3I42A

Structure of response regulator receiver domain (chey-like) from methylobacillus flagellatus
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
119
structure length
118
Chain Sequence
SLQQALIVEDYQAAAETFKELLEMLGFQADYVMSGTDALHAMSTRGYDAVFIDLNLPDTSGLALVKQLRALPMEKTSKFVAVSGFKNDLGKEACELFDFYLEKPIDIASLEPILQSIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator receiver domain protein (CheY-like)
publication title Structure of response regulator receiver domain (CheY-like) from Methylobacillus flagellatus
rcsb
source organism Methylobacillus flagellatus kt
molecule tags Structural genomics, unknown function
total genus 36
structure length 118
sequence length 119
ec nomenclature
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3i42A00
2Q5CA 4XASA 4KK4A 3P9YA 4NCBA 1XHFA 3OQMA 4G0MA 4MGEA 1VKRA 2ZAYA 3OMXA 2VUHB 3H5TA 4QPJC 5B3JA 4MR9A 2IPMA 4P1ZA 1XHEA 4W5NA 3LKBA 4F8JA 3DLHA 4MR7A 3JPYA 4JB2A 3CZCA 2HQBA 5ABPA 4G0YA 5HSGA 4XXHA 3RVRA 1KGSA 3JS5A 3GL9A 1BAPA 3A0RB 5TPZA 4IRXA 4RK1A 5HQJA 3LUHA 2CHFA 4IMIB 3SAJA 6ABPA 1JFSA 3H5VA 4F06A 2P4UA 1JFVA 3CTPA 3CFYA 5EWLA 5KQPA 4EY3A 4MS4A 3O2JA 2GX6A 2WJAA 3Q7RA 2PUGA 1AB6A 1E6KA 1NXTA 2GWRA 2IOYA 3CKMA 4TLLB 5EWMB 4JB0A 4ETNA 1P8AA 3OLVA 3NNDA 4FE7A 4NICA 3RVQA 4EYGA 3EAFA 3Q41A 3EULA 4HNRA 1RXIA 3QEMB 5JS2A 4JA2A 3URMA 4B09A 1FQWA 2LUOA 4ZYLA 4WUTA 4Z4HA 2RDMA 3QLTA 1DG9A 4OTZA 2QVCA 1LK0A 4MQFB 3B2NA 3HEBA 1L5ZA 4DADA 1NXSA 3KYIB 4EYOA 3GT7A 1M2FA 5IX8A 2PL9A 4YV7A 2FKAA 2FVYA 3LTEA 5TQ2B 4OG2A 1DCKA 2HSGA 3BRQA 1JDPA 5FBKA 1LJLA 2L17A 3IP6A 5TPZD 3C97A 2BGGA 1H9CA 2WRZA 4W5OA 1ISSA 3CLKA 4Q7EA 4RK5A 4ML3A 3TB6A 4S05A 4PE5B 1SXHA 5IBQA 2HPHA 4YWHA 3ROFA 5IEBA 3MM4A 2RJNA 1A04A 4MR9B 3RVKA 1GCGA 3O74A 1YTUA 2A9OA 4OLAA 4MR7B 3D8UA 2H0AA 4FE4A 4RY0A 5JNVA 1LBHA 1PEYA 3RVSA 3M9XA 4IMJB 4LE0A 1JWLA 3OLZA 3H1GA 4LE2A 1JFTA 1TLFA 3TMYA 3ILYA 2WJWA 2HQOA 3NNNA 4GNRA 1BDHA 5BRJA 1ISRA 1RZRA 3RQIA 1I3CA 1LBIA 5EWLB 4G0ZA 1Z18A 3KJXA 4F3TA 2E4WA 4MS4B 4PEVA 3GBPA 4YP9A 2GI4A 1PUXA 1U04A 3NHMA 4RSMA 3HXMA 1DC8A 3O2SB 5JNSA 4LZLA 4JP1A 2MYUA 3TD9A 2WB4A 3CRNA 1ZESA 2F8TA 3DGEC 3KHTA 5KQMA 3Q7TA 4RDCA 5DGCA 5CHYA 3H6HA 5IUKC 5HKOA 1DC7A 1EWTA 2LPMA 1QMPA 3HSYA 3HUUA 4WXEA 5CNJA 5JNTA 2QV0A 3O1IC 1NXVA 3H1EA 1TJYA 3M6MD 3F6CA 5TQ0A 3LOPA 3JVIA 5KQGA 3C3WA 4OLBA 3IPCA 2YHAA 4D6YA 3H5IA 4H3HB 3RVNA 3NHZA 5D2CA 2LP4Y 2RJOA 3H75A 1DCFA 4YO7A 2YHBA 3FFTA 2PUFA 4YLEA 2RGYA 2FEPA 4LX8A 1JH9A 4N76A 3GBVA 4P98A 2DRIA 4WZZA 3SM9A 1DBQA 4RY8A 5FWYA 1ABEA 4QYWA 3VNBA 4LDAA 4N41A 2MSKA 3CG0A 3LUDA 4O1IA 3HO1A 1VRVA 1JL3A 3C3MA 1RZRD 3OM1A 5IUJC 3N0XA 5DTEA 4Q6WA 4KMRA 1ZY2A 3O1JC 4MQEA 2CHEA 1U0SY 4UHKA 3DBIA 3N6VA 5JNWA 1EWVA 2V0NA 3GRCA 1RXEA 3KLNA 1J56A 2MYNA 3G85A 3HUTA 4UHJA 4ZJPA 3F73A 3Q15C 4RK4A 3IP9A 4KQCA 1Z2DA 3F7NA 2HJ9A 2HQRA 2FMIA 3EQZA 4JOQA 5PNTA 1L5YA 4YS6A 5BRAA 1VLZA 3G1WA 4KREA 3MQ4A 5IC5A 2FN8A 4RXMA 3DLBA 1MVOA 2MYPA 4RU1A 4RXUA 5EWJA 4EVRA 2FXIA 4L85A 1E6MA 4O5AA 4TN5A 3ROTA 3IDOA 5GQSA 2NT3A 4HYEA 1APBA 3HDVA 2E4UA 1CHNA 1GCAA 4LDZA 3H5LA 3SG0A 3IPAA 3LMKA 3TO5A 3NBMA 1Z16A 1DRJA 3C3KA 2AYXA 3FFWA 1ABFA 2PKXA 2VYCA 2A9RA 5HM6A 3HVRA 4RKQA 2WY2D 2FEWB 4JAVC 4MYRA 2XDYA 5GOTA 4XARA 3LKVA 2M1ZA 3GV0A 2R4QA 1DRKA 1Z17A 2ZWMA 3KTOA 3MIZA 3HCWA 1M2EA 1QP7A 2QXYA 3I5AA 1VPWA 5T7BA 4N47A 1OXKB 5T3YA 3H5WA 2IPNA 3KCNA 4H60A 4ETMA 2PL1A 5C5CA 5JNUA 1Z12A 2KYRA 3EGCA 1DJMA 3JPWA 1EHCA 2PE5A 3GWGA 1BDIA 2NZVG 3OLYA 1JYEA 1ZHHA 2JB9A 3KG2A 3LUKA 5FWYB 1MB0A 1M5TA 3N8IA 1BA2A 3HM9A 2QR3A 2FQWA 4S04A 1EAYA 4XAQA 4W5QA 2OENG 4IILA 4MR8A 3GA5A 5FWXA 5KI6A 1P6QA 2PLNA 3KLOA 4MQEB 1PHRA 4RK6A 1F4VA 3OQNA 1U8TA 1D2AA 1FFGA 2QZJA 1JBEA 3A3KA 3HS3A 3O2QB 1EWKA 3QK7A 5E3JA 4GPAA 4D74A 4KNYA 5IUNC 4KPYA 1E2BA 4W5RA 4L4UA 1NXOA 1YIOA 3QLVC 3A10A 3RVOA 2O20A 3DGFC 3JVDA 3L49A 4MS3A 4EVQA 3HK2A 3A0UA 2AYZA 1MB3A 2B1JA 3KKEA 1C0EA 1DBWA 3I09A 1RNLA 5F64A 3H6GA 4KK3A 3BILA 4N0QA 3CS3A 4NV3A 1SRRA 3T38A 1K68A 4ZMRA 1AB5A 2JVIA 5EWJB 3RVPA 1URPA 3EDCA 4Z4GA 3RVLA 1T34A 1C4WA 3LUGA 1JLKA 1P2FA 2WMYA 4G0PA 4IF4A 3CNBA 2JK1A 4RY9A 1NXXA 5KC9A 4Y9TA 7ABPA 5CNMA 3GYBA 2QU7A 4PICA 1CEYA 1Z15A 3QELA 1WETA 2MYTA 3LUAA 2A9QA 2IKSA 5FBHA 1ZH4A 3LUFA 3UUGA 5KQLA 4YCSA 2E4VA 1U2PA 1TM2A 3D02A 2PJUA 1MIHA 4TLMB 3Q7SA 1FFSA 4RV5A 1YMVA 2X7XA 1QQAA 1SXGA 1ZH2A 1RPJA 4WXMA 3MF4A 3KYJB 1W9HA 4FB4A 1FSPA 1KRXA 1D1PA 1NXPA 1D1QA 3LUCA 1PNRA 2QW1A 4MR8B 5FWXB 3C6QA 3EQ2A 1QP4A 4Z4IA 3MYYA 1W25A 3KSMA 2FW0A 3N53A 1P6UA 2L19A 2B4AA 2LBPA 3EJWA 3N75A 3E3MA 4MS1A 1R8JA 1GUDA 4LRQA 4RK0A 3R0JA 3VNAA 1D5WA 2R47A 4Z4CA 4MS3B 2L2QA 3CG4A 3F6PA 3FDFA 4KV7A 2JVKA 4OBBA 3QLUA 8ABPA 2CWDA 1SXIA 2PUDA 4F11A 1YMUA 3OO0A 5TQJA 2GBPA 3O75A 3QLVA 1ZGGA 3KS9A 4YRZA 3OO1A 3I42A 4QYMA 4H3KB 2FQXA 2ID7A 3LUJA 1JF8A 3CZ5A 4Z0NA 4RK7A 4OATA 4G0QA 4KZKA 5DLEA 2LIVA 1TMYA 3NNSA 5TE9A 4MAAA 4TMYA 5DKFA 3HZHA 1PNTA 1S8NA 2VUIB 1GUBA 5ED4A 4HNQA 2QVGA 1QNLA 4N03A 3QELB 1A0OA 4Q6BA 3W9SA 5C5EA 3I45A 2MSWA 2GKGA 3RH0A 2PUEA 1MAVA 4ZMSA 4LE1A 1BDJA 2R48A 4G0XA 5TQ0B 4YGXB 1ZGZA 2VK2A 1IIBA 1F51E 4NCAA 2IDMA 4Z4FA 3JY6A 2MSLA 4RZSA 2CD7A 2FTKE 4RXTA 1USGA 1Z13A 4QICA 4EYQA 3ILHA 4EUKA 5DCLA 1XWWA 2ID9A 2FEKA 4HNSA 2NUBA 1U2QA 4DN6A 2W42A 1NATA 3T95A 1QO0A 1JHZA 4MPTA 2FMFA 1NY5A 5KWSA 2NT4A 2JVJA 1USIA 2E4ZA 4EGSA 1KRWA 5CNIA 3UKJA 4F12A 2FLKA 3CU5A 1ZAYA 5TPWA 4Z4EA 1PEAA 3S99A 1DZ3A 3K4HA 4MS1B 1YS6A 1Z26A 3T6KA 5BR1A 3QX9A 4MRMA 1ZVVA 1HEYA 3H5OA 4KVFA 3OM0A 4NQRA 3UK0A 4G86A 6CHYA 2E4YA 2NZUG 2FSPA 5BQ3A 1USKA 1JDNA 4O1HA 1CYEA 3MMNA 5CNKA 4E7OA 4G97A 3Q9SA 2PUAA 2JBAA 3TX6A 1KMIY 3JTEA 2JCGA 5IULC 3EODA 4EYKA 2PAFA 4KFCA 1JYFA 2P9HA 5B3JC 1YVUA 3CHYA 3BBLA 3FFXA 3HDGA 2M98A 3QEKA 1B00A 4W5TA 4YR7A 3O1HB 4Z99A 1M5UA 1YK1A 2I6FA 3MA0A 4IGAA 4PZ0A 1QO0D 3QX8A 3HJFA 1D4ZA 3RVJA 1ZN2A 2H3HA 9ABPA 1QQBA 2E4XA 3SQNA 2IYNA 4D6XA 5KC8A 1Z25A 2IPLA 3RVMA 1QKKA 1UDRA 3SNKA 4E7PA 4ZPJA 1YS7A 1YK0A 3HV2A 3LFTA 4MLCA 2WWVD 3N0WA 4RWEA 4KRFA 1A2OA 2FQYA 1ZDMA 3FGZA 1NXWA 3SY8A 2FMHA 4XLTA 3BREA 2L18A 1JX6A 1K66A 1GLGA 2JRLA 3E61A 4ETIA 2A9PA 1TVMA 5EWMA 4RS3A 5JS1A 1ZITA 5TPWB 4CBVA 3L6UA 2OQRA 4PYRA 3H1FA 2TMYA 2N9UA 3QEMA 3OLXA 1E6LA 4G0OA 3OMWA 3OQOA 2FLWA 3K9CA 1QP0A 4XFKA 2PMCA 1DBPA 1FFWA 4MRMB 3IP5A 4MLDA 1DP4A 3QLUC 3T8YA 1QPZA 1OXBB 4Z9AA 1Z2EA 2F8SA 2QSJA 3O21A 2FMKA 2PUCA 1DCMA 2R25B 4MQFA 3OLWA 1SD5A 4M88A 4Z9BA 1BVHA 1LJUA 3IP7A 2JBAB 5TQ2A 4WWHA 4RKRA 2FN9A 2IPAB 3N0RA 4JASB 5I4CA 4WT7A 3BRSA 1EFAA 1NTRA 4KQ9A 3M9WA 4DQDA 3FMVA 4EVSA 2J48A 3DZDA 5IEJA 2PUBA 4N0PA 1Y1LA 5JNRA
chains in the Genus database with same CATH superfamily
3N28A 2AD5A 2XD9A 1S8FA 3C4JA 3KK0A 2VJYA 4LK3A 1MJFA 4UTNA 3F90A 1AKUA 1PI3A 3L6OO 4JJAA 4JN6B 1JNYA 1ZEJA 4ZEOA 4NZZA 2J30A 1CQJB 1T4DA 2AOTA 3OIDA 4MR7A 4P92A 4JB2A 4LSGA 2LKCA 3MHTA 1WXQA 5K1ZA 5GAJA 1WVIA 1WMDA 3TFQA 4Z86A 2IF0A 3QVXA 2QMEA 4D25A 3W5VA 3A0RB 1MC1A 4IRXA 4M21A 3SKVA 4MVYA 4HB3A 4MVWA 3BJRA 3PFBA 1E2KA 5KS2A 2ZJ3A 4MMXB 1UPFA 3CH4B 4F06A 4UD2A 2AC7A 4PAWA 1VLLA 1VSQA 3THYA 1GGEA 1XTPA 4PX5A 2Y1OA 1KQNA 2GX6A 2A58A 4U6QA 3VJLA 4Y2XA 4PPNA 5FYQA 5B37A 3KOXA 4RCZA 2B37A 1NMEA 4BO2A 1O58A 4OU5A 3RWOA 4D9KA 4LK2A 2HMTA 2JNWA 4DDWA 1X7DA 2YQZA 3DBHA 5IDQA 1YQGA 2OO5C 2PV7A 2ZSJA 4FHDA 4ZYLA 5LXTF 3ACDA 1YB1A 4KN6A 1PD0A 2HNBA 2RONA 3SFZA 2H1OA 4J6EA 1HFWA 3G0OA 5HRUA 2GYUA 1GTL1 3N2IA 3OPXA 1RJDA 1EFPB 4BFWA 3L8EA 1E2HA 5EJ6A 2Y3IA 3WHIA 3UV3A 4YJFA 3HVJA 3VHRA 2ZBQA 3I01M 2FKAA 1F8YA 2X4DA 5CM8B 4NU6A 4DCPA 1NE7A 3R6DA 1DUIA 1GZVA 3DTTA 4IL5A 3UF0A 1Z82A 4HEJA 1TKBA 1O0BA 1X1RA 2GXQA 4FC6A 3EZYA 3FCAA 2A9VA 1KI8A 2A3RA 2B1IA 4QPPA 2BGGA 2V9ZA 3K35A 1E1NA 1SZPA 4H1VA 2XPCA 1PR3A 2K7FA 4Z1OA 1S9DA 2ODPA 3MAAC 1TQ8A 4M98A 5CM9C 3EDMA 4G5HA 1GR0A 3OZUA 4JVOA 2CLLB 1ZHFA 4C87A 2QORA 4A8HA 3H5AA 4MMZB 2A9OA 1W44A 4B7AA 5HIKA 3D8UA 2JKVA 3QFRA 2DWCA 3K70D 3U6KA 5ECDA 5GPBA 1V16A 4I6EA 4PNHA 4IMJB 2XWPA 2A1IA 2VT3A 5BW6B 4JL8A 1CZOA 3N2GB 3D81A 4U2BA 2YVLA 4FUQA 4O4LB 4QWMA 2Q3CA 4IXWA 5EE1A 2YJ6A 2C57A 5SY9A 3T61A 3V6MA 1ISRA 1H1LB 2B83A 4ENSA 5A4AA 1SA0A 4HYTA 2X2PA 3DFUA 3RS5A 1EJ0A 3PCXA 1YBHA 2GI4A 2RH4A 1THGA 1VLVA 4GZLA 4D41A 5H9WA 1WW8A 2W2KA 1FNMA 1L4UA 3CRNA 3BK1A 2OSBA 2XMPA 3RIHA 3VKVA 4OXYA 4CKBA 1UIRA 1YSCA 3QKIA 3HXQA 2KWIA 4TVSA 4GWKA 1XAJA 4NE7A 4WXEA 4HH0A 4YCAA 3T15A 4EUEA 2FQQA 5CIQA 2QRJA 4QJ3A 3M6MD 4KIUA 3VHXB 2C9OA 4X7BA 3BRWA 5F23A 3M34A 3HXPA 3SCZA 2GJ9A 1RKXA 3GNLA 1P4RA 5DHFA 4GUDA 3SVZA 13PKA 3H8VA 3TAXA 1FRQA 4J3JA 3TSAA 4JT4A 4PU0A 1T2AA 3LHIA 2PCLA 3ZE6A 3L1HA 1PJTA 3BCHA 1T29A 1G20E 3O6VA 3QY9A 4UMEA 4WQMA 1SQSA 2GPBA 1XXHB 2XAAA 3KQTA 1GCIA 2EZTA 5JC8A 4YH1A 2IUSA 3SXUB 4KITB 3RV4A 1Z0DA 1TCVA 1VSUA 1CJSA 3ZGNA 2WHXA 4FFSA 1HURA 1QAMA 3C7CB 3B89A 3EVCA 1P1IA 1VPLA 1NMYA 1R74A 2H2IA 2X3FA 3DNMA 1IQ0A 3L6RA 2OGWA 3OX1A 3TOXA 3E9QA 4AL4A 1SBTA 4DCVA 3GGOA 1QU2A 3DMGA 3LGSA 4MWDA 4NBRA 4MDFA 1ZY2A 4M2LA 1Q6ZA 3U3KA 1SCBA 3EFOA 4XLLA 4UKDA 4UU0A 4D6PA 4F85A 1GG8A 3G85A 3L93A 4ZJPA 2C7BA 1V1JA 3EC2A 3RT7A 1SELA 1NPYA 5H3LA 1J20A 3T1NA 4P36A 2VYVD 3IB6A 2PPVA 4HG2A 2Z57A 4QU5A 4ZEXA 5PNTA 2VATA 1SJ9A 3ICQB 4FEGA 1M6NA 1TUBB 2DG2A 3Q40A 5AVTA 3WISA 4DV5B 1EA5A 1ULHA 2A0WA 2IVZA 3BTVA 1G5TA 1QQ5A 1Y1RA 3N9IA 3T5CA 2H0RA 3GT0A 1ZW1A 2XUKA 2F6RA 3PQ6A 4EPXA 4Y0NA 1DARA 1QQ7A 1CHNA 1UXHA 3ACCA 1KU6A 1T4CB 3C16C 3D2LA 4LMAA 3U3ZA 3DZBA 3NBMA 4LS3A 2X6TA 1E2QA 2C03A 3DPSA 2CEKA 4HBGA 1X14A 1PL0A 3K1AB 4FYKA 4GG1A 3N70A 3T3MB 1R0XA 2VEOA 3ZDCA 3FWNA 1WLSA 2WSBA 1NUSA 4BP8A 4OJYA 1NVEA 3FKSD 1KVRA 1DRKA 4QFDA 4QOGA 3C6YA 1S02A 5CPFA 5J40A 3AHFA 2PLWA 4AQYB 2REXB 1UFVA 2YV1A 2FZKA 4LTDA 1VL6A 5T4HA 4PAQA 1W0KA 3S40A 1IULA 4J2TA 2HJSA 5I8ZA 1OXKB 2R6FA 1G8SA 1AQIA 5C1BA 3TPCA 3PWSA 4MUGA 4RYLA 1QG2A 1E64A 1GV1A 1MTZA 2XAUA 2HA5A 4CDMA 4WX2B 2O8VA 3WLOA 5ICSA 5L7WA 3TWOA 3ZW7A 2HRCA 1CSEE 1P3Y1 5JDCC 1XRLA 3FCOA 4EPYA 2Z43A 3VQTA 1KFCB 2FQWA 4MV7A 2PSFA 1UAYA 5IXJA 3ROKA 4BLTA 3GA5A 1T0PA 1XQ6A 221PA 2V97A 3RBXA 4B6EA 2IV7A 4IFIA 4C0QC 1GTSA 4ENVA 1WXGA 4DLBA 4GZ3A 1L5NA 1P9OA 1CQIA 3WJ2A 2REOA 4J1TA 3A4TA 4E08A 2Y9MB 4EHDA 3VMFA 1GXSA 4ENUA 3IVXA 2BRUA 3FETA 3HSSA 4KWIA 2XUGA 3HKBA 2B1JA 4KB5A 3HJRA 5H3HA 5AW3A 3K9FC 5JSZB 4R01A 2H08A 3WLSA 1XJ0A 3VBCA 4QJIA 2V7UA 4PW0A 2H85A 4Q4AA 2GZMA 1Y0BA 1K68A 1SQ5A 4NYIQ 4QO7A 1JTFA 4TVOA 4A82A 1V48A 3CTMA 3UH0A 1DSSG 3KE9A 1ZQ1A 3KSUA 1OQAA 1QTQA 1F2TA 3HTXA 1JLKA 2GN6A 3C7AA 4ZT2A 2JIQA 2PGOA 2J9YB 2YMMA 1J24A 4P7GA 2ET6A 2XNDD 4RY9A 2O2YA 3BMQB 1TQDA 2WAXA 3HV0A 3G02A 1KK2A 2CXPA 2ZJZA 4N5MA 2WWGA 4PONA 3G5MA 5CXSA 3ZXUB 5JVDA 3LQFA 2GERA 1Z4PX 3N2KA 3BGDA 5D3MB 5DH9A 1HNXB 5E4JA 4ZOQI 1OI7A 1B41A 1CIPA 2R4TA 1KIFA 5AMXA 3CIFA 4MARA 2HSDA 4NMXB 4PLFA 5E7IA 1DJNA 2QVBA 3AP1A 3NOXA 4R2XA 5E7JA 3BTSA 1E9CA 4YP7A 4EG0A 2VR1A 3L79A 2E4VA 5JZSA 2VJKA 1F9AA 3C1TA 3WK5A 1NMXA 3PEYA 2PYDA 1T3ZA 1E3EA 2QG4A 2PWZA 1IN7A 1B6SA 3MCVA 3MRXA 4C88A 4EKGA 4J1QA 1SH7A 1ZH2A 1N77A 3MF4A 1LSJA 3KJQA 2V03A 2XMZA 3P4UA 5CEJA 1CQZA 3VNRA 2DR3A 3KQNA 1OOEA 4TWJA 4NJOA 4M83A 1ZX1A 4G26A 2BEVB 4KIWA 3FX2A 2QW1A 3GDGA 3QJYA 4PRLA 5NULA 2LXNA 3W77A 3OFNA 1OV4A 1D7OA 1TNDA 4AJLA 1PAUA 1BFUA 3D5QA 1KZ1A 2WJIA 1NI4A 2DYKA 5EKDA 3AVXA 5KQSA 1QJ4A 2BMEA 3VMMA 4OAQA 1OLUB 3EJWA 2I6XA 5HBGA 1E0DA 4DLTA 1H2YA 3ISTA 4LRQA 3R0JA 1EUZA 1N7JA 1O77A 2Q1WA 2YWJA 3EF0A 1LDBA 3UYLA 4IG4A 3WAGA 1VCIA 2VF5X 4I36A 1TX4B 4CEJB 4JUIA 3I8OA 5LZ5A 3RPEA 3NHJA 2C98A 2I67A 1FDUA 2PT9A 4L9SA 5TQJA 3RS2A 3VRHA 4A27A 2R1TB 1QB7A 4YJHA 1BNCA 4AJPA 2ZITA 3E4CA 1Q17A 4QYMA 3LUJA 1X1BA 1C30B 4NSNA 4BX0A 4CF7A 3VPFA 1YIAA 1T9AA 3RD5A 4FDVA 3AR8A 1JECA 3MD0A 3U5TA 3ZWMA 1JIUA 2F59A 5DHQA 4AMZA 4AU1A 2VNSA 2YXLA 2IY8A 4IQ0A 1Z22A 3ZNOA 5M04A 3HZHA 1XN4A 1Y9JA 2Q4TA 4LYDA 3MINA 5HE9A 3WIVA 1E2NA 4AYWA 1II8B 2QVGA 1FYDA 2WYVA 5LNK6 1X80B 1DKMA 1ZM4A 1XROA 2PO7A 4LQDA 4R1QA 5EA2A 5K0ZA 3LW7A 1OWPA 1YU9A 2ILVA 2YWXA 3A9TA 5JXHA 3HNPA 1U1EA 4TXLA 1B73A 4WOCA 3UO8B 4FYPA 3EIFA 2FOIA 1XT6A 3F3SA 2AEFA 3F6BX 4JQSA 4OUDA 1PT6A 1CR1A 2XCIA 4C1BA 4D57A 4MI9A 4EHIA 3I30X 1TMKA 2DLNA 3PPXA 3QU5A 3NIDB 1XWWA 4JYPA 5MFPA 1RAGA 2VRWA 3HBJA 4OXQA 4I4IA 4IPTA 3T5MA 1G5QA 2JAXA 3ZBPA 1T3GA 4IVPA 3TKAA 1EP9A 4CDNA 2IIPA 4MPTA 3WSVA 1U5AA 2IFTA 3NBYC 2ZRGA 1OXUA 7REQB 3FPEA 4ZQGA 3TCNA 1KH3A 2B4KA 3CSDA 4M8IA 1E79D 1IHUA 2BEUB 4BXOA 2QLTA 2JLQA 2WKWA 4Y6QA 3LBAA 3U13A 4L4YA 2G80A 3NBQA 5FBVB 4WFKA 3MCWA 3I62A 1I30A 2XB9A 1O6BA 3BG5A 4PIMA 5T41A 3H5OA 3UMGA 2DQ4A 1GKKA 2H4WA 2ZREA 5JSFA 2XF8A 4V3CA 2G5GX 2UZ3A 1JGTA 3AY3A 1LLDA 2B69A 4BFYA 1M8FA 1NC1A 3UGQA 4FQ7A 3BF7A 3WIOA 3ZXSA 1Z47A 1CV2A 1KOJA 3TX6A 1GEGA 4P4UA 3M9LA 3VZQA 3V8RA 4BZWA 2BFOA 1VP9A 3ZHSA 3SX2A 3D0RA 2VHWA 3ORQA 4CG0A 3HY6A 3FCCA 3PE6A 4RZIA 3NPAA 1IM5A 3G8CA 5FUBA 4NH0A 2P9HA 1OLXA 1YVUA 1A8HA 3MD9A 3QEKA 4KHPB 4KQEA 3TR0A 3UT6A 3ZNPA 3RRNA 3BS4A 1BX1A 1F7VA 4TRRA 1S96A 5I5GA 1X7HA 2VK1A 5JMOA 2D8AA 1K86A 1P61B 4JEUA 2B6NA 3D8NA 4F3YA 9ABPA 4EHLA 5JAIA 3GVHA 4EI9A 2H29A 5CAEA 5DTRA 2IYNA 5AW2A 1C4OA 4HNTA 1R5JA 2VPIA 2NXWA 3I6QA 4GXRA 2C5LA 4E4YA 1HQDA 1KYYA 3KR9A 2Q3DA 5KYVA 3V7UA 1FSFA 4M0MA 1LTKA 1YS7A 4MWGA 4AY6A 1KH1A 3QENA 4KQFA 3K72B 2SCUA 4XJXA 5KDOA 1IZ7A 1DT5A 3UT5A 3JX9A 3K15A 4IW3B 5C1IA 3DVQX 2OSVA 1HG1A 1N3BA 5FLYA 4KO3S 4BNYA 3U80A 3FOZA 2NU7A 3W1VA 3TQQA 5KWEA 4IVQA 3WL4A 4P83A 3ZV3A 1BMDA 3NBZC 3BD9A 3HBMA 1E9AA 2P30A 2L18A 4K0RA 4P0PB 3DJFA 1JEJA 3WQBA 5FNVF 4BV9A 4FD2A 1ZRSA 1H23A 3ZYCA 1QGED 3WGJA 1G60A 1L8AA 3O95A 4KLRA 2ZIUB 1YCFA 1UFQA 4GL4A 5ADWA 2Y6VA 3WWOA 1PT5A 4EHKA 4WKPA 1HE3A 2YY7A 5D85A 1SC1A 3RREA 2XMCA 2MSNA 4R9UC 4S3MA 1M2HA 3MMXA 4WZAB 4RH1A 2XWSA 3ZUGA 4BMDA 4A8JA 1KJQA 2FMKA 1XDUA 4YAOA 3E8XA 2RGCA 1BU8A 5L7TA 2G7ZA 2M6RA 3BSYA 4M88A 2I8CA 3T0IA 5FR2A 2LD4A 2V74B 2VHEA 2ORWA 1K2VN 3ORSA 3LM8A 4MWSA 3KNZA 4MMYB 3TD6A 3TLKA 4EZIA 2C4UA 2RAUA 5EQDA 3LK6A 5A0VA 3AF0A 1UL1X 1I33A 3UBMA 3AU8A 3TRKA 1C3EA 1E1DA 4GSYA 4TXHA 4DQDA 1DIGA 1DWUA 3HY3A 1NRWA 3EK2A 1N5OX 4N0PA 2IXGA 3IV6A 4FYHA 4GOOD 5JSKA 1OZAA 1PL7A 1TD1A 3DTVA 1YJAA 4X6LA 1R9NA 2P2ZA 2NVUB 4DA8A 2OFFA 1VI6A 4BFTA 3KB8A 1PJAA 4JEIA 2NW6A 4MR9A 2ZRAA 4LBZA 2UUPA 3QF4B 2G1AA 3NDIA 3K1TA 3NH6A 2Q1UA 3DL7A 4PLGA 2FK8A 3JPYA 3CN9A 4HEHA 4QBTA 1M1UA 4N3CA 4RD1A 4Y0VA 4IZHA 3VYRB 4B4UA 3I5UA 4ZI3A 4I3HA 5IT0A 3J80A 1KAQA 5HSGA 5IMBA 3DO8A 1SCQA 4BQPA 5L3RA 4JXXA 1A77A 1XIVA 2UZ1A 3ENWA 4KR6A 1ORVA 5DBIA 4J03A 4L1KA 1BU5A 1WTCA 2J6BA 5U4QA 2GHQA 2WAAA 1INLA 4Y0AA 1CY2A 1BE8A 1KJZA 3D6NB 4B3JA 3FSGA 3I8SA 1S1MA 3CFYA 3TZKA 4DE5A 5KQPA 2FE1A 2FG5A 4CRWB 2BELA 5IAGA 3S7ZA 3VOTA 3WNBA 2ZU6A 3FVRA 5EHGA 4GZ5A 1JXQA 2ZIAA 1RYZA 4EGJA 2ZUFA 1Q6YA 2ZI5A 2H4HA 3NTOA 1YNSA 2WM2A 1CFJA 3DMNA 2CHQA 3EUWA 3GLGE 2EF0A 3KLPX 3CX7A 1N8TA 5FORA 4LDQA 1GPDG 3DVLA 5IU6A 5K9ZA 2FW8A 1ZR2A 1QZXA 3IMEA 5JCJD 3HYLA 3U4QB 4Z4HA 2QIPA 4PXAA 3K6SA 1EG7A 3K5IA 1QGUB 4NVRA 4J91A 2QZPA 3NTQA 2W2QA 4K86A 5K8TA 1YA8A 3EH2A 2B98A 4R2MA 3VM6A 3MVEA 2X2FA 2GASA 3NJ4A 4DADA 4HL6A 5AWFC 1MTOA 5C4GB 2CSUA 1GU0A 3OOSA 3KJIA 3FF4A 3EDOA 4B4OA 5E2AA 4RD3A 1GLNA 2QD5A 4L50A 1PJLA 4RSGA 4X1KB 3EUAA 5HF6A 4DR3B 3Q8KA 4NDAA 5EJ8A 4RPKA 1KKLA 4F84A 4EKDA 1UJ5A 4EKNB 3PFGA 2Z4TA 3EZLA 3GUZA 1E2LA 1KXZA 2ZAIA 5HCIA 4C0SA 4EFDA 2YXBA 4RK5A 5L95A 2CBXA 1KYWA 4H18A 4JBIA 4WW0A 2N47A 4PS1A 3X1XA 4YWHA 3IELA 4TN1A 1PBTA 3CLVA 4CG2A 1CW2B 1I24A 3DXXA 3OT1A 2KB0A 4GPTA 4RL4A 4JFAA 4PR3A 2RGWA 2ZGVA 4OHUA 2I2FA 3EZXA 5BQFA 3KAPA 4OLAA 2H07A 1QRDA 3DPIA 4PIVA 1YBMA 1AQUA 4FLMA 2I7CA 3AYXB 4WLFA 4AICA 1XTVA 3LA8A 1JWLA 4Q9NA 2HCRA 5JQGB 4F2PA 1NT4A 1ID1A 2WKPA 4Y2YA 2ASEA 3CR7A 1A9XB 2NYRA 1QE0A 3HWX1 3RJ9A 2VQ6A 2ZANA 1TJ5A 3SM3A 3V4VB 4F5ZA 4GLLA 3JQBA 2ABWA 1F9EA 5CU7A 3WMRA 2Z9CA 3N0VA 3JAWA 3NHMA 4RSMA 4IQFA 4PBRA 3STXA 2LIPA 3T1TA 2P67A 1V3TA 1X94A 1ZESA 3DGEC 3GT4A 4ZOLB 5DWDA 3OFJA 1V5WA 4XM2A 1DC7A 3CUTA 2XXAB 2XCUA 4ILKA 3W3AD 3CH5A 3H1EA 5AOVA 3E7XA 3HU5A 1DE0A 4H6PA 3OEHA 5C3UA 2E87A 4IYRA 4X62B 5HMMA 2QUKA 3F6YA 3W6UA 1T5DX 4EUFA 4F4CA 1P7PA 1Y4SA 5HTOA 4L3WA 1JAIA 1NVVQ 1TZCA 3EXIA 3GQBA 2KMLA 4NENA 1PJRA 5EUMA 2ARKA 3DVAB 3H75A 3OT5A 4PG6A 4C4ZA 3LVQE 4LZOA 2D7DA 3H2IA 4FCCA 3T5PA 1MJ5A 1YD7A 1ZUNA 2O6HA 3QVOA 3GJTA 5HF9A 5C1PA 3ROPA 4ONEA 1ZNWA 1ULSA 1A5TA 2Q6OA 3IIIA 3ITKA 4RABA 3OZXA 2HMAA 5B58C 3O4VA 3IAHA 3GMSA 3ZNQA 4OHKA 3N0XA 3RKSA 5CFMA 4ROSA 5KNDH 1LFDB 1D2RA 1O3YA 1TADA 2WHRA 2GK6A 3HJTA 4UHKA 3RRMA 2Q8QA 3ZCXA 1ISJA 2ODQA 3GFRA 3OX2A 3ZR4B 4EK9A 2DLCX 2D5IA 3ILSA 4UHJA 2MYNA 1GAXA 3JD2A 1VP3A 3DKVA 3PFKA 3W7AA 1E59A 4MVJF 2O5CA 3ZGOA 1PNOA 3ZGVA 2GCIA 1MJGM 2UV8A 3GFBA 4RGVA 1AKMA 4ZQHA 5KSOA 1RC1A 2R66A 3GF4A 2GZ3A 3GN1A 5KYWA 1R12A 4WKOA 3EXAA 2O7VA 1VI2A 2JLWA 2GEJA 1V8PA 1HOXA 3RB8A 4BO6A 5BRAA 3LLSA 3MQ4A 2IQ5A 2QM8A 2FN8A 4XD7A 5EJGA 4I3FA 4L8WB 3SEFA 2AOUB 4P2BA 1CUCA 1FTGA 2J67A 3WYAA 4E09A 4EJMA 5JNUA 2VP3A 2FCRA 3CLRD 3A04A 1YQUA 3IOMA 3JQ8A 5IT9A 5E9QA 1ZVKA 1FL9A 4YBZA 5E4TA 5HK8A 3N86A 1NMSA 2G71A 1EEHA 4RIHA 2M6LA 2VDWB 5AHWA 1K1EA 3FFWA 2WVJA 3WWPA 1AKRA 3HVRA 4Z7QB 4OV6B 2VYNA 1JHQA 1MG0A 2CVZA 4JL5A 4NZYA 1RI3A 4RKQA 3UJ8A 3VR5A 3ZN2A 2WU3A 2IIVA 3L6CA 3ONFA 4Q24A 1YXMA 3ICPA 5M5BA 2R8PA 3NRJA 4MVJG 4F1JA 5LP6B 2VXBA 3GMIA 4C3VA 3MOGA 3BM5A 5AKHA 2P78A 2GOYA 5LL6P 5G2OA 2IQIA 4LCBA 2WMNB 3LPAA 1R8YA 4JDUA 4Q37A 1T5SA 4EG5A 2FP4B 2II6A 3A6KA 2V0CA 4HAYA 3GWGA 4IX9A 4U2GA 2J5XA 4ADSG 1MEEA 2BP7A 2H4ZA 2VHUA 3U4IA 2ZB2A 1MZPA 2ZPTX 1V8FA 3P8ZA 3BE6A 1SKYE 1UJ6A 2QTTA 2EDCA 1ICIA 1XA0A 2P8JA 1OC4A 1ODJA 4X95A 1TYEB 3UHJA 4AZVA 3T5GA 4YAFA 1ZUIA 4LJ5A 1Y48E 5LP1A 4U7GA 4INAA 5DSTA 4M1ZA 4L5JA 5JATA 3REGA 1AIPA 4AS1A 3UA3A 3UTCA 4WEOA 5LZ9A 5FUWA 2A3NA 3HS3A 4AZ3A 3H2YA 4ARBA 4KNYA 1Y4DE 3UMVA 5IUNC 4TTAA 3Q2IA 3QQ5A 5ALMA 4JA0A 3FNGA 3NIWA 3P20A 1WUYA 4ZI2A 1WUTA 3IR6A 3D1JA 2HADA 1RBZA 3R9WA 4I1VA 1U9IC 2C07A 3OEWA 4LUCA 4HZGA 4MVJM 3VC1A 3GVCA 1XJCA 5CYOA 3BILA 1GNQA 2IY7A 4I8IA 5DGTA 4OGKA 1BHSA 5K0SA 2JVIA 1AF7A 1CDEA 4Z4GA 5KREA 4P2GA 2WWFA 2E4AA 1UBNA 3PQ7A 3VPBA 1C4WA 2R6DA 4RD0A 2JFHA 2QL9A 2ZVJA 2PNJA 4IF4A 3CF4G 4IHJF 3W1WA 1UOOA 2VN8A 1EM6A 3JR3A 4LYGA 1J25A 2OUIA 2QU7A 3G2HA 4QGHA 5EMHA 3PF9A 5AM0A 5KJEA 4URZR 3QELA 3O92A 2O3SA 3D4BA 2PWBA 2QL6A 2VHZA 3ZKWA 1JDBB 2VHXA 4PLCA 1V2HE 2IDZA 3D2AA 2AZDA 1DBIA 3AKCA 4M0PA 1BYUA 2G67A 1XUOA 2IYZA 2QYSA 1DRVA 1KETA 2WAOA 1YDEA 2FF7A 3H9CA 3Q7SA 4R8MA 4D0NA 1QQAA 5L4SA 3BAZA 4AXXA 1U2DA 1A9QA 2Y71A 4UUQA 4XYEA 2P6NA 1QG0A 5AI8A 4ZKDA 2YN0A 3RROA 5C35A 1IN1A 2K5UA 2NUAA 2UUOA 4I4LA 2Z83A 3LPMA 3K31A 3M2PA 1NXPA 3QE0A 3ZVNA 1MBZA 2E21A 3EUEA 1GRVA 2HQSA 1CDZA 3ROEA 3GWZA 5IRCD 1N57A 1EFKA 1Q3KA 2Q46A 2QUAA 3P9IA 1EK5A 2P0YA 4EG8A 4GKBA 3WNQA 4BVKA 1AU9A 3WLIA 2DY1A 2PU7A 5AT1A 2XVYA 1DWPA 3CUEF 2V7PA 5CA1A 1D9XA 2LR0A 2XI4A 2QNIA 4DGSA 1DFIA 2QN9A 4L5AA 4BNVA 1YMUA 4C4RA 2QRHA 1ZD2P 4G8BA 1Z74A 4F7DA 1GU1A 1Q2UA 3QXGA 4ACBA 5JJ5A 1ZHOA 2PLAA 3EDYA 2BWJA 1HPLA 2HXSA 1JVSA 5EJ5A 5DHUA 3BRWD 1WV0A 2OUKA 4OP1A 3ZS8A 1HLDA 1G8KA 2UYOA 1X2EA 3WHKA 1UZNA 4LJ8A 3RWMB 1LGYA 2R7NA 4OLJA 1W9MA 4TUYF 1I7QB 3P2IA 1O03A 1MABA 2Y1WA 2ZR9A 3BD8A 4GR9A 1IB0A 1QK4A 2QY6A 3NV7A 4YLGA 5K3CA 3U17A 4EQ6B 2P3OA 5BSGA 1BOFA 2VZEA 3K09A 3CA8A 1FXSA 2IP4A 1RJEA 2ZJ1A 1HDXA 1I4TD 5LZ4A 4CNBA 2IYPA 1XDGA 2QTNA 3AR2A 1SC3A 3DO6A 3H7AA 2ZJ8A 4N03A 4QPCA 4BLRA 1R5NA 1CP2A 2RHOA 3DV0B 4YDRA 4ZMSA 3UPTA 3KZ1E 4K8OA 2IRWA 3OZRA 4TLAA 1I9CA 3NHKA 1CLUA 1E3SA 1USWA 3IPRA 5PGMA 1IMOA 2EGGA 2OYRA 1SFRA 3D8RA 4I1OA 2UXDB 3NRCA 4KXWA 4CFYA 4EY8A 2BSXA 3DHYA 1N2GA 1O6CA 3ILHA 1MO5A 1UC5B 3W5JA 4YRIA 2V3VA 4YUWA 3DYIA 1WZNA 4LX0A 3IOEA 5IN5A 3AU9A 2GGSA 4Y7CA 2WWRA 1SQFA 5KTRA 1U0LA 2WMDA 1EUDA 4QHYA 2EAUA 3EXG2 2Q5FA 4LSMA 4DSTA 4LBWA 3T52A 1Y34E 3TLYA 2WZDA 5JAPA 3QVWA 4KO8A 5E6UB 1UP4A 4AKIA 3PUHA 2WUEA 2NP7A 1EXMA 2R00C 2J6CA 2ZJ0A 4LOHA 2COUA 4A2PA 1U6JA 4DJFC 3GUVA 4F3KA 4JI2B 1JFFA 3CPSA 2GLTA 2PEYA 2NTVA 3ML1A 1AX9A 5AOBA 3TF5A 1FK8A 3NR2A 1AGRA 2WVGA 3H17A 3NHYA 1LQUA 4OXIA 1RP1A 1ZC3A 3WIBA 4YRNA 2V6JA 2DXIA 4QXPA 4B48A 5EIBD 4UJ3A 2Q5IA 2WTNA 5BVGB 2WD9A 1L4NA 2XKJE 4N5IX 4CM7A 2AFHA 2PS1A 1CYEA 3GK3A 3WWCA 4E0BA 1YVEI 2B92A 4YRTA 4GQBA 2WJVA 4IQ4A 2NV6A 1V41E 4NG5A 3G0DA 3DH0A 2ZRDA 4GBMA 3MRTA 3TZHA 2IITA 5GVSA 4LFBB 3T9FA 3UW1A 1O97D 2IXAA 2WDPA 2HR1A 4UTOA 4ALJA 5ERYA 1B15A 1S2GA 3FR8A 4Y2SA 2J5KA 4ZO8A 5AVYA 1W0KD 3AZPA 4D8YA 4C7OB 1B23P 5CT5A 3CLUD 1VOTA 2I4IA 1OU0A 4QOEA 3S44A 2YRFA 5SYNA 4A23A 1ZC4A 2Z08A 4PZ0A 1TUGA 1DWOA 1WHSA 4GR5A 5LYJF 3HJFA 4AT1A 4XPIA 3CZ9A 1MEOA 3ONVA 3PKZA 1E7QA 1D6SA 1RYNA 4HAIA 4LQLA 3ROXA 4BFUA 4OBXA 3WLEA 5KX5A 1J70A 4DCOA 2IPLA 1QKKA 3NFYA 3KFLA 1D6MA 4NULA 4M7WA 3QBVA 3FXAA 3ZV7A 1N2HA 5CLJA 5FHQA 3ECCA 3DDWA 1GAWA 4FGUA 2PSHA 1TK9A 3B1XA 1Z4NA 4PINA 4UZFA 2H31A 2BZGA 3EB9A 2X9LA 2IU6A 4XWTA 5BURA 1HE4A 1Y4AE 5DWQA 1HO3A 1ZDMA 3KOUA 4WNYA 4Q1FA 4FFMA 2B3TA 5K0BA 1QGZA 1R0BA 2WNSA 3W8DA 5GZ3A 3HB9A 1IMJA 2ZZNA 1GLGA 4I4TF 1L5OA 3AKYA 4ETIA 1OD6A 4MWBA 4XDYA 2JGMA 1AE1A 4GNKA 4ZYXA 3N87A 4OHBA 2A1TR 4WERA 1EFVB 4UCXA 4MYUA 3OQ6A 1E7RA 3NHRA 2WJJA 4KR9A 4EY4A 5FUQA 4HVCA 2C3UA 4F9EA 2WA1A 3ET4A 3NBKA 3Q8MA 4RV4A 1XVUA 2UVDA 4L76A 1HOTA 2NNLD 3JQAD 2G9QA 3O9VA 5I45A 3DDCA 2O59A 1JHMA 1IWBB 2PZGA 3UCFA 3Q6NA 2P68A 1FUIA 2OYSA 2WFZA 4KP7A 4KQ6A 1IJKA 4IUYA 4UVGA 4KEAA 2Y8EA 4E5UA 1UQRA 3FRHA 1Y3CE 3R1IA 5D1NA 1YR8A 3VZSA 4WESA 3EIUA 3O8OA 3N8DA 4Q93A 4DQXA 2GBFA 3IUSA 4EM6A 1FFBA 2FUCA 3OZSA 4M9UA 4RUKA 3WMEA 2XXBA 4UBIA 2OPHA 4BNZA 4EFNA 2I2WA 3K9GA 4O4IB 3N59A 2P9ZA 1CUBA 4AG5A 3QKSB 4GMDA 4KYTA 2WTMA 1E3DA 1FQJA 3RRZA 3A25A 3CPJB 2HT1A 2A35A 4G24A 4JI3B 1MIOB 5J2TB 1IEXA 3H5TA 4HZUB 4FBGA 3DEZA 3MAGA 3JQ7B 4ZD6A 4PGMA 2G9NA 3U31A 5LA6F 1DMSA 3DLHA 3PUKA 1PZHA 5FOVA 3HA5A 5AICA 1YRBA 2Q1XA 4AWAA 3VKGA 1CT9A 4PANA 5ABPA 4PPQA 3ECAA 2GJ8A 4CL3A 3OFND 4M0EA 4NBVA 3CZPA 4LY9A 1I6LA 2Y67A 4V24A 2PH3A 3I73A 3SAJA 3CV3A 4QQNA 2Z30A 3G23A 3IB3A 1GGFA 5H4GA 5CURA 4QOFA 1UZLA 4UREA 2IT1A 1Z2OX 3Q7RA 3K0FB 4UHDA 1AB6A 2FEMA 4Q02A 2TRSB 3QE2A 3JASA 2GO1A 5G1NA 3PC8C 3A70A 3VO2A 1KHHA 2HIAA 5TS2A 4CM4B 4UHBA 3LQKA 1LK5A 3ZTYA 2A7QA 1IWOA 1AUVA 1DEHA 1BROA 3T9DA 1EFLA 5EXPA 1L4GA 1X7ZB 4FKMA 4ZZ0A 3OH8A 2BF4A 2LUOA 3AUAA 2IEGA 1CJUC 3OETA 3VDXA 5A3RA 2QUIA 4KUHA 2ZIZA 4I99A 3VUFA 1BJTA 1A4UA 2C7QA 5IFKA 4KWHA 1L5ZA 3PCRB 2BR3A 2E1PA 1F0YA 1K4YA 4AJKA 3GLUA 1CVIA 2B20A 2FDRA 3KT3A 4H7FA 1ZH0A 4XPZA 3LHKA 5FUMA 1KI1A 2BGNA 2E5FA 2RFLA 1N8KA 3IQXA 3U19A 2RARA 3BRQA 1V2GA 3UIEA 1YZHA 3V4LA 3HYCA 1PG2A 4EOGA 1QWSA 1VLHA 1KRHA 3N2YA 3MJSA 5LIRA 4OBEA 1ISSA 2AC4A 1I0ZA 5KOIA 1ZL2A 2DR0A 4L5YA 2XMGA 4LGVA 2OO7A 3GNQA 4CFZA 3LPCA 4ITVA 1MQ9A 3FNQA 4FC7A 2IPOA 4HFNA 3MM4A 1A04A 1A4XA 1PZMA 2OD2A 5IABA 1P60A 1YO6A 4MI3A 1YTUA 2AOTB 2ZRPA 4MR7B 3F46A 1ZK3A 4KFSA 5AI0A 1TJ4A 2FG6C 1A9SA 1SUDA 5CVDA 1A8SA 1OWLA 4YK7A 4UNPA 1ZCFA 3E8SA 1TKAA 2CDCA 5CXUA 3CX6A 5KTTA 2OV8A 9LDTA 4KQKA 1DQZA 1OYOA 1QHXA 2I34A 2VYQA 3PNOA 2MOKA 3RTGA 1FMTA 3VDQA 4R8KA 2KBFA 4LZAA 3THYB 4Y30A 3S2SA 3JR7A 2J4DA 2QNBA 1PUXA 2YZ7A 3MXTA 4W6ZA 3HBAA 2IIQA 4I6JA 4HWGA 4QRHA 1MW8X 3S1AA 1XF9A 1SOAA 3DZ8A 4Z7JA 1TA4A 3LHSA 3KHTA 3Q7TA 3L6DA 4MXDA 5I3CA 3C1AA 1J1ZA 4G2NA 3DBHB 2LPMA 2WF9A 1KYTA 2HI0A 4DF3A 3SLGA 5EE5B 2ZQYA 2YASA 5HMLA 4A26A 3LOPA 1ODSA 1Y1TA 1ZKMA 2OPBA 2WF5A 1XDZA 1O4VA 2FF5A 3GFFA 3PNVA 1UXOA 2UZIR 4YJFB 2ZVPX 2YHAA 2CMFA 2QAIA 2XYPA 1U98A 1H94A 3FG9A 4N82A 4H17A 3CEAA 1JHPA 3RVNA 5IJXA 4L73A 1NGSA 1NNI1 2FWMX 2VG8A 1A27A 4GR4A 5IM4A 1O96A 2WFLA 3AUSA 3OWXA 2PZLA 2RGYA 4LX8A 4C6HA 5JI2E 3A1UA 2DCUA 3GBVA 1OWOA 3O38A 1NYTA 5EJ9A 1U0OC 5TT0A 2Z98A 3QEJA 3P2OA 4K9PA 4R1MA 1W5BA 2Q29A 1ODLA 2I76A 4O1IA 5AHKA 3L8CA 5HOQA 4XWKA 4DR6B 4F71A 5JO0A 2AG1A 3SQOA 3K9HA 3FZNA 2H48A 1RWMA 1UWKA 3IO3A 1V11A 4A4DA 5JAUA 2QMQA 1Z36A 4KMOA 5ENZA 3CVXA 1UBEA 1EWVA 2WHPB 5IG2A 1BTOA 3UC9A 1PJ3A 1Q74A 3VGJA 4F4IA 1ZN8A 1J7KA 4CF5A 1FVOA 1SHKA 2RGNA 4DLRA 3TJRA 4C2BA 1CUSA 1DOZA 2AF4C 2H54A 2JFXA 3MTGA 4FX2A 4DQUA 4FFOA 5KYXA 1Q7GA 3BK2A 5HJ5A 3LBYA 2AJDA 3MMZA 3H11A 3OTGA 2G0TA 4NCNA 1E1QD 1JUDA 3GRPA 1PJ4A 2N0SA 4KW7A 4DA7A 4DNXA 1N5JA 1SA0B 3BQNB 4M7OA 4RDHA 1N6NA 1SKQA 2ACWA 2OMKA 2OGZA 2PKWA 3IDOA 3B52X 3RUCA 2W2KB 1CB0A 1FQKA 4I7EA 4LDZA 4E2ZA 3U1BA 1H6CA 3C3CA 1PL6A 4ZEWA 4CKBB 1VHQA 3RAFC 4S2EA 1IY8A 5EMMA 3WMGA 2C3MA 4RTOA 1K3FA 4MJ7A 1TVCA 2ZTSA 4P54A 4QARA 3SYLA 2CLFB 2XDYA 2C9ZA 3TIIA 3WZMA 5KSWB 4IDOA 1N6HA 3LKVA 1KMQA 3CW8X 1FTSA 4J6FA 4KQMA 3DUWA 4URHA 2F3QA 4FHZA 1EPUA 1XVTA 3EDRA 1GFSA 3I2JA 2ZT5A 5DULA 2Q2NA 4NNPA 5EE0A 4JI6B 4C7VA 4L95C 3U61B 2GM4A 3G2MA 1XJQA 2HNAA 3HJUA 3WKCA 4MW2A 1VPWA 3EA4A 1V7ZA 2FH5B 5GV8A 4ABTA 1G291 3FCYA 3ZCUA 2ZATA 2AXPA 1L5VA 2HO5A 2BBTA 2IPNA 3DFFA 3KCNA 4IEFB 3H2SA 1EVYA 5DN9A 4YCDA 1A5SB 1N3LA 4MICA 1TB4A 5FL7A 3T9AA 1P17A 1BDIA 5KJFA 4PZ9A 3TLAA 5C8YF 1T8PA 3OZAA 4GLOA 2WSLA 1F8FA 3UYKA 4BO9A 4L8VA 5BV1A 5DNYB 5THKA 5DOZA 3R4VA 4W5QA 4MAMA 1YB5A 1QS0A 3NV9A 2JAWA 2L69A 2C99A 1ZIOA 2Z56A 3PHJA 4QJ4A 3DF7A 1J2TA 5BPFA 1YZTA 1M34E 2J31A 3QLUC 3MLEA 4H77A 4LV8B 4PQFA 5LZ7A 4YRRA 3V3TA 4KODA 4BMNA 3ZHOA 5A5FA 1IHYA 2XXJA 2F1JA 3AJ9A 5K0JA 4JP8A 3TXXA 1D8AA 1MB3A 1L7DA 4K3UA 1Y9EA 1C0EA 3UJ6A 1NNUA 2JH8A 3DOIA 3TECE 3UJ3X 5F64A 4WK0B 3VR6H 1DWQA 5A05A 4D3XA 3QUBA 1Y33E 1BCRA 3RVPA 3SC3A 3C2QA 3EDCA 4UATA 4C6TA 4XM0A 1T5LA 3IV9A 1JIJA 3TUJC 3PJGA 5KYGA 2WE7A 3NGXA 4X54A 1J21A 1QR6A 3LP5A 1KSFX 2J0EA 4QXOA 4QLOA 4A03A 2VZ9A 2NO1A 4OAOA 1PFUA 3HN2A 4BN5A 3V1YA 3V3KA 4GI3A 4CT4B 3OIUA 3V2IA 1JSCA 3ZI7A 1E0KA 1IWPB 5BWMA 1QIEA 4LZWA 3ZQKA 1FCJA 4Z2YA 1S2OA 5FA5A 2J5QA 3BIXA 3JZFA 5JXGA 4DDKA 3GA0A 1NRIA 4QXRA 4XSGA 3SX0A 3TTTA 5GADl 5JJKA 4MV5A 3ZY4A 3FNHA 3FJ1A 3NTUA 4N54A 4UULA 3B85A 2F17A 2AVNA 2XSZA 1W1UA 1DHRA 2IW3A 4YBRA 1ST2A 3SR3A 1ECGA 1E5DA 3BCSA 5T8KA 4G5RA 2PDAA 3WZLA 3ZI0A 5C5DA 2FG7C 4TL8A 3AG5A 3IUJA 4TWRA 2HMSA 5JFOA 3A6GA 3LJKA 4NWIA 5EXSA 4CMAA 2JATA 3KOYA 2MWMA 2FWNA 5TRTA 1MHTA 2PKYX 4WJKB 1HLGA 1HZZC 2X7XA 4LF4B 1VL2A 4RSRA 3C45A 4OVKA 5L6LB 1BMFA 1XVVA 3C6KA 5GWXA 4O4HF 3DT8A 4FB4A 4X6UA 4B6FA 1NVMB 4P7FA 3BC1A 4N48A 1D1QA 1ZMXA 2PH7A 4G4SP 2ATIA 1KQ3A 2CD9A 2QM3A 4M6WB 4BIMA 1EIZA 1TCUA 2GVDC 2XT6A 4F97A 4JHLA 4TS3A 2OOKA 4O8ZA 2R62A 3FB1A 5AFSA 1CEQA 3FGPA 3I01A 4W7SA 5E1DA 3RS8A 1K88A 3WJ1A 1CQIB 4C5AA 4CW7A 4DHEA 3PYMA 3SQXA 2XTJA 3R24A 5JD6A 1GXSB 1XTZA 4ZCQA 1PLJA 2H1FA 4TYQA 4MHOA 2QYHA 2FEOA 1T5HX 3HKBB 3E70C 4HDSA 4NTZA 5LMUB 1T6YA 2BMVA 4C3OB 4OXNA 2F55A 1UEIA 1Z4MA 1QVVA 3HYTA 4RORA 5CDGA 2QN3A 4AY5A 4KRYA 2CLMB 4Q4AB 4B84A 4PFSA 3AXSA 3KL4A 3ENVA 3QEOA 3CZMA 4XDGA 3I42A 1K7SN 1NVDA 4INZA 1FPQA 1GARA 3BWDD 5TSDA 4BATA 4M0KA 2V6BA 1DRWA 3PXUA 2OZVA 3W05A 3PRJA 4POAA 1LSUA 2FX3A 4ZQBA 2AOWA 1RQPA 2B78A 1F2TB 3HYNA 3L46A 4HX9A 4Y1RA 2P5SA 5K3FA 3A37A 3U44A 4MX8A 1SK9A 2PBRA 5H1YA 2IU3A 4FI3C 3LY8A 5CFOA 5JVDB 3S2YA 1E7MA 3K7EA 3N2KB 3CJQA 1L5MA 4UJ5A 1FZQA 4U4AA 4CXMA 2OHOA 1MAVA 4FN5A 4DAEA 1Z8NA 4QYIA 3KZVA 5IHXA 1QYXA 3FTFA 2JFOA 3WR5A 4MW4A 2JLAA 4B6QA 2NADA 2R8BA 2ZULA 4B75A 2L82A 2ZSUA 3K0CC 4OQ4A 2JGFA 3JVUA 7ADHA 1G8PA 1MT3A 2I6QA 2JRCA 4M76B 4JLSA 4YA6A 3LA6A 5F76A 4E1BA 4R1TA 2CNLA 2DZDA 5KNBH 1T2NA 4GL2A 4TZ0A 1SXQA 3EMKA 1CQWA 3OCVA 2GVZC 2P6MA 4FXPA 3P96A 2GZAA 1GPWB 5BMVF 1MVLA 2PRZA 3TKYA 2QN7A 4B6JA 2IYUA 5LP6C 2C5SA 2VDUE 3H87A 1NI4B 6ADHA 3T1HB 3ZY5A 4Z4EA 2CXRA 3WFZA 4WI1A 3AWIA 4XH9B 1VE1A 3AEKA 3BIFA 3K4HA 1C3VA 1IBCA 2CUTA 5AKGA 5K51A 3X1DA 4C6SA 1ULUA 4LJRA 3EH1A 1M66A 4A0SA 1TK2A 2PJDA 4DG5A 1WU7A 3S2GA 2C97A 4JC8A 2E4YA 1BCSA 3FHCB 4NAHA 4FYYA 4QREA 3HVIA 4BMZA 5HWSA 3TTXA 3UN1A 2G1PA 4A0RA 5GONF 4WA7A 1PT7A 4TRJA 2VYND 3VR5D 1XU9A 1ELOA 2XB6A 3KVYA 4XUGB 4YJHB 3DEHA 3LZ6A 3MHPA 3WBFA 4EHBA 1YFLA 2R1VA 1L7PA 1DDOA 3OIGA 3QVMA 4IGIA 4Q1AA 4EYKA 5CCDA 1ID8A 4ZO6A 5JQWA 1K6JA 3KAJA 3C6XA 3UAVA 4ZTZB 3PQ8A 1IN8A 2Y2VA 1XQWA 2J0SA 4U7PB 1NASA 3OJOA 3PIRA 1B00A 1RXVA 3WL8A 3OBIA 2G4LA 5KJ1A 3D4NA 3HRIA 3NXSA 3MINB 5GIOE 3AWDA 3KTFA 1Z34A 4X20A 2Y76A 1QIHA 1TQ6A 4CLOA 3JQGA 2Y1FA 4JD5A 3K5WA 3TTVA 1XZDA 3T5BA 4AZWA 4CTJA 2QI9F 5KJ6A 4HLCA 3HI4A 3QV1A 3BH0A 4OUDB 1I2AA 4KFRA 2B0JA 4P86A 4R1LA 5LU8A 1OYWA 4IIBA 4CQLA 1W1WA 1E0AA 4XIFA 2JLCA 2WWVD 2NYVA 1Z2NX 5BV7A 4KYVA 8MHTA 3G0CA 1YQQA 4IDNA 4B74A 1HZJA 3FDIA 5LQNA 4TSRA 3AGPA 3LT5A 1T9KA 2FZVA 3T7SA 4EZBA 4Z1MD 2HTFA 3X3HA 1T9DA 1H0SA 3ABOB 1KFBB 3VVLA 1JX6A 1KZ6A 1Y7HA 3ZLBA 1SCNE 3KR0A 4JQYA 4J9UE 5H59A 4M1WA 4DY6A 3T1YB 1JDBC 5K4GA 3QMVA 4UCWA 3T4UA 4BXOB 2REBA 1MKYA 3EFBA 3HJNA 2XH8A 1FA9A 2QW8A 2FLWA 1FDOA 2BD0A 2OAEA 4XFKA 1I0LA 1I2BA 1QZUA 3EHDA 1Z7WA 4J0GA 4AROA 4GVPA 5BSHA 2V6FA 1IYZA 4MAFA 1IQPA 2GK7A 2G77B 1FUUA 1NOJA 1L5GB 4KI0A 4DLXA 4MYTA 4EHFA 5I9LA 4JBGA 5BYJA 4RJTA 2EVWX 5IXYA 4F1KA 2WJ3A 3Q2OA 1BVHA 3ACBA 3LPLA 4BJ6A 1CRLA 1QFXA 1MOZA 1N2SA 2P62A 2O19A 2Z5GA 1IXRC 2PH5A 3V42A 1VIDA 1C2TA 2CCGA 4BNGA 3BTUA 3GAAA 3LXXA 3UOAB 3FTNA 1ZD3A 4I08A 2ZUTA 3UUWA 3VSCA 3R7DA 3ZHZA 1OLXB 2E37A 1H1DA 3CUSA 3OE1A 3DZDA 4EH1A 4FQ5A 2C2YA 6Q21A 3KETA 3W9BA 2DP4E 1ATIA 4XVCA 1YZUA 2GCPA 2VSNA 4G0MA 1GPMA 2QP9X 3GLVA 3G5TA 3MUFA 2AW5A 2HIMA 1D2CA 3ZD9A 1E8NA 2V7VA 2XYHA 1QYDA 3B2QA 3E6AA 4HWSA 4TXNA 5CAEB 5C53B 1A7UA 1ODKA 3VTZA 3I76A 4D9HA 3CZCA 3O4FA 3O4HA 3IC5A 4MGIR 4E2XA 3KIPA 3IQZA 4G0YA 3KT0A 2FUG1 4F6CA 1A69A 3JS5A 3T94A 2YVAA 3VH3A 3EXG1 1PWXA 2SCUB 1JB1A 1T6NA 2OK8A 2CHFA 3UT5B 1YVDA 3SF0A 2DKNA 2QLBA 3PUIA 2NU7B 1E2MA 2AH5A 1JFVA 1Q1BA 1UP7A 1RT9A 4DQLA 5LUAA 1JHYA 2FW7A 4HY3A 1PBNA 1U02A 2NAPA 2XNHA 3DXZA 5E7MA 3UAXA 1IU9A 3HR7A 4ESOA 1GQYA 1O94C 1T0JB 1SCJA 1M6HA 2ODTX 3LX6A 3PICA 4JB0A 1P8AA 1GITA 1QHSA 3AI2A 2SICE 3QFCA 3RBVA 2IZ5A 1X1EA 3WHLA 4BNKA 1UM9A 2B30A 2QD1A 4KR7A 4IUBS 4C0HA 3LUBA 5BWBA 1VJ5A 2B4TO 2ZJOA 3OPYA 1BGVA 3UKDA 2J09A 1HFJA 5IPFA 2RDMA 1DG9A 2OR3A 3GFOA 1DU4A 8GPBA 5ALRA 2Z1DA 4A8JB 2FSVC 2PMBA 1N5KA 2I6GA 1SKMA 1F6DA 1LDMA 2PSEA 3C85A 1L4FA 2X58A 5ARCA 3WKAA 1XVIA 4GI5A 3DNFA 4DA9A 2A5YB 3Q3JB 2WF8A 1YZVA 5IJ0A 4COKA 1ILWA 1JIVA 1DCKA 1LW7A 3HCBA 4Q3CA 3VKWA 2EJWA 5AJYA 2N1MA 2I2BA 3IDAA 3KPWA 2EFYA 4ZVVA 4HD8A 3NANA 1E9DA 1LJLA 5K6TA 2JLXA 1P4GA 2AQIA 1FS6A 4B80A 4EFLA 1KI3A 1LJ8A 1RXSA 4GW3A 2E6KA 4KYIB 1ZI8A 2ZOSA 1NUHA 2FSGA 3FOEC 3ZH2A 1A71A 5JXJA 3DTVB 2IBMA 2P9JA 3LLMA 4KGZA 2AZXA 1RLIA 3KZOA 4FFWA 3VDMA 4KRXA 1PT9A 1C9KA 4MR9B 3BHNA 2ZYWX 3MCZA 3W2HA 3GLHE 4GRAA 3Q12A 1CZRA 3KPUA 5KKAA 4GS5A 2WINI 4QQ8A 1X77A 1LA2A 2PT5A 3ZJYA 3OLCX 4HQNA 1KAOA 4KO2S 2WIDA 2R6JA 2GAAA 3D59A 5HCUA 2IXBA 5AESA 1Z0SA 1BXZA 1COWD 2JLZA 2UZ1B 2VBCA 3EYWA 3ZBTA 1WOYA 2K2QB 3ANNA 3IP3A 3AT1A 4G25A 3PFNA 1MQ8B 2RCNA 3O47A 2OV6A 2IH5A 2CXQA 1C7EA 3IP1A 4IFEA 1Z18A 4URWR 3DJYA 4BJ3A 3GBPA 4J76A 4BTEA 2EIXA 3GPLA 1SCUA 1NOIA 4IEEA 2CXHA 3V7YA 1OAKA 1XQYA 1YDFA 1TLTA 3I3SR 2NPFA 1IVYA 2GBCA 3D8HA 4MEBA 2PKQP 3NAQA 4M53A 3AUKA 5I9IA 2CMDA 2FPIA 4RC9A 3RJ5A 1O08A 2Q5JA 4F3NA 3OWHA 1MJHA 3F96A 3NM5A 4LJ7A 3TBHA 4BVFA 3ISJA 3CGGA 1NXVA 4G5FA 1P0QA 5ALWA 3U3MA 3K6SB 1O57A 5K7SA 1H9BA 2NUTA 3TDMA 5ESRA 4XLZA 3RAJA 2IX9A 4NYMR 4X71A 4YPFA 4OLBA 4FGJA 4QL3A 3P9RA 1Z39A 1V5FA 1YVRA 1UKVY 1GNTA 2OO5A 1E4EA 3GYGA 4L51A 4D9CA 3GFSA 4QO8A 2BKAA 2XE8A 1W49A 2X40A 4J1SA 4LXUA 4NCHA 1RRKA 1NNLA 4QT0A 2O3RA 4ZRNA 4UTXA 4I8XA 2E89A 3KJEA 3DLCA 2XMRA 1WIWA 4OU4A 3U2QA 1JHXA 3H3JA 2I0FA 2ZRBA 4B8YA 5BNZA 5FOSA 5LFAA 3CG0A 1I3OA 4XDHA 1N0WA 4B32A 5L4NA 3OM1A 5T64A 5AW1A 4TM8A 2WNHA 3UPUA 1SG0A 1XRSB 1C41A 1NJ8A 3C5VA 3DAYA 1NQUA 3OT1B 2JFVA 4R05A 4TT3A 1OIWA 3RYHA 4RHTA 4ASUA 4DNQA 2RHTA 3RRXA 5B1IA 4UM9B 4YCLA 3GRZA 4FYWA 2F1KA 3GRCA 4JXZA 5FULA 1RYBA 1P0MA 5G0TA 3DF9A 3TNYA 5KSYA 1I5RA 4M36A 2QAJA 1OH6A 2Q45A 1DKQA 4W8HA 1OH8A 3IP9A 3M70A 1KFJB 1XVLA 1RRVA 4INOA 4UBNA 4OJQA 1WM1A 1Y5LA 1LQ2A 2I6TA 4C14A 5MFZA 2LKDA 5E6RA 3GFQA 1EB9A 4DXAA 3QZUA 1C3XA 4RXMA 4QUEA 2O3JA 3JAWB 1OVGA 5HF5A 1C3LA 1XRMA 1JN0A 2ZI7A 4Q1EA 4UZEA 1YJCA 3CZ4A 3IOCA 3WGLA 3B3FA 3SG0A 1EK2A 4F91B 4BX8A 1U1DA 1NBMA 4HTFA 5ALLA 3PXGA 5L51A 2HSEA 2JIZA 5U9CA 1F60A 5FAKA 1YE8A 2GEDA 4B3BA 4QSHA 3QRWA 2H9YA 1QIMA 3BXPA 4JAVC 3R0QA 4ZVUA 2VLIA 1XDSA 2VJQA 4GMXA 1EMDA 3GV0A 1KWKA 2G70A 3O8CA 3C24A 2Z3VA 3HB5X 4OD0A 5EJ7A 2G88A 2AUTA 5LDGA 1CXZA 4EX7A 5JLAA 4M9CA 3FOFC 1H4SA 2C7GA 1OGJA 3EXIB 3GDHA 3GQBB 1Y7LA 4NENB 4PTYA 4BLSA 2DSTA 3SOPA 2PVSA 2J4CA 1XU7A 3QXXA 4V1CA 5DOVA 1DKRA 1QV9A 1N2XA 2NQ8A 4PR0A 1J0XO 1EHCA 2DPLA 1KQPA 2YTZA 5GGYA 2Y05A 3JQFC 1ZICA 2JB9A 2GZRA 2ZUBA 3GHYA 4KXQA 2VCYA 3O9MA 2GEFA 4DYDA 3AMVA 4Z9YA 4GYJA 4FP9A 1JIIA 1QKIA 3NAZA 5FI1B 2J5BA 2OHHA 4RHCA 4ZU1X 3U9TA 4BEBA 3AJ8A 1G2IA 1F1JA 4HMPA 1KK3A 1BE0A 1PR2A 4DS3A 3HUFA 4KPYA 3M2TA 3QLJA 4YONB 3KQLA 1Y6ZA 2XTAA 2XZOA 3SZUA 3PPYA 3TEMA 2VTBB 3QLVC 3ZQ4A 3GZ4A 4L22A 1GTZA 4HDAA 2OYCA 3THSA 5A62A 3L4EA 1VIYA 2HPZA 4FSHA 3VISA 1B6RA 3JD3A 4HRAA 4MRSA 3WLPA 5A4DA 4CLRA 1UM8A 5KYWB 5TT1A 1PZGA 1T8TA 2GJAA 2ETVA 2IYWA 5D5QA 5DK4A 1RNLA 3RYCA 3RANA 4XWAA 1KKUA 1BVRA 2EX0A 1AB5A 2R6ZA 3JATA 4IDQA 4MKRA 3ZE8A 4HJRA 3OBBA 1NQ5A 5BWCA 1NM5A 1O9BA 1T34A 3C7KA 2ZDQA 3JQ8B 4O2RA 4GZMA 5BNTA 1VSVA 5LKRA 4TYNA 2ES4A 3II6X 2FDXA 2VQ3A 2WMYA 3L8YA 4WZBE 5H68A 1M1YA 3B5IA 4QM6A 1S2NA 1WXXA 2FVXA 2R68A 2YZKA 4MCAA 3ZEIA 4DMUB 1IBRA 5CNMA 3IXMA 1C1XA 3BH6A 4OO3A 4R51A 2G5PA 3C8DA 5AW0A 3OCCA 3OU6A 4YCCA 3AM4A 1KPHA 1KNQA 2PZMA 4QUKA 2PMFA 3AIOA 1ZI9A 3FNIA 3OOHA 3WBJA 1S3GA 2X1MA 4YP0A 2D3WA 1XELA 5AJXA 3KKNA 1C0LA 2FPGA 2X23A 2DUUA 2HSWA 4K03A 3AR6A 4PC1A 2VQFB 4IYJA 1ZPDA 5K0GA 1E2GA 1FFAA 4RLHA 4J0JA 3AJEA 4OQMA 1UC4B 3IULA 2I3AA 3FNFA 4AB1A 5FNVA 3RSFA 2BP7B 1A9TA 4L8LA 3LTNC 4C22A 2P2LA 3DS8A 4B35A 3PT5A 1XKXA 4XFDA 3FPSA 1Y5MA 2FZEA 4DW8A 3MGKA 1SVNA 2D0DA 1MA3A 3A1TA 3DP9A 3PKJA 3QG1A 5JDCA 1Z8FA 1ZBQA 2OCDA 1M8PA 2L19A 4E03A 2LBPA 3I3OA 3E3MA 1OXTA 2YMPA 2Q9CA 3M4NA 1THTA 1KS2A 1IPFA 5D01A 4V0KA 2OESA 6AT1A 4OI2A 3ESXA 7GPBA 1AUPA 3SC2A 2O0HA 3JQQA 4C3ZA 3T3EA 2JAOA 3RJTA 3SKXA 1G16A 1U8ZA 2HCBA 2W6PA 1Y9ZA 4X45A 3KS9A 2P6PA 1RS0A 4F56A 3E5MA 3AHDA 2EERA 2ID7A 2XIJA 1LLUA 4FYIA 5D7BA 5HFNA 2YJ5A 2C7RA 4UXJA 3UMCA 1NLZA 1P44A 1QR2A 4PZDA 1J9EA 4C7MA 3IAS1 1JJVA 4CM5A 3IAM6 1QV6A 3H7IA 4B5LA 4NU5A 1NJ1A 1JDTA 1XZLA 1YS9A 2RKWA 4FOLA 4UQOA 4AJNA 5IVKA 1WXHA 1CZLA 1S8NA 4YN3A 2X4LA 3RUHA 1KEEA 4D5EA 4YRPA 1I0IA 2I3DA 3PR1A 3NCHA 2X7JA 2X0RA 1D2NA 5J5CA 1OBOA 1S6YA 3ESDA 3LBHA 3QELB 4JP2A 1YBFA 5JWOA 5F9HA 4LHSA 4RZXA 5FBWB 4BB9A 2PUEA 3CW2A 3GVIA 4I50F 1W52X 3ZKWB 3Q8LA 2WM8A 3DAPA 5ECWA 4YGXB 1ZGZA 4BJ1A 4QLBA 1A8UA 5BR7A 2QTLA 4J0IA 1K7EB 3SIRA 2MSLA 4DDMA 1DLIA 1NHGA 3AHHA 4JOCA 1Z4QA 4BLUA 1IZ9A 2C61A 3AFMA 1ZW6A 3VOBA 1NMQA 1EQUA 2A88A 1COZA 3WK4A 5FOWA 4E30A 1WB5A 1OTHA 2P35A 4ZT4A 4M99A 5TNXA 3SHQA 2VPZA 2I4OA 5CW2A 4D9FA 5KWIA 1RTKA 2FJUA 4G85A 3TRDA 5ELMA 3PNKA 1JEOA 2IYAA 4F2GA 2CBGA 1KEWA 3IEUA 5G3YA 4R0VA 4OIMA 1QHYA 4R3UC 2XITA 2JI4A 3COYA 3IURA 3Q5EA 4UQLA 5TPWA 2REQA 4MHSA 4DDHA 4KSYA 1Z29A 2BGLA 4IICA 2INGX 3PR3A 4RVUA 2AMVA 3D3QA 2HAEA 2WSIA 3BMXA 5J43A 5CA1B 3UK0A 1CY4A 2C5FA 4EVIA 2PKEA 4ALIA 3STUA 4CEIA 1ZINA 3G2IA 3A6PC 2DBQA 4KVGA 4BFVA 3MMNA 2PGNA 2OTCA 3M4JA 2E5WA 2J8ZA 2VAWA 2YY5A 2QPAA 3C5CA 3GAFA 2Q6IA 2EGUA 2C1EA 4FFBA 1KMIY 1BEZA 3E81A 4Y6PA 4BP1A 4R3NA 3EC1A 1PJ8A 4WN3A 2A67A 1NI5A 2FETA 3LD9A 2ZBPA 4IKPA 4U9UA 1T0HB 1OGIA 1Y8RA 1QUFA 4P93A 4KFCA 3T41A 1MABB 4JEHA 4MWOA 3HDGA 3PQ4A 3COZA 3FTDA 3NP9A 4II2A 2BFWA 1DAOA 2AX3A 2BN4A 1YR3A 1MJGA 4ZICA 1U28C 2CB9A 3O3MB 4OLHA 4WDRA 5FL7D 1HDYA 1AKQA 1GQ2A 4RO0A 2QTWB 2I9PA 1W88A 4U2KA 1Q16A 4KQ1A 4Y2RA 3PF8A 2ONCA 2MMCA 3KJFA 1FNCA 4NAVA 2E4XA 2XUAA 3I2KA 5T6BA 1XX6A 2F67A 4EP1A 4TM7A 1KQFA 3W3AH 1ZWKA 1ISMA 4BAZA 3C8MA 1JQEA 2I03A 1QCDA 1M67A 3KJZA 2SHKA 1A95A 3FBGA 1UDRA 1PWZA 1E7WA 2OLJA 1P18A 4F1WA 1KARA 1XBTA 4ENQA 2AE1A 3WLAA 1KVTA 2R65A 2VPPA 5B53A 3LW8A 1YZNA 3N58A 4EI2A 5I7FA 3F5QA 3NX4A 4E5YA 1RZ3A 1P1JA 4IZ6A 1FRNA 4DKJA 2Z2ZA 4NMHA 1EUDB 5DEOA 2H2GA 4UUMA 3UPDA 1H1TA 5SYAA 3KSAC 2R86A 4EUNA 4G41A 5CBKA 3TNJA 3UK1A 2WAYA 2DE0X 1UZAA 5I7RA 5K3DA 4I1PA 1JFFB 4LXGA 4QUHA 1DJPA 5I7OA 3WGYA 1EHYA 5B7PA 2HX1A 3RIEA 2MTBA 2WJPA 1SMKA 2VTVA 5EJ2A 2HBQA 1DI0A 3QVUA 4NPCA 5ESXA 1A76A 2AFHB 1X3LA 2X76A 3H9BA 3KFXA 2AOVA 4CKCA 4EB8A 4IIHA 2QTBA 2R8ZA 1CUDA 2HJRA 4B6SA 5KOHA 3L8HA 3S1LA 1T2CA 2AN4A 1SIWA 2IPAB 3OVMA 3W06A 4TKVA 1FE8A 4WPGA 2ZG6A 4AX4A 3UG7A 2QRVA 5I4CA 4B3DA 1L8LA 1XXLA 4Q16A 3PKIA 2I8LA 2QJRA 2WTEA 4LYAA 2OHXA 4J1TC 4ZO9A 721PA 2JFBA 3KWJA 1LPAB 4UAVA 1ZJ4A 3O90A 1FSSA 5CH8A 2OV3A 7YASA 1ZA2A 1MA0A 1LBTA 2I87A 3KYIB 3P0EA 3Q7PA 3ZHBA 1PWHA 2X77A 3HP7A 4QE3A 2ZAYA 1WHSB 5EOVA 1NX9A 1MO2A 2CLCX 4EG1A 3QPDA 2QDKA 4MVJA 4QPJC 2H11A 4XPIB 3THRA 4LOKA 2IHUA 1VMAA 1EDEA 2JCXA 3H0KA 1WKCA 5KX5B 4IKEA 3UTDA 4LNUA 4MYSA 4LDNA 5K3OA 4AP9A 3C15C 1WAMA 2HJWA 1P0CA 2HDOA 1SUEA 1Z7EA 1PL8A 5TPZA 3IHTA 3I04M 5AKKA 3GRYA 2VWQA 2YHIA 4K9MA 5HQJA 6NULA 4IMIB 6ABPA 2CFSA 3GHHA 1ORWA 4D9MA 5KAPA 2FQ1A 1AY0A 3BBPA 3W5BA 1NQAO 1C1YA 2EDAA 2MSCB 1Q22A 1Y8AA 2WJAA 3OU7A 3AVTA 2AE2A 3B6EA 3IS3A 1G7TA 3JQ6A 3P2JA 4L5CA 1CZUA 2WMOB 5FPYA 3DZCA 2BJHA 3NH9A 3R3JA 3OLVA 4GBJA 1XTSA 1OMOA 4K1XA 1E3WA 3KYBA 3EULA 2FR0A 5EZ6B 3CRMA 4WKGA 1MOQA 4Q4CA 1IB6A 1JWAB 1G4HA 5CDHA 4K9SA 3FKJA 3AETA 3UJHA 2Q0QA 1WABA 3R3HA 2I55A 4WIAA 4RQAA 1RRPA 1RE0A 2P2DA 3UATA 3VNSA 4DV3B 4WK4B 4P6VF 2PRSA 3ETJA 3G6KA 1NXSA 3F8TA 3GT7A 3CT6A 4HAZA 2O14A 3A2LA 3DT6A 2QYOA 5CMLA 1Z5VA 4ME6A 1ZLXA 1PT8A 1B42A 2F64A 4RESA 1P72A 1FLDA 4FD3A 2DBZA 3O8OB 4WESB 5KSPA 5BMOA 1YCDA 4PPYA 3CF4A 1G8GA 1T2UA 5TIIA 1TEZA 3LHDA 2EKQA 1RM0A 4FBMA 5C3MA 5IVDA 4R16A 2H7VA 3D0QA 3CLKA 3S4YA 5AVSA 4OEHA 2XUIA 2EJCA 2C78A 5JISA 3VR0A 4CQNA 4DCTA 4DV1B 5CVTA 3TOSA 3B6IA 1NYLA 2LDXA 3D2CA 5IZCA 2RI6A 3GGPA 2X2EA 1GN8A 3BDAA 4OJMX 3U49A 4MLPA 4UBOA 521PA 4ZCSA 4QVKA 4X90A 2LCQA 3W8FA 1YFJA 4QULA 4KN5A 2P1DA 4FSDA 1T9HA 1DIOB 1E2IA 1Y8QA 1K98A 5F1YA 2NX2A 4QTYA 1QFSA 3MGGA 4XYBA 2DEUA 1E8DA 2YUTA 3WGVA 5DMHA 1VE3A 3NPMA 2IYEA 4OSOA 3V1NA 3WGQA 2ZVQX 1JR2A 3NALA 3U9SA 4P7BA 5A4FS 3QPAA 3TL3A 3BSWA 4MUIA 5AK3A 3E0QA 3JASB 3PR2B 2NZWA 1OV6A 2ZBDA 2FUKA 3COJA 3K0HA 2P1RA 5I48A 2YOHA 4QYSA 1TA9A 4RPJA 2G06A 3MUEA 4JJGA 2GS9A 3L8ZA 5CNJA 1Y8ZA 4XUEA 2C2KA 2Q5LA 3F8WA 3KYDA 4D4KA 1PK9A 1JEQA 4OLFA 3H83A 2YXPX 1FVFA 2QZSA 2WNIA 5ERXA 4LTNA 3STHA 5KVCA 2WV7A 3ED1A 5HM8A 3EEOA 1UQUA 2G76A 1IVSA 4FEEA 4UUPA 2QRNA 1HBJA 2QU8A 1NSYA 2RBGA 2YBEA 3NHZA 3T12A 3ZG6A 3R0XA 3R5KA 3R75A 1WKBA 1J9GA 2YHBA 4G09A 4YMSA 3RU9A 2PYIA 3Q9NA 3W4IA 5KTPA 3RADC 3PX7A 5EIXA 3ZCSA 2F3TA 5C18A 5FWYA 4N8DA 1RM4A 3FRJA 1CRQA 1FRZA 1VG8A 1DXYA 1WUKS 3LUDA 4HSEA 1M2VA 5I7VA 3IT3A 1X87A 2V6IA 4DC1A 3FDXA 3DHVA 2HHJA 2QTHA 3E84A 3TRHA 5IFLA 3R9IA 2OXEA 3GEIA 3WFJA 4CIXA 3ZD6A 3MMSA 2OFWA 2XUJA 1K08A 1C9DB 4OHVA 4TV8F 3N6VA 4V0QA 4CVNA 1RXEA 4AJ2A 4JUAA 3IXQA 2ADOA 3SKYA 2KW5A 1IAQA 1E1RA 1GL6A 1RAHA 3W1EA 3UVEA 2G9RA 1B0AA 2HJ9A 1HM5A 4O4JA 5F2EA 2FMIA 4BEJA 2CF5A 5DXAA 3ESBA 4YS6A 4DIEA 1Y1PA 3AVYA 1YE5A 4TUYA 4P08A 4ATNA 3BXHA 4IVNA 1FOEB 2IOFK 5KKNB 5J3JA 2Q1SA 1OU4A 3K8OE 4YRKA 1AZSC 2Y1XA 1RWBA 2WD8A 4O5AA 4F2DA 3S1AB 2WHYA 3H1BA 4XRGA 5AW8A 2HYIC 4RLQA 1O5OA 3OKAA 2V6MA 1RQ2A 3Q7IA 3BSSA 4ON9A 2B5WA 1TI7A 2XDQA 3LQ4A 3DHEA 3Q5DA 3D3KA 3W5UA 3F2IA 4MQ4A 2DQSA 1W0JD 5SZHB 4OB7A 1W19A 1XMPA 3X2FA 1UIMA 4EO4A 3QPBA 3HEAA 2O0KA 3TEFA 3I64A 1EK1A 5B3LA 5EJ4A 3HE3A 3TW0A 4ZA2A 2JGRA 4H16A 5K8JB 1M72A 1LZLA 2JCSA 3KUDA 4OKNA 1R0WA 1YRAA 3BXXA 4RTPA 5DF1A 1JG4A 1W94A 4U9IS 3GLKA 4HKTA 4PVCA 5T7BA 4X6XA 1RI4A 4DIDA 2FZLA 3ETGA 2C4MA 1O96B 1JDSA 2PL1A 3AR3A 4P3XA 2XB8A 3MTDA 3R7WA 2D59A 1F6WA 3IAFA 1ISGA 2VDRB 4W9MC 5AXCA 2FUEA 3EJ6A 4G8DA 4R31A 2ZR7A 3ROQA 2C5BA 2W4QA 4E2YA 1UFOA 3QYJA 2VSOA 4MR8A 2ZAOA 3QU9A 1T8UA 1G59A 5KI6A 2PLNA 4BPBA 1V11B 2VUSA 1YB2A 3FDZA 4ENTA 2IS2A 3MQ2A 4PHHA 4JLBA 3UY4A 2QE7D 1JBEA 3H16A 1KI7A 3GGDA 4D74A 2NZYA 1SHJA 4PNEA 5HZGA 4CUKA 1L8QA 4WJZA 3ONDA 3K9WA 1O5TA 3RFUA 1MAHA 2WTAA 1MX3A 3L49A 4RV9A 3HK2A 1SAYA 1ZGCA 4M1OA 4BZPA 3DE0X 2PY6A 1W4AA 3HXLA 3WGIA 5KYXB 4DXDA 5EZSA 3V4OA 1UP6A 3NWPA 5H8WA 5KYUA 3BICA 3R7FA 1EFCA 2RHGB 2MIIA 3H11B 1PR6A 1NF3A 2WIBA 3BL8A 4BASA 2V59A 3VTFA 2HCFA 2F9MA 2P7HA 4L27A 4L0CA 3CUYA 4K6GA 2H00A 2D2VA 3PK0A 4JIMA 2NXJA 3ZDQA 2PCJA 3BH7A 1MX5A 5C4MA 2RB5A 5LLSA 1UT6A 3I12A 2EIHA 4BAUA 3UMMA 3GY0A 1PZNA 2HCJB 2QLNA 4TTTS 1QCYA 3I4LA 1R0CA 4KX3A 5E3IA 1CUJA 3CVWA 1SVUA 3VC7A 1PS8A 3FZGA 1T1GA 2X42A 1L6RA 2CDBA 3WGZA 2YS7A 2ZB8A 2AKAB 3BUSA 4NHOA 4XSVA 2DFPA 2JJMA 3IVCA 3S2ZA 5HKBA 1XFDA 3PZRA 1LDNA 2JEYA 2YQ5A 3EF3A 3ZCPA 3W5DA 1ITZA 2ZRLA 4F9FA 2BLLA 5B6JA 2OBYA 1GT91 3AJAA 2XZDA 4JC0A 4QSMA 5BW5A 3WG9A 1U9CA 2HEGA 5ESWA 4AJOA 3KV3O 5A9TA 3TD2A 2AR7A 2HWXA 3AF2A 2VP0A 2OHVA 4QODA 5JJLA 2PJUA 2ZB7A 1B4DA 1QAQA 2FKNA 4RV5A 1RWXA 1YMVA 1NV9A 2GHTA 2ORYA 3L06A 1NF9A 5LIPA 4D4MA 4DDVA 4I4TA 2YCLA 3FDJA 4FDTA 2YHUA 1RPJA 3PPVA 4TTIA 5A71A 4XFJA