3I3QA

Crystal structure of alkb in complex with mn(ii) and 2-oxoglutarate
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
203
structure length
203
Chain Sequence
EPLAAGAVILRRFAFNAAEQLIRDINDVASQSPFRQMVTPGGYTMSVAMTNCGHLGWTTHRQGYLYSPIDPQTNKPWPAMPQSFHNLCQRAATAAGYPDFQPDACLINRYAPGAKLSLHQDKDEPDLRAPIVSVSLGLPAIFQFGGLKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPLKAGFHPLTIDCRYNLTFRQAGKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-ketoglutarate-dependent dioxygenase alkB
publication title Enzymological and structural studies of the mechanism of promiscuous substrate recognition by the oxidative DNA repair enzyme AlkB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 51
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 1.14.11.33: DNA oxidative demethylase.
pdb deposition date 2009-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 3i3qA00
3KHCA 4NPMA 4RFRB 3S5AA 3H8OA 2FDIA 3BU0A 5F8PA 4NRPA 2FD8A 3H8RA 2IUWA 3O1PA 3O1OA 3O1VA 4ZS2A 3T4HB 4IE4A 3RZGA 3I3QA 4O7XA 2FDFA 4CXYA 3RZHA 4NJ4A 4CXXA 4JHTA 4NIDA 3RZJA 4ZHNA 3S57A 2FDHA 3RZMA 3BKZA 4MGTA 4NPLA 4MG2A 4O61A 4ZS3A 3O1MA 3I49A 4OCTA 4NIGA 5DABA 3T4VA 4QHOA 3LFMA 4QKDA 4QKFA 3O1TA 3BIEA 3BTZA 4IE7A 4IE6A 3T3YA 3BI3A 3O1UA 3H8XA 3O1SA 3RZLA 4NROA 3RZKA 3KHBA 4NRQA 4QKNA 3I3MA 3O1RA 4NIHA 3I2OA 3BUCA 2FDGA 4QKBA 3BTYA 2FDKA 2FDJA 4IE0A 4NIIA 3BTXA 4IDZA 4NRMA 4CXWA 4IE5A
chains in the Genus database with same CATH superfamily
3ZR6A 1TVGA 2YB7A 1BBT3 2JDMA 2GNMA 1GBGA 1H2NA 4O9GA 1HRV3 3H8OA 2W3JA 1SBDA 4I0BA 4AFAA 1QJU1 1WLDA 2O1QA 4AI0A 2JDKA 2WA4A 1OHFA 1OPOA 4AI3A 5LW9A 2FZ2A 4AGGA 2QZ3A 4LKSA 1ZBA2 4QX3A 2WQ8A 4F7ZA 2OUHA 1EV12 2VMCA 4OVEA 5EQUA 1ZX5A 3ZKYA 1AUYA 1BEV2 2WZEA 1DQ1A 3J9SA 1LCLA 3VBSA 3O1VA 3BU7A 1D0HA 4WM7B 5F2WA 1X9TA 3HT2A 4Y1XA 5J7MA 5KR7A 3ETPA 5A70A 2WRAA 1QEXA 1VBA3 4AEDB 3A0NA 2EIBA 4UOJA 4DMIA 3E5XA 4LR4A 4PI0A 4AEKA 4MLOA 2VJXA 2CGPA 5SV5A 2BPA2 3G7DA 3BODA 4LO8A 3QH7A 2BW8A 3NJYA 2J1VA 2UWCA 3NV4A 1I6XA 4U36A 4W6XA 1VBC3 3K77A 4MGTA 3BGAA 5ACA1 3OG2A 2YMZA 1BJQA 1PIV3 1ULPA 2WINB 3WLUA 1N1YA 1Y4WA 4JGYA 2EIDA 1MVQA 1EP0A 4JGZB 2MNGA 1W6PB 1W2UA 1WGPA 5FZDA 5CFDB 3FHIB 1ZM1A 4YW2A 3I3EA 1AX0A 2NZ9A 1UKGA 3ASIA 1OOPA 4GWIA 1YQ5A 5JCTA 4K7JA 1J84A 4GB32 1ZVFA 2JB8A 3PVBB 2N7GA 1KJLA 5A3WA 2GP3A 3WHTA 3QLQA 5F1RA 2E33A 4ORFA 4AQ2A 5DABA 3PJQA 1UMZA 4JDOA 3VBOB 4LBOA 1HQWA 2VBDA 3J7MA 2QQPA 4HVOA 4CDQC 3LZZA 5IVJA 5J3UA 3HD8B 1BVVA 4KWLA 3LD8A 2KR2A 1OLME 3EB7A 4XABA 5JIAA 1Q8VA 1K12A 2BWAA 3RJRA 1PK6C 1LGCA 4IV3A 3N7KA 2PXJA 2VZOA 1RMU2 3GGLA 2VOVA 1YJLA 3VZMA 3LDBA 3LCPA 1COV1 4HVRA 4FPOB 3UKTA 4NIAA 4Q8KA 1HV1A 3VZLA 4DUVA 1S0JA 4GZ9A 1SLTA 1W06A 1NA1C 2DWRA 4UAPA 5KXEA 3KVAA 3MUZ1 4TYSA 1GZ9A 3CJXA 2TUNA 2OW4A 1ALYA 1VBD3 2VNRA 2IVIB 4RSUA 4EV0A 4OMDA 3RWKX 5I91A 4NIHA 4P9YA 2XKPA 2X09A 1EYBA 1NQJA 2WWUA 2W1WA 5LA2A 1S0EA 1WMXA 1ASJ1 3P3NA 3WW1A 3ZXJA 4IE0A 4Q4V2 1AL23 1RUJ2 3KT1A 1CVNA 4B7KA 4E2QA 3RYPA 2BNOA 4TLFA 3UJOA 1FOD3 3NAPB 4L0PA 3JQWA 5FYZA 2GNTA 3JZVA 2CHHA 2HJIA 1CJPA 4C91A 1RJ7A 5FY1A 1H6YA 5C9AB 1R1A2 4ISQA 4QXKA 4Q0PA 1MVEA 3OGGA 4CCJA 3CQOA 1JZ6A 1CPNA 2FD8A 4WM7C 4LBKA 3HPNA 3JBG2 3K4ZA 4HN0A 1F15A 4LQRA 4DY5A 5AC93 5G05L 4AHXA 4S2FA 5ABJB 2NPIA 1W3XA 3U4SA 1OF4A 4HOOA 5FYCA 1AR63 2WS91 1YQ6A 3RZGA 4UF0A 3J8F1 3VD9A 1FV2A 4Y33A 4QQPA 3QOPA 4O7XA 3LSEA 3NNJA 1RVF3 3CO2A 3RZHA 3RG0A 1ND3A 2R6QA 1V9U2 1ZBE2 3BALA 4V1PA 2ZOEB 1Y9GA 4ZU7A 1YCIA 4JKMA 4WZCA 1UY4A 3MUY1 5FMCA 1J58A 4HVQA 5KWRA 1QJX1 2AREA 5C4WB 4R9DA 1WLTA 4QD2A 5HXMA 3VD4A 3PVEA 3KVBA 2WZ8A 2BU9A 2EICA 2WNVA 2A3WA 3Q8BA 1DZRA 3AZZA 5A80A 4JGZC 1AR82 1J83A 1Q8QA 2ZXQA 4DIQA 1QHDA 1YIPA 4JQRA 4JRLA 1G9FA 3QBQA 2BVVA 3NNMA 3S6PA 5FFOC 5FYTA 3ZIWA 3BOPA 3MPPG 3U37A 5IVCA 3WSOA 1PMIA 2QQLA 1LGNA 2E7TA 3B9IA 1M06G 1PMJX 1ULDA 4RR3B 1O59A 1VP6A 2MEV2 1IS6A 3WNXA 2X5IB 1UW8A 4CSWA 2VZRA 2Y6KA 4DXTA 1YJKA 3RYKA 1PX4A 2DCJA 1MS1A 3WF3A 3FC0A 4YW4A 3VBOC 1ULGA 2YROA 1CX1A 2VR4A 2E51A 4XE9A 4N53B 3VHRA 1WD3A 4AAXA 3E1F1 1UQXA 4DFSA 5J36A 4GXLA 1JN2P 1Q56A 2AGSA 1G8WA 3USSA 3ZSKA 5FQ0A 4Q0SA 1CIWA 1SPPA 4DZGA 5EJZB 1I9RA 1W6QB 1UOGA 1RUI3 3GJAA 4XUTA 4B8EA 3SITA 1ENSA 1HXS2 4XF9A 4HLTA 1XQNA 2P3JA 3IM0A 3KCYA 2AR6A 4QWNA 4YW1A 5FPAA 2VMFA 4XJZA 1F9KA 4A42A 1GUIA 1W39A 1ZBA1 5BXXA 3GZEA 3HR9A 4YFZA 4XW3A 5C3SA 3LPGA 5A7SA 3HAGA 1S0IA 3JB8A 2RDSA 5GZGA 3H1WA 2AH2A 1JOPA 2J7MA 2O8OA 4FQ4A 3H0OA 5KXBA 4OZXA 1Z7S3 2VOWA 2QDRA 5HCHA 4V2VA 5FJKA 2R1BA 2PHRA 3MF6A 4Q29A 4OHYA 1LU1A 1MZ5A 4LKFA 1TMF2 3M8LA 4CU8A 4RS5B 3NV3A 3OGSA 1OLRA 2P3KA 5C9AC 4HXCA 4AFMA 3FE5A 2D40A 3P3PA 3HMYA 3I2GA 1JOBA 1RITA 1UY1A 2GDFA 3B00A 1N1SA 1O4ZA 3D82A 4NIDA 1RUOA 2P1BA 4NHXA 2WZR3 3IPVA 4WBBA 5HI0A 1X8MA 3ELNA 3GDBA 1IQDC 1GV9A 1W90A 5JIUA 3APBA 1W3VA 3ZXFA 3UNPA 2DVFA 3O0WA 2SBAA 5LY1A 4GAZA 2W68A 4GIQA 3MICA 4RL7A 3AYEA 5KHIA 4CEWB 4MX3A 3V0BB 1C4RA 4D6QA 3N9OA 3D0JA 4L2NA 4C8DA 4BXFA 4IW3A 4CDWA 2FDFA 1GICA 4CXXA 5C4WC 4XCAA 4PDWB 4GB31 4GJZA 2VOKA 1SFYA 5FY9A 3ATGA 4AWDA 5FPZA 1AR71 1RUE3 3SH3A 1UZYA 4OMCA 1NXMA 3LE0A 3PUSA 3ZX7A 2IVJA 3Q8AA 4XACA 4QHZA 2FDHA 3CNAA 3PL0A 5A6ZA 2QJVA 1W2OA 2HWF1 4JQTA 3VBHB 4E4HA 5FXVA 5FPXA 5GZCA 3TRSB 4DO0A 4NPLA 4Y22A 3WV6A 4KG8A 2PHXA 3RRDA 1K42A 4ZS3A 4W4ZA 2A1XA 2GH2A 2IXLA 2WYFA 4XJWA 2NP0A 2VG9A 2ERFA 3LDRA 4EROA 3A0KA 3NJVA 5C71A 3V56A 4RR3C 4Y1YA 4QPGB 4GQ7A 3POFA 1U5ZA 2X5IC 2QQIA 1W8HA 3W5NA 1ULOA 5J96B 1PO12 4WVMA 4ATFA 1RMU1 3PMSA 5IVYA 4A41A 1FATA 2VBBA 2LROA 2IXIA 5IK8A 3K75B 5K7PA 3HNMA 3ZPYA 3WNKA 2VNVA 2QQVA 4WM8A 1LHNA 1I5ZA 4A7KA 1PGL2 1MS9A 1LODA 1TG7A 1RC6A 4HETA 4XIOA 3RI8A 1OH4A 3N7MA 5CFCB 2AZ5A 2EIGA 2I07B 1PM7A 1REDA 3C7FA 1YWKA 3I2IA 3WW3A 3VKLA 1S0BA 1ZZ7A 2RDQA 4YM2A 4D7SA 5F3GA 2DFBA 4Q4V1 1ZRDA 4YG6A 1RUJ1 3M3IA 4IUGA 5EV7A 4RGKA 3DPRB 4CE8A 3AMHA 2HWB1 1XXNA 5ACA3 3D3AA 1WW6A 2A73B 5A7WA 3BCWA 1MACA 2QQOA 3HT1A 4PIYA 1O5UA 3JB4C 2XQXA 4UBHA 4YGEA 1K5JA 1F5FA 1QDOA 2QE3A 2EF6A 1R1A1 2IZWA 4XUQA 3O1SA 3HBZA 1UXZA 1VRH3 3HWJA 4HK8A 1VBB3 5FZGA 1UXXX 4RN5A 3JBG1 3POGA 2JWPA 1C8NA 3B02A 1RUD2 3SHRA 4IEVA 4QAWA 4YFWA 3MLJA 4M4PA 4SBVA 5IT6A 4BHPA 1GWKA 2PAEA 4IV1A 2G9ZA 4BMBA 1JYIA 1HB2A 1O3QA 4MH0E 4HL0A 5FYBA 4RS5C 1IG0A 2E6VA 3VDBA 1JZ7A 4A45A 1XNBA 1SG3A 5FCCA 3HOBA 2BFUS 3AP7A 1K5MC 3GHNA 1CR7A 3GCXA 3K48A 4LBLA 4CUGA 1POQA 4AHYA 1CAWB 3RSJA 5FY4A 3IN9A 5FXXA 2OIIA 4D8MA 4XXPA 2NMNA 2ZGOA 5KC5A 1QWRA 4IEYA 2ZGLA 5CZKA 4YZ3A 4FTEA 3VL8A 1DP0A 1IG3A 1WCQA 5CNAA 4AVTA 1DDLA 3OUIA 3UV9A 2VTFA 4CP9B 2WBKA 3H8RA 1PO23 4P5YA 5FP7A 3C7HA 2WZPP 5C6CA 4CEWC 4AZZA 4IEQA 1AR81 1MQTC 3O1PA 4QB2A 5M0TA 5K0UC 1C1FA 3FUQA 4ZS2A 4EYUA 1SLCA 4PIXA 1S4CA 1R083 4CDUA 1ST8A 5IFTA 3EMRA 3U07A 3KGZA 5FO8B 1PVC2 2GU9A 3R4SA 3SH4A 5DDJ1 4J25A 5AVPA 2MEV1 2ZGPA 4OQ9A 4PT6A 3P5BA 2ETEA 4Y4RA 3OPZA 3ZXAC 5J1XA 3AL5A 3MHZA 4COYA 2Y0IA 3LSDA 2W9XA 3ZDVA 5BNOB 5F6KA 1G9AA 1NXD1 5FPVA 2PTMA 2Y6LA 2GC0A 4D7YA 3O12A 1SEFA 1X50A 5IW0A 1VE0A 2QBXA 2WDBA 3WX5A 3W5MA 2WFPA 1AYN2 4GALA 2XVKA 3EHKA 3OD4A 3SC7X 3TAYA 4AEJA 5I8TA 3BYWA 5FYUA 1EY2A 2NLRA 1DCSA 2WAAA 4XXAA 3MDPA 3I2JA 5JZGA 3NMBA 4IEUA 4XQ4A 3CJIC 2QDNA 1CAVB 3FLTA 2Q8OA 3I97A 2GMPA 1HXS1 2DU1A 2RJ2A 1EPZA 3KF5A 3M2MA 2HEYF 2VE1A 3DN7A 2JG8A 3POSA 4IETA 1GOGA 2WS93 3OUHA 4N43A 5GLUA 3UKNA 3WP6A 1GP4A 4R9AA 1CX4A 1CQ9A 1QJU2 1BKZA 1D4M2 1N1VA 4INDA 3J26N 5LK7B 5FZKA 1UU6A 4RQPA 5AFBA 4Z8BA 3NVCA 1D4VB 4XBQA 5HV0A 2OPKA 3ME2A 2VZQA 4QQHA 4B4RA 1W8TA 2E63A 3VHNA 2RS32 1POV1 3D6EA 4J1WA 4MO3M 4YVSA 3DKQA 4URTA 3AMMA 3DPRC 4LUMA 3VBSB 3VHPA 4KGQA 2B39A 1J3RA 1ENXA 1RHI1 1WCDJ 3LA2A 4IEOA 3JCIA 4Q0QA 4TTGA 1Z0HA 2JD9A 2R16A 1LOCA 2A5ZA 3C7OA 2WO2A 2R49A 4Q4X2 1TMF1 1VMFA 2YGMA 4AFBA 4CCLA 2NN8A 1FI2A 1BHGA 2YU2A 1RINA 3OBAA 1RYYA 4K3UA 1JZ8A 1O3SA 2QQJA 3KMHA 3MW2A 5FTTC 4KL1A 4OUSA 1GNZA 5LY2A 1IZ3A 2ZACA 4HKLA 5F3IA 3KHBA 5J37A 3UT0A 4BIOA 4CDXC 4QX7A 4NR1A 4ES9A 1JI6A 3OTFA 2NQYA 2Z69A 2HH9A 2OT7A 2VZ1A 2CGOA 3IMNA 4I01A 4OHWA 5IK4A 4QXBA 4AOCA 1MEC2 3GBGA 4G9SB 4JGYB 5BNPA 1JYVA 1OVPA 3N9QA 5CKMA 2V73A 1XE0A 2DBIA 4L99A 4XUNA 1QGLA 1OOPB 1I1EA 1STMA 2RV9A 5C70A 4DUWA 2VVDA 2IFRA 2QZ2A 1LGBA 2A6XA 2DF7A 2YU1A 4QU2A 5FUPA 5LA0A 4Q0VA 1OUXA 4FFHA 1KDMA 3PLQA 4XUOA 5JSOA 3MIGA 3AKTA 4XF1A 5FLJA 1ZREA 2BZDA 1H6XA 4H7LA 4XMIA 5FZAA 3HNYM 3UGGA 3USUA 1T6GC 3ZYJB 1JUIA 1ZBA3 2W08A 5JMCA 2D43A 5FZ8A 5FZ6A 1H2MA 4BCUA 2WSVA 1EV13 2HWD1 2TBVA 4LBMA 5I0SA 4RGAA 1PO11 2RS52 3MGUA 3EJKA 1NLSA 1BEV3 4K6BA 2XJVA 3QD6A 3BPSA 4MHRA 4BK4A 5BNOC 3RMYA 3SISA 2DCYA 4S2HA 2VCAA 1XNKA 3NWKA 4YPJA 4F3JA 5A3TA 3A21A 5JDBA 1LJ7A 2W92A 5FBJA 4ZHNA 5FYHA 1QOSA 2PQSA 5K4LA 2BOJA 1FAYA 1HN0A 2DBNA 2VXRA 2YFZA 3PVOA 5HXVA 4XMAA 3BKZA 2HWE2 4BLIA 3ZYIB 2VOXA 2B9UA 1OC1A 5LRSA 2AC1A 1AF9A 4LO7A 2IFWA 3INAA 4DXSA 5C5TA 3AP5A 1VMHA 3NJXA 3D5OA 4YWAA 3PJYA 5IVVA 2JDUA 1ASJ2 1RL3A 1XRUA 4LPLA 1LU2A 4LXLA 3A4UA 1JZ5A 5FP4A 4OQ8A 3LPFA 4Y5SA 3MZHA 1BCXA 3B94A 4FP2A 2A71A 2R0FA 1GR3A 3FMGA 3HVDA 3C7EA 1OF3A 3ILRA 3JU9A 4A3XA 2WT1A 2PHUA 2EIEA 3WQ7A 2D3SA 5F5QA 5DMYA 1KGYA 2EXHA 2X10A 1YI7A 5ISLA 3VBSC 2XVGA 4J1XA 1PVXA 2XQRA 4GB33 2VNOA 3ZFEA 3NW4A 4CYDA 5LBCA 1PZ9A 4YLZA 3U1XA 1HB4A 4UF0B 1C8M2 2CV6A 4RHV2 5JAXA 3ACHA 4E4ZA 1VAVA 4JTNA 4OZOA 1F35A 4Y1ZA 3J8F2 1MS8A 4OI1A 5IFPA 2WKKA 4JDNA 3VLBB 1GZCA 1ND3B 4AW7A 5BNNA 5CEHA 3WZ1A 2H6BA 3NO8A 1YQ8A 2Q0AA 3D0SA 1UCXA 1XPWA 2R062 4FVVA 3MLLA 3ZKUA 1QJX2 1UNBA 4AVSA 3KQ4B 1RMU3 1G9CA 1DBNA 1X8EA 3PU3A 4GWNA 1PHMA 2A70A 2JIJA 2KA3A 2WNVB 4XYXA 2BUKA 1DQ2A 3U4XA 2GAUA 1JHJA 1GANA 2RM22 4HPKA 4JX0A 3PIJA 2FDJA 3NSTA 3H8UA 1UIKA 1YFWA 2R30A 2O8QA 4C90A 1PVC1 1RUG2 2VVEA 3R05A 4UWDA 5GALA 5T54A 1AYM3 1FX5A 1H2LA 1QQP1 3H50A 3I8TA 4CEYA 3MBWA 4RFT0 5K9YA 5LBFA 1OKOA 2G19A 3FL7A 1JU4A 3VKFC 3PTYA 2FDIA 4XHXA 3ACGA 4Q4V3 3WW2A 3FLRA 1RUJ3 1ND2A 3LF7A 3WQBA 5GLZA 3WNPA 1N1TA 1WLCA 2DFCA 1SQ4A 3KWVA 1W2TA 1UZVA 3AFGA 3AMQA 4JC1A 1OFNA 1W9TA 3I4IA 3GXUA 5JOXA 5LK5A 2G1MA 1SFNA 1FPN1 1R1A3 5A6XA 5FO9B 3WCRA 2NMOA 3G6JB 2QKDA 1VLNA 2C6SA 2P3YA 4GA9A 5FQ0B 5I0TA 1QXJA 3OUJA 1SPPB 1JZ2A 3H3LA 4BH9A 2E7AA 2GNBA 2VU9A 1I5PA 3DXTA 1JXNA 3Q8FA 3TEXA 4YM1A 1LAJA 4B1LA 2D6MA 4PLMA 4AGVA 2J1RA 3WNNA 3IB3A 1D4M1 4LO6B 4YM0A 4N90A 2MHFA 1NKGA 4B4PA 3VBUA 3RZMA 1V9U3 1ZBE3 1KS5A 3THPA 1T2XA 1HX6A 1XBFA 2RS31 3B01A 5FZLA 5LASA 1RXGA 1Z78A 3FN9A 4Y1VA 1QKQA 1QF3A 1W6MA 2XKOA 2DTYA 2D5FA 2A3XA 5KXCA 1PX3A 2GP5A 2Y34A 5FKCA 5L7OC 5LCWL 4Q4X1 3VBRB 3MYXA 5EPAA 3ZFFA 1OURA 1H30A 4OCTA 2FBEA 2D93A 1AR83 4FQZA 1VRBA 1LOFC 4JAAA 1U5YA 1CZSA 3VZKA 2AUYA 2BYVE 1L7QA 3KCXA 3MW3A 3CIHA 2IXJA 4M0NA 3WF2A 3R4DB 4ES8A 4QPIA 3POWA 2F4PA 4DPNA 3ZXEA 1W8NA 3IPVB 2MEV3 3WDVA 3LFMA 1LTEA 2A7AA 4E4DX 3AP4A 3Q9OA 4BMEA 4BA6A 3LEIA 2LM3A 2RS12 4QXHA 1DYKA 1MEC1 1W28A 1E5SA 1HN1A 3N9MA 1XE8A 2DUOA 4DOUA 2BEOA 2R041 3VL9A 5E1RA 2ADEA 2QVSB 3TOJA 4GJYA 2V5DA 4AYUA 3AMPA 1GNYA 2YFUA 4CDWB 4XFFA 3EO6A 4MYEA 2IXCA 4AXOA 3DUIA 3AVSA 2BQPA 1H0BA 2JDZA 3ALQA 4A2UA 1EAH2 1AR72 3WQ1A 1SBEA 2WNVC 4LOSA 1W9SA 4LBQA 4M3CA 5DUUA 5FZCA 5T5JA 5T5LA 1GFF2 1HXS3 4XAEA 1OQ1A 2B46X 1CAXA 2ZBJA 2XL7A 2A3YA 2HWF2 4Y22B 3WNLA 4FPGA 1N3PA 3BUCA 3E6CC 3T0DA 5FZ7A 4LUKA 5C5UA 2EVXA 2RR12 1GZWA 1AR93 5T3NA 2JE7A 1VBE1 3RPQA 4IDZA 3THDA 5C8WA 1W6OA 3E5QA 1OA3A 4GH4A 4MSVA 2RS51 4QPWA 4QGMA 5D21A 1LENA 5FOJB 4NPMA 1POV3 3AZYA 4WVMB 2XG3A 4LLOA 1O7FA 1XU1A 3KF3A 1IKQA 1PMHX 1B35A 1SMVA 2HEWF 4QMAA 2VM9A 5A3MA 5L36A 5DAQA 4F83A 4WM8B 3M70A 1TMF3 3M3OA 1XYOA 2ARXA 4N7IA 4B3NA 2Y64A 2R072 2HWE1 2V09A 3EQEA 4YARA 3Q8EA 2WWSA 1POV0 1N3QA 1HB3A 4LITA 1XE7A 1IPSA 2JXAA 3GYDA 1AX2A 3WG2A 2F4LA 4MGSA 1CAUA 2J22A 1RXFA 2WO7A 1W8ZA 4XZPA 4N7UA 5KHHA 3ZVXA 3WINE 2OXBA 4ARXA 5FJHA 1VJ2A 2BNMA 4MGKE 2HWB2 5EZWA 1GQPA 2X53S 3AX4A 5A7WB 3NNLA 4IGPA 2TEPA 3M7AA 5FR3A 4BU2A 4LKEA 1H1MA 2ZHNA 3GBWA 5APAA 3GHMA 1QNWA 3MIFA 4GMP1 4QB6A 5C3RA 4QT6A 4LEJA 4FPYA 1RTVA 1Y43B 5IAXA 3ACFA 4KU8A 2Q5TA 1NZIA 3LEMA 4L9BA 1EPWA 1CESA 3OBTA 3GZTB 4L8QA 1S55A 1S2BA 2DYCA 4PF5A 3T09A 3VKOA 2IWGB 3VBRC 4DRVA 1VAMA 4LO4B 4QGNA 4CA9A 4IV1B 4YVWA 2ORZA 3ZFGA 1C8M1 3ES1A 4RHV1 1DGWA 4LO5B 1YIFA 2H0VA 3WDXA 4AEDC 1RUF1 2G4IA 2JICA 3IAQA 2DU0A 3VDAA 4QX2A 2WO3A 3OPWA 4R4XA 2UY8A 1W8OA 3K4DA 2DUPA 4LBNA 3GBFA 2XLAA 4B7EA 4CCDA 4BQ5A 2X8KA 1S0CA 3A22A 5D8AA 5LZ6A 2R061 1XYPA 1ULEA 2Y6HA 1DQ5A 2RMU1 1PO13 3OEAA 4P08A 5DN2A 2GALA 4XDOA 1CN1A 1V70A 1GOFA 1O91A 3AC0A 1U5IA 2VAUA 1OFSA 2OVUA 4LULA 5EIYB 3N7JA 5FMOL 3HNBM 1ODMA 2YZ4A 2RM21 3SEEA 1W0PA 3MF9A 3PUAA 4FPEA 1LECA 2FCTA 3CEWA 4BK5A 5IUQA 1UU5A 2JE9A 5CFDC 1RUG1 5CYYA 2Q8CA 3TEWA 1RUH1 1OLQA 4V2WA 2W91A 2HEVF 3EBRA 4BOWA 1DLCA 3WF1A 5DDJ2 2VW0A 2BOIA 4AK3A 1ZZ8A 4L11A 3RJ2X 3O1UA 4HSLA 5A1FA 2ZAHA 2VUCA 3NNGA 2LALA 5JVVA 3HIFA 1BQPA 3DYPA 4PQQA 1WA6X 2HWC1 2JD4A 3SQOA 2HLEA 1WMEA 1FV3A 1DYOA 4KI5M 4LA3A 4MXVA 1OSGA 1WMDA 4N9IA 1W2NA 2P34A 2ZKNA 3HN1A 3WVJA 1B09A 5JZGB 4Y20A 5A1AA 4COZA 1RUD3 2VUAA 2H6CA 2UURA 4FPHA 4CXWA 1HKDA 4KWUA 2GZWA 1C5HA 3WT3A 1DFQA 4FBFA 3MIDA 4ZONA 4A4AA 5A3LA 1AXYA 4AFCA 2JG8B 1PK6A 5F8PA 5E88A 5FY5A 2BV4A 4LLFA 1DF0A 3KV9A 1LHOA 1V6MA 4HFSA 4C1WA 2C9KA 4JTOA 4XIKA 2VQTA 2JE8A 4RQPB 5GM0A 2PYTA 1E5IA 1SLAA 3ILNA 4RD7A 4URAA 5FYSA 4XQWA 3RMXA 3RGBA 1NA1A 4FXKB 1R092 4OI2A 4Z2WA 1V6KA 5CKQA 3O0XA 3MO4A 5F3CA 2I74A 4GWJA 3HQXA 3ZO0B 3OJBA 4TSVA 3B7MA 1RHI2 3NAPC 4B1MA 5GZFA 3PURA 4G3YC 3T2OA 5EJ3A 5E8AA 3F2ZA 1CD3G 1O4TA 1H2KA 2XHKA 2VXJA 5DUXA 5E89A 5GKAC 4HKWA 3I3BA 2OQ6A 4P9LA 2PHDA 1H4HA 1SHWB 4YRDA 5KXDA 4BQYA 1E5RA 4AFDA 2ZX1A 1HRI3 1PVC3 2BWCA 4E9KA 4QDRA 1P8JA 4FOWA 2EALA 5C3QA 1JW6A 3MI8A 3PVNA 2ZKLA 4IV1C 1S0FA 5ABJC 5T50A 2RS11 2WFF2 2PHFA 2VNGA 3I59B 5A7QA 3UK9A 4WM7A 2VCCA 5A6YA 4FPJA 3O1MA 4BM8A 5JI9A 2W52A 2YY1A 3K46A 5BNPB 2XPJA 5CIRA 4TZDA 4HANA 1DQ6A 4LKDA 2FCVA 4GULA 4YYOA 5C3PA 5CA6A 4QDSA 2VTXJ 1Y9QA 2DVGA 3LKJA 1AYN3 3CMGA 3IT8A 1S2KA 3QACA 2ZAAA 4WVZA 4XHBA 2WT2A 5I0RA 4OI0A 1GWMA 2DVDA 1EAH1 1IS4A 5F5CA 2GN7A 4UFLA 2WQ4A 4P9IA 5C8CA 3U14A 1WZXA 5AVAA 2PN5A 1JZ3A 4IEWA 3URFA 2VQ0A 5FUNA 3RI9A 1JYWA 1FNZA 1UYZA 5H9SA 4XUPA 2YYOA 1OMIA 2J42A 3DECA 2XH6A 4EE2A 2YUEA 2CNAA 1QJU3 1KFXL 1D4M3 2RR11 3MW4A 1BMV1 5ANNA 5IK5A 2ENRA 3VD7A 1Q8OA 2VMEA 4X6RB 1W6PA 2EXIA 1UD1A 2ZA9A 2J1AA 2VMHA 4LE3A 1OPMA 5IVEA 1U5XA 4I09A 4XEZA 2VQAA 3IIAA 2HWD2 1W6NA 3SMHA 1YHFA 3BI3A 3SLIA 2RVAA 5LB6A 4D69A 1NX9A 4NVPA 3CL1A 1C1LA 2NM1A 4N53C 3H8XA 3JD71 4Q4Y1 4Q4X3 3IAPA 3S30A 1NYWA 3R6SA 5A3PA 1CJDA 2YC4A 3WDTA 2XOMA 1ZZ9A 1O5LA 2R071 3VBOA 4CP1A 5KHKA 4XJ8A 1OD5A 2QQWA 4YGCA 2Y6GA 5A3OA 3E6BA 3SEPA 1LOGA 3A23A 4M3CF 4EWEA 1V6IA 1WD4A 4TWTA 3T2QA 4U2AA 1OI6A 5JXIA 5DPNA 1FXZA 2ZEWA 5JZGC 1J3PA 4IESA 2G9GA 1CZVA 3S7EA 3RFRA 1QH6A 1LOBA 1DGRA 1W99A 3ZSLA 2JG8C 3MV11 2JECA 2ZGQA 4FSJA 3VHOA 2VUDA 3S5AA 5BPXA 1WBFA 4RQPC 3BU0A 3AXEA 4N9HA 3F95A 3AYCA 2ET1A 2ZX2A 1NT0A 1UU4A 2BERA 3R0RA 3CF6E 4M3CE 4FPFA 4AE2A 1E57A 3W21A 2JB4A 5DUVA 3POEA 1UY2A 3GNEA 1HLCA 1QY4A 2Z79A 2BVBA 3VDCA 3ZFEB 3OB8A 4ONUA 4AVVA 3UL2A 3RZJA 5FYYA 5LA1A 1D7PM 4XJ9A 1LHVA 1UY3A 2VW2A 1US3A 4AQSA 4OFGA 1RJ8A 3ZN4A 1JBCA 1ULFA 3KV5A 4LTAA 5CG8A 1WW4A 3D4KA 5BNNB 1UX7A 2JDHA 4I30A 5H9QA 1V6NA 1AVBA 3BIEA 2JDNA 3TNQA 3LOIA 2WA3A 2WNUA 4XFIA 1J3QA 2EAAA 4MXWB 2X05A 2RHPA 2JIGA 1DQ4A 4ZZ5A 3LFIA 4LIUA 5FWEA 5DZFA 3M3QA 1HRV1 1COV3 1GU3A 1HV0A 3LA7A 4AG4A 4HPKB 1QJFA 3ETQA 3K4AA 2G9FA 2O14A 1TQ5A 5ANQA 3N7LA 5A32B 4MV2A 2BGOA 4PDWC 5JLVA 5FZ9A 5FLHA 3WF0A 4BE3A 4L92A 1VR3A 4CEYB 4XCBA 2QQKA 1QQP2 4IL7A 4I3GA 2QCSB 4QGLA 1GZTA 2VULA 2YHJA 1NCQB 4TXWA 1ASJ3 1UYXA 3FJSA 3VKNA 1ND2B 1QXRA 3VBHC 2A75A 2ZTNA 3AJYA 4P5HA 4XPVA 2JEMA 1V6LA 1YQ2A 3T2TA 1NCRA 1X9PA 4FFGA 3U78A 4DXZA 1VBA1 2IXHA 2VZPA 2I45A 2KXLA 4BZ4A 2P3IA 1UKRA 4Y5TA 4QPGC 3V0AB 2QQMA 3DL3A 4A6SA 1FPN2 2WAOA 2W47A 3C7GA 4EN8B 4EWAA 2D3RA 1RIRA 2Z2SB 4RR3A 4EWDA 4FOVA 4XBNA 4CVUA 1VBC1 3IZOA 2ZGTA 2QFEA 1YQCA 5GZDA 1RUC2 2Q4SA 2P17A 1PNGA 3KD4A 1PIV1 3TEZA 1NLRA 1C8M3 4RHV3 4AVCA 5CFCC 4P9XA 1OH3A 4FAGA 4GMP0 2OA2A 3J8F3 2CWSA 2UU8A 5JXHA 4R8HA 3I3DA 2W1UA 2XONA 3VBUB 3PUQA 4GD4A 2VC9A 3UKVA 4EN0A 5FAXA 1NAEA 3WD5A 1R091 3TBDA 5FBZA 3IDAA 4Y24A 4OI4A 3DV8A 4HT1T 4XZUG 2R063 2E9QA 1QJX3 1SLLA 1W6MB 1W03A 1VB4A 2JENA 3WP4A 1KRIA 3OYWA 3ZXKA 2P5BA 4NRMA 3LIGA 4ISRA 3ORJA 1NOVA 3L2YA 4QM8A 3X29B 3ZFFB 5LA9A 1CWPA 3B69A 3CLPA 2RM23 5DZGA 4UFHA 1BZWA 3I2HA 1HQNA 4BIFA 5JPMB 1O3RA 2UYBA 3CZUA 3N9NA 3IIIA 1RUG3 2BGCA 5FXWA 3AVRA 3MIEA 3ZFEC 4QPIB 1C28A 3ZXDA 3FX3A 2VQUA 3LB9A 2B4KA 4JDMA 4JHZA 4K1ZA 3H3UA 2WFF1 1UIJA 3NKTA 3KV4A 4UW6A 2HKXA 2CSGA 1H8VA 2XJRA 3GM8A 1O3TA 1I3HA 4AEMA 5IK7A 2GNDA 3MPBA 4Z2AA 3T4HB 4PCRA 2W39A 2JG9A 1FYUA 5F37A 5BNNC 5CBLA 2VPVA 4ZU5A 4MGQA 2ET7A 2R042 5LBEA 4CXYA 4RS5A 2LW8A 3AZVA 1UMIA 4A6OA 4E27A 1VBD1 1H1AA 4OHVA 3RQ0A 4JHTA 5L9BA 1XOYA 4OULA 1K5MA 2DVBA 5B4NA 1LOEA 4MVTA 3ZM8A 1GYKA 3VN4A 4LBQB 4M3CB 3WHUA 1LHWA 1IS5A 3P6BA 3ZYFA 2PHWA 4MOAA 1YRZA 4Q4W2 5C7GA 4UBGA 1JS9A 4TN7A 1GQHA 4I2OA 2R1DA 4BJ0A 5C3OA 2PLV2 4R9BA 3OGJA 2ES3A 2GMMA 1KXGA 2GH8A 4CEWA 4FFIA 5CKNA 1MQTA 4YGDA 5K0UA 1VBE2 1Y3TA 1W6OB 1YYNA 4NO4A 4GH4B 1O4YA 3BOWA 1NCQC 5EP9A 1ZRFA 4NN0A 5BNQA 5LATA 4IV3B 2C5DA 1Y9MA 1B35B 2BRTA 4OLLA 4R4ZA 3NQHA 1BK1A 3WOGA 4NIGA 5J98B 2D3PA 4P9JA 2ZEZA 1QOTA 4OUEA 4EJRA 1HIXA 4NMIA 3T0BA 1LESA 3T4VA 2WJSA 4EN9B 3H7YA 2CU5A 1RVF1 1L7RA 4QKDA 3N35A 5IAVA 2V72A 1QOOA 4W6WA 1IPJA 1C57A 1XB9A 3PNAA 5IHRA 1W9WA 2XUMA 3MFAA 1WCKA 5FY7A 4AL9A 2D5HA 5AFEA 2DUQA 1CAUB 1SCRA 4JRAA 3I2FA 2RE9A 3CKHA 2H0BA 3IWZA 3KQRA 2LRPA 4CUCA 2W2IA 3CJIA 2ORXA 2WSUA 5K8SA 5DZEA 5DAPA 3OGRA 5GJ6A 4Q8LA 4BQ2A 1C5IA 3QH6A 2D98A 5FKBA 5C33A 1DGRN 4XFAA 3LA3A 1UX6A 1K45A 4CUAA 4D94A 4HBNA 5HV4A 2HBUA 3WG3A 4XILA 3BB6A 3VKMA 1ZA4A 2K0GA 1UOJA 1XNTA 5JOWA 5FMOS 1HJGA 4NHLA 2WNEA 3O14A 4L97A 1XNCA 1UF2C 1DLLA 2DTWA 1EAH3 1AR73 3RWNA 3BTYA 4YVWB 2PHLA 3ZFFC 2XBO2 1QU0A 3ZFGB 4PF1A 2FMYA 5FZHA 3DPRA 5CADA 4AI8A 3HN3A 3VBFA 5JSPA 5JOYA 2BP6A 2CTVA 2FHRA 5DAXA 2HWF3 1RUF2 1PGW1 3AXDA 3POIA 2GSYA 4K8FA 1TME2 2RR13 1Q3EA 3GZAA 3T08A 3WQ0A 4CU6A 4PLNA 1F4HA 1EUUA 4J6GA 4QPIC 4R9CA 4P9WA 2ARBA 1H9PA 2C0ZA 5D8AB 4FPKA 4AAPA 3W20A 2I2SA 2F6BA 1DZTA 4XURA 5FZFA 3LIHA 1G86A 5LRRA 4DRRA 2C4XA 2RMU2 4PIZA 4WVVA 4XETA 5FPLA 5FYIA 1YXWA 3W9AA 3TN92 1ZA7A 4JGYC 3OD0A 1UN1A 3EYPA 3H1MA 4Y5Z0 4CDXA 4QDQA 4BB3A 4NWVA 4XFCA 2BTVC 4LHKA 4CCCA 2R073 2VUJA 4X6QB 1FMD2 1OOPC 4LHSA 1N3OA 2QUOA 4IXLA 3T1MA 5BUVA 1RUH2 1H8TA 2VCBA 1JOJA 4NHYA 4ZXKA 4LK6A 4QPYA 2RG4A 2GN3A 2Z4FA 4AI1A 4CZSA 2V4AA 1WKYA 5JMOA 2DCKA 2OS2A 1Z7S1 3ACLA 1QIQA 2HWB3 2FZ1A 4LORA 5FZ3A 3DF0A 4MGIE 2W95A 3KLSA 2CWMA 4WZFA 3ZSJA 2D6KA 3A7QA 4NHMA 2HWC2 1LB2A 5FZ1A 1BXHA 1OQEA 4PBOA 3I49A 3BTAA 4FCAA 3W59A 4AVBA 4IV3C 4Y20B 3JBG3 1MZEA 2WZR1 2ZS6B 2KD7A 1QJY2 2R0HA 3C2UA 1RUC1 3ZN6A 1XNAA 4UW3A 1PK6B 3GZUC 4I02A 2B5HA 2XJTA 1AL0G 5BNOA 1DG6A 4OYUA 2VMGA 4NAMA 3AKPA 2QQNA 5T5OA 3IKWA 4E8DA 1W0OA 4DB5A 1LRHA 2XJQA 2WR9A 1NLQA 4ZU4A 4MGYE 3BPZA 4H55A 4MUVA 4K20A 1RUE1 5D1IA 2GC2A 4ZKTB 1LEDA 1CAVA 3BTZA 2DV9A 3C3VA 2UWAA 3PUHA 3CU7A 5BY5A 1W2AX 4YM3A 1AXZA 4IE6A 3D8CA 4HSJA 1WA4A 1SFPA 4HMZA 5FDBA 5FK7A 3AKQA 1IPKA 3SH5A 3ZLIA 5F32A 2XVLA 2VBPA 3RZLA 1SDWA 5GLTA 4ZZ8A 1VPHA 1NY72 4Q1PA 5DDJ3 4AGRA 4UXAA 4K9SA 3LEGA 4YVWC 2BGPA 3WNOA 4YW3A 1AXKA 1QDCA 1Q8SA 2Q1FA 4HG6B 3ZFGC 2SLIA 3IMMA 3I2OA 2FDGA 2QTWB 1UMHA 1F4AA 2Y0OA 2XUEA 3AP9A 2Q30A 3BTXA 5EWSA 3H9AA 1ND3C 5FP9A 4PJYA 2HBTA 1VIWB 1W0NA 2VY0A 4GWMA 5FZBA 5DAVA 1WWYA 5D8AC 2E26A 2BNNA 2WN2A 1EUTA 4FFFA 5FO7B 3TEYA 4A44A 1F31A 3OCPA 5D2AA 5FUIA 1G7YA 3GF6A 1JTZX 3GJBA 5HCBA 4MZUA 3WG1A 4BDVB 1DGWX 4BQ1A 3WUDA 3VDDA 2K46A 5C8CB 3THTA 4QHBA 4Z92B 1A78A 5FIXA 4FT8A 1SACA 4Q4W1 1F8VA 5EYYA 1SLBA 5T52A 2VMIA 4UI9L 2VMDA 2VZSA 2PLV1 1CGPA 1PGSA 1X82A 3RS6A 4C0BA 4BLJA 2VZUA 4IE4A 1X36A 3ZIXA 4H3WA 4ET7A 4LOTA 1BMV2 2YC2A 1VRH1 3BIWE 1S1AA 1VBB1 2Q8EA 5CG9A 1R093 1ONAA 3ILFA 4K1YA 3HQUA 1W6NB 2ZGNA 4MHUA 5FK8A 2OQ7A 3ZSMA 1NQDA 2YPDA 2F17A 4KU7A 1RHI3 2ZGUA 2XHNA 5FZOA 5J48A 2ZABA 5A33A 3ROUA 4CTEA 3ZXGA 4FAHA 1JMUB 3JD72 2OZ6A 4Q4Y2 5H9RA 3KV6A 2B7YA 2WABA 1TNFA 1KFUL 1UL9A 4X8NA 3E6DA 2WUHA 4LT5A 2K9ZA 5BYNA 4CP2A 2XWJB 3E5UA 2QNKA 3MIBA 3M3CA 5L9VA 5HCFA 4DXRA 5I0DA 5FRAA 2RJKA 4RGGA 2WFF3 1TE1B 4XQDA 4Q0UA 4PQ9A 3TB0A 1PO21 2Y6JA 4XF0A 2Q1ZB 4CCNA 2B42B 4DEVA 2FMDA 3ZYRA 2XJSA 3AK0A 1MPXA 3SKJE 3CHXA 5IVBA 5IWFA 1YFYA 4R52A 2YC0A 1R081 3KS7A 1JH5A 3DKWA 5FP8A 1APNA 2AENA 3ZYBA 1JUHA 3DXUA 3ZN5A 4M00A 5HPOA 4I0AA 1AYM2 1XSQA 4QKFA 3O1TA 2VL4A 1UY0A 4XJAA 1KQRA 2YPJA 2XBO1 2JX9A 3POYA 4N8MA 5DG1A 1R64A 2PELA 5CISA 3SCFA 5GLWA 1LKNA 4H7MA 4P00B 4Q2FA 3ZOIA 5L7OA 1TME1 2YDEA 2V4VA 1REEA 3PUIA 3VZOA 5CVRA 5F6LB 1K3IA 5HBAA 2D7FA 2DDUA 2ILMA 1HDKA 1LOFA 4S2GA 1Y7BA 1MS4A 2XWBB 4BQ4A 2WNUB 1SDDB 2HWD3 3N36A 4IEXA 4Z07A 1XNDA 5FZ0A 5FMDA 1H1IA 2D97A 5B4XA 3N9PA 5DG2A 2GC3A 4ZPIA 3TN91 4QX5A 1GQGA 1DGLA 4YGBA 2W5FA 4P14A 4GKYA 1MZ6A 1BBT2 4D6SA 1CONA 1US2A 1MR5A 2Q1MA 1GLHA 4Y3OA 1O8SA 3U10A 3UGFA 3U75A 3MV01 3WG4A 1ZNPA 3AB0A 1XYNA 1HRV2 2Y26A 4COUA 2WIIB 2YV8A 4JCKA 4CDWC 4FTBA 1FMD1 4CDUB 3NJZA 1W9YA 3ACIA 1WW7A 4FOYA 1W8FA 2PAMA 3ZR5A 2JJ6A 2WWJA 4RFRB 5FZMA 1KEXA 5T55A 3LOBA 3AP6A 3C8XA 5DUWA 5C8CC 1WCUA 3P1IA 2GC1A 1C3HA 3QCWA 3IDCB 3B9CA 3NRUA 4UT5A 1Q8PA 4XTPA 4LHNA 1RGSA 3ZXLA 1NCRB 3VD5A 1DYPA 3POBA 4AR2A 3OY8A 5FOBB 3ON7A 4HKOA 4KWJA 1VBA2 5TSWA 1S0GA 3ES4A 3TYJA 1LOAA 4D3WA 3O1OA 4I0WB 4XFBA 3H3ZA 3ST7A 2IC1A 1SBFA 4SLIA 3T0AA 5EHDA 3I3QA 1KJRA 4CDQA 1A8DA 2V5YA 3SKVA 1QJY1 2ZGRA 3WY6A 4CUBA 5LWBA 1ODNA 1IQAA 2BDRA 2VECA 3GCWA 2ZGMA 4META 3MIHA 1VBC2 4WM8C 5A7PA 3UGHA 1SCSA 2C24A 1RB8G 1PIV2 2ZMKA 4N43B 2A6ZA 4K8RB 1ZZ6A 1AHSA 2PAKA 4RA0A 4HK9A 1LEMA 1UZ0A 1D2QA 2AEZA 4YVSB 2XDVA 5A7OA 3WF4A 3I7DA 4ZY9A 1NE6A 3SCGA 2KM2A 3OYWB 1MS3A 1D2SA 4DQAA 1KS4A 3ZSEA 3PTRB 1IHMA 3FLPA 2X29A 3NV2A 1OXCA 3PU8A 5EXOA 5FPUA 1S2EA 4XVHA 2ID4A 1OBNA 5A6QA 4G4FA 1AR92 2B8MA 3ZYGA 3GALA 1NY71 4QX1A 5JXGA 1EV11 1QQP3 1Q43A 1VMJA 2Z5WA 3J7LA 1BEV1 2E53A 2VTXA 3E97A 1UZZA 3FBYA 1WCSA 4Y4YA 4KWKA 4LIVA 3J7NA 5FV3A 2Z42A 4FPLA 2VVFA 4UW4A 2EAKA 1YFXA 2R32A 2ZMNA 3VBRA 2JG9B 2LS6A 5E6HA 3KCCA 3FUOA 2B45X 4JVAA 3VGIA 2BBVA 1DHKB 4DY3A 4AI9A 4IE7A 3S0MA 1CPMA 1ZRIA 1HB1A 1UPIA 2J1SA 3AFKA 4AEDA 3ZDSA 1CZTA 1W9FA 2WNUC 3FHQA 4YZ1A 1FPN3 2W0XA 1VBD2 5EYXA 1OD3A 1U12A 4PBPA 2VOTA 5JUVA 1K5MB 2WT0A 3IBMA 4KNCA 3SXWA 4W65A 5E16A 3R4UA 1UYPA 4NROA 2ZJCA 4I3PA 4CPBD 1AL22 3AMNA 3DGTA 4NRQA 5JWPA 1A34A 1RUC3 1YC61 2YGLA 4XC9A 4FI9A 3BN6A 2ZGSA 1GOHA 1FOD2 3WR0A 4COWA 5FWJA 4CDUC 3J7HA 1U0AA 2ADDA 4FO9A 2FDKA 2W1SA 2E32A 4QQLA 3USUB 5F7UA 1MQTB 4JGZA 5K0UB 4IQPA 2VGDA 3BVCA 1UZWA 1PZ7A 4XJUA 5CFDA 3UESA 4B4QA 3B93A 2RS33 4PHZA 3FHAA 5LEJA 2C26A 1KITA 1LULA 2W1QA 5FYMA 4C0HA 2BBAA 2ATFA 2UY9A 3VV1A 3LWCA 4CRQA 2CGNA 5AC92 1BK0A 1NCRC 3WW4A 4UFIA 2P2KA 2NYYA 1LNSA 1QJZA 2W46A 4LK7A 2Q8DA 1AR62 2TNFA 1YLLA 4QQ2A 5ERLA 3HJRA 3K2OA 3HQRA 4EZ4A 1W8WA 2CL2A 5A3NA 1WLWA 1RVF2 1W8UA 1O8PA 2C9AA 5A1LA 1M4WA 3WXPA 1YUDA 2ZHLA 3T2PA 1UYYA 2EXJA 3V65A 4MGZE 2D6LX 2JKBA 1HQLA 2PA7A 3AJZA 1BVP1 2XXZA 4HONA 3K51A 4H2AA 1CIYA 4GKXA 3DYOA 3DYMA 1OA4A 4N43C 4NAOA 4XTMA 3SCHA 3CJIB 1MEC3 3ZMNA 1G9BA 4XFHA 4YW6A 1OUSA 4Q26A 4CCEA 2R043 1DIWA 3H42B 4QB1A 1V6OA 4YVSC 2ZHMA 1WMFA 1AYM1 3K3NA 3HEIA 2ZGKA 2JDPA 3SNMA 3AKSA 4O61A 2HYKA 2P6HA 3JUUA 3L2HA 3WUCA 3VUOA 3KGLA 4Z1VA 1JYTA 1PNFA 1GMMA 1XJAA 4EQVA 2XMLA 5IATA 4LNVA 2JDYA 2LUWA 2W87A 4HN1A 3VBFB 2VH9A 1V0AA 1GNHA 3OBRA 4Q4W3 1ZYBA 2MPFA 3NAPA 4S2DA 5I0UA 5CU1A 5FMBA 2PLV3 4NUBA 3U11A 4F8AA 1PGW2 4KG0A 3VB9A 3MEPA 2WLPA 2Y38A 1BYHA 3WEZA 5B2GB 1ZRCA 1VBE3 5C9AA 3O7OA 3WCSA 1F2NA 2RS53 1IKPA 3AM2A 1IOAA 4XFGA 1ENRA 2QQUA 1UOFA 1OVSA 1BBT1 5G04L 1REFA 4NE9A 4CCOA 4CDXB 4E2SA 5BNPC 2JG9C 1OT5A 1DZQA 1RUI2 5ABJA 4Q27A 2Y6FA 4B29A 1RUNA 2YBSA 4JZRA 5F9TA 1F5JA 2HYXA 5FPBA 1Q5OA 2OYZA 3O0VA 4M01A 4XOGA 5FZ4A 2RDRA 2XR4A 2HWE3 5I8SA 3UJQA 1V9U1 1ZBE1 5KHJA 1H8TB 3T3YA 3FBMA 4QU1A 1A8MA 1ENQA 4BWOA 3LDKA 1XU2A 2D6PA 5EJ1B 4IGQA 1J59A 4EZHA 5JOZA 4OUMA 3OOXA 3FFQA 5C4WA 4BQ3A 1S0DA 4XAAA 1GP6A 2ZZJA 2CDOA 2YG0A 4P02B 3NKGA 4WV8A 3RZKA 1QNYA 3HBKA 4W8JA 1Z7S2 3POJA 4QKNA 4CU9A 2L9LA 2ZHKA 1G6NA 1QXPA 4QXCA 3M3EA 1GP5A 3OPTA 3PDQA 4YZ4A 4CCMA 4CCKA 1JYXA 4IEZA 1N47A 2UYAA 2JDAA 4A7ZA 4QKBA 4M0HA 1AZDA 4GMP3 1L7LA 5FY8A 1JZ4A 5BV6A 1MS5A 4NIIA 1URXA 4Y1UA 4AVAA 2VCMA 1HRI2 1T6BX 4JKLA 4XF3A 3WNMA 4Q5OA 2DCZA 1DU3D 1YFUA 2IXKA 2XLGA 2XLFA 4ATEA 2PHTA 2WZR2 3M1HA 5KHGA 3NNFA 1OA2A 3ZN6B 2X5IA 4ASKA 2XBO3 2ZEYA 5T5PA 3O5SA 4DEQA 4CU7A 4EN6B 3UYJA 1KD7A 4NRPA 5L73A 4C1XA 2D6OX 2WO1A 1RUF3 4BXSV 4N53A 3WDWA 2D6NA 5JR2A 1UOBA 1TME3 2LTNA 5L9RA 2WN3A 4ITCA 3Q8CA 2A6VA 2IUWA 5F3EA 5F39A 4IEPA 3AL6A 1O6UA 2RDNA 5KC6A 3KT4A 4QX0A 4O65A 2RMU3 4BPZA 1RUE2 1ZZBA 3ENRA 1TNRA 1BLZA 1NUKA 1QJEA 3PHMA 3TN93 1MS0A 4QX8A 1NG0A 4PI2A 2AACA 4COVA 4W6YA 1W6QA 4EN7B 1V00A 4PLOA 4KH9A 4Q1RA 1HW5A 3WP5A 3B3QE 3ABZA 2VZVA 1IGOA 1AR91 1WW5A 2CYFA 5IJRA 1FMD3 1W05A 4TLGA 1GKBA 5IYYA 2JKXA 1W04A 5LBBA 1RUH3 2BJSA 3AYAA 5FXZA 5DQ0A 2YBPA 2ZEXA 5EFUA 3ZYPA 2WNOA 3OSDA 4D7TA 1JU3A 4MG2A 1UWWA 3V64A 4CPBA 2OX0A 3VBFC 2Y60A 3KSCA 4AQ6A 2E7QA 1FT9A 1NZCA 2PQQA 4KGGA 4YG0A 1OLMA 5JSRA 1D0GA 3LQCA 3LAGA 4IE5A 2W94A 5I93A 4ARYA 3CDZB 3VZNA 1AX1A 2HWC3 4XBLA 1VAKA 4FP3A 3RZZA 4NWWA 2ARAA 4KMQA 3FZ3A 1R1ZA 1JYCA 3WDYA 2PFWA 1SLIA 3RDIA 4XDQA 4KQ7A 3T30A 1PZ8A 4UW5A 1NE4A 2ZPXA 3VDDB 3S5QA 3WP3A 1QJY3 4BQWA 1AL21 1YO8A 4FPCA 5FREA 4JKKA 3VZJA 2C1FA 4DUXA 5CB7A 3ECQA 3MLKA 1SZBA 1AJOA 3I59A 1FOD1 1CAXB 5ACA2 2D44A 1WBLA 4YSFA 1GSLA 2WYSA 4A7YA 3DEMA 2DCTA 5FZEA 5L19A 1GZWB 2E31A 2FCUA 4LBJA 3ZYHA 4AI2A 1H8TC 3V0BA 4CEYC 2O0OA 2XJUA 2ZX3A 2WC2A 1VRH2 2ARCA 4M4RA 1VBB2 1JHNA 2B9VA 2CDPA 4PDWA 1GWLA 2GMEA 1ND2C 5F5IA 5AC91 1JYNA 4MADA 2CAVA 2OZJA 3K3OA 5GZEA 4NOTA 5FZOB 3KT7A 1AR61 5A33B 2VZTA 2ZX0A 3H1YA 3PIGA 3OF1A 4FXGB 4D6RA 1A6CA 3VBHA 3O1RA 5FY0A 3KM5A 2XJPA 2OKXA 2WQZC 4QQOA 3AZWA 1A3KA 4HZFA 4UFJA 5GLVA 4D0QA 2J1TA 2CAUA 3KB5A 4BQXA 1H9WA 1AJKA 4Z82A 1ACCA 3N3HA 3NV1A 4A3ZA 1UPSA 5JR7B 5J09A 1LR5A 4QPGA 1YI9A 3AKRA 4LA2A 3OGVA 4WVWA 5JPNB 2OPWA 2R7EB 1XSRA 3KHCA 3PMEA 3FWEA 4K40A 3UETA 2RS13 1J1TA 4CP0A 3AYDA 4LBQD 3B5LB 1PO22 1L3JA 2UWBA 1MZFA 2ZMLA 1PGL1 1COV2 3VBUC 2DURA 1HJFA 4OHXA 5CFCA 3S7IA 4BYYA 2CY6A 1R082 2XB6C 3RYRA 2P37A 4YW7A 1UO9A 2OUJA 2PMWB 3RNSA 3VD3A 1G9DA 2ZCWA 3LGRA 4W50A 5FZIA 3ITQA 5LEKA 4H14A 4LJHA 5A3UA 4YW5A 5I8YA 1LHUA 2FQPA 3FFZA 1H4GA 3THCA 5H9PA 1TEIA 1YNAA 1TZOA 2ZZQA 1IS3A 2AEYA 5L7OB 4NJ4A 3N4MA 4XDPA 3IDBB 2AYHA 3OEBA 4AHWA 4UYBA 5FP3A 1ZZCA 4QM9A 5DXDA 3S57A 4FTSA 4RYDA 2VW1A 1OKQA 4E8CA 3M4FA 3WDUA 3ZPOA 1RUD1 1E5HA 5SV8A 4DS0A 2A6WA 3I2KA 3JQXA 4KBBA 4E2GA 1RUI1 1X33A 2YBKA 1UAIA 4YZ5A 5F2SA 4LMFA 4IERA 3JD73 4Q4Y3 2WS92 1ZRRA 2J1UA 1FNYA 4KBZA 5FYVA 5A7NA 2P6CA 3W58A 3T1LA 4DINB 4FOQA 4XF4A 2EA7A 3JXSA 4LE4A 3VDDC 3DCQA 3H7JA 1DQ0A 4LHLA 4IGOA 4UFMA 1CAWA 3AZXA 5CAZA 4UFKA 3EXUA 5HCAA 4MXWA 2VD7A 2XL9A 1OQDA 4AF9A 3I2DA 4E4SA 4Y26A 2XGXA 3CBNA 4QHOA 4CP9A 3OY8B 1VALA 1XC6A 4K21A 1V6JA 3N9LA 3TWIA 5IVFA 2WLQA 3KZ4C 5JI7A 1WUVA 1PM4A 1X7NA 3U0ZA 4GH4C 4DNYA 3IDEA 1HRI1 4YG3A 4OHZA 4CDQB 2WL1A 5A32A 4YNIA 3L9JT 2P4EA 1B35C 5F5AA 4NPRA 2K2SA 5DAWA 3LEKA 1KDKA 4AQTA 2EXKA 4ZXEA 1QMJA 3TNPB 1NCQA 2BFUL 2ZX4A 1ULCA 2Y33A 2YXSA 3NL1A 4NHKA 4X8PA 3OBZA 4ASMB 2VO5A 4JV4A 2A6YA 3CZJA 3I54A 2J1EA 2RJLA 3I3MA 1VB2A 3ZMOA 4ASLA 4BISA 3J4UH 4O9EA 2DVAA 1JODA 1AYN1 4AHZA 4P9GA 1NA1B 5JXJA 2Y8KA 5KBFA 3V0AA 5FLIA 4YZ2A 3RVHA 3MFCA 1J1LA 2VZ3A 1YEWA 1QH7A
chains in the Genus database with same CATH topology
3KHCA 4NPMA 4RFRB 3S5AA 3H8OA 2FDIA 3BU0A 5F8PA 4NRPA 2FD8A 3H8RA 2IUWA 3O1PA 3O1OA 3O1VA 4ZS2A 3T4HB 4IE4A 3RZGA 3I3QA 4O7XA 2FDFA 4CXYA 3RZHA 4NJ4A 4CXXA 4JHTA 4NIDA 3RZJA 4ZHNA 3S57A 2FDHA 3RZMA 3BKZA 4MGTA 4NPLA 4MG2A 4O61A 4ZS3A 3O1MA 3I49A 4OCTA 4NIGA 5DABA 3T4VA 4QHOA 3LFMA 4QKDA 4QKFA 3O1TA 3BIEA 3BTZA 4IE7A 4IE6A 3T3YA 3BI3A 3O1UA 3H8XA 3O1SA 3RZLA 4NROA 3RZKA 3KHBA 4NRQA 4QKNA 3I3MA 3O1RA 4NIHA 3I2OA 3BUCA 2FDGA 4QKBA 3BTYA 2FDKA 2FDJA 4IE0A 4NIIA 3BTXA 4IDZA 4NRMA 4CXWA 4IE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHC A;  4NPM A;  4RFR B;  3S5A A;  3H8O A;  2FDI A;  3BU0 A;  5F8P A;  4NRP A;  2FD8 A;  3H8R A;  2IUW A;  3O1P A;  3O1O A;  3O1V A;  4ZS2 A;  3T4H B;  4IE4 A;  3RZG A;  3I3Q A;  4O7X A;  2FDF A;  4CXY A;  3RZH A;  4NJ4 A;  4CXX A;  4JHT A;  4NID A;  3RZJ A;  4ZHN A;  3S57 A;  2FDH A;  3RZM A;  3BKZ A;  4MGT A;  4NPL A;  4MG2 A;  4O61 A;  4ZS3 A;  3O1M A;  3I49 A;  4OCT A;  4NIG A;  5DAB A;  3T4V A;  4QHO A;  3LFM A;  4QKD A;  4QKF A;  3O1T A;  3BIE A;  3BTZ A;  4IE7 A;  4IE6 A;  3T3Y A;  3BI3 A;  3O1U A;  3H8X A;  3O1S A;  3RZL A;  4NRO A;  3RZK A;  3KHB A;  4NRQ A;  4QKN A;  3I3M A;  3O1R A;  4NIH A;  3I2O A;  3BUC A;  2FDG A;  4QKB A;  3BTY A;  2FDK A;  2FDJ A;  4IE0 A;  4NII A;  3BTX A;  4IDZ A;  4NRM A;  4CXW A;  4IE5 A; 
#chains in the Genus database with same CATH topology
 3ZR6 A;  1TVG A;  2YB7 A;  1BBT 3;  2JDM A;  2GNM A;  1GBG A;  1H2N A;  4O9G A;  1HRV 3;  3H8O A;  2W3J A;  1SBD A;  4I0B A;  4AFA A;  1QJU 1;  1WLD A;  2O1Q A;  4AI0 A;  2JDK A;  2WA4 A;  1OHF A;  1OPO A;  4AI3 A;  5LW9 A;  2FZ2 A;  4AGG A;  2QZ3 A;  4LKS A;  1ZBA 2;  4QX3 A;  2WQ8 A;  4F7Z A;  2OUH A;  1EV1 2;  2VMC A;  4OVE A;  5EQU A;  1ZX5 A;  3ZKY A;  1AUY A;  1BEV 2;  2WZE A;  1DQ1 A;  3J9S A;  1LCL A;  3VBS A;  3O1V A;  3BU7 A;  1D0H A;  4WM7 B;  5F2W A;  1X9T A;  3HT2 A;  4Y1X A;  5J7M A;  5KR7 A;  3ETP A;  5A70 A;  2WRA A;  1QEX A;  1VBA 3;  4AED B;  3A0N A;  2EIB A;  4UOJ A;  4DMI A;  3E5X A;  4LR4 A;  4PI0 A;  4AEK A;  4MLO A;  2VJX A;  2CGP A;  5SV5 A;  2BPA 2;  3G7D A;  3BOD A;  4LO8 A;  3QH7 A;  2BW8 A;  3NJY A;  2J1V A;  2UWC A;  3NV4 A;  1I6X A;  4U36 A;  4W6X A;  1VBC 3;  3K77 A;  4MGT A;  3BGA A;  5ACA 1;  3OG2 A;  2YMZ A;  1BJQ A;  1PIV 3;  1ULP A;  2WIN B;  3WLU A;  1N1Y A;  1Y4W A;  4JGY A;  2EID A;  1MVQ A;  1EP0 A;  4JGZ B;  2MNG A;  1W6P B;  1W2U A;  1WGP A;  5FZD A;  5CFD B;  3FHI B;  1ZM1 A;  4YW2 A;  3I3E A;  1AX0 A;  2NZ9 A;  1UKG A;  3ASI A;  1OOP A;  4GWI A;  1YQ5 A;  5JCT A;  4K7J A;  1J84 A;  4GB3 2;  1ZVF A;  2JB8 A;  3PVB B;  2N7G A;  1KJL A;  5A3W A;  2GP3 A;  3WHT A;  3QLQ A;  5F1R A;  2E33 A;  4ORF A;  4AQ2 A;  5DAB A;  3PJQ A;  1UMZ A;  4JDO A;  3VBO B;  4LBO A;  1HQW A;  2VBD A;  3J7M A;  2QQP A;  4HVO A;  4CDQ C;  3LZZ A;  5IVJ A;  5J3U A;  3HD8 B;  1BVV A;  4KWL A;  3LD8 A;  2KR2 A;  1OLM E;  3EB7 A;  4XAB A;  5JIA A;  1Q8V A;  1K12 A;  2BWA A;  3RJR A;  1PK6 C;  1LGC A;  4IV3 A;  3N7K A;  2PXJ A;  2VZO A;  1RMU 2;  3GGL A;  2VOV A;  1YJL A;  3VZM A;  3LDB A;  3LCP A;  1COV 1;  4HVR A;  4FPO B;  3UKT A;  4NIA A;  4Q8K A;  1HV1 A;  3VZL A;  4DUV A;  1S0J A;  4GZ9 A;  1SLT A;  1W06 A;  1NA1 C;  2DWR A;  4UAP A;  5KXE A;  3KVA A;  3MUZ 1;  4TYS A;  1GZ9 A;  3CJX A;  2TUN A;  2OW4 A;  1ALY A;  1VBD 3;  2VNR A;  2IVI B;  4RSU A;  4EV0 A;  4OMD A;  3RWK X;  5I91 A;  4NIH A;  4P9Y A;  2XKP A;  2X09 A;  1EYB A;  1NQJ A;  2WWU A;  2W1W A;  5LA2 A;  1S0E A;  1WMX A;  1ASJ 1;  3P3N A;  3WW1 A;  3ZXJ A;  4IE0 A;  4Q4V 2;  1AL2 3;  1RUJ 2;  3KT1 A;  1CVN A;  4B7K A;  4E2Q A;  3RYP A;  2BNO A;  4TLF A;  3UJO A;  1FOD 3;  3NAP B;  4L0P A;  3JQW A;  5FYZ A;  2GNT A;  3JZV A;  2CHH A;  2HJI A;  1CJP A;  4C91 A;  1RJ7 A;  5FY1 A;  1H6Y A;  5C9A B;  1R1A 2;  4ISQ A;  4QXK A;  4Q0P A;  1MVE A;  3OGG A;  4CCJ A;  3CQO A;  1JZ6 A;  1CPN A;  2FD8 A;  4WM7 C;  4LBK A;  3HPN A;  3JBG 2;  3K4Z A;  4HN0 A;  1F15 A;  4LQR A;  4DY5 A;  5AC9 3;  5G05 L;  4AHX A;  4S2F A;  5ABJ B;  2NPI A;  1W3X A;  3U4S A;  1OF4 A;  4HOO A;  5FYC A;  1AR6 3;  2WS9 1;  1YQ6 A;  3RZG A;  4UF0 A;  3J8F 1;  3VD9 A;  1FV2 A;  4Y33 A;  4QQP A;  3QOP A;  4O7X A;  3LSE A;  3NNJ A;  1RVF 3;  3CO2 A;  3RZH A;  3RG0 A;  1ND3 A;  2R6Q A;  1V9U 2;  1ZBE 2;  3BAL A;  4V1P A;  2ZOE B;  1Y9G A;  4ZU7 A;  1YCI A;  4JKM A;  4WZC A;  1UY4 A;  3MUY 1;  5FMC A;  1J58 A;  4HVQ A;  5KWR A;  1QJX 1;  2ARE A;  5C4W B;  4R9D A;  1WLT A;  4QD2 A;  5HXM A;  3VD4 A;  3PVE A;  3KVB A;  2WZ8 A;  2BU9 A;  2EIC A;  2WNV A;  2A3W A;  3Q8B A;  1DZR A;  3AZZ A;  5A80 A;  4JGZ C;  1AR8 2;  1J83 A;  1Q8Q A;  2ZXQ A;  4DIQ A;  1QHD A;  1YIP A;  4JQR A;  4JRL A;  1G9F A;  3QBQ A;  2BVV A;  3NNM A;  3S6P A;  5FFO C;  5FYT A;  3ZIW A;  3BOP A;  3MPP G;  3U37 A;  5IVC A;  3WSO A;  1PMI A;  2QQL A;  1LGN A;  2E7T A;  3B9I A;  1M06 G;  1PMJ X;  1ULD A;  4RR3 B;  1O59 A;  1VP6 A;  2MEV 2;  1IS6 A;  3WNX A;  2X5I B;  1UW8 A;  4CSW A;  2VZR A;  2Y6K A;  4DXT A;  1YJK A;  3RYK A;  1PX4 A;  2DCJ A;  1MS1 A;  3WF3 A;  3FC0 A;  4YW4 A;  3VBO C;  1ULG A;  2YRO A;  1CX1 A;  2VR4 A;  2E51 A;  4XE9 A;  4N53 B;  3VHR A;  1WD3 A;  4AAX A;  3E1F 1;  1UQX A;  4DFS A;  5J36 A;  4GXL A;  1JN2 P;  1Q56 A;  2AGS A;  1G8W A;  3USS A;  3ZSK A;  5FQ0 A;  4Q0S A;  1CIW A;  1SPP A;  4DZG A;  5EJZ B;  1I9R A;  1W6Q B;  1UOG A;  1RUI 3;  3GJA A;  4XUT A;  4B8E A;  3SIT A;  1ENS A;  1HXS 2;  4XF9 A;  4HLT A;  1XQN A;  2P3J A;  3IM0 A;  3KCY A;  2AR6 A;  4QWN A;  4YW1 A;  5FPA A;  2VMF A;  4XJZ A;  1F9K A;  4A42 A;  1GUI A;  1W39 A;  1ZBA 1;  5BXX A;  3GZE A;  3HR9 A;  4YFZ A;  4XW3 A;  5C3S A;  3LPG A;  5A7S A;  3HAG A;  1S0I A;  3JB8 A;  2RDS A;  5GZG A;  3H1W A;  2AH2 A;  1JOP A;  2J7M A;  2O8O A;  4FQ4 A;  3H0O A;  5KXB A;  4OZX A;  1Z7S 3;  2VOW A;  2QDR A;  5HCH A;  4V2V A;  5FJK A;  2R1B A;  2PHR A;  3MF6 A;  4Q29 A;  4OHY A;  1LU1 A;  1MZ5 A;  4LKF A;  1TMF 2;  3M8L A;  4CU8 A;  4RS5 B;  3NV3 A;  3OGS A;  1OLR A;  2P3K A;  5C9A C;  4HXC A;  4AFM A;  3FE5 A;  2D40 A;  3P3P A;  3HMY A;  3I2G A;  1JOB A;  1RIT A;  1UY1 A;  2GDF A;  3B00 A;  1N1S A;  1O4Z A;  3D82 A;  4NID A;  1RUO A;  2P1B A;  4NHX A;  2WZR 3;  3IPV A;  4WBB A;  5HI0 A;  1X8M A;  3ELN A;  3GDB A;  1IQD C;  1GV9 A;  1W90 A;  5JIU A;  3APB A;  1W3V A;  3ZXF A;  3UNP A;  2DVF A;  3O0W A;  2SBA A;  5LY1 A;  4GAZ A;  2W68 A;  4GIQ A;  3MIC A;  4RL7 A;  3AYE A;  5KHI A;  4CEW B;  4MX3 A;  3V0B B;  1C4R A;  4D6Q A;  3N9O A;  3D0J A;  4L2N A;  4C8D A;  4BXF A;  4IW3 A;  4CDW A;  2FDF A;  1GIC A;  4CXX A;  5C4W C;  4XCA A;  4PDW B;  4GB3 1;  4GJZ A;  2VOK A;  1SFY A;  5FY9 A;  3ATG A;  4AWD A;  5FPZ A;  1AR7 1;  1RUE 3;  3SH3 A;  1UZY A;  4OMC A;  1NXM A;  3LE0 A;  3PUS A;  3ZX7 A;  2IVJ A;  3Q8A A;  4XAC A;  4QHZ A;  2FDH A;  3CNA A;  3PL0 A;  5A6Z A;  2QJV A;  1W2O A;  2HWF 1;  4JQT A;  3VBH B;  4E4H A;  5FXV A;  5FPX A;  5GZC A;  3TRS B;  4DO0 A;  4NPL A;  4Y22 A;  3WV6 A;  4KG8 A;  2PHX A;  3RRD A;  1K42 A;  4ZS3 A;  4W4Z A;  2A1X A;  2GH2 A;  2IXL A;  2WYF A;  4XJW A;  2NP0 A;  2VG9 A;  2ERF A;  3LDR A;  4ERO A;  3A0K A;  3NJV A;  5C71 A;  3V56 A;  4RR3 C;  4Y1Y A;  4QPG B;  4GQ7 A;  3POF A;  1U5Z A;  2X5I C;  2QQI A;  1W8H A;  3W5N A;  1ULO A;  5J96 B;  1PO1 2;  4WVM A;  4ATF A;  1RMU 1;  3PMS A;  5IVY A;  4A41 A;  1FAT A;  2VBB A;  2LRO A;  2IXI A;  5IK8 A;  3K75 B;  5K7P A;  3HNM A;  3ZPY A;  3WNK A;  2VNV A;  2QQV A;  4WM8 A;  1LHN A;  1I5Z A;  4A7K A;  1PGL 2;  1MS9 A;  1LOD A;  1TG7 A;  1RC6 A;  4HET A;  4XIO A;  3RI8 A;  1OH4 A;  3N7M A;  5CFC B;  2AZ5 A;  2EIG A;  2I07 B;  1PM7 A;  1RED A;  3C7F A;  1YWK A;  3I2I A;  3WW3 A;  3VKL A;  1S0B A;  1ZZ7 A;  2RDQ A;  4YM2 A;  4D7S A;  5F3G A;  2DFB A;  4Q4V 1;  1ZRD A;  4YG6 A;  1RUJ 1;  3M3I A;  4IUG A;  5EV7 A;  4RGK A;  3DPR B;  4CE8 A;  3AMH A;  2HWB 1;  1XXN A;  5ACA 3;  3D3A A;  1WW6 A;  2A73 B;  5A7W A;  3BCW A;  1MAC A;  2QQO A;  3HT1 A;  4PIY A;  1O5U A;  3JB4 C;  2XQX A;  4UBH A;  4YGE A;  1K5J A;  1F5F A;  1QDO A;  2QE3 A;  2EF6 A;  1R1A 1;  2IZW A;  4XUQ A;  3O1S A;  3HBZ A;  1UXZ A;  1VRH 3;  3HWJ A;  4HK8 A;  1VBB 3;  5FZG A;  1UXX X;  4RN5 A;  3JBG 1;  3POG A;  2JWP A;  1C8N A;  3B02 A;  1RUD 2;  3SHR A;  4IEV A;  4QAW A;  4YFW A;  3MLJ A;  4M4P A;  4SBV A;  5IT6 A;  4BHP A;  1GWK A;  2PAE A;  4IV1 A;  2G9Z A;  4BMB A;  1JYI A;  1HB2 A;  1O3Q A;  4MH0 E;  4HL0 A;  5FYB A;  4RS5 C;  1IG0 A;  2E6V A;  3VDB A;  1JZ7 A;  4A45 A;  1XNB A;  1SG3 A;  5FCC A;  3HOB A;  2BFU S;  3AP7 A;  1K5M C;  3GHN A;  1CR7 A;  3GCX A;  3K48 A;  4LBL A;  4CUG A;  1POQ A;  4AHY A;  1CAW B;  3RSJ A;  5FY4 A;  3IN9 A;  5FXX A;  2OII A;  4D8M A;  4XXP A;  2NMN A;  2ZGO A;  5KC5 A;  1QWR A;  4IEY A;  2ZGL A;  5CZK A;  4YZ3 A;  4FTE A;  3VL8 A;  1DP0 A;  1IG3 A;  1WCQ A;  5CNA A;  4AVT A;  1DDL A;  3OUI A;  3UV9 A;  2VTF A;  4CP9 B;  2WBK A;  3H8R A;  1PO2 3;  4P5Y A;  5FP7 A;  3C7H A;  2WZP P;  5C6C A;  4CEW C;  4AZZ A;  4IEQ A;  1AR8 1;  1MQT C;  3O1P A;  4QB2 A;  5M0T A;  5K0U C;  1C1F A;  3FUQ A;  4ZS2 A;  4EYU A;  1SLC A;  4PIX A;  1S4C A;  1R08 3;  4CDU A;  1ST8 A;  5IFT A;  3EMR A;  3U07 A;  3KGZ A;  5FO8 B;  1PVC 2;  2GU9 A;  3R4S A;  3SH4 A;  5DDJ 1;  4J25 A;  5AVP A;  2MEV 1;  2ZGP A;  4OQ9 A;  4PT6 A;  3P5B A;  2ETE A;  4Y4R A;  3OPZ A;  3ZXA C;  5J1X A;  3AL5 A;  3MHZ A;  4COY A;  2Y0I A;  3LSD A;  2W9X A;  3ZDV A;  5BNO B;  5F6K A;  1G9A A;  1NXD 1;  5FPV A;  2PTM A;  2Y6L A;  2GC0 A;  4D7Y A;  3O12 A;  1SEF A;  1X50 A;  5IW0 A;  1VE0 A;  2QBX A;  2WDB A;  3WX5 A;  3W5M A;  2WFP A;  1AYN 2;  4GAL A;  2XVK A;  3EHK A;  3OD4 A;  3SC7 X;  3TAY A;  4AEJ A;  5I8T A;  3BYW A;  5FYU A;  1EY2 A;  2NLR A;  1DCS A;  2WAA A;  4XXA A;  3MDP A;  3I2J A;  5JZG A;  3NMB A;  4IEU A;  4XQ4 A;  3CJI C;  2QDN A;  1CAV B;  3FLT A;  2Q8O A;  3I97 A;  2GMP A;  1HXS 1;  2DU1 A;  2RJ2 A;  1EPZ A;  3KF5 A;  3M2M A;  2HEY F;  2VE1 A;  3DN7 A;  2JG8 A;  3POS A;  4IET A;  1GOG A;  2WS9 3;  3OUH A;  4N43 A;  5GLU A;  3UKN A;  3WP6 A;  1GP4 A;  4R9A A;  1CX4 A;  1CQ9 A;  1QJU 2;  1BKZ A;  1D4M 2;  1N1V A;  4IND A;  3J26 N;  5LK7 B;  5FZK A;  1UU6 A;  4RQP A;  5AFB A;  4Z8B A;  3NVC A;  1D4V B;  4XBQ A;  5HV0 A;  2OPK A;  3ME2 A;  2VZQ A;  4QQH A;  4B4R A;  1W8T A;  2E63 A;  3VHN A;  2RS3 2;  1POV 1;  3D6E A;  4J1W A;  4MO3 M;  4YVS A;  3DKQ A;  4URT A;  3AMM A;  3DPR C;  4LUM A;  3VBS B;  3VHP A;  4KGQ A;  2B39 A;  1J3R A;  1ENX A;  1RHI 1;  1WCD J;  3LA2 A;  4IEO A;  3JCI A;  4Q0Q A;  4TTG A;  1Z0H A;  2JD9 A;  2R16 A;  1LOC A;  2A5Z A;  3C7O A;  2WO2 A;  2R49 A;  4Q4X 2;  1TMF 1;  1VMF A;  2YGM A;  4AFB A;  4CCL A;  2NN8 A;  1FI2 A;  1BHG A;  2YU2 A;  1RIN A;  3OBA A;  1RYY A;  4K3U A;  1JZ8 A;  1O3S A;  2QQJ A;  3KMH A;  3MW2 A;  5FTT C;  4KL1 A;  4OUS A;  1GNZ A;  5LY2 A;  1IZ3 A;  2ZAC A;  4HKL A;  5F3I A;  3KHB A;  5J37 A;  3UT0 A;  4BIO A;  4CDX C;  4QX7 A;  4NR1 A;  4ES9 A;  1JI6 A;  3OTF A;  2NQY A;  2Z69 A;  2HH9 A;  2OT7 A;  2VZ1 A;  2CGO A;  3IMN A;  4I01 A;  4OHW A;  5IK4 A;  4QXB A;  4AOC A;  1MEC 2;  3GBG A;  4G9S B;  4JGY B;  5BNP A;  1JYV A;  1OVP A;  3N9Q A;  5CKM A;  2V73 A;  1XE0 A;  2DBI A;  4L99 A;  4XUN A;  1QGL A;  1OOP B;  1I1E A;  1STM A;  2RV9 A;  5C70 A;  4DUW A;  2VVD A;  2IFR A;  2QZ2 A;  1LGB A;  2A6X A;  2DF7 A;  2YU1 A;  4QU2 A;  5FUP A;  5LA0 A;  4Q0V A;  1OUX A;  4FFH A;  1KDM A;  3PLQ A;  4XUO A;  5JSO A;  3MIG A;  3AKT A;  4XF1 A;  5FLJ A;  1ZRE A;  2BZD A;  1H6X A;  4H7L A;  4XMI A;  5FZA A;  3HNY M;  3UGG A;  3USU A;  1T6G C;  3ZYJ B;  1JUI A;  1ZBA 3;  2W08 A;  5JMC A;  2D43 A;  5FZ8 A;  5FZ6 A;  1H2M A;  4BCU A;  2WSV A;  1EV1 3;  2HWD 1;  2TBV A;  4LBM A;  5I0S A;  4RGA A;  1PO1 1;  2RS5 2;  3MGU A;  3EJK A;  1NLS A;  1BEV 3;  4K6B A;  2XJV A;  3QD6 A;  3BPS A;  4MHR A;  4BK4 A;  5BNO C;  3RMY A;  3SIS A;  2DCY A;  4S2H A;  2VCA A;  1XNK A;  3NWK A;  4YPJ A;  4F3J A;  5A3T A;  3A21 A;  5JDB A;  1LJ7 A;  2W92 A;  5FBJ A;  4ZHN A;  5FYH A;  1QOS A;  2PQS A;  5K4L A;  2BOJ A;  1FAY A;  1HN0 A;  2DBN A;  2VXR A;  2YFZ A;  3PVO A;  5HXV A;  4XMA A;  3BKZ A;  2HWE 2;  4BLI A;  3ZYI B;  2VOX A;  2B9U A;  1OC1 A;  5LRS A;  2AC1 A;  1AF9 A;  4LO7 A;  2IFW A;  3INA A;  4DXS A;  5C5T A;  3AP5 A;  1VMH A;  3NJX A;  3D5O A;  4YWA A;  3PJY A;  5IVV A;  2JDU A;  1ASJ 2;  1RL3 A;  1XRU A;  4LPL A;  1LU2 A;  4LXL A;  3A4U A;  1JZ5 A;  5FP4 A;  4OQ8 A;  3LPF A;  4Y5S A;  3MZH A;  1BCX A;  3B94 A;  4FP2 A;  2A71 A;  2R0F A;  1GR3 A;  3FMG A;  3HVD A;  3C7E A;  1OF3 A;  3ILR A;  3JU9 A;  4A3X A;  2WT1 A;  2PHU A;  2EIE A;  3WQ7 A;  2D3S A;  5F5Q A;  5DMY A;  1KGY A;  2EXH A;  2X10 A;  1YI7 A;  5ISL A;  3VBS C;  2XVG A;  4J1X A;  1PVX A;  2XQR A;  4GB3 3;  2VNO A;  3ZFE A;  3NW4 A;  4CYD A;  5LBC A;  1PZ9 A;  4YLZ A;  3U1X A;  1HB4 A;  4UF0 B;  1C8M 2;  2CV6 A;  4RHV 2;  5JAX A;  3ACH A;  4E4Z A;  1VAV A;  4JTN A;  4OZO A;  1F35 A;  4Y1Z A;  3J8F 2;  1MS8 A;  4OI1 A;  5IFP A;  2WKK A;  4JDN A;  3VLB B;  1GZC A;  1ND3 B;  4AW7 A;  5BNN A;  5CEH A;  3WZ1 A;  2H6B A;  3NO8 A;  1YQ8 A;  2Q0A A;  3D0S A;  1UCX A;  1XPW A;  2R06 2;  4FVV A;  3MLL A;  3ZKU A;  1QJX 2;  1UNB A;  4AVS A;  3KQ4 B;  1RMU 3;  1G9C A;  1DBN A;  1X8E A;  3PU3 A;  4GWN A;  1PHM A;  2A70 A;  2JIJ A;  2KA3 A;  2WNV B;  4XYX A;  2BUK A;  1DQ2 A;  3U4X A;  2GAU A;  1JHJ A;  1GAN A;  2RM2 2;  4HPK A;  4JX0 A;  3PIJ A;  2FDJ A;  3NST A;  3H8U A;  1UIK A;  1YFW A;  2R30 A;  2O8Q A;  4C90 A;  1PVC 1;  1RUG 2;  2VVE A;  3R05 A;  4UWD A;  5GAL A;  5T54 A;  1AYM 3;  1FX5 A;  1H2L A;  1QQP 1;  3H50 A;  3I8T A;  4CEY A;  3MBW A;  4RFT 0;  5K9Y A;  5LBF A;  1OKO A;  2G19 A;  3FL7 A;  1JU4 A;  3VKF C;  3PTY A;  2FDI A;  4XHX A;  3ACG A;  4Q4V 3;  3WW2 A;  3FLR A;  1RUJ 3;  1ND2 A;  3LF7 A;  3WQB A;  5GLZ A;  3WNP A;  1N1T A;  1WLC A;  2DFC A;  1SQ4 A;  3KWV A;  1W2T A;  1UZV A;  3AFG A;  3AMQ A;  4JC1 A;  1OFN A;  1W9T A;  3I4I A;  3GXU A;  5JOX A;  5LK5 A;  2G1M A;  1SFN A;  1FPN 1;  1R1A 3;  5A6X A;  5FO9 B;  3WCR A;  2NMO A;  3G6J B;  2QKD A;  1VLN A;  2C6S A;  2P3Y A;  4GA9 A;  5FQ0 B;  5I0T A;  1QXJ A;  3OUJ A;  1SPP B;  1JZ2 A;  3H3L A;  4BH9 A;  2E7A A;  2GNB A;  2VU9 A;  1I5P A;  3DXT A;  1JXN A;  3Q8F A;  3TEX A;  4YM1 A;  1LAJ A;  4B1L A;  2D6M A;  4PLM A;  4AGV A;  2J1R A;  3WNN A;  3IB3 A;  1D4M 1;  4LO6 B;  4YM0 A;  4N90 A;  2MHF A;  1NKG A;  4B4P A;  3VBU A;  3RZM A;  1V9U 3;  1ZBE 3;  1KS5 A;  3THP A;  1T2X A;  1HX6 A;  1XBF A;  2RS3 1;  3B01 A;  5FZL A;  5LAS A;  1RXG A;  1Z78 A;  3FN9 A;  4Y1V A;  1QKQ A;  1QF3 A;  1W6M A;  2XKO A;  2DTY A;  2D5F A;  2A3X A;  5KXC A;  1PX3 A;  2GP5 A;  2Y34 A;  5FKC A;  5L7O C;  5LCW L;  4Q4X 1;  3VBR B;  3MYX A;  5EPA A;  3ZFF A;  1OUR A;  1H30 A;  4OCT A;  2FBE A;  2D93 A;  1AR8 3;  4FQZ A;  1VRB A;  1LOF C;  4JAA A;  1U5Y A;  1CZS A;  3VZK A;  2AUY A;  2BYV E;  1L7Q A;  3KCX A;  3MW3 A;  3CIH A;  2IXJ A;  4M0N A;  3WF2 A;  3R4D B;  4ES8 A;  4QPI A;  3POW A;  2F4P A;  4DPN A;  3ZXE A;  1W8N A;  3IPV B;  2MEV 3;  3WDV A;  3LFM A;  1LTE A;  2A7A A;  4E4D X;  3AP4 A;  3Q9O A;  4BME A;  4BA6 A;  3LEI A;  2LM3 A;  2RS1 2;  4QXH A;  1DYK A;  1MEC 1;  1W28 A;  1E5S A;  1HN1 A;  3N9M A;  1XE8 A;  2DUO A;  4DOU A;  2BEO A;  2R04 1;  3VL9 A;  5E1R A;  2ADE A;  2QVS B;  3TOJ A;  4GJY A;  2V5D A;  4AYU A;  3AMP A;  1GNY A;  2YFU A;  4CDW B;  4XFF A;  3EO6 A;  4MYE A;  2IXC A;  4AXO A;  3DUI A;  3AVS A;  2BQP A;  1H0B A;  2JDZ A;  3ALQ A;  4A2U A;  1EAH 2;  1AR7 2;  3WQ1 A;  1SBE A;  2WNV C;  4LOS A;  1W9S A;  4LBQ A;  4M3C A;  5DUU A;  5FZC A;  5T5J A;  5T5L A;  1GFF 2;  1HXS 3;  4XAE A;  1OQ1 A;  2B46 X;  1CAX A;  2ZBJ A;  2XL7 A;  2A3Y A;  2HWF 2;  4Y22 B;  3WNL A;  4FPG A;  1N3P A;  3BUC A;  3E6C C;  3T0D A;  5FZ7 A;  4LUK A;  5C5U A;  2EVX A;  2RR1 2;  1GZW A;  1AR9 3;  5T3N A;  2JE7 A;  1VBE 1;  3RPQ A;  4IDZ A;  3THD A;  5C8W A;  1W6O A;  3E5Q A;  1OA3 A;  4GH4 A;  4MSV A;  2RS5 1;  4QPW A;  4QGM A;  5D21 A;  1LEN A;  5FOJ B;  4NPM A;  1POV 3;  3AZY A;  4WVM B;  2XG3 A;  4LLO A;  1O7F A;  1XU1 A;  3KF3 A;  1IKQ A;  1PMH X;  1B35 A;  1SMV A;  2HEW F;  4QMA A;  2VM9 A;  5A3M A;  5L36 A;  5DAQ A;  4F83 A;  4WM8 B;  3M70 A;  1TMF 3;  3M3O A;  1XYO A;  2ARX A;  4N7I A;  4B3N A;  2Y64 A;  2R07 2;  2HWE 1;  2V09 A;  3EQE A;  4YAR A;  3Q8E A;  2WWS A;  1POV 0;  1N3Q A;  1HB3 A;  4LIT A;  1XE7 A;  1IPS A;  2JXA A;  3GYD A;  1AX2 A;  3WG2 A;  2F4L A;  4MGS A;  1CAU A;  2J22 A;  1RXF A;  2WO7 A;  1W8Z A;  4XZP A;  4N7U A;  5KHH A;  3ZVX A;  3WIN E;  2OXB A;  4ARX A;  5FJH A;  1VJ2 A;  2BNM A;  4MGK E;  2HWB 2;  5EZW A;  1GQP A;  2X53 S;  3AX4 A;  5A7W B;  3NNL A;  4IGP A;  2TEP A;  3M7A A;  5FR3 A;  4BU2 A;  4LKE A;  1H1M A;  2ZHN A;  3GBW A;  5APA A;  3GHM A;  1QNW A;  3MIF A;  4GMP 1;  4QB6 A;  5C3R A;  4QT6 A;  4LEJ A;  4FPY A;  1RTV A;  1Y43 B;  5IAX A;  3ACF A;  4KU8 A;  2Q5T A;  1NZI A;  3LEM A;  4L9B A;  1EPW A;  1CES A;  3OBT A;  3GZT B;  4L8Q A;  1S55 A;  1S2B A;  2DYC A;  4PF5 A;  3T09 A;  3VKO A;  2IWG B;  3VBR C;  4DRV A;  1VAM A;  4LO4 B;  4QGN A;  4CA9 A;  4IV1 B;  4YVW A;  2ORZ A;  3ZFG A;  1C8M 1;  3ES1 A;  4RHV 1;  1DGW A;  4LO5 B;  1YIF A;  2H0V A;  3WDX A;  4AED C;  1RUF 1;  2G4I A;  2JIC A;  3IAQ A;  2DU0 A;  3VDA A;  4QX2 A;  2WO3 A;  3OPW A;  4R4X A;  2UY8 A;  1W8O A;  3K4D A;  2DUP A;  4LBN A;  3GBF A;  2XLA A;  4B7E A;  4CCD A;  4BQ5 A;  2X8K A;  1S0C A;  3A22 A;  5D8A A;  5LZ6 A;  2R06 1;  1XYP A;  1ULE A;  2Y6H A;  1DQ5 A;  2RMU 1;  1PO1 3;  3OEA A;  4P08 A;  5DN2 A;  2GAL A;  4XDO A;  1CN1 A;  1V70 A;  1GOF A;  1O91 A;  3AC0 A;  1U5I A;  2VAU A;  1OFS A;  2OVU A;  4LUL A;  5EIY B;  3N7J A;  5FMO L;  3HNB M;  1ODM A;  2YZ4 A;  2RM2 1;  3SEE A;  1W0P A;  3MF9 A;  3PUA A;  4FPE A;  1LEC A;  2FCT A;  3CEW A;  4BK5 A;  5IUQ A;  1UU5 A;  2JE9 A;  5CFD C;  1RUG 1;  5CYY A;  2Q8C A;  3TEW A;  1RUH 1;  1OLQ A;  4V2W A;  2W91 A;  2HEV F;  3EBR A;  4BOW A;  1DLC A;  3WF1 A;  5DDJ 2;  2VW0 A;  2BOI A;  4AK3 A;  1ZZ8 A;  4L11 A;  3RJ2 X;  3O1U A;  4HSL A;  5A1F A;  2ZAH A;  2VUC A;  3NNG A;  2LAL A;  5JVV A;  3HIF A;  1BQP A;  3DYP A;  4PQQ A;  1WA6 X;  2HWC 1;  2JD4 A;  3SQO A;  2HLE A;  1WME A;  1FV3 A;  1DYO A;  4KI5 M;  4LA3 A;  4MXV A;  1OSG A;  1WMD A;  4N9I A;  1W2N A;  2P34 A;  2ZKN A;  3HN1 A;  3WVJ A;  1B09 A;  5JZG B;  4Y20 A;  5A1A A;  4COZ A;  1RUD 3;  2VUA A;  2H6C A;  2UUR A;  4FPH A;  4CXW A;  1HKD A;  4KWU A;  2GZW A;  1C5H A;  3WT3 A;  1DFQ A;  4FBF A;  3MID A;  4ZON A;  4A4A A;  5A3L A;  1AXY A;  4AFC A;  2JG8 B;  1PK6 A;  5F8P A;  5E88 A;  5FY5 A;  2BV4 A;  4LLF A;  1DF0 A;  3KV9 A;  1LHO A;  1V6M A;  4HFS A;  4C1W A;  2C9K A;  4JTO A;  4XIK A;  2VQT A;  2JE8 A;  4RQP B;  5GM0 A;  2PYT A;  1E5I A;  1SLA A;  3ILN A;  4RD7 A;  4URA A;  5FYS A;  4XQW A;  3RMX A;  3RGB A;  1NA1 A;  4FXK B;  1R09 2;  4OI2 A;  4Z2W A;  1V6K A;  5CKQ A;  3O0X A;  3MO4 A;  5F3C A;  2I74 A;  4GWJ A;  3HQX A;  3ZO0 B;  3OJB A;  4TSV A;  3B7M A;  1RHI 2;  3NAP C;  4B1M A;  5GZF A;  3PUR A;  4G3Y C;  3T2O A;  5EJ3 A;  5E8A A;  3F2Z A;  1CD3 G;  1O4T A;  1H2K A;  2XHK A;  2VXJ A;  5DUX A;  5E89 A;  5GKA C;  4HKW A;  3I3B A;  2OQ6 A;  4P9L A;  2PHD A;  1H4H A;  1SHW B;  4YRD A;  5KXD A;  4BQY A;  1E5R A;  4AFD A;  2ZX1 A;  1HRI 3;  1PVC 3;  2BWC A;  4E9K A;  4QDR A;  1P8J A;  4FOW A;  2EAL A;  5C3Q A;  1JW6 A;  3MI8 A;  3PVN A;  2ZKL A;  4IV1 C;  1S0F A;  5ABJ C;  5T50 A;  2RS1 1;  2WFF 2;  2PHF A;  2VNG A;  3I59 B;  5A7Q A;  3UK9 A;  4WM7 A;  2VCC A;  5A6Y A;  4FPJ A;  3O1M A;  4BM8 A;  5JI9 A;  2W52 A;  2YY1 A;  3K46 A;  5BNP B;  2XPJ A;  5CIR A;  4TZD A;  4HAN A;  1DQ6 A;  4LKD A;  2FCV A;  4GUL A;  4YYO A;  5C3P A;  5CA6 A;  4QDS A;  2VTX J;  1Y9Q A;  2DVG A;  3LKJ A;  1AYN 3;  3CMG A;  3IT8 A;  1S2K A;  3QAC A;  2ZAA A;  4WVZ A;  4XHB A;  2WT2 A;  5I0R A;  4OI0 A;  1GWM A;  2DVD A;  1EAH 1;  1IS4 A;  5F5C A;  2GN7 A;  4UFL A;  2WQ4 A;  4P9I A;  5C8C A;  3U14 A;  1WZX A;  5AVA A;  2PN5 A;  1JZ3 A;  4IEW A;  3URF A;  2VQ0 A;  5FUN A;  3RI9 A;  1JYW A;  1FNZ A;  1UYZ A;  5H9S A;  4XUP A;  2YYO A;  1OMI A;  2J42 A;  3DEC A;  2XH6 A;  4EE2 A;  2YUE A;  2CNA A;  1QJU 3;  1KFX L;  1D4M 3;  2RR1 1;  3MW4 A;  1BMV 1;  5ANN A;  5IK5 A;  2ENR A;  3VD7 A;  1Q8O A;  2VME A;  4X6R B;  1W6P A;  2EXI A;  1UD1 A;  2ZA9 A;  2J1A A;  2VMH A;  4LE3 A;  1OPM A;  5IVE A;  1U5X A;  4I09 A;  4XEZ A;  2VQA A;  3IIA A;  2HWD 2;  1W6N A;  3SMH A;  1YHF A;  3BI3 A;  3SLI A;  2RVA A;  5LB6 A;  4D69 A;  1NX9 A;  4NVP A;  3CL1 A;  1C1L A;  2NM1 A;  4N53 C;  3H8X A;  3JD7 1;  4Q4Y 1;  4Q4X 3;  3IAP A;  3S30 A;  1NYW A;  3R6S A;  5A3P A;  1CJD A;  2YC4 A;  3WDT A;  2XOM A;  1ZZ9 A;  1O5L A;  2R07 1;  3VBO A;  4CP1 A;  5KHK A;  4XJ8 A;  1OD5 A;  2QQW A;  4YGC A;  2Y6G A;  5A3O A;  3E6B A;  3SEP A;  1LOG A;  3A23 A;  4M3C F;  4EWE A;  1V6I A;  1WD4 A;  4TWT A;  3T2Q A;  4U2A A;  1OI6 A;  5JXI A;  5DPN A;  1FXZ A;  2ZEW A;  5JZG C;  1J3P A;  4IES A;  2G9G A;  1CZV A;  3S7E A;  3RFR A;  1QH6 A;  1LOB A;  1DGR A;  1W99 A;  3ZSL A;  2JG8 C;  3MV1 1;  2JEC A;  2ZGQ A;  4FSJ A;  3VHO A;  2VUD A;  3S5A A;  5BPX A;  1WBF A;  4RQP C;  3BU0 A;  3AXE A;  4N9H A;  3F95 A;  3AYC A;  2ET1 A;  2ZX2 A;  1NT0 A;  1UU4 A;  2BER A;  3R0R A;  3CF6 E;  4M3C E;  4FPF A;  4AE2 A;  1E57 A;  3W21 A;  2JB4 A;  5DUV A;  3POE A;  1UY2 A;  3GNE A;  1HLC A;  1QY4 A;  2Z79 A;  2BVB A;  3VDC A;  3ZFE B;  3OB8 A;  4ONU A;  4AVV A;  3UL2 A;  3RZJ A;  5FYY A;  5LA1 A;  1D7P M;  4XJ9 A;  1LHV A;  1UY3 A;  2VW2 A;  1US3 A;  4AQS A;  4OFG A;  1RJ8 A;  3ZN4 A;  1JBC A;  1ULF A;  3KV5 A;  4LTA A;  5CG8 A;  1WW4 A;  3D4K A;  5BNN B;  1UX7 A;  2JDH A;  4I30 A;  5H9Q A;  1V6N A;  1AVB A;  3BIE A;  2JDN A;  3TNQ A;  3LOI A;  2WA3 A;  2WNU A;  4XFI A;  1J3Q A;  2EAA A;  4MXW B;  2X05 A;  2RHP A;  2JIG A;  1DQ4 A;  4ZZ5 A;  3LFI A;  4LIU A;  5FWE A;  5DZF A;  3M3Q A;  1HRV 1;  1COV 3;  1GU3 A;  1HV0 A;  3LA7 A;  4AG4 A;  4HPK B;  1QJF A;  3ETQ A;  3K4A A;  2G9F A;  2O14 A;  1TQ5 A;  5ANQ A;  3N7L A;  5A32 B;  4MV2 A;  2BGO A;  4PDW C;  5JLV A;  5FZ9 A;  5FLH A;  3WF0 A;  4BE3 A;  4L92 A;  1VR3 A;  4CEY B;  4XCB A;  2QQK A;  1QQP 2;  4IL7 A;  4I3G A;  2QCS B;  4QGL A;  1GZT A;  2VUL A;  2YHJ A;  1NCQ B;  4TXW A;  1ASJ 3;  1UYX A;  3FJS A;  3VKN A;  1ND2 B;  1QXR A;  3VBH C;  2A75 A;  2ZTN A;  3AJY A;  4P5H A;  4XPV A;  2JEM A;  1V6L A;  1YQ2 A;  3T2T A;  1NCR A;  1X9P A;  4FFG A;  3U78 A;  4DXZ A;  1VBA 1;  2IXH A;  2VZP A;  2I45 A;  2KXL A;  4BZ4 A;  2P3I A;  1UKR A;  4Y5T A;  4QPG C;  3V0A B;  2QQM A;  3DL3 A;  4A6S A;  1FPN 2;  2WAO A;  2W47 A;  3C7G A;  4EN8 B;  4EWA A;  2D3R A;  1RIR A;  2Z2S B;  4RR3 A;  4EWD A;  4FOV A;  4XBN A;  4CVU A;  1VBC 1;  3IZO A;  2ZGT A;  2QFE A;  1YQC A;  5GZD A;  1RUC 2;  2Q4S A;  2P17 A;  1PNG A;  3KD4 A;  1PIV 1;  3TEZ A;  1NLR A;  1C8M 3;  4RHV 3;  4AVC A;  5CFC C;  4P9X A;  1OH3 A;  4FAG A;  4GMP 0;  2OA2 A;  3J8F 3;  2CWS A;  2UU8 A;  5JXH A;  4R8H A;  3I3D A;  2W1U A;  2XON A;  3VBU B;  3PUQ A;  4GD4 A;  2VC9 A;  3UKV A;  4EN0 A;  5FAX A;  1NAE A;  3WD5 A;  1R09 1;  3TBD A;  5FBZ A;  3IDA A;  4Y24 A;  4OI4 A;  3DV8 A;  4HT1 T;  4XZU G;  2R06 3;  2E9Q A;  1QJX 3;  1SLL A;  1W6M B;  1W03 A;  1VB4 A;  2JEN A;  3WP4 A;  1KRI A;  3OYW A;  3ZXK A;  2P5B A;  4NRM A;  3LIG A;  4ISR A;  3ORJ A;  1NOV A;  3L2Y A;  4QM8 A;  3X29 B;  3ZFF B;  5LA9 A;  1CWP A;  3B69 A;  3CLP A;  2RM2 3;  5DZG A;  4UFH A;  1BZW A;  3I2H A;  1HQN A;  4BIF A;  5JPM B;  1O3R A;  2UYB A;  3CZU A;  3N9N A;  3III A;  1RUG 3;  2BGC A;  5FXW A;  3AVR A;  3MIE A;  3ZFE C;  4QPI B;  1C28 A;  3ZXD A;  3FX3 A;  2VQU A;  3LB9 A;  2B4K A;  4JDM A;  4JHZ A;  4K1Z A;  3H3U A;  2WFF 1;  1UIJ A;  3NKT A;  3KV4 A;  4UW6 A;  2HKX A;  2CSG A;  1H8V A;  2XJR A;  3GM8 A;  1O3T A;  1I3H A;  4AEM A;  5IK7 A;  2GND A;  3MPB A;  4Z2A A;  3T4H B;  4PCR A;  2W39 A;  2JG9 A;  1FYU A;  5F37 A;  5BNN C;  5CBL A;  2VPV A;  4ZU5 A;  4MGQ A;  2ET7 A;  2R04 2;  5LBE A;  4CXY A;  4RS5 A;  2LW8 A;  3AZV A;  1UMI A;  4A6O A;  4E27 A;  1VBD 1;  1H1A A;  4OHV A;  3RQ0 A;  4JHT A;  5L9B A;  1XOY A;  4OUL A;  1K5M A;  2DVB A;  5B4N A;  1LOE A;  4MVT A;  3ZM8 A;  1GYK A;  3VN4 A;  4LBQ B;  4M3C B;  3WHU A;  1LHW A;  1IS5 A;  3P6B A;  3ZYF A;  2PHW A;  4MOA A;  1YRZ A;  4Q4W 2;  5C7G A;  4UBG A;  1JS9 A;  4TN7 A;  1GQH A;  4I2O A;  2R1D A;  4BJ0 A;  5C3O A;  2PLV 2;  4R9B A;  3OGJ A;  2ES3 A;  2GMM A;  1KXG A;  2GH8 A;  4CEW A;  4FFI A;  5CKN A;  1MQT A;  4YGD A;  5K0U A;  1VBE 2;  1Y3T A;  1W6O B;  1YYN A;  4NO4 A;  4GH4 B;  1O4Y A;  3BOW A;  1NCQ C;  5EP9 A;  1ZRF A;  4NN0 A;  5BNQ A;  5LAT A;  4IV3 B;  2C5D A;  1Y9M A;  1B35 B;  2BRT A;  4OLL A;  4R4Z A;  3NQH A;  1BK1 A;  3WOG A;  4NIG A;  5J98 B;  2D3P A;  4P9J A;  2ZEZ A;  1QOT A;  4OUE A;  4EJR A;  1HIX A;  4NMI A;  3T0B A;  1LES A;  3T4V A;  2WJS A;  4EN9 B;  3H7Y A;  2CU5 A;  1RVF 1;  1L7R A;  4QKD A;  3N35 A;  5IAV A;  2V72 A;  1QOO A;  4W6W A;  1IPJ A;  1C57 A;  1XB9 A;  3PNA A;  5IHR A;  1W9W A;  2XUM A;  3MFA A;  1WCK A;  5FY7 A;  4AL9 A;  2D5H A;  5AFE A;  2DUQ A;  1CAU B;  1SCR A;  4JRA A;  3I2F A;  2RE9 A;  3CKH A;  2H0B A;  3IWZ A;  3KQR A;  2LRP A;  4CUC A;  2W2I A;  3CJI A;  2ORX A;  2WSU A;  5K8S A;  5DZE A;  5DAP A;  3OGR A;  5GJ6 A;  4Q8L A;  4BQ2 A;  1C5I A;  3QH6 A;  2D98 A;  5FKB A;  5C33 A;  1DGR N;  4XFA A;  3LA3 A;  1UX6 A;  1K45 A;  4CUA A;  4D94 A;  4HBN A;  5HV4 A;  2HBU A;  3WG3 A;  4XIL A;  3BB6 A;  3VKM A;  1ZA4 A;  2K0G A;  1UOJ A;  1XNT A;  5JOW A;  5FMO S;  1HJG A;  4NHL A;  2WNE A;  3O14 A;  4L97 A;  1XNC A;  1UF2 C;  1DLL A;  2DTW A;  1EAH 3;  1AR7 3;  3RWN A;  3BTY A;  4YVW B;  2PHL A;  3ZFF C;  2XBO 2;  1QU0 A;  3ZFG B;  4PF1 A;  2FMY A;  5FZH A;  3DPR A;  5CAD A;  4AI8 A;  3HN3 A;  3VBF A;  5JSP A;  5JOY A;  2BP6 A;  2CTV A;  2FHR A;  5DAX A;  2HWF 3;  1RUF 2;  1PGW 1;  3AXD A;  3POI A;  2GSY A;  4K8F A;  1TME 2;  2RR1 3;  1Q3E A;  3GZA A;  3T08 A;  3WQ0 A;  4CU6 A;  4PLN A;  1F4H A;  1EUU A;  4J6G A;  4QPI C;  4R9C A;  4P9W A;  2ARB A;  1H9P A;  2C0Z A;  5D8A B;  4FPK A;  4AAP A;  3W20 A;  2I2S A;  2F6B A;  1DZT A;  4XUR A;  5FZF A;  3LIH A;  1G86 A;  5LRR A;  4DRR A;  2C4X A;  2RMU 2;  4PIZ A;  4WVV A;  4XET A;  5FPL A;  5FYI A;  1YXW A;  3W9A A;  3TN9 2;  1ZA7 A;  4JGY C;  3OD0 A;  1UN1 A;  3EYP A;  3H1M A;  4Y5Z 0;  4CDX A;  4QDQ A;  4BB3 A;  4NWV A;  4XFC A;  2BTV C;  4LHK A;  4CCC A;  2R07 3;  2VUJ A;  4X6Q B;  1FMD 2;  1OOP C;  4LHS A;  1N3O A;  2QUO A;  4IXL A;  3T1M A;  5BUV A;  1RUH 2;  1H8T A;  2VCB A;  1JOJ A;  4NHY A;  4ZXK A;  4LK6 A;  4QPY A;  2RG4 A;  2GN3 A;  2Z4F A;  4AI1 A;  4CZS A;  2V4A A;  1WKY A;  5JMO A;  2DCK A;  2OS2 A;  1Z7S 1;  3ACL A;  1QIQ A;  2HWB 3;  2FZ1 A;  4LOR A;  5FZ3 A;  3DF0 A;  4MGI E;  2W95 A;  3KLS A;  2CWM A;  4WZF A;  3ZSJ A;  2D6K A;  3A7Q A;  4NHM A;  2HWC 2;  1LB2 A;  5FZ1 A;  1BXH A;  1OQE A;  4PBO A;  3I49 A;  3BTA A;  4FCA A;  3W59 A;  4AVB A;  4IV3 C;  4Y20 B;  3JBG 3;  1MZE A;  2WZR 1;  2ZS6 B;  2KD7 A;  1QJY 2;  2R0H A;  3C2U A;  1RUC 1;  3ZN6 A;  1XNA A;  4UW3 A;  1PK6 B;  3GZU C;  4I02 A;  2B5H A;  2XJT A;  1AL0 G;  5BNO A;  1DG6 A;  4OYU A;  2VMG A;  4NAM A;  3AKP A;  2QQN A;  5T5O A;  3IKW A;  4E8D A;  1W0O A;  4DB5 A;  1LRH A;  2XJQ A;  2WR9 A;  1NLQ A;  4ZU4 A;  4MGY E;  3BPZ A;  4H55 A;  4MUV A;  4K20 A;  1RUE 1;  5D1I A;  2GC2 A;  4ZKT B;  1LED A;  1CAV A;  3BTZ A;  2DV9 A;  3C3V A;  2UWA A;  3PUH A;  3CU7 A;  5BY5 A;  1W2A X;  4YM3 A;  1AXZ A;  4IE6 A;  3D8C A;  4HSJ A;  1WA4 A;  1SFP A;  4HMZ A;  5FDB A;  5FK7 A;  3AKQ A;  1IPK A;  3SH5 A;  3ZLI A;  5F32 A;  2XVL A;  2VBP A;  3RZL A;  1SDW A;  5GLT A;  4ZZ8 A;  1VPH A;  1NY7 2;  4Q1P A;  5DDJ 3;  4AGR A;  4UXA A;  4K9S A;  3LEG A;  4YVW C;  2BGP A;  3WNO A;  4YW3 A;  1AXK A;  1QDC A;  1Q8S A;  2Q1F A;  4HG6 B;  3ZFG C;  2SLI A;  3IMM A;  3I2O A;  2FDG A;  2QTW B;  1UMH A;  1F4A A;  2Y0O A;  2XUE A;  3AP9 A;  2Q30 A;  3BTX A;  5EWS A;  3H9A A;  1ND3 C;  5FP9 A;  4PJY A;  2HBT A;  1VIW B;  1W0N A;  2VY0 A;  4GWM A;  5FZB A;  5DAV A;  1WWY A;  5D8A C;  2E26 A;  2BNN A;  2WN2 A;  1EUT A;  4FFF A;  5FO7 B;  3TEY A;  4A44 A;  1F31 A;  3OCP A;  5D2A A;  5FUI A;  1G7Y A;  3GF6 A;  1JTZ X;  3GJB A;  5HCB A;  4MZU A;  3WG1 A;  4BDV B;  1DGW X;  4BQ1 A;  3WUD A;  3VDD A;  2K46 A;  5C8C B;  3THT A;  4QHB A;  4Z92 B;  1A78 A;  5FIX A;  4FT8 A;  1SAC A;  4Q4W 1;  1F8V A;  5EYY A;  1SLB A;  5T52 A;  2VMI A;  4UI9 L;  2VMD A;  2VZS A;  2PLV 1;  1CGP A;  1PGS A;  1X82 A;  3RS6 A;  4C0B A;  4BLJ A;  2VZU A;  4IE4 A;  1X36 A;  3ZIX A;  4H3W A;  4ET7 A;  4LOT A;  1BMV 2;  2YC2 A;  1VRH 1;  3BIW E;  1S1A A;  1VBB 1;  2Q8E A;  5CG9 A;  1R09 3;  1ONA A;  3ILF A;  4K1Y A;  3HQU A;  1W6N B;  2ZGN A;  4MHU A;  5FK8 A;  2OQ7 A;  3ZSM A;  1NQD A;  2YPD A;  2F17 A;  4KU7 A;  1RHI 3;  2ZGU A;  2XHN A;  5FZO A;  5J48 A;  2ZAB A;  5A33 A;  3ROU A;  4CTE A;  3ZXG A;  4FAH A;  1JMU B;  3JD7 2;  2OZ6 A;  4Q4Y 2;  5H9R A;  3KV6 A;  2B7Y A;  2WAB A;  1TNF A;  1KFU L;  1UL9 A;  4X8N A;  3E6D A;  2WUH A;  4LT5 A;  2K9Z A;  5BYN A;  4CP2 A;  2XWJ B;  3E5U A;  2QNK A;  3MIB A;  3M3C A;  5L9V A;  5HCF A;  4DXR A;  5I0D A;  5FRA A;  2RJK A;  4RGG A;  2WFF 3;  1TE1 B;  4XQD A;  4Q0U A;  4PQ9 A;  3TB0 A;  1PO2 1;  2Y6J A;  4XF0 A;  2Q1Z B;  4CCN A;  2B42 B;  4DEV A;  2FMD A;  3ZYR A;  2XJS A;  3AK0 A;  1MPX A;  3SKJ E;  3CHX A;  5IVB A;  5IWF A;  1YFY A;  4R52 A;  2YC0 A;  1R08 1;  3KS7 A;  1JH5 A;  3DKW A;  5FP8 A;  1APN A;  2AEN A;  3ZYB A;  1JUH A;  3DXU A;  3ZN5 A;  4M00 A;  5HPO A;  4I0A A;  1AYM 2;  1XSQ A;  4QKF A;  3O1T A;  2VL4 A;  1UY0 A;  4XJA A;  1KQR A;  2YPJ A;  2XBO 1;  2JX9 A;  3POY A;  4N8M A;  5DG1 A;  1R64 A;  2PEL A;  5CIS A;  3SCF A;  5GLW A;  1LKN A;  4H7M A;  4P00 B;  4Q2F A;  3ZOI A;  5L7O A;  1TME 1;  2YDE A;  2V4V A;  1REE A;  3PUI A;  3VZO A;  5CVR A;  5F6L B;  1K3I A;  5HBA A;  2D7F A;  2DDU A;  2ILM A;  1HDK A;  1LOF A;  4S2G A;  1Y7B A;  1MS4 A;  2XWB B;  4BQ4 A;  2WNU B;  1SDD B;  2HWD 3;  3N36 A;  4IEX A;  4Z07 A;  1XND A;  5FZ0 A;  5FMD A;  1H1I A;  2D97 A;  5B4X A;  3N9P A;  5DG2 A;  2GC3 A;  4ZPI A;  3TN9 1;  4QX5 A;  1GQG A;  1DGL A;  4YGB A;  2W5F A;  4P14 A;  4GKY A;  1MZ6 A;  1BBT 2;  4D6S A;  1CON A;  1US2 A;  1MR5 A;  2Q1M A;  1GLH A;  4Y3O A;  1O8S A;  3U10 A;  3UGF A;  3U75 A;  3MV0 1;  3WG4 A;  1ZNP A;  3AB0 A;  1XYN A;  1HRV 2;  2Y26 A;  4COU A;  2WII B;  2YV8 A;  4JCK A;  4CDW C;  4FTB A;  1FMD 1;  4CDU B;  3NJZ A;  1W9Y A;  3ACI A;  1WW7 A;  4FOY A;  1W8F A;  2PAM A;  3ZR5 A;  2JJ6 A;  2WWJ A;  4RFR B;  5FZM A;  1KEX A;  5T55 A;  3LOB A;  3AP6 A;  3C8X A;  5DUW A;  5C8C C;  1WCU A;  3P1I A;  2GC1 A;  1C3H A;  3QCW A;  3IDC B;  3B9C A;  3NRU A;  4UT5 A;  1Q8P A;  4XTP A;  4LHN A;  1RGS A;  3ZXL A;  1NCR B;  3VD5 A;  1DYP A;  3POB A;  4AR2 A;  3OY8 A;  5FOB B;  3ON7 A;  4HKO A;  4KWJ A;  1VBA 2;  5TSW A;  1S0G A;  3ES4 A;  3TYJ A;  1LOA A;  4D3W A;  3O1O A;  4I0W B;  4XFB A;  3H3Z A;  3ST7 A;  2IC1 A;  1SBF A;  4SLI A;  3T0A A;  5EHD A;  3I3Q A;  1KJR A;  4CDQ A;  1A8D A;  2V5Y A;  3SKV A;  1QJY 1;  2ZGR A;  3WY6 A;  4CUB A;  5LWB A;  1ODN A;  1IQA A;  2BDR A;  2VEC A;  3GCW A;  2ZGM A;  4MET A;  3MIH A;  1VBC 2;  4WM8 C;  5A7P A;  3UGH A;  1SCS A;  2C24 A;  1RB8 G;  1PIV 2;  2ZMK A;  4N43 B;  2A6Z A;  4K8R B;  1ZZ6 A;  1AHS A;  2PAK A;  4RA0 A;  4HK9 A;  1LEM A;  1UZ0 A;  1D2Q A;  2AEZ A;  4YVS B;  2XDV A;  5A7O A;  3WF4 A;  3I7D A;  4ZY9 A;  1NE6 A;  3SCG A;  2KM2 A;  3OYW B;  1MS3 A;  1D2S A;  4DQA A;  1KS4 A;  3ZSE A;  3PTR B;  1IHM A;  3FLP A;  2X29 A;  3NV2 A;  1OXC A;  3PU8 A;  5EXO A;  5FPU A;  1S2E A;  4XVH A;  2ID4 A;  1OBN A;  5A6Q A;  4G4F A;  1AR9 2;  2B8M A;  3ZYG A;  3GAL A;  1NY7 1;  4QX1 A;  5JXG A;  1EV1 1;  1QQP 3;  1Q43 A;  1VMJ A;  2Z5W A;  3J7L A;  1BEV 1;  2E53 A;  2VTX A;  3E97 A;  1UZZ A;  3FBY A;  1WCS A;  4Y4Y A;  4KWK A;  4LIV A;  3J7N A;  5FV3 A;  2Z42 A;  4FPL A;  2VVF A;  4UW4 A;  2EAK A;  1YFX A;  2R32 A;  2ZMN A;  3VBR A;  2JG9 B;  2LS6 A;  5E6H A;  3KCC A;  3FUO A;  2B45 X;  4JVA A;  3VGI A;  2BBV A;  1DHK B;  4DY3 A;  4AI9 A;  4IE7 A;  3S0M A;  1CPM A;  1ZRI A;  1HB1 A;  1UPI A;  2J1S A;  3AFK A;  4AED A;  3ZDS A;  1CZT A;  1W9F A;  2WNU C;  3FHQ A;  4YZ1 A;  1FPN 3;  2W0X A;  1VBD 2;  5EYX A;  1OD3 A;  1U12 A;  4PBP A;  2VOT A;  5JUV A;  1K5M B;  2WT0 A;  3IBM A;  4KNC A;  3SXW A;  4W65 A;  5E16 A;  3R4U A;  1UYP A;  4NRO A;  2ZJC A;  4I3P A;  4CPB D;  1AL2 2;  3AMN A;  3DGT A;  4NRQ A;  5JWP A;  1A34 A;  1RUC 3;  1YC6 1;  2YGL A;  4XC9 A;  4FI9 A;  3BN6 A;  2ZGS A;  1GOH A;  1FOD 2;  3WR0 A;  4COW A;  5FWJ A;  4CDU C;  3J7H A;  1U0A A;  2ADD A;  4FO9 A;  2FDK A;  2W1S A;  2E32 A;  4QQL A;  3USU B;  5F7U A;  1MQT B;  4JGZ A;  5K0U B;  4IQP A;  2VGD A;  3BVC A;  1UZW A;  1PZ7 A;  4XJU A;  5CFD A;  3UES A;  4B4Q A;  3B93 A;  2RS3 3;  4PHZ A;  3FHA A;  5LEJ A;  2C26 A;  1KIT A;  1LUL A;  2W1Q A;  5FYM A;  4C0H A;  2BBA A;  2ATF A;  2UY9 A;  3VV1 A;  3LWC A;  4CRQ A;  2CGN A;  5AC9 2;  1BK0 A;  1NCR C;  3WW4 A;  4UFI A;  2P2K A;  2NYY A;  1LNS A;  1QJZ A;  2W46 A;  4LK7 A;  2Q8D A;  1AR6 2;  2TNF A;  1YLL A;  4QQ2 A;  5ERL A;  3HJR A;  3K2O A;  3HQR A;  4EZ4 A;  1W8W A;  2CL2 A;  5A3N A;  1WLW A;  1RVF 2;  1W8U A;  1O8P A;  2C9A A;  5A1L A;  1M4W A;  3WXP A;  1YUD A;  2ZHL A;  3T2P A;  1UYY A;  2EXJ A;  3V65 A;  4MGZ E;  2D6L X;  2JKB A;  1HQL A;  2PA7 A;  3AJZ A;  1BVP 1;  2XXZ A;  4HON A;  3K51 A;  4H2A A;  1CIY A;  4GKX A;  3DYO A;  3DYM A;  1OA4 A;  4N43 C;  4NAO A;  4XTM A;  3SCH A;  3CJI B;  1MEC 3;  3ZMN A;  1G9B A;  4XFH A;  4YW6 A;  1OUS A;  4Q26 A;  4CCE A;  2R04 3;  1DIW A;  3H42 B;  4QB1 A;  1V6O A;  4YVS C;  2ZHM A;  1WMF A;  1AYM 1;  3K3N A;  3HEI A;  2ZGK A;  2JDP A;  3SNM A;  3AKS A;  4O61 A;  2HYK A;  2P6H A;  3JUU A;  3L2H A;  3WUC A;  3VUO A;  3KGL A;  4Z1V A;  1JYT A;  1PNF A;  1GMM A;  1XJA A;  4EQV A;  2XML A;  5IAT A;  4LNV A;  2JDY A;  2LUW A;  2W87 A;  4HN1 A;  3VBF B;  2VH9 A;  1V0A A;  1GNH A;  3OBR A;  4Q4W 3;  1ZYB A;  2MPF A;  3NAP A;  4S2D A;  5I0U A;  5CU1 A;  5FMB A;  2PLV 3;  4NUB A;  3U11 A;  4F8A A;  1PGW 2;  4KG0 A;  3VB9 A;  3MEP A;  2WLP A;  2Y38 A;  1BYH A;  3WEZ A;  5B2G B;  1ZRC A;  1VBE 3;  5C9A A;  3O7O A;  3WCS A;  1F2N A;  2RS5 3;  1IKP A;  3AM2 A;  1IOA A;  4XFG A;  1ENR A;  2QQU A;  1UOF A;  1OVS A;  1BBT 1;  5G04 L;  1REF A;  4NE9 A;  4CCO A;  4CDX B;  4E2S A;  5BNP C;  2JG9 C;  1OT5 A;  1DZQ A;  1RUI 2;  5ABJ A;  4Q27 A;  2Y6F A;  4B29 A;  1RUN A;  2YBS A;  4JZR A;  5F9T A;  1F5J A;  2HYX A;  5FPB A;  1Q5O A;  2OYZ A;  3O0V A;  4M01 A;  4XOG A;  5FZ4 A;  2RDR A;  2XR4 A;  2HWE 3;  5I8S A;  3UJQ A;  1V9U 1;  1ZBE 1;  5KHJ A;  1H8T B;  3T3Y A;  3FBM A;  4QU1 A;  1A8M A;  1ENQ A;  4BWO A;  3LDK A;  1XU2 A;  2D6P A;  5EJ1 B;  4IGQ A;  1J59 A;  4EZH A;  5JOZ A;  4OUM A;  3OOX A;  3FFQ A;  5C4W A;  4BQ3 A;  1S0D A;  4XAA A;  1GP6 A;  2ZZJ A;  2CDO A;  2YG0 A;  4P02 B;  3NKG A;  4WV8 A;  3RZK A;  1QNY A;  3HBK A;  4W8J A;  1Z7S 2;  3POJ A;  4QKN A;  4CU9 A;  2L9L A;  2ZHK A;  1G6N A;  1QXP A;  4QXC A;  3M3E A;  1GP5 A;  3OPT A;  3PDQ A;  4YZ4 A;  4CCM A;  4CCK A;  1JYX A;  4IEZ A;  1N47 A;  2UYA A;  2JDA A;  4A7Z A;  4QKB A;  4M0H A;  1AZD A;  4GMP 3;  1L7L A;  5FY8 A;  1JZ4 A;  5BV6 A;  1MS5 A;  4NII A;  1URX A;  4Y1U A;  4AVA A;  2VCM A;  1HRI 2;  1T6B X;  4JKL A;  4XF3 A;  3WNM A;  4Q5O A;  2DCZ A;  1DU3 D;  1YFU A;  2IXK A;  2XLG A;  2XLF A;  4ATE A;  2PHT A;  2WZR 2;  3M1H A;  5KHG A;  3NNF A;  1OA2 A;  3ZN6 B;  2X5I A;  4ASK A;  2XBO 3;  2ZEY A;  5T5P A;  3O5S A;  4DEQ A;  4CU7 A;  4EN6 B;  3UYJ A;  1KD7 A;  4NRP A;  5L73 A;  4C1X A;  2D6O X;  2WO1 A;  1RUF 3;  4BXS V;  4N53 A;  3WDW A;  2D6N A;  5JR2 A;  1UOB A;  1TME 3;  2LTN A;  5L9R A;  2WN3 A;  4ITC A;  3Q8C A;  2A6V A;  2IUW A;  5F3E A;  5F39 A;  4IEP A;  3AL6 A;  1O6U A;  2RDN A;  5KC6 A;  3KT4 A;  4QX0 A;  4O65 A;  2RMU 3;  4BPZ A;  1RUE 2;  1ZZB A;  3ENR A;  1TNR A;  1BLZ A;  1NUK A;  1QJE A;  3PHM A;  3TN9 3;  1MS0 A;  4QX8 A;  1NG0 A;  4PI2 A;  2AAC A;  4COV A;  4W6Y A;  1W6Q A;  4EN7 B;  1V00 A;  4PLO A;  4KH9 A;  4Q1R A;  1HW5 A;  3WP5 A;  3B3Q E;  3ABZ A;  2VZV A;  1IGO A;  1AR9 1;  1WW5 A;  2CYF A;  5IJR A;  1FMD 3;  1W05 A;  4TLG A;  1GKB A;  5IYY A;  2JKX A;  1W04 A;  5LBB A;  1RUH 3;  2BJS A;  3AYA A;  5FXZ A;  5DQ0 A;  2YBP A;  2ZEX A;  5EFU A;  3ZYP A;  2WNO A;  3OSD A;  4D7T A;  1JU3 A;  4MG2 A;  1UWW A;  3V64 A;  4CPB A;  2OX0 A;  3VBF C;  2Y60 A;  3KSC A;  4AQ6 A;  2E7Q A;  1FT9 A;  1NZC A;  2PQQ A;  4KGG A;  4YG0 A;  1OLM A;  5JSR A;  1D0G A;  3LQC A;  3LAG A;  4IE5 A;  2W94 A;  5I93 A;  4ARY A;  3CDZ B;  3VZN A;  1AX1 A;  2HWC 3;  4XBL A;  1VAK A;  4FP3 A;  3RZZ A;  4NWW A;  2ARA A;  4KMQ A;  3FZ3 A;  1R1Z A;  1JYC A;  3WDY A;  2PFW A;  1SLI A;  3RDI A;  4XDQ A;  4KQ7 A;  3T30 A;  1PZ8 A;  4UW5 A;  1NE4 A;  2ZPX A;  3VDD B;  3S5Q A;  3WP3 A;  1QJY 3;  4BQW A;  1AL2 1;  1YO8 A;  4FPC A;  5FRE A;  4JKK A;  3VZJ A;  2C1F A;  4DUX A;  5CB7 A;  3ECQ A;  3MLK A;  1SZB A;  1AJO A;  3I59 A;  1FOD 1;  1CAX B;  5ACA 2;  2D44 A;  1WBL A;  4YSF A;  1GSL A;  2WYS A;  4A7Y A;  3DEM A;  2DCT A;  5FZE A;  5L19 A;  1GZW B;  2E31 A;  2FCU A;  4LBJ A;  3ZYH A;  4AI2 A;  1H8T C;  3V0B A;  4CEY C;  2O0O A;  2XJU A;  2ZX3 A;  2WC2 A;  1VRH 2;  2ARC A;  4M4R A;  1VBB 2;  1JHN A;  2B9V A;  2CDP A;  4PDW A;  1GWL A;  2GME A;  1ND2 C;  5F5I A;  5AC9 1;  1JYN A;  4MAD A;  2CAV A;  2OZJ A;  3K3O A;  5GZE A;  4NOT A;  5FZO B;  3KT7 A;  1AR6 1;  5A33 B;  2VZT A;  2ZX0 A;  3H1Y A;  3PIG A;  3OF1 A;  4FXG B;  4D6R A;  1A6C A;  3VBH A;  3O1R A;  5FY0 A;  3KM5 A;  2XJP A;  2OKX A;  2WQZ C;  4QQO A;  3AZW A;  1A3K A;  4HZF A;  4UFJ A;  5GLV A;  4D0Q A;  2J1T A;  2CAU A;  3KB5 A;  4BQX A;  1H9W A;  1AJK A;  4Z82 A;  1ACC A;  3N3H A;  3NV1 A;  4A3Z A;  1UPS A;  5JR7 B;  5J09 A;  1LR5 A;  4QPG A;  1YI9 A;  3AKR A;  4LA2 A;  3OGV A;  4WVW A;  5JPN B;  2OPW A;  2R7E B;  1XSR A;  3KHC A;  3PME A;  3FWE A;  4K40 A;  3UET A;  2RS1 3;  1J1T A;  4CP0 A;  3AYD A;  4LBQ D;  3B5L B;  1PO2 2;  1L3J A;  2UWB A;  1MZF A;  2ZML A;  1PGL 1;  1COV 2;  3VBU C;  2DUR A;  1HJF A;  4OHX A;  5CFC A;  3S7I A;  4BYY A;  2CY6 A;  1R08 2;  2XB6 C;  3RYR A;  2P37 A;  4YW7 A;  1UO9 A;  2OUJ A;  2PMW B;  3RNS A;  3VD3 A;  1G9D A;  2ZCW A;  3LGR A;  4W50 A;  5FZI A;  3ITQ A;  5LEK A;  4H14 A;  4LJH A;  5A3U A;  4YW5 A;  5I8Y A;  1LHU A;  2FQP A;  3FFZ A;  1H4G A;  3THC A;  5H9P A;  1TEI A;  1YNA A;  1TZO A;  2ZZQ A;  1IS3 A;  2AEY A;  5L7O B;  4NJ4 A;  3N4M A;  4XDP A;  3IDB B;  2AYH A;  3OEB A;  4AHW A;  4UYB A;  5FP3 A;  1ZZC A;  4QM9 A;  5DXD A;  3S57 A;  4FTS A;  4RYD A;  2VW1 A;  1OKQ A;  4E8C A;  3M4F A;  3WDU A;  3ZPO A;  1RUD 1;  1E5H A;  5SV8 A;  4DS0 A;  2A6W A;  3I2K A;  3JQX A;  4KBB A;  4E2G A;  1RUI 1;  1X33 A;  2YBK A;  1UAI A;  4YZ5 A;  5F2S A;  4LMF A;  4IER A;  3JD7 3;  4Q4Y 3;  2WS9 2;  1ZRR A;  2J1U A;  1FNY A;  4KBZ A;  5FYV A;  5A7N A;  2P6C A;  3W58 A;  3T1L A;  4DIN B;  4FOQ A;  4XF4 A;  2EA7 A;  3JXS A;  4LE4 A;  3VDD C;  3DCQ A;  3H7J A;  1DQ0 A;  4LHL A;  4IGO A;  4UFM A;  1CAW A;  3AZX A;  5CAZ A;  4UFK A;  3EXU A;  5HCA A;  4MXW A;  2VD7 A;  2XL9 A;  1OQD A;  4AF9 A;  3I2D A;  4E4S A;  4Y26 A;  2XGX A;  3CBN A;  4QHO A;  4CP9 A;  3OY8 B;  1VAL A;  1XC6 A;  4K21 A;  1V6J A;  3N9L A;  3TWI A;  5IVF A;  2WLQ A;  3KZ4 C;  5JI7 A;  1WUV A;  1PM4 A;  1X7N A;  3U0Z A;  4GH4 C;  4DNY A;  3IDE A;  1HRI 1;  4YG3 A;  4OHZ A;  4CDQ B;  2WL1 A;  5A32 A;  4YNI A;  3L9J T;  2P4E A;  1B35 C;  5F5A A;  4NPR A;  2K2S A;  5DAW A;  3LEK A;  1KDK A;  4AQT A;  2EXK A;  4ZXE A;  1QMJ A;  3TNP B;  1NCQ A;  2BFU L;  2ZX4 A;  1ULC A;  2Y33 A;  2YXS A;  3NL1 A;  4NHK A;  4X8P A;  3OBZ A;  4ASM B;  2VO5 A;  4JV4 A;  2A6Y A;  3CZJ A;  3I54 A;  2J1E A;  2RJL A;  3I3M A;  1VB2 A;  3ZMO A;  4ASL A;  4BIS A;  3J4U H;  4O9E A;  2DVA A;  1JOD A;  1AYN 1;  4AHZ A;  4P9G A;  1NA1 B;  5JXJ A;  2Y8K A;  5KBF A;  3V0A A;  5FLI A;  4YZ2 A;  3RVH A;  3MFC A;  1J1L A;  2VZ3 A;  1YEW A;  1QH7 A; 
#chains in the Genus database with same CATH homology
 3KHC A;  4NPM A;  4RFR B;  3S5A A;  3H8O A;  2FDI A;  3BU0 A;  5F8P A;  4NRP A;  2FD8 A;  3H8R A;  2IUW A;  3O1P A;  3O1O A;  3O1V A;  4ZS2 A;  3T4H B;  4IE4 A;  3RZG A;  3I3Q A;  4O7X A;  2FDF A;  4CXY A;  3RZH A;  4NJ4 A;  4CXX A;  4JHT A;  4NID A;  3RZJ A;  4ZHN A;  3S57 A;  2FDH A;  3RZM A;  3BKZ A;  4MGT A;  4NPL A;  4MG2 A;  4O61 A;  4ZS3 A;  3O1M A;  3I49 A;  4OCT A;  4NIG A;  5DAB A;  3T4V A;  4QHO A;  3LFM A;  4QKD A;  4QKF A;  3O1T A;  3BIE A;  3BTZ A;  4IE7 A;  4IE6 A;  3T3Y A;  3BI3 A;  3O1U A;  3H8X A;  3O1S A;  3RZL A;  4NRO A;  3RZK A;  3KHB A;  4NRQ A;  4QKN A;  3I3M A;  3O1R A;  4NIH A;  3I2O A;  3BUC A;  2FDG A;  4QKB A;  3BTY A;  2FDK A;  2FDJ A;  4IE0 A;  4NII A;  3BTX A;  4IDZ A;  4NRM A;  4CXW A;  4IE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...