OX0 A;  3N9N A;  4COU A;  4LBJ A;  5IK5 A;  2WWU A;  1R08 3;  1J58 A;  2YFU A;  3N9Q A;  1QJY 2;  5DQ0 A;  2D6K A;  2VBD A;  2OII A;  2JD9 A;  4NRP A;  2BOJ A;  2ZEW A;  2VW0 A;  3S6P A;  2XJT A;  3CL1 A;  3P5B A;  3PVO A;  4XTM A;  1WMD A;  1NQD A;  1O5L A;  1LHW A;  1WW5 A;  4ZHN A;  2WRA A;  4D7Y A;  4BQX A;  1XU2 A;  5HCH A;  4XFH A;  1XNA A;  2DUP A;  4N8M A;  1MS4 A;  2X10 A;  3B9C A;  4AED A;  3U0Z A;  4AYU A;  1RJ8 A;  2C5D A;  2WS9 3;  3CF6 E;  2HWD 3;  1MEC 2;  4FTE A;  1XQN A;  4XXA A;  3VBH C;  1BEV 1;  4HXC A;  1AR9 3;  1ASJ 2;  4ZY9 A;  3ZR5 A;  5H9P A;  4B1L A;  2P4E A;  2ARE A;  3MID A;  2XJS A;  2FDH A;  5FYI A;  4E8C A;  1MS9 A;  5JMO A;  4QB2 A;  3H50 A;  3A0K A;  3PU8 A;  2PLV 1;  4K8F A;  5FZH A;  4XJ8 A;  1RMU 2;  3B02 A;  2H6C A;  2AEY A;  2E53 A;  1CAU A;  2O8O A;  2D98 A;  2UWB A;  2RR1 1;  3LEG A;  5J3U A;  1QH7 A;  5C8C B;  3HT1 A;  3PUA A;  2VR4 A;  2XGX A;  1VE0 A;  3L2Y A;  3N3H A;  4YGD A;  1AR7 3;  4L11 A;  4FBF A;  1GIC A;  3R0R A;  4KGG A;  5I8S A;  4OQ9 A;  3UJO A;  2R07 1;  2WQ4 A;  3GHN A;  3U78 A;  2W91 A;  2HEY F;  2JG8 B;  3AKR A;  3NJX A;  1DZQ A;  1PZ9 A;  3MI8 A;  3D0S A;  3H1Y A;  5FZ9 A;  1UW8 A;  4M3C B;  3P3P A;  1QOT A;  2CGO A;  2VOW A;  2FMD A;  1W9Y A;  5JOZ A;  4LQR A;  1YLL A;  2WZP P;  1J3P A;  4NRM A;  2A6V A;  2ETE A;  4AWD A;  1VBD 1;  4ZU7 A;  3QH6 A;  2VW2 A;  3VZO A;  4YZ1 A;  4WVV A;  4B7K A;  2VC9 A;  5IK8 A;  4MUV A;  4ASL A;  4NHK A;  3EQE A;  2ZHL A;  3RG0 A;  2HWC 2;  4FPE A;  4FPK A;  5AFB A;  2WUH A;  5T5P A;  5KR7 A;  3WF3 A;  4X8P A;  4IV3 B;  4A6S A;  3VL8 A;  4JGZ B;  3WP6 A;  5GZG A;  1VMH A;  2HWE 3;  1CIY A;  2HLE A;  5F3I A;  2QQN A;  2CTV A;  5FPZ A;  5FZE A;  3WDV A;  2D40 A;  2D5F A;  2VZ1 A;  4MGI E;  5FRE A;  5FXW A;  4BMB A;  4LBQ D;  4AHX A;  5A1A A;  5FPL A;  3VBU B;  1QF3 A;  2G1M A;  1EAH 3;  1MS3 A;  4HK9 A;  1V9U 2;  4BIF A;  2R07 3;  4L99 A;  4CRQ A;  4DY3 A;  5L9B A;  4HPK A;  1HQL A;  3LEM A;  4XJA A;  4PF1 A;  1TME 3;  4A41 A;  2QQI A;  4MXV A;  1O8S A;  4AI9 A;  4JKK A;  1H8T B;  2XKO A;  1T6B X;  4UFM A;  5CEH A;  3EHK A;  2B8M A;  3C7G A;  3KF5 A;  5KXE A;  3MLL A;  4LKE A;  1YCI A;  4K8R B;  2E6V A;  4AHY A;  5F2W A;  4AVA A;  2V09 A;  4QKD A;  4RA0 A;  1CZV A;  4E9K A;  3VZJ A;  1GWL A;  4HET A;  2ZPX A;  2VZO A;  2WT1 A;  4FPJ A;  4OUM A;  4B4R A;  2WQ8 A;  4P9W A;  3T1L A;  3TOJ A;  5FPU A;  4HBN A;  1WME A;  1H2L A;  4IEO A;  5KHI A;  5FZM A;  3H8O A;  5DDJ 1;  4XHB A;  5I0D A;  1D4M 1;  2VEC A;  1UO9 A;  2SLI A;  4J6G A;  4PDW C;  2B5H A;  5FYM A;  1ULO A;  3UET A;  4X6R B;  3VKF C;  1DFQ A;  2YGM A;  1HJG A;  3CJI B;  4L92 A;  1ZA7 A;  5L7O C;  2FBE A;  5DUV A;  2JG9 C;  3MIH A;  1V70 A;  5HV4 A;  3AYC A;  4Q27 A;  5F1R A;  4J25 A;  4AQ6 A;  2OUH A;  2VZS A;  3TAY A;  1NXM A;  3DGT A;  4BHP A;  1UNB A;  1RUE 2;  4YGB A;  1IS3 A;  2PQQ A;  4YSF A;  2WNV A;  5CFD C;  2ZHN A;  3WNO A;  4OHY A;  1IZ3 A;  1UD1 A;  1X8E A;  3IAP A;  1GZW A;  1SFP A;  3I97 A;  1VBA 3;  4IEV A;  5FZL A;  4JGY C;  4BXS V;  4JTO A;  4D7S A;  4D7T A;  4AG4 A;  2IC1 A;  4ATF A;  1Q8V A;  4QHB A;  1QOO A;  4RGA A;  1A34 A;  3HD8 B;  4LPL A;  4QM9 A;  5IVY A;  5HCA A;  4OLL A;  4XBQ A;  4XYX A;  1J59 A;  5A80 A;  2HWF 2;  4FP2 A;  3AP4 A;  3OGS A;  2HWC 3;  3EMR A;  3NNJ A;  4YM1 A;  2W68 A;  3QAC A;  1OA2 A;  3DKQ A;  2OA2 A;  4IER A;  4Z2A A;  1EUU A;  5J96 B;  4CDU C;  4A2U A;  3N7J A;  3DV8 A;  2UWC A;  3AVS A;  1O7F A;  2HWD 1;  5K0U B;  3ZPY A;  2ZGL A;  1JZ5 A;  3I4I A;  1OA4 A;  2AH2 A;  1XNK A;  5GLT A;  2GN3 A;  3ELN A;  3RDI A;  2YU2 A;  2Y0O A;  4AFD A;  5CFC C;  4NHL A;  3WOG A;  1CWP A;  1J84 A;  4AQ2 A;  4A6O A;  4QX2 A;  4BME A;  1D4V B;  3O1O A;  5FYU A;  2D6N A;  2VO5 A;  4FTB A;  1GOG A;  2RS1 3;  4MX3 A;  2JE7 A;  1LHN A;  5ABJ C;  5BNP B;  4NAM A;  1G6N A;  4BA6 A;  1VJ2 A;  2ENR A;  2W0X A;  3AK0 A;  5DXD A;  3AKS A;  1W28 A;  1PNG A;  1PMH X;  3USU B;  2VUA A;  1RMU 3;  2IVI B;  1IGO A;  1D2S A;  5HV0 A;  3I2G A;  4KBZ A;  2JDM A;  2NN8 A;  2ZXQ A;  3PUS A;  2Z79 A;  5LBC A;  1U5Z A;  3GDB A;  5SV8 A;  4RS5 B;  3KQ4 B;  2PAE A;  3QD6 A;  1W8H A;  2E32 A;  1LEN A;  4Y4R A;  2E33 A;  3KSC A;  3T2O A;  1PO2 3;  3AFK A;  1G9F A;  2Y60 A;  3LZZ A;  1WCK A;  5FZ1 A;  3BU0 A;  4WM8 A;  2QQM A;  2WYF A;  4WBB A;  5FYH A;  1CN1 A;  4O7X A;  5A6Y A;  1CAV B;  4CA9 A;  3TRS B;  1BZW A;  1ZBE 2;  3U14 A;  1DGR N;  1A6C A;  1DBN A;  3POG A;  1KFX L;  1GR3 A;  2DFB A;  2PYT A;  4OYU A;  4Q2F A;  5J09 A;  2IXI A;  4YM0 A;  4D3W A;  5AC9 1;  5A3N A;  2JE9 A;  2Q5T A;  4HSJ A;  4URA A;  3H42 B;  1S0D A;  4XC9 A;  2ARX A;  4NWV A;  5JSP A;  1BYH A;  3ACH A;  4P9I A;  2PAM A;  3VHN A;  3OD0 A;  1LEC A;  3ENR A;  1UZY A;  4AQT A;  4FXK B;  2BNO A;  1IS5 A;  4L0P A;  2LM3 A;  3AKT A;  2QQK A;  1FOD 1;  4IE4 A;  1EAH 1;  2ZX4 A;  1AXY A;  4S2D A;  5F9T A;  1N3O A;  3GCX A;  5KHG A;  1J1L A;  1W0N A;  3AMM A;  1MZ6 A;  2FZ2 A;  1F5F A;  4NUB A;  3M8L A;  2Q8D A;  1WD3 A;  3WDU A;  2MPF A;  2Z2S B;  4XF0 A;  1PGW 1;  1PIV 3;  5SV5 A;  2RM2 3;  4IL7 A;  1VBE 3;  3VD4 A;  3I2J A;  1RIT A;  3ZM8 A;  1SBF A;  3NAP B;  4Q4Y 2;  1XPW A;  3ZN4 A;  5IVF A;  4MLO A;  1MS5 A;  2VD7 A;  2VMC A;  3KZ4 C;  1UKG A;  1XB9 A;  1R1Z A;  2BUK A;  4MV2 A;  5A7P A;  3IIA A;  2CHH A;  4R9D A;  1YIF A;  4CXX A;  2SBA A;  4FOV A;  3KV4 A;  4FPL A;  3LB9 A;  3MPP G;  3S5Q A;  2QE3 A;  5EZW A;  3MZH A;  3HNB M;  4YM3 A;  1XSR A;  1RUH 3;  3WLU A;  2QUO A;  4W8J A;  4COZ A;  5T5O A;  1JZ8 A;  2PTM A;  1H1M A;  5JR7 B;  1QXR A;  3PME A;  2ZX2 A;  5C9A C;  1QJY 1;  3POI A;  2WZR 2;  1EYB A;  3VHO A;  1GP5 A;  1UU5 A;  1FOD 3;  2Y64 A;  1JYX A;  3SLI A;  1OOP C;  2ZAC A;  3USU A;  3M3I A;  4JHZ A;  1D2Q A;  2Y34 A;  1ND2 B;  2RHP A;  3KV9 A;  4Q4Y 3;  5FWE A;  1SAC A;  4E4Z A;  1NLS A;  1ZA4 A;  2OZ6 A;  5IFP A;  3FLR A;  4JZR A;  4DNY A;  5LZ6 A;  5ISL A;  1PIV 2;  5IUQ A;  2BVB A;  5DAP A;  2F17 A;  4LLO A;  3UV9 A;  3VD9 A;  4EYU A;  5A3P A;  3JU9 A;  5FZ4 A;  2BWA A;  4A4A A;  3ZFG C;  4V2W A;  4WZF A;  1R08 1;  4PHZ A;  4HVQ A;  3B9I A;  3AMH A;  4ERO A;  3Q8C A;  1QQP 2;  3R4D B;  3BPS A;  1X7N A;  1Y9M A;  4I2O A;  3I8T A;  3DL3 A;  2TNF A;  4MET A;  3VBR B;  4UW5 A;  4DEV A;  5CU1 A;  2GNB A;  3QOP A;  1V6J A;  3F2Z A;  5JPN B;  4DQA A;  1I6X A;  1G86 A;  3MFA A;  1EPZ A;  4EWE A;  1G7Y A;  4XZP A;  4L8Q A;  1KJR A;  4QU2 A;  2ZOE B;  4LOT A;  3LOI A;  2X05 A;  1AF9 A;  1RVF 2;  4RHV 3;  5FQ0 B;  1GLH A;  4RS5 C;  1Z78 A;  1CPM A;  5A1L A;  4XDQ A;  2ZAB A;  5FZ3 A;  3AM2 A;  4Y24 A;  1NA1 B;  2R06 3;  4GB3 2;  3B93 A;  2RDQ A;  1NAE A;  3BTZ A;  3K46 A;  2PLV 3;  2GC2 A;  3M3C A;  5GKA C;  1O3S A;  3IDC B;  4AE2 A;  1OBN A;  1PZ8 A;  1UY3 A;  1N3Q A;  2A71 A;  3GCW A;  4YG6 A;  3RMX A; 
#chains in the Genus database with same CATH homology
 4NRM A;  4IE7 A;  4NRQ A;  3O1T A;  3H8R A;  3RZJ A;  4MG2 A;  3S57 A;  4JHT A;  4NII A;  4ZHN A;  3H8X A;  3RZM A;  3BIE A;  4ZS3 A;  5DAB A;  5F8P A;  4NPL A;  3O1U A;  4O61 A;  3I2O A;  4MGT A;  2FDJ A;  4NIH A;  3BI3 A;  4OCT A;  3I49 A;  4NIG A;  4IE5 A;  3RZH A;  3T3Y A;  4CXX A;  2FDF A;  4QKD A;  2FDG A;  3S5A A;  3BTX A;  4QHO A;  4NPM A;  4NRO A;  4IE0 A;  4RFR B;  3RZG A;  3BU0 A;  3O1P A;  4IE4 A;  4NID A;  2FDI A;  4QKN A;  3O1O A;  3BTZ A;  3O1M A;  3O1S A;  2IUW A;  4O7X A;  2FD8 A;  3BUC A;  3I3Q A;  4QKF A;  3LFM A;  3O1V A;  3T4V A;  4NJ4 A;  3H8O A;  4IE6 A;  3RZK A;  4ZS2 A;  4NRP A;  4IDZ A;  3O1R A;  3KHC A;  3T4H B;  3BTY A;  3RZL A;  2FDH A;  3BKZ A;  2FDK A;  4CXW A;  3KHB A;  4CXY A;  3I3M A;  4QKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...