3I43A

Escherichia coli thiol peroxidase (tpx) wild type disulfide form
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
SQTVHFQGNPVTVANSIPQAGSKAQTFTLVAKDLSDVTLGQFAGKRKVLNIFPSIDTGVCAASVRKFNQLATEIDNTVVLCISADLPFAQSRFCGAEGLNNVITLSTFRNAEFLQAYGVAIADGPLKGLAARAVVVIDENDNVIFSQLVDEITTEPDYEAALAVLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol peroxidase
publication title Structural changes common to catalysis in the Tpx peroxiredoxin subfamily.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Oxidoreductase
total genus 55
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2009-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3i43A00
5C00A 3TB2A 4BL7A 4EC0A 3BBYA 4ZBBA 3UMAA 3F6FA 2LRTA 1SL1B 3QAWA 3C8EA 4I97A 4AGSA 5DAKB 2ALBA 4K7NA 3TDGA 2DLXA 5IM9A 4MF6A 4L5LA 3P2AA 1GULA 2GS3A 1FVJA 3GN3A 3JCML 1GSSA 1N2AA 3UAPA 3C73A 4LL1B 4MK3A 2YWIA 2XC2A 2GQLA 2NBSA 5H5QA 3US3A 2LS5A 2L5LA 2M80A 4LL4B 1E6BA 1QGVA 4XS4B 5ECSA 3KH7A 1K0AA 14GSA 1BEDA 1TK0B 2RUEA 3VWXA 2WULA 5HFGA 1ZCPA 2C80A 3EMPA 5ECLB 1ZGNA 3KM6A 2CVBA 2H30A 2XPEA 4PQ1A 3IXRA 4ZIJA 3KTBA 5LD0A 1PL2A 4TR0A 1WRYA 2HZEA 1XWBA 5G1KA 4MJAA 5CRHA 2ZUPA 5F0GA 3RHBA 5IPHA 2V6KA 4IQ1A 5DJLA 3ZYWA 2REMA 1EWXA 4O32A 3F63A 2IN3A 1J08A 2GSRA 2MBSA 1OKTA 3IPZA 4MLYA 4POKA 4NAXA 2G2QA 1A2LA 4J57E 1FG4A 3HJPA 2C0FA 3P8WA 4ZBAA 5J9CA 4QQ7A 4NWYA 1TKDB 6GSSA 1AQXA 1XXUA 3HJMA 1XPVA 4V1Ap 4OFNA 4POBA 1WWJA 4V2NA 4YAPA 2LKUA 3TGZA 3IK7A 4G10A 3QDNA 3LXTA 3Q18A 1GTIA 2F8AA 3L9UA 4NV5A 1KEBA 3FZ4A 2BJXA 4EO3A 3CSHA 4IGJA 1GNEA 3G7IA 1XIYA 1OC9A 2HXKA 1XW9A 2H0HA 2KOKA 4LA1A 4IJIA 2CZ3A 4O5RA 5IOWA 1GH2A 2H74A 4K0GA 4FYCA 1VF1A 1EOGA 4D73B 1A8YA 3KJYA 1K0BA 1SL2B 3MAKA 1EEMA 16GSA 1K0CA 1GUMA 3FR9A 5IMCA 4PNFA 4TN8A 3LGCA 4L0WA 3D4TA 7GSSA 1F6MC 1MDIA 2H1GA 1TRSA 2FWHA 1FB6A 3IDVA 2DBCA 1B4QA 2VCZA 3PR8A 13GSA 1UVZA 2X8CA 2EC4A 2IMFA 1PX7A 3FR6A 5ECHB 1SL0B 5J3RA 1A0RP 2B5EA 4KE3A 1XWCA 3HYPA 1B4PA 3ED3A 4KDUA 3ZMKA 2K8VA 5ABRA 1B48A 3EMXA 2F51A 3VWWA 4MJBA 4F2IA 4YQUA 6GSWA 1R7HA 4JEDA 2C4JA 2HE3A 3ME7A 2YANA 1K0DA 1WIKA 2WZ9A 1A23A 1V40A 2LSTA 1OC3A 3M3MA 4EUYA 4PQHA 3J7Yb 2R6KA 5B8BA 3HY2A 3UOMA 2LQOA 4GLTA 1XWAA 3G9BA 5F06A 1BG5A 3LORA 2GTUA 12GSA 3M9KA 5ID2A 1XW5A 1ABAA 5J41A 4K1FA 1A2JA 4WR5A 4PXOA 5ECOB 1ZYQB 1KNGA 5DBQA 1H75A 2H1AA 1U88A 4ECBA 5IMFA 1MDJA 3ZFBA 2KLXA 3FHKA 5IIZA 2VCQA 2HZEB 2JU5A 4X0XA 2VUPA 3A2XA 1DE2A 1Y6EA 2IMEA 3QAGA 4BA7A 5D73A 3LJRA 1JLWA 3LXZA 2DC5A 1O8WA 3GURA 4KDXA 1JFUA 4O92A 4OMVA 1FVKA 3GKMA 4HOJA 1OE8A 3WGXA 1T4YA 6GSXA 4ECCA 4HEA2 3VPTA 1OYJA 2GZPA 4NPBA 3BOAA 3UJ1A 3GRXA 3O3TA 1Q98A 3QD9A 1XWKA 1USBA 2YP6A 4EE0A 3GFKA 2CX3A 2DJ1A 1J0FA 5G1LA 1AC1A 2GT6A 2YN1A 3WD6A 1EV4A 2VIMA 2I3YA 2E2MA 3G7JA 3TRQA 3UIWA 4TKYA 3M8NA 1JZOA 2C3NA 2B6MA 5L71A 3DD3A 1OC9B 2QC7A 2H73A 3KH9A 1THOA 3GL5A 5D9XA 1SU9A 1J9BA 2WS2A 2PN8A 2VCVA 18GSA 2A2RA 1JZWA 3QFBC 2L57A 4DSSA 2A2SA 1SYRA 2OACA 5ECNB 4N0ZA 3WYWA 1ZZYA 2N5BA 1TTZA 4IQAA 3I69A 1JZDA 2B1KA 2KP1A 4GCIA 5GAND 9GSSA 5J9BA 2IMIA 4RI7A 4WBRD 2B7KA 4XTSA 1W89A 3HVSA 4POMA 3ZIJA 1PSQA 4XRDA 1EOHA 4QL7A 4KW6A 2YV9A 4LMVA 3O6TA 4ISDA 4WEYA 5CREA 3LYKA 5EL8A 2G0FA 4PQIA 3UEMA 3A5WA 2VOCA 5IMVA 2CAQA 3KCMA 4MF5A 3CRTA 4IHUA 3HZ8A 2JZSA 3VWUA 1DBYA 6GSTA 1IYHA 2R37A 1WP0A 2C1YA 1ZYEA 4KDYA 1GSUA 2B7JA 2JSYA 3IOSA 3BJ5A 5IO2A 3K8NA 4MJEA 4I2TA 2CT6A 2VL3A 2P0GA 4GSNA 4JU5A 2MMOA 4KCEA 1WOUA 5EVOA 3QMXA 2X99A 2LJRA 2O87A 2OKAA 1OVNA 1GWCA 5A4UA 3LG6A 3GX8A 3UARA 4LMWA 1SK1A 3C7MA 5INYA 4DVCA 5ID2B 1DUGA 2CZ2A 3GX0A 1K0MA 1YKCA 2H01A 1GUKA 4EF0A 3LSZA 3WGEA 1QXHA 5IPGA 2VCTA 1W4VA 3P7XA 1HNBA 5B7CA 4AJ8A 3KTLA 4KGIA 1S3AA 3R2QA 2CVDA 3ZIVA 2H0IA 4EDYA 3DVXA 4OCEA 4N11A 2V6OA 1ERWA 3NZNA 5G5FA 3Q19A 3M9JA 4I5QA 3ERWA 2VLVA 3KP8A 3C1RA 5ECKB 1XVWA 5JWOB 3S9FA 1TRWA 1HD2A 4CW9A 4IVFA 5FHIA 4K2DA 3GTUA 3FZ9A 3LFLA 3KP9A 2H75A 2AUVA 4NHWA 3LYPA 1ERVA 3GH6A 5DALA 2DMLA 3E0UA 5F07A 3F4SA 3QFAC 4GF0A 2XPDA 2JZRA 4TW5A 1T7PB 1YEXA 1M99A 2L59A 4MMMA 4KSOA 3ZTLA 3IR4A 4RI6A 4ZL9A 1BQ7A 3ZZXA 4RQRA 1TRVA 3TJJA 1JHBA 4DEJA 3RAZA 3W8JA 1GUHA 4NV2A 4MZBA 3MSZA 3MWHA 3TRXA 2FWFA 3GKKA 1HYUA 1Q4JA 4IBPA 1MDKA 4ZILA 2JZTA 5D9WA 2X8GA 1OAZA 3ZFLA 1XFLA 1EP7A 5DCGA 1TJDA 2GGTA 4PUAA 4TOPA 3TCOA 1B9XC 2C8UA 2LTKA 5CRWA 2R5GA 4YH2A 1EGRA 2GDRA 3CSIA 2OA7A 1R5AA 2AB6A 4K7OA 1WJKA 4NHZA 1PRXA 4KA0A 2O85A 2VM1A 4MH3A 4MPFA 5A4WA 4HQZA 4MCUA 2DSAA 5CAXA 10GSA 3FYGA 4MA9A 3BCKA 1K0NA 2EIRA 1F3AA 2YZHA 3VI7A 4PNGA 3F4TA 1O8XA 4NMUA 3MNGA 3UVHA 4F0BA 3SBCA 3WT1A 5ECIB 1R5PA 2XHFA 4MABA 2V2GA 2YZUA 2DJKA 3ZREA 1GSYA 3TRPA 5B8AA 5HR3A 5B6MA 3D22A 2K8SA 2CX4A 5ECRB 2IJYA 5D9TA 2VCWA 4KCAA 2CV4A 1DSBA 5GSSA 2GQKA 3GH9A 4AJ7A 3EYTA 4Q5RA 3VK9A 1M2AA 4WF4A 5AIVA 1YY7A 3KXOA 2LEGA 2WDUA 2FA4A 1O7UA 3UL3A 2J9HA 3GSSA 4YQMA 2OBIA 2MYGA 4IP1A 3H1NA 1GTAA 4ACSA 1TI1A 4TR4A 1RQMA 1O85A 4IW9A 2J23A 1GSDA 2HRNA 1EGOA 3HJOA 2PWJA 5DQYA 4GTUA 2R2JA 4G19A 4ZB8A 3ZRDA 1YDKA 2IPAA 1AXDA 2WB9A 4BPYA 5D96A 3D6IA 3BD2A 2IWTA 1B8XA 4E8EA 1NW2A 4N0VA 1EZKA 4NXIA 1CQGA 2RUFA 2C0GA 1S3DA 1F3BA 3TKPA 1FHEA 2FY6A 3GTUB 2MZCA 5ECPB 3DEXA 3CRUA 3ME8A 2CAIA 2FWEA 3DRNA 3CSJA 4OFMA 2F8FA 1G6YA 1AQVA 2H8LA 2L6DA 2P31A 1A0FA 2YNXA 5GSTA 3DVWA 3L78A 4TRXA 2H72A 5HQPA 5AIXA 3F9UA 2HFDA 2IL3A 3H79A 2GVPA 2F3MA 1YQ1A 5HR1A 2AYTA 4OD7A 1SK0A 3VPQA 2XBIA 3AY8A 4X43A 5DDLA 5GAPD 2IFQA 1GSQA 3C1SA 1ZL9A 2GSSA 4ULXA 1NHYA 3A2VA 1G7OA 1RK4A 1ILOA 3TJBA 2YCDA 2H0GA 2K9FA 4HS1A 4HJMA 5B6NA 2QGVA 2VCXA 5G31A 2KHPA 2VL2C 3NOFA 4MF7A 4Q5QA 2TRXA 4KSMA 2PMTA 2H76A 4IJ3A 2Z9SA 1X5DA 3WGDA 3D4MA 1TK5B 3D21A 3F3QA 2B1LA 3TKQA 5FT3A 1T4ZA 1Z5YE 1YF0A 1KTEA 3KEBA 3Q74A 3FY7A 3UBLA 4K6XA 4YAVA 4J2FA 3LWAA 1SKRB 4HU9A 2WFCA 4V2MA 1SJIA 5AN1A 2E2GA 2CVKA 3TUEA 2YWOA 2LRCA 4WETA 4V2LA 4ZXGA 1JLVA 3EU3A 1XOBA 5G2ZA 1M2BA 3IA1A 3DXBA 4XCSA 4Q5FA 5JCGA 2OE0A 3EU4A 1XOAA 3GKNA 2HYXA 2BMXA 4EVMA 1Z3EA 5KN1A 1ACVA 1VF2A 3L0HA 4EXJA 1PD21 2MMAA 1BJXA 4V1Ag 4FH8A 1TK8B 4O7HA 2FUG2 1AUCA 2R3XA 3U6VA 2HI7A 2PUKC 4GSSA 1K0OA 2H1BA 3TKRA 3V1WA 4ZL7A 2D2ZA 1F9MA 2GQMA 1IYIA 3W8SA 3ZMLA 1PN9A 1TOFA 3DWVA 3H4KA 2GZZA 4TR1A 2NPBA 4AF2A 4K7IA 4IELA 1PMTA 1M7TA 3D0ZA 3GMFA 3MDKA 1SD8A 5CNWA 2WGRA 2BTOT 4BWQA 1Z7RA 2YV7A 3LEFA 5IMAA 3QCPA 2X8HA 2B5XA 1ZMAA 2VD0A 4ZB9A 3F4RA 1SKWB 2HLSA 5ECQB 3KMOA 2F9SA 2P5RA 1TDIA 4X1UA 1WPIA 1RW1A 2VD1A 5H5RA 4K8MA 2VO4A 3GYKA 2HSYA 3RHCA 2OE3A 5EY6A 3GIXA 1TRUA 1I5GA 1VGLA 2EIOA 2PVOC 3F3RA 3KD0A 1X9WB 4D73A 5J4UA 2GLRA 3GUSA 2IFQB 3L9SA 1GNWA 1HNAA 4ML6A 1SJZA 4GWRA 1THXA 2I1UA 5H5SA 3IRAA 4YQVA 2DJJA 4ILFA 1GLPA 1CQHA 1FW1A 2C3QA 2VL2A 3CBUA 4ML1A 3FKFA 3L9VA 2WCIA 2FGXA 5IO0A 2GT5A 3IHQA 2PGTA 2DIZA 4EDZA 17GSA 2FA8A 1K3LA 1QFNA 2H70A 4GXZA 4I6XA 2XBQA 2MBTA 1HQOA 1T00A 2H1DA 5CRGA 1AQWA 3ZVJA 2PPTA 1Z9HA 4PX1A 2NTOA 5HFIA 1SYXA 4HU7A 2E0QA 3EINA 2HSHA 4HZ2A 3DMLA 5C04A 2WRTA 2FNOA 5DJMA 4JRRA 3LQ7A 4OO4A 1X0RA 4KAEA 1U3IA 3SWLA 4F82A 1DE1A 2YJ7A 1M0UA 2H19A 3HCZA 4LLRA 1T1VA 3N5OA 4TR3A 2M72A 3I9V2 3KGKA 3F6DA 3APSA 5KN3A 1XBSA 4BVXA 6GSUA 5IMZA 4IKHA 3APQA 3O76A 1GSFA 3VURA 1SJ6A 1V9WA 4L5OA 1WMJA 1JZRA 4GRFA 3DYRA 1FB0A 3FRCA 4XS1A 2H6XA 4HZ4A 3TKSC 1MD3A 2KUCA 2N5AA 4POLA 3IBHA 2O7KA 2N5FA 1GTUA 1XWGA 3HKRA 5F05A 2YWNA 2P5QA 2GZYA 2O8VB 1QMVA 3VFIA 1ML6A 3IV4A 3IE3A 4WBJA 3QPMA 4DSSB 5AISA 1QUWA 4N30A 2B3SA 2H66A 1GTBA 2ZNMA 2E7PA 4JR6A 5LNKe 3FK8A 4BWSA 3HVVA 22GSA 1T3BA 3GA4A 3CYNA 5ECMB 1WE0A 4QL9A 4IN0A 1LBKA 2YOIA 5COHA 4JE1A 2MMZA 2AAWA 3TOTA 3GKXA 3N9JA 3GSTA 4TR1B 1LJRA 4F03A 5A4VA 3GHAA 3RPPA 1YF1A 1VF4A 3HVXA 1XZOA 2QKEA 1AAZA 4PGTA 3ZL5A 2FD3A 3TJGA 3F0IA 5DVBA 2DJ0A 1LU4A 2IMKA 2DJ2A 4BVYA 3FEUA 3H8QA 2L4QA 3IAS2 6GSVA 4MJCA 1PGTA 4XHMA 2M46A 4FIWA 4FYUA 1YJ6A 5ENUA 1C72A 3VI5A 1XW6A 1A24A 1KBNA 4L0UA 2C3TA 4E8HA 1ON4A 2CQ9A 3KZQA 5A5KA 4G2EA 1Z6NA 2L5OA 2MMNA 2K6VA 2RLIA 4TXOA 2NVLA 1V57A 4MH2A 2DJ3A 4JZQA 2OJLA 5LCZA 3HHVA 1F37A 1NHOA 4DSQA 2CA8A 2FWGA 1Z6MA 5CRDA 4MZCA 5CO3A 3UBKA 1TP9A 2FLSA 4ZB6A 3M1GA 1Z7PA 2A4VA 5IQYA 3DGQA 1N8JA 2LV3A 3TKSE 3CXGA 4HJ2A 4MPGA 4F0CA 2LUSA 2JACA 3U5RE 2HNLA 2R4VA 3I6AA 4FYBA 4XRAA 5D8IA 1K3OA 1TXXA 4ID0A 5IOXA 2RM6A 2NDOA 2LQQA 3H93A 3EVIA 3TJFA 5E59A 5CP1A 2DIYA 2EIQA 1BX9A 5D93A 1SD9A 4L8EA 2OBKA 4XIHA 3HZ4A 4P3YB 1BAYA 5DALB 3GV1A 1AW9A 4KH7A 1SENA 2ZCTA 3M0FA 3WT2A 6GSYA 2LJAA 1EP8A 5KN0A 2IIYA 1B9YC 3HD5A 1PX6A 1NM3A 4JBBA 3IAM2 2HZFA 1UA5A 1U6TA 2V32A 1OKDA 3ERFA 3ERGA 3HA9A 1K3YA 3RBTA 5ELAA 4ECIA 4PUFC 5IMDA 1FOVA 1PKZA 3OR5A 1GSEA 4OWYA 5CYYA 1V98A 1OC8A 2ON7A 3IK9A 3TKSA 3GNJA 1TI3A 3I43A 1O81A 3G7YA 2QSIA 4IP6A 1X9SB 1M2DA 1EV9A 4HUAA 4EKZA 4MP4A 1NSWA 2AHEA 4ZBDA 3UVTA 2AV4A 2H71A 3F8UA 2H6ZA 1XCCA 3KIJA 2OADA 2C0DA 5F8BA 3ZVJD 3ZLPA 2YWMA 1TU8A 3PGTA 1TU7A 3EC3A 1O73A 2YJHA 2H6YA 5GZZB 4FO5A 2C0EA 4GSTA 4RUVA 1VRSD 2VLTA 2JL4A 4MDCA 5KEJA 1X5CA 1U3AA 1Y25A 1XVQA 2RM5A 1I9DA 5JWQB 2GSTA 1FO5A 5HFKA 3E3EA 4HI7A 1X9MB 20GSA 5JWRB 4ZL8A 1AIUA 3QOUA 5DAKA 1GRXA 3HXSA 2B5YA 2L6CA 1X5EA 2PU9C 3DKSA 2ES7A 3QAVA 1A2MA 2LNTA 3QR6A 2AJQB 4N10A 5E4WA 4H86A 2I4AA 3FZAA 3PH9A 1UN2A 2I81A 5DQSA 5G30A 4OCFA 4J56E 3RDWA 4JR4A 2PVQA 1OE7A 2TRCP 4XS4A 5KN2A 5G5EA 2VAFA 2V41A 11GSA 3HDCA 2PERA 2K18A 4WXTA 4XS6A 4DSRA 4CHSA 2DMMA 2LJKA 4HDEA 4TXOB 3A2WA 2JSZA 4EL1A 4MZWA 1GL8A 2LNSA 5D9VA 3DIEA 4HQSA 2GSQA 2TIRA 3TJKA 1EEJA 1TW9A 3P90A 4AJ6A 1SK2A 19GSA 1GLQA 2L4CA 4OFTA 4K0NA 4K9ZA 1HNCA 3CMIA 4G9HA 1GP1A 5EPFA 2PBJA 4KB3A 4IS0A 2IMDA 3CTFA 1SKSB 3FZ5A 3KMNA 1YEPA 4TXVA 4F9ZA 1G6WA 5DCHA 2WJUA 4CDOA 3VLNA 3RPNA 3TOUA 4WR4A 1U87A 2VM2A 2YPMA 1R4WA 4WKWA 4WF5A 4GQFA 4KUNA 5HR2A 1H4OA 3GL3A 3EE2A 1PL1A 4I2UA 1PQNA 1YKAA 3A3TA 4Z7XA 1PA3A 2OE1A 1S3CA 1E2YA 1A8LA 1YZXA 1O6JA 4I8BA 8GSSA 4GQCA 4Q5NA 1ERUA 2V1MA 1VF3A 4KX4A 4TVEA 4KNDA 3IC4A 1R26A 3EURA 3L4NA 3Q6OA 1ERTA 1FAAA 1M9AA 1QK8A 3ISOA 5AGYA 1G7EA 5ELGA 3E9JB 1MTCA 2JADA 1MEKA 4RQXA 1URMA 2X64A 4PURA 5HR0A 4ECJA 5J5NA 3D5JA 3J7Yk 1G0TA 2KP2A 1V2AA 3C71A 5JCWA 1F2EA 1V58A 2VL9A 2VLUA 1BYEA 2LRNA 3ZITA 1QQ2A 3APOA 3EWLA 1PKWA 2FHEA 3PINA 2ON5A 1T8EB 2FCHA 2RIIA 2HRFA 1M9BA 5FWGA 1ST9A 2O89A 1UC7A 5JCUA 3W6GA 1MD4A 3FR3A 3BCIA 3FW2A 3CTGA 1ZOFA 4OO5A 3VWVA 2HT9A 2I9HA 3NIVA
chains in the Genus database with same CATH superfamily
5C00A 3TB2A 4BL7A 4EC0A 3BBYA 4ZBBA 3UMAA 3F6FA 2LRTA 1SL1B 3QAWA 3C8EA 4I97A 4AGSA 5DAKB 2ALBA 4K7NA 3TDGA 2DLXA 5IM9A 4MF6A 4L5LA 3P2AA 1GULA 2GS3A 1FVJA 3GN3A 3JCML 1GSSA 1N2AA 3UAPA 3C73A 4LL1B 4MK3A 2YWIA 2XC2A 2GQLA 2NBSA 5H5QA 3US3A 2LS5A 2L5LA 2M80A 4LL4B 1E6BA 1QGVA 4XS4B 5ECSA 3KH7A 1K0AA 14GSA 1BEDA 1TK0B 2RUEA 3VWXA 2WULA 5HFGA 1ZCPA 2C80A 3EMPA 5ECLB 1ZGNA 3KM6A 2CVBA 2H30A 2XPEA 4PQ1A 3IXRA 4ZIJA 3KTBA 5LD0A 1PL2A 4TR0A 1WRYA 2HZEA 1XWBA 5G1KA 4MJAA 5CRHA 2ZUPA 5F0GA 3RHBA 5IPHA 2V6KA 4MNNA 4IQ1A 5DJLA 3ZYWA 2REMA 1EWXA 4O32A 3F63A 2IN3A 1J08A 2GSRA 2MBSA 1OKTA 2HSMA 3IPZA 4MLYA 4POKA 4NAXA 2G2QA 1A2LA 4J57E 1FG4A 3HJPA 2C0FA 3P8WA 4ZBAA 5J9CA 4QQ7A 4NWYA 1TKDB 6GSSA 1AQXA 1XXUA 3HJMA 1XPVA 4V1Ap 4OFNA 4POBA 1WWJA 4V2NA 4YAPA 2LKUA 3TGZA 4G0IA 3IK7A 4G10A 3QDNA 3LXTA 3Q18A 1GTIA 2F8AA 3L9UA 4NV5A 1KEBA 3FZ4A 2BJXA 4EO3A 3CSHA 4IGJA 1GNEA 3G7IA 1XIYA 1OC9A 2HXKA 1XW9A 2H0HA 2KOKA 4LA1A 4IJIA 2CZ3A 4O5RA 5IOWA 1GH2A 2H74A 4K0GA 4FYCA 1VF1A 1EOGA 4D73B 1A8YA 3KJYA 1K0BA 1SL2B 3MAKA 1EEMA 16GSA 1K0CA 1GUMA 3FR9A 5IMCA 4PNFA 4FQUA 4TN8A 3LGCA 4L0WA 3D4TA 7GSSA 1F6MC 1MDIA 2H1GA 1TRSA 2FWHA 1FB6A 3IDVA 2DBCA 1B4QA 2VCZA 3PR8A 13GSA 1UVZA 2X8CA 2EC4A 2IMFA 1PX7A 3FR6A 5ECHB 1SL0B 5J3RA 1A0RP 2B5EA 4KE3A 1XWCA 3HYPA 1B4PA 3ED3A 4KDUA 3ZMKA 2K8VA 5ABRA 1B48A 3EMXA 2UZ8A 4BL7B 2F51A 3VWWA 4MJBA 4F2IA 4YQUA 6GSWA 1R7HA 4JEDA 2C4JA 2HE3A 3ME7A 2YANA 1K0DA 1WIKA 2WZ9A 1A23A 1V40A 2LSTA 1OC3A 3M3MA 4EUYA 4PQHA 3J7Yb 2R6KA 5B8BA 3HY2A 3UOMA 2LQOA 4GLTA 1XWAA 3G9BA 5F06A 1BG5A 3LORA 2GTUA 12GSA 3M9KA 5ID2A 1XW5A 1ABAA 5J41A 4K1FA 1A2JA 4WR5A 4PXOA 5ECOB 1ZYQB 1KNGA 5DBQA 1H75A 2H1AA 1U88A 4ECBA 5IMFA 1MDJA 3ZFBA 2KLXA 3FHKA 5IIZA 2VCQA 2HZEB 2JU5A 4X0XA 2VUPA 3A2XA 1DE2A 1Y6EA 2IMEA 3QAGA 4BA7A 4YKGA 5D73A 3LJRA 1JLWA 2QA2A 3LXZA 2DC5A 1O8WA 3GURA 4KDXA 1JFUA 4O92A 4OMVA 1FVKA 3GKMA 4HOJA 1OE8A 3WGXA 1T4YA 6GSXA 4K2XA 4ECCA 4HEA2 4K5RA 3VPTA 1OYJA 2GZPA 4NPBA 3BOAA 3UJ1A 3GRXA 3O3TA 1Q98A 4BVYB 3QD9A 1XWKA 1USBA 2YP6A 4EE0A 3GFKA 2CX3A 2DJ1A 1J0FA 5G1LA 1AC1A 2GT6A 2YN1A 3WD6A 1EV4A 2VIMA 4ICYA 2I3YA 2E2MA 3G7JA 3TRQA 3UIWA 4TKYA 3M8NA 1JZOA 2C3NA 2B6MA 5L71A 3DD3A 1OC9B 2QC7A 2H73A 3KH9A 1THOA 3GL5A 5D9XA 1SU9A 1J9BA 2WS2A 2PN8A 2VCVA 18GSA 3HVNA 2A2RA 1JZWA 3QFBC 2L57A 4DSSA 2A2SA 1SYRA 2OACA 5ECNB 4N0ZA 3WYWA 1ZZYA 2N5BA 1TTZA 4IQAA 3I69A 1JZDA 2B1KA 2KP1A 4GCIA 5GAND 9GSSA 5J9BA 2IMIA 4RI7A 4WBRD 2B7KA 4XTSA 1W89A 3HVSA 4POMA 3ZIJA 1PSQA 4XRDA 1EOHA 4QL7A 4KW6A 2YV9A 4LMVA 3O6TA 4ISDA 4WEYA 5CREA 3LYKA 5EL8A 2G0FA 4PQIA 3UEMA 3A5WA 2VOCA 5IMVA 2CAQA 3KCMA 4MF5A 3CRTA 4IHUA 3HZ8A 2JZSA 3VWUA 1DBYA 6GSTA 1IYHA 2R37A 2DKIA 1WP0A 2C1YA 1ZYEA 4KDYA 1GSUA 2B7JA 4EIPA 2JSYA 3IOSA 3BJ5A 5IO2A 3K8NA 4MJEA 4I2TA 2CT6A 2VL3A 2P0GA 4GSNA 4JU5A 2MMOA 4KCEA 1WOUA 5EVOA 3QMXA 2X99A 2LJRA 2O87A 2OKAA 1OVNA 1GWCA 5A4UA 3LG6A 3GX8A 3UARA 4LMWA 1SK1A 3C7MA 5INYA 4DVCA 5ID2B 1DUGA 2CZ2A 3GX0A 1ZYPA 1K0MA 1YKCA 2H01A 1GUKA 4EF0A 3LSZA 3WGEA 1QXHA 5IPGA 2VCTA 1W4VA 3P7XA 1HNBA 5B7CA 4AJ8A 3KTLA 4KGIA 1S3AA 3R2QA 2CVDA 3ZIVA 2H0IA 4EDYA 3DVXA 4OCEA 4N11A 2V6OA 1ERWA 3NZNA 5G5FA 3Q19A 3M9JA 4I5QA 3ERWA 2VLVA 3KP8A 3C1RA 5ECKB 1XVWA 5JWOB 3S9FA 1TRWA 1PN0A 1HD2A 4CW9A 4IVFA 5FHIA 4K2DA 3GTUA 3FZ9A 3LFLA 3KP9A 2H75A 2AUVA 4NHWA 3LYPA 1ERVA 3GH6A 5DALA 2DMLA 3E0UA 5F07A 3F4SA 3QFAC 4GF0A 2XPDA 1XG8A 2JZRA 4TW5A 1T7PB 1YEXA 1M99A 2L59A 4MMMA 4KSOA 4USSA 3ZTLA 3IR4A 4RI6A 4ZL9A 1BQ7A 3ZZXA 4RQRA 4O5UA 1TRVA 3TJJA 1JHBA 4DEJA 3RAZA 3W8JA 1GUHA 4NV2A 4MZBA 3MSZA 3MWHA 3TRXA 2FWFA 3GKKA 3MIXA 1HYUA 1Q4JA 4IBPA 1MDKA 4ZILA 2JZTA 5D9WA 2X8GA 1OAZA 3ZFLA 1XFLA 3IC8A 1EP7A 5DCGA 1TJDA 2GGTA 4PUAA 4TOPA 2QA1A 3TCOA 1B9XC 2C8UA 2LTKA 3CQFA 5CRWA 2R5GA 4YH2A 1EGRA 2GDRA 3CSIA 2OA7A 1R5AA 2HRAA 2AB6A 4K7OA 1WJKA 4NHZA 1PRXA 4KA0A 2O85A 2VM1A 4MH3A 4MPFA 5A4WA 4HQZA 4MCUA 2DSAA 5CAXA 10GSA 3FYGA 4MA9A 3BCKA 1K0NA 2EIRA 1F3AA 2YZHA 3VI7A 4PNGA 3F4TA 1O8XA 4NMUA 3MNGA 3UVHA 4F0BA 3SBCA 3WT1A 5ECIB 1R5PA 2XHFA 4MABA 2V2GA 2YZUA 2DJKA 3ZREA 1GSYA 4G0KA 3TRPA 5B8AA 5HR3A 5B6MA 3D22A 2K8SA 2CX4A 5ECRB 4CY8A 2IJYA 5D9TA 2VCWA 4KCAA 2CV4A 1DSBA 5GSSA 2GQKA 3GH9A 4AJ7A 3EYTA 4Q5RA 3VK9A 1M2AA 4WF4A 5AIVA 1YY7A 3KXOA 2LEGA 2WDUA 2DKHA 2FA4A 1O7UA 3UL3A 2J9HA 3GSSA 4YQMA 2OBIA 2MYGA 4IP1A 3H1NA 1GTAA 4ACSA 1TI1A 4TR4A 1RQMA 1O85A 4IW9A 2J23A 1GSDA 2HRNA 1EGOA 3HJOA 2PWJA 5DQYA 4GTUA 2R2JA 4G19A 4ZB8A 3ZRDA 1YDKA 2IPAA 1AXDA 2WB9A 4BPYA 5D96A 3D6IA 3BD2A 2IWTA 1B8XA 4E8EA 1NW2A 4N0VA 1EZKA 4NXIA 1CQGA 2RUFA 2C0GA 1S3DA 1F3BA 3TKPA 1FHEA 2FY6A 3GTUB 2MZCA 5ECPB 3DEXA 3CRUA 3ME8A 2CAIA 2FWEA 3DRNA 3CSJA 4OFMA 2F8FA 1G6YA 1AQVA 2H8LA 2L6DA 2P31A 1A0FA 2YNXA 5GSTA 3DVWA 3L78A 4TRXA 2A4HA 2H72A 5HQPA 5AIXA 3F9UA 2HFDA 2IL3A 3H79A 2GVPA 2F3MA 1YQ1A 5HR1A 2AYTA 4OD7A 1SK0A 3VPQA 4HSCX 2XBIA 3AY8A 4X43A 5DDLA 5GAPD 2IFQA 1GSQA 3C1SA 4G0LA 1ZL9A 2GSSA 4ULXA 1NHYA 3A2VA 1G7OA 1RK4A 1ILOA 3TJBA 2YCDA 2H0GA 2R0GA 2K9FA 4HS1A 4HJMA 5B6NA 2QGVA 2VCXA 5G31A 2KHPA 2VL2C 3NOFA 4MF7A 4Q5QA 2TRXA 4KSMA 2PMTA 2H76A 4IJ3A 2Z9SA 1X5DA 3WGDA 3D4MA 1TK5B 3D21A 3F3QA 2B1LA 3TKQA 5FT3A 1T4ZA 1Z5YE 1YF0A 1KTEA 3KEBA 3Q74A 3FY7A 3UBLA 4K6XA 4YAVA 4J2FA 3LWAA 1SKRB 4HU9A 2WFCA 4V2MA 1SJIA 5AN1A 2E2GA 3PPUA 2CVKA 3TUEA 2YWOA 2LRCA 4WETA 4V2LA 4ZXGA 1JLVA 3EU3A 1XOBA 5G2ZA 1M2BA 3IA1A 3DXBA 4XCSA 4O5QA 3FMWA 4Q5FA 5JCGA 2OE0A 3EU4A 1XOAA 3GKNA 2HYXA 2BMXA 4CY6A 4Z2RA 4EVMA 1Z3EA 5KN1A 1ACVA 1VF2A 2X4AA 3L0HA 4EXJA 1PD21 2MMAA 1BJXA 4V1Ag 4FH8A 1TK8B 4O7HA 2FUG2 1AUCA 2R3XA 3U6VA 2HI7A 2PUKC 4GSSA 1K0OA 2H1BA 3TKRA 3V1WA 4ZL7A 2D2ZA 1F9MA 3LW9A 2GQMA 1IYIA 3W8SA 3ZMLA 1PN9A 1TOFA 3DWVA 3H4KA 2GZZA 4TR1A 2NPBA 4AF2A 4K7IA 4IELA 1PMTA 1M7TA 3D0ZA 3GMFA 3MDKA 1SD8A 5CNWA 2WGRA 2BTOT 4BWQA 1Z7RA 2YV7A 3LEFA 5IMAA 3QCPA 2X8HA 2B5XA 1ZMAA 2VD0A 4ZB9A 3F4RA 1SKWB 2HLSA 5ECQB 3KMOA 2F9SA 2P5RA 1TDIA 4X1UA 1WPIA 1RW1A 2VD1A 5H5RA 4K8MA 2VO4A 3GYKA 2HSYA 3RHCA 2OE3A 5EY6A 3GIXA 1TRUA 1I5GA 1VGLA 2EIOA 2PVOC 4YKFA 3F3RA 3KD0A 1X9WB 4PTSA 4D73A 4EIQA 5J4UA 2GLRA 3GUSA 2IFQB 3L9SA 1GNWA 1HNAA 4ML6A 1SJZA 1M3JA 4GWRA 1THXA 2I1UA 5H5SA 3IRAA 4YQVA 2DJJA 4ILFA 1GLPA 1CQHA 1FW1A 4K5SA 2C3QA 2VL2A 3CBUA 4ML1A 3FKFA 3L9VA 2WCIA 2FGXA 2HRKA 5IO0A 3IHGA 2GT5A 3IHQA 2PGTA 2DIZA 4EDZA 17GSA 2FA8A 1K3LA 1QFNA 2H70A 4GXZA 4I6XA 2XBQA 2MBTA 4A5PA 1HQOA 1T00A 2H1DA 5CRGA 1AQWA 3ZVJA 2PPTA 1Z9HA 4PX1A 2NTOA 5HFIA 1SYXA 4HU7A 2E0QA 3EINA 5KOWA 2HSHA 4HZ2A 3DMLA 5C04A 2WRTA 2FNOA 5DJMA 4JRRA 3LQ7A 4OO4A 1X0RA 4KAEA 1U3IA 3SWLA 4F82A 1DE1A 2YJ7A 1M0UA 2H19A 3HCZA 4LLRA 1T1VA 3N5OA 4TR3A 2M72A 3I9V2 3KGKA 3F6DA 3APSA 5KN3A 1XBSA 4BVXA 5KOXA 1FOHA 6GSUA 5IMZA 4IKHA 3APQA 3O76A 1GSFA 3VURA 1SJ6A 1V9WA 4L5OA 1WMJA 1JZRA 4GRFA 3DYRA 1FB0A 3FRCA 4X4JA 4XS1A 2H6XA 4HZ4A 3TKSC 1MD3A 2KUCA 2N5AA 4POLA 3IBHA 2O7KA 2N5FA 1GTUA 1XWGA 3HKRA 5F05A 2YWNA 2P5QA 2GZYA 2O8VB 1QMVA 3VFIA 1ML6A 3IV4A 3IE3A 4WBJA 3QPMA 4DSSB 5AISA 2A2PA 1QUWA 4N30A 2B3SA 2H66A 1GTBA 2ZNMA 2E7PA 4JR6A 5LNKe 3FK8A 4BWSA 3HVVA 22GSA 1T3BA 3GA4A 3MYDA 3CYNA 5ECMB 1WE0A 4QL9A 4IN0A 1LBKA 2YOIA 5COHA 4JE1A 2MMZA 2AAWA 3TOTA 3GKXA 3N9JA 3GSTA 4TR1B 1LJRA 4F03A 5A4VA 3GHAA 3RPPA 1YF1A 1VF4A 3HVXA 1XZOA 2QKEA 1AAZA 4PGTA 3ZL5A 2FD3A 3TJGA 3F0IA 5DVBA 2DJ0A 1LU4A 2IMKA 1M3IA 2DJ2A 4BVYA 3FEUA 3H8QA 2L4QA 3IAS2 6GSVA 4MJCA 1PGTA 4XHMA 2M46A 4FIWA 4FYUA 1YJ6A 5ENUA 1C72A 3VI5A 1XW6A 1A24A 1KBNA 4L0UA 2C3TA 4E8HA 1ON4A 2CQ9A 3KZQA 5A5KA 5BMUA 4G2EA 1Z6NA 2L5OA 2MMNA 2K6VA 2RLIA 4TXOA 2NVLA 1V57A 4MH2A 4Z2UA 2DJ3A 4JZQA 2OJLA 5LCZA 3HHVA 1F37A 1ZYNA 1NHOA 4DSQA 2CA8A 2FWGA 1Z6MA 5CRDA 4MZCA 5CO3A 3UBKA 1TP9A 2FLSA 4ZB6A 3M1GA 1Z7PA 2A4VA 5IQYA 3DGQA 1N8JA 2LV3A 3TKSE 3EPTA 3CXGA 4HJ2A 4MPGA 4F0CA 2LUSA 2JACA 3U5RE 2HNLA 2R4VA 3I6AA 4FYBA 4XRAA 5D8IA 1K3OA 1TXXA 4ID0A 5IOXA 2RM6A 2NDOA 2LQQA 3H93A 3EVIA 3TJFA 5E59A 5CP1A 2DIYA 2EIQA 1BX9A 5D93A 1SD9A 4L8EA 2OBKA 4XIHA 3HZ4A 4P3YB 1BAYA 5DALB 3GV1A 1AW9A 4KH7A 1SENA 3R3EA 2ZCTA 3M0FA 3WT2A 6GSYA 2LJAA 1EP8A 5KN0A 2IIYA 1B9YC 3HD5A 1PX6A 1NM3A 4JBBA 3IAM2 2HZFA 1UA5A 1U6TA 2V32A 1OKDA 3ERFA 3ERGA 3HA9A 1K3YA 3RBTA 5ELAA 4ECIA 4PUFC 5IMDA 1FOVA 1PKZA 4BVXB 3OR5A 1GSEA 4OWYA 3A5IA 5CYYA 1V98A 1OC8A 2ON7A 3IK9A 3TKSA 3GNJA 1TI3A 3I43A 1O81A 3G7YA 2QSIA 4IP6A 1X9SB 1M2DA 1EV9A 4HUAA 4EKZA 4MP4A 1NSWA 2AHEA 4ZBDA 3UVTA 2AV4A 2H71A 3F8UA 2H6ZA 1XCCA 3KIJA 2OADA 2C0DA 5F8BA 3ZVJD 3ZLPA 2R0CA 2YWMA 1TU8A 3PGTA 1TU7A 3EC3A 1O73A 2YJHA 2H6YA 5GZZB 4FO5A 2C0EA 4GSTA 4RUVA 1VRSD 2VLTA 2JL4A 4MDCA 5KEJA 1X5CA 1U3AA 1Y25A 1XVQA 2RM5A 1I9DA 5JWQB 2GSTA 1FO5A 5HFKA 3E3EA 4HI7A 1X9MB 20GSA 5JWRB 4ZL8A 1AIUA 3QOUA 5DAKA 1GRXA 3HXSA 2B5YA 2L6CA 1X5EA 2PU9C 3DKSA 2ES7A 3QAVA 1A2MA 2LNTA 3QR6A 2AJQB 4N10A 5E4WA 2X49A 4H86A 2I4AA 3FZAA 3PH9A 1UN2A 2I81A 5DQSA 5G30A 4OCFA 4J56E 3RDWA 2R0PA 4JR4A 2PVQA 1OE7A 2TRCP 4XS4A 5KN2A 5G5EA 2VAFA 2V41A 11GSA 3HDCA 2PERA 2K18A 4WXTA 4XS6A 4DSRA 4KF9A 4CHSA 2DMMA 2LJKA 4HDEA 4TXOB 3A2WA 2JSZA 4EL1A 4MZWA 1GL8A 2LNSA 5D9VA 3DIEA 4HQSA 2GSQA 2TIRA 3TJKA 1EEJA 1TW9A 3P90A 4AJ6A 1SK2A 19GSA 1GLQA 2L4CA 4OFTA 4K0NA 4K9ZA 1HNCA 3CMIA 4G9HA 1GP1A 5EPFA 2PBJA 4KB3A 4IS0A 2IMDA 3CTFA 1SKSB 3FZ5A 3KMNA 1YEPA 4TXVA 4F9ZA 1G6WA 5DCHA 4Z2TA 2WJUA 4CDOA 3VLNA 3RPNA 3TOUA 4WR4A 1U87A 2VM2A 4BIKA 2YPMA 1R4WA 4WKWA 4WF5A 4GQFA 4KUNA 5HR2A 1H4OA 3GL3A 3EE2A 1PL1A 4I2UA 1PQNA 1YKAA 3A3TA 4Z7XA 1PA3A 2OE1A 1S3CA 1E2YA 1A8LA 1YZXA 1O6JA 1PFOA 4I8BA 8GSSA 4GQCA 4Q5NA 1ERUA 2V1MA 1VF3A 4KX4A 4TVEA 4KNDA 3IC4A 1R26A 3EURA 3L4NA 3Q6OA 1ERTA 1FAAA 1M9AA 1QK8A 3ISOA 5AGYA 1G7EA 5ELGA 3E9JB 1MTCA 2JADA 1MEKA 4RQXA 1URMA 2X64A 4PURA 5HR0A 4ECJA 5J5NA 3D5JA 3J7Yk 1G0TA 2KP2A 1V2AA 3C71A 5JCWA 1F2EA 1S3RA 1V58A 2VL9A 2VLUA 1BYEA 2LRNA 3ZITA 1QQ2A 3APOA 3EWLA 1PKWA 2FHEA 3PINA 2ON5A 1T8EB 2FCHA 2RIIA 2HRFA 1M9BA 5FWGA 5BRTA 1ST9A 2O89A 1UC7A 5JCUA 3W6GA 1MD4A 3FR3A 3BCIA 3FW2A 3CTGA 1ZOFA 4OO5A 3VWVA 2HT9A 2I9HA 3NIVA
chains in the Genus database with same CATH topology
5C00A 3TB2A 4BL7A 4EC0A 3BBYA 4ZBBA 3UMAA 3F6FA 2LRTA 1SL1B 3QAWA 3C8EA 4I97A 4AGSA 5DAKB 2ALBA 4K7NA 3TDGA 2DLXA 5IM9A 4MF6A 4L5LA 3P2AA 1GULA 2GS3A 1FVJA 3GN3A 3JCML 1GSSA 1N2AA 3UAPA 3C73A 4LL1B 4MK3A 2YWIA 2XC2A 2GQLA 2NBSA 5H5QA 3US3A 2LS5A 2L5LA 2M80A 4LL4B 1E6BA 1QGVA 4XS4B 5ECSA 3KH7A 1K0AA 14GSA 1BEDA 1TK0B 2RUEA 3VWXA 2WULA 5HFGA 1ZCPA 2C80A 3EMPA 5ECLB 1ZGNA 3KM6A 2CVBA 2H30A 2XPEA 4PQ1A 3IXRA 4ZIJA 3KTBA 5LD0A 1PL2A 4TR0A 1WRYA 2HZEA 1XWBA 5G1KA 4MJAA 5CRHA 2ZUPA 5F0GA 3RHBA 5IPHA 2V6KA 4MNNA 4IQ1A 5DJLA 3ZYWA 2REMA 1EWXA 4O32A 3F63A 2IN3A 1J08A 2GSRA 2MBSA 1OKTA 2HSMA 3IPZA 4MLYA 4POKA 4NAXA 2G2QA 1A2LA 4J57E 1FG4A 3HJPA 2C0FA 3P8WA 4ZBAA 5J9CA 4QQ7A 4NWYA 1TKDB 6GSSA 1AQXA 1XXUA 3HJMA 1XPVA 4V1Ap 4OFNA 4POBA 1WWJA 4V2NA 4YAPA 2LKUA 3TGZA 4G0IA 3IK7A 4G10A 3QDNA 3LXTA 3Q18A 1GTIA 2F8AA 3L9UA 4NV5A 1KEBA 3FZ4A 2BJXA 4EO3A 3CSHA 4IGJA 1GNEA 3G7IA 1XIYA 1OC9A 2HXKA 1XW9A 2H0HA 2KOKA 4LA1A 4IJIA 2CZ3A 4O5RA 5IOWA 1GH2A 2H74A 4K0GA 4FYCA 1VF1A 1EOGA 4D73B 1A8YA 3KJYA 1K0BA 1SL2B 3MAKA 1EEMA 16GSA 1K0CA 1GUMA 3FR9A 5IMCA 4PNFA 4FQUA 4TN8A 3LGCA 4L0WA 3D4TA 7GSSA 1F6MC 1MDIA 2H1GA 1TRSA 2FWHA 1FB6A 3IDVA 2DBCA 1B4QA 2VCZA 3PR8A 13GSA 1UVZA 2X8CA 2EC4A 2IMFA 1PX7A 3FR6A 5ECHB 1SL0B 5J3RA 1A0RP 2B5EA 4KE3A 1XWCA 3HYPA 1B4PA 3ED3A 4KDUA 3ZMKA 2K8VA 5ABRA 1B48A 3EMXA 2UZ8A 4BL7B 2F51A 3VWWA 4MJBA 4F2IA 4YQUA 6GSWA 1R7HA 4JEDA 2C4JA 2HE3A 3ME7A 2YANA 1K0DA 1WIKA 2WZ9A 1A23A 1V40A 2LSTA 1OC3A 3M3MA 4EUYA 4PQHA 3J7Yb 2R6KA 5B8BA 3HY2A 3UOMA 2LQOA 4GLTA 1XWAA 3G9BA 5F06A 1BG5A 3LORA 2GTUA 12GSA 3M9KA 5ID2A 1XW5A 1ABAA 5J41A 4K1FA 1A2JA 4WR5A 4PXOA 5ECOB 1ZYQB 1KNGA 5DBQA 1H75A 2H1AA 1U88A 4ECBA 5IMFA 1MDJA 3ZFBA 2KLXA 3FHKA 5IIZA 2VCQA 2HZEB 2JU5A 4X0XA 2VUPA 3A2XA 1DE2A 1Y6EA 2IMEA 3QAGA 4BA7A 4YKGA 5D73A 3LJRA 1JLWA 2QA2A 3LXZA 2DC5A 1O8WA 3GURA 4KDXA 1JFUA 4O92A 4OMVA 1FVKA 3GKMA 4HOJA 1OE8A 3WGXA 1T4YA 6GSXA 4K2XA 4ECCA 4HEA2 4K5RA 3VPTA 1OYJA 2GZPA 4NPBA 3BOAA 3UJ1A 3GRXA 3O3TA 1Q98A 4BVYB 3QD9A 1XWKA 1USBA 2YP6A 4EE0A 3GFKA 2CX3A 2DJ1A 1J0FA 5G1LA 1AC1A 2GT6A 2YN1A 3WD6A 1EV4A 2VIMA 4ICYA 2I3YA 2E2MA 3G7JA 3TRQA 3UIWA 4TKYA 3M8NA 1JZOA 2C3NA 2B6MA 5L71A 3DD3A 1OC9B 2QC7A 2H73A 3KH9A 1THOA 3GL5A 5D9XA 1SU9A 1J9BA 2WS2A 2PN8A 2VCVA 18GSA 2A2RA 1JZWA 3QFBC 2L57A 4DSSA 2A2SA 1SYRA 2OACA 5ECNB 4N0ZA 3WYWA 1ZZYA 2N5BA 1TTZA 4IQAA 3I69A 1JZDA 2B1KA 2KP1A 4GCIA 5GAND 9GSSA 5J9BA 2IMIA 4RI7A 4WBRD 2B7KA 4XTSA 1W89A 3HVSA 4POMA 3ZIJA 1PSQA 4XRDA 1EOHA 4QL7A 4KW6A 2YV9A 4LMVA 3O6TA 4ISDA 4WEYA 5CREA 3LYKA 5EL8A 2G0FA 4PQIA 3UEMA 3A5WA 2VOCA 5IMVA 2CAQA 3KCMA 4MF5A 3CRTA 4IHUA 3HZ8A 2JZSA 3VWUA 1DBYA 6GSTA 1IYHA 2R37A 2DKIA 1WP0A 2C1YA 1ZYEA 4KDYA 1GSUA 2B7JA 4EIPA 2JSYA 3IOSA 3BJ5A 5IO2A 3K8NA 4MJEA 4I2TA 2CT6A 2VL3A 2P0GA 4GSNA 4JU5A 2MMOA 4KCEA 1WOUA 5EVOA 3QMXA 2X99A 2LJRA 2O87A 2OKAA 1OVNA 1GWCA 5A4UA 3LG6A 3GX8A 3UARA 4LMWA 1SK1A 3C7MA 5INYA 4DVCA 5ID2B 1DUGA 2CZ2A 3GX0A 1ZYPA 1K0MA 1YKCA 2H01A 1GUKA 4EF0A 3LSZA 3WGEA 1QXHA 5IPGA 2VCTA 1W4VA 3P7XA 1HNBA 5B7CA 4AJ8A 3KTLA 4KGIA 1S3AA 3R2QA 2CVDA 3ZIVA 2H0IA 4EDYA 3DVXA 4OCEA 4N11A 2V6OA 1ERWA 3NZNA 5G5FA 3Q19A 3M9JA 4I5QA 3ERWA 2VLVA 3KP8A 3C1RA 5ECKB 1XVWA 5JWOB 3S9FA 1TRWA 1PN0A 1HD2A 4CW9A 4IVFA 5FHIA 4K2DA 3GTUA 3FZ9A 3LFLA 3KP9A 2H75A 2AUVA 4NHWA 3LYPA 1ERVA 3GH6A 5DALA 2DMLA 3E0UA 5F07A 3F4SA 3QFAC 4GF0A 2XPDA 2JZRA 4TW5A 1T7PB 1YEXA 1M99A 2L59A 4MMMA 4KSOA 4USSA 3ZTLA 3IR4A 4RI6A 4ZL9A 1BQ7A 3ZZXA 4RQRA 4O5UA 1TRVA 3TJJA 1JHBA 4DEJA 3RAZA 3W8JA 1GUHA 4NV2A 4MZBA 3MSZA 3MWHA 3TRXA 2FWFA 3GKKA 3MIXA 1HYUA 1Q4JA 4IBPA 1MDKA 4ZILA 2JZTA 5D9WA 2X8GA 1OAZA 3ZFLA 1XFLA 3IC8A 1EP7A 5DCGA 1TJDA 2GGTA 4PUAA 4TOPA 2QA1A 3TCOA 1B9XC 2C8UA 2LTKA 5CRWA 2R5GA 4YH2A 1EGRA 2GDRA 3CSIA 2OA7A 1R5AA 2HRAA 2AB6A 4K7OA 1WJKA 4NHZA 1PRXA 4KA0A 2O85A 2VM1A 4MH3A 4MPFA 5A4WA 4HQZA 4MCUA 2DSAA 5CAXA 10GSA 3FYGA 4MA9A 3BCKA 1K0NA 2EIRA 1F3AA 2YZHA 3VI7A 4PNGA 3F4TA 1O8XA 4NMUA 3MNGA 3UVHA 4F0BA 3SBCA 3WT1A 5ECIB 1R5PA 2XHFA 4MABA 2V2GA 2YZUA 2DJKA 3ZREA 1GSYA 4G0KA 3TRPA 5B8AA 5HR3A 5B6MA 3D22A 2K8SA 2CX4A 5ECRB 4CY8A 2IJYA 5D9TA 2VCWA 4KCAA 2CV4A 1DSBA 5GSSA 2GQKA 3GH9A 4AJ7A 3EYTA 4Q5RA 3VK9A 1M2AA 4WF4A 5AIVA 1YY7A 3KXOA 2LEGA 2WDUA 2DKHA 2FA4A 1O7UA 3UL3A 2J9HA 3GSSA 4YQMA 2OBIA 2MYGA 4IP1A 3H1NA 1GTAA 4ACSA 1TI1A 4TR4A 1RQMA 1O85A 4IW9A 2J23A 1GSDA 2HRNA 1EGOA 3HJOA 2PWJA 5DQYA 4GTUA 2R2JA 4G19A 4ZB8A 3ZRDA 1YDKA 2IPAA 1AXDA 2WB9A 4BPYA 5D96A 3D6IA 3BD2A 2IWTA 1B8XA 4E8EA 1NW2A 4N0VA 1EZKA 4NXIA 1CQGA 2RUFA 2C0GA 1S3DA 1F3BA 3TKPA 1FHEA 2FY6A 3GTUB 2MZCA 5ECPB 3DEXA 3CRUA 3ME8A 2CAIA 2FWEA 3DRNA 3CSJA 4OFMA 2F8FA 1G6YA 1AQVA 2H8LA 2L6DA 2P31A 1A0FA 2YNXA 5GSTA 3DVWA 3L78A 4TRXA 2A4HA 2H72A 5HQPA 5AIXA 3F9UA 2HFDA 2IL3A 3H79A 2GVPA 2F3MA 1YQ1A 5HR1A 2AYTA 4OD7A 1SK0A 3VPQA 2XBIA 3AY8A 4X43A 5DDLA 5GAPD 2IFQA 1GSQA 3C1SA 4G0LA 1ZL9A 2GSSA 4ULXA 1NHYA 3A2VA 1G7OA 1RK4A 1ILOA 3TJBA 2YCDA 2H0GA 2R0GA 2K9FA 4HS1A 4HJMA 5B6NA 2QGVA 2VCXA 5G31A 2KHPA 2VL2C 3NOFA 4MF7A 4Q5QA 2TRXA 4KSMA 2PMTA 2H76A 4IJ3A 2Z9SA 1X5DA 3WGDA 3D4MA 1TK5B 3D21A 3F3QA 2B1LA 3TKQA 5FT3A 1T4ZA 1Z5YE 1YF0A 1KTEA 3KEBA 3Q74A 3FY7A 3UBLA 4K6XA 4YAVA 4J2FA 3LWAA 1SKRB 4HU9A 2WFCA 4V2MA 1SJIA 5AN1A 2E2GA 3PPUA 2CVKA 3TUEA 2YWOA 2LRCA 4WETA 4V2LA 4ZXGA 1JLVA 3EU3A 1XOBA 5G2ZA 1M2BA 3IA1A 3DXBA 4XCSA 4O5QA 3FMWA 4Q5FA 5JCGA 2OE0A 3EU4A 1XOAA 3GKNA 2HYXA 2BMXA 4CY6A 4Z2RA 4EVMA 1Z3EA 5KN1A 1ACVA 1VF2A 2X4AA 3L0HA 4EXJA 1PD21 2MMAA 1BJXA 4V1Ag 4FH8A 1TK8B 4O7HA 2FUG2 1AUCA 2R3XA 3U6VA 2HI7A 2PUKC 4GSSA 1K0OA 2H1BA 3TKRA 3V1WA 4ZL7A 2D2ZA 1F9MA 3LW9A 2GQMA 1IYIA 3W8SA 3ZMLA 1PN9A 1TOFA 3DWVA 3H4KA 2GZZA 4TR1A 2NPBA 4AF2A 4K7IA 4IELA 1PMTA 1M7TA 3D0ZA 3GMFA 3MDKA 1SD8A 5CNWA 2WGRA 2BTOT 4BWQA 1Z7RA 2YV7A 3LEFA 5IMAA 3QCPA 2X8HA 2B5XA 1ZMAA 2VD0A 4ZB9A 3F4RA 1SKWB 2HLSA 5ECQB 3KMOA 2F9SA 2P5RA 1TDIA 4X1UA 1WPIA 1RW1A 2VD1A 5H5RA 4K8MA 2VO4A 3GYKA 2HSYA 3RHCA 2OE3A 5EY6A 3GIXA 1TRUA 1I5GA 1VGLA 2EIOA 2PVOC 4YKFA 3F3RA 3KD0A 1X9WB 4PTSA 4D73A 4EIQA 5J4UA 2GLRA 3GUSA 2IFQB 3L9SA 1GNWA 1HNAA 4ML6A 1SJZA 4GWRA 1THXA 2I1UA 5H5SA 3IRAA 4YQVA 2DJJA 4ILFA 1GLPA 1CQHA 1FW1A 4K5SA 2C3QA 2VL2A 3CBUA 4ML1A 3FKFA 3L9VA 2WCIA 2FGXA 2HRKA 5IO0A 3IHGA 2GT5A 3IHQA 2PGTA 2DIZA 4EDZA 17GSA 2FA8A 1K3LA 1QFNA 2H70A 4GXZA 4I6XA 2XBQA 2MBTA 4A5PA 1HQOA 1T00A 2H1DA 5CRGA 1AQWA 3ZVJA 2PPTA 1Z9HA 4PX1A 2NTOA 5HFIA 1SYXA 4HU7A 2E0QA 3EINA 5KOWA 2HSHA 4HZ2A 3DMLA 5C04A 2WRTA 2FNOA 5DJMA 4JRRA 3LQ7A 4OO4A 1X0RA 4KAEA 1U3IA 3SWLA 4F82A 1DE1A 2YJ7A 1M0UA 2H19A 3HCZA 4LLRA 1T1VA 3N5OA 4TR3A 2M72A 3I9V2 3KGKA 3F6DA 3APSA 5KN3A 1XBSA 4BVXA 5KOXA 1FOHA 6GSUA 5IMZA 4IKHA 3APQA 3O76A 1GSFA 3VURA 1SJ6A 1V9WA 4L5OA 1WMJA 1JZRA 4GRFA 3DYRA 1FB0A 3FRCA 4X4JA 4XS1A 2H6XA 4HZ4A 3TKSC 1MD3A 2KUCA 2N5AA 4POLA 3IBHA 2O7KA 2N5FA 1GTUA 1XWGA 3HKRA 5F05A 2YWNA 2P5QA 2GZYA 2O8VB 1QMVA 3VFIA 1ML6A 3IV4A 3IE3A 4WBJA 3QPMA 4DSSB 5AISA 2A2PA 1QUWA 4N30A 2B3SA 2H66A 1GTBA 2ZNMA 2E7PA 4JR6A 5LNKe 3FK8A 4BWSA 3HVVA 22GSA 1T3BA 3GA4A 3MYDA 3CYNA 5ECMB 1WE0A 4QL9A 4IN0A 1LBKA 2YOIA 5COHA 4JE1A 2MMZA 2AAWA 3TOTA 3GKXA 3N9JA 3GSTA 4TR1B 1LJRA 4F03A 5A4VA 3GHAA 3RPPA 1YF1A 1VF4A 3HVXA 1XZOA 2QKEA 1AAZA 4PGTA 3ZL5A 2FD3A 3TJGA 3F0IA 5DVBA 2DJ0A 1LU4A 2IMKA 2DJ2A 4BVYA 3FEUA 3H8QA 2L4QA 3IAS2 6GSVA 4MJCA 1PGTA 4XHMA 2M46A 4FIWA 4FYUA 1YJ6A 5ENUA 1C72A 3VI5A 1XW6A 1A24A 1KBNA 4L0UA 2C3TA 4E8HA 1ON4A 2CQ9A 3KZQA 5A5KA 5BMUA 4G2EA 1Z6NA 2L5OA 2MMNA 2K6VA 2RLIA 4TXOA 2NVLA 1V57A 4MH2A 4Z2UA 2DJ3A 4JZQA 2OJLA 5LCZA 3HHVA 1F37A 1ZYNA 1NHOA 4DSQA 2CA8A 2FWGA 1Z6MA 5CRDA 4MZCA 5CO3A 3UBKA 1TP9A 2FLSA 4ZB6A 3M1GA 1Z7PA 2A4VA 5IQYA 3DGQA 1N8JA 2LV3A 3TKSE 3EPTA 3CXGA 4HJ2A 4MPGA 4F0CA 2LUSA 2JACA 3U5RE 2HNLA 2R4VA 3I6AA 4FYBA 4XRAA 5D8IA 1K3OA 1TXXA 4ID0A 5IOXA 2RM6A 2NDOA 2LQQA 3H93A 3EVIA 3TJFA 5E59A 5CP1A 2DIYA 2EIQA 1BX9A 5D93A 1SD9A 4L8EA 2OBKA 4XIHA 3HZ4A 4P3YB 1BAYA 5DALB 3GV1A 1AW9A 4KH7A 1SENA 3R3EA 2ZCTA 3M0FA 3WT2A 6GSYA 2LJAA 1EP8A 5KN0A 2IIYA 1B9YC 3HD5A 1PX6A 1NM3A 4JBBA 3IAM2 2HZFA 1UA5A 1U6TA 2V32A 1OKDA 3ERFA 3ERGA 3HA9A 1K3YA 3RBTA 5ELAA 4ECIA 4PUFC 5IMDA 1FOVA 1PKZA 4BVXB 3OR5A 1GSEA 4OWYA 3A5IA 5CYYA 1V98A 1OC8A 2ON7A 3IK9A 3TKSA 3GNJA 1TI3A 3I43A 1O81A 3G7YA 2QSIA 4IP6A 1X9SB 1M2DA 1EV9A 4HUAA 4EKZA 4MP4A 1NSWA 2AHEA 4ZBDA 3UVTA 2AV4A 2H71A 3F8UA 2H6ZA 1XCCA 3KIJA 2OADA 2C0DA 5F8BA 3ZVJD 3ZLPA 2R0CA 2YWMA 1TU8A 3PGTA 1TU7A 3EC3A 1O73A 2YJHA 2H6YA 5GZZB 4FO5A 2C0EA 4GSTA 4RUVA 1VRSD 2VLTA 2JL4A 4MDCA 5KEJA 1X5CA 1U3AA 1Y25A 1XVQA 2RM5A 1I9DA 5JWQB 2GSTA 1FO5A 5HFKA 3E3EA 4HI7A 1X9MB 20GSA 5JWRB 4ZL8A 1AIUA 3QOUA 5DAKA 1GRXA 3HXSA 2B5YA 2L6CA 1X5EA 2PU9C 3DKSA 2ES7A 3QAVA 1A2MA 2LNTA 3QR6A 2AJQB 4N10A 5E4WA 2X49A 4H86A 2I4AA 3FZAA 3PH9A 1UN2A 2I81A 5DQSA 5G30A 4OCFA 4J56E 3RDWA 2R0PA 4JR4A 2PVQA 1OE7A 2TRCP 4XS4A 5KN2A 5G5EA 2VAFA 2V41A 11GSA 3HDCA 2PERA 2K18A 4WXTA 4XS6A 4DSRA 4KF9A 4CHSA 2DMMA 2LJKA 4HDEA 4TXOB 3A2WA 2JSZA 4EL1A 4MZWA 1GL8A 2LNSA 5D9VA 3DIEA 4HQSA 2GSQA 2TIRA 3TJKA 1EEJA 1TW9A 3P90A 4AJ6A 1SK2A 19GSA 1GLQA 2L4CA 4OFTA 4K0NA 4K9ZA 1HNCA 3CMIA 4G9HA 1GP1A 5EPFA 2PBJA 4KB3A 4IS0A 2IMDA 3CTFA 1SKSB 3FZ5A 3KMNA 1YEPA 4TXVA 4F9ZA 1G6WA 5DCHA 4Z2TA 2WJUA 4CDOA 3VLNA 3RPNA 3TOUA 4WR4A 1U87A 2VM2A 2YPMA 1R4WA 4WKWA 4WF5A 4GQFA 4KUNA 5HR2A 1H4OA 3GL3A 3EE2A 1PL1A 4I2UA 1PQNA 1YKAA 3A3TA 4Z7XA 1PA3A 2OE1A 1S3CA 1E2YA 1A8LA 1YZXA 1O6JA 4I8BA 8GSSA 4GQCA 4Q5NA 1ERUA 2V1MA 1VF3A 4KX4A 4TVEA 4KNDA 3IC4A 1R26A 3EURA 3L4NA 3Q6OA 1ERTA 1FAAA 1M9AA 1QK8A 3ISOA 5AGYA 1G7EA 5ELGA 3E9JB 1MTCA 2JADA 1MEKA 4RQXA 1URMA 2X64A 4PURA 5HR0A 4ECJA 5J5NA 3D5JA 3J7Yk 1G0TA 2KP2A 1V2AA 3C71A 5JCWA 1F2EA 1V58A 2VL9A 2VLUA 1BYEA 2LRNA 3ZITA 1QQ2A 3APOA 3EWLA 1PKWA 2FHEA 3PINA 2ON5A 1T8EB 2FCHA 2RIIA 2HRFA 1M9BA 5FWGA 5BRTA 1ST9A 2O89A 1UC7A 5JCUA 3W6GA 1MD4A 3FR3A 3BCIA 3FW2A 3CTGA 1ZOFA 4OO5A 3VWVA 2HT9A 2I9HA 3NIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C00 A;  3TB2 A;  4BL7 A;  4EC0 A;  3BBY A;  4ZBB A;  3UMA A;  3F6F A;  2LRT A;  1SL1 B;  3QAW A;  3C8E A;  4I97 A;  4AGS A;  5DAK B;  2ALB A;  4K7N A;  3TDG A;  2DLX A;  5IM9 A;  4MF6 A;  4L5L A;  3P2A A;  1GUL A;  2GS3 A;  1FVJ A;  3GN3 A;  3JCM L;  1GSS A;  1N2A A;  3UAP A;  3C73 A;  4LL1 B;  4MK3 A;  2YWI A;  2XC2 A;  2GQL A;  2NBS A;  5H5Q A;  3US3 A;  2LS5 A;  2L5L A;  2M80 A;  4LL4 B;  1E6B A;  1QGV A;  4XS4 B;  5ECS A;  3KH7 A;  1K0A A;  14GS A;  1BED A;  1TK0 B;  2RUE A;  3VWX A;  2WUL A;  5HFG A;  1ZCP A;  2C80 A;  3EMP A;  5ECL B;  1ZGN A;  3KM6 A;  2CVB A;  2H30 A;  2XPE A;  4PQ1 A;  3IXR A;  4ZIJ A;  3KTB A;  5LD0 A;  1PL2 A;  4TR0 A;  1WRY A;  2HZE A;  1XWB A;  5G1K A;  4MJA A;  5CRH A;  2ZUP A;  5F0G A;  3RHB A;  5IPH A;  2V6K A;  4IQ1 A;  5DJL A;  3ZYW A;  2REM A;  1EWX A;  4O32 A;  3F63 A;  2IN3 A;  1J08 A;  2GSR A;  2MBS A;  1OKT A;  3IPZ A;  4MLY A;  4POK A;  4NAX A;  2G2Q A;  1A2L A;  4J57 E;  1FG4 A;  3HJP A;  2C0F A;  3P8W A;  4ZBA A;  5J9C A;  4QQ7 A;  4NWY A;  1TKD B;  6GSS A;  1AQX A;  1XXU A;  3HJM A;  1XPV A;  4V1A p;  4OFN A;  4POB A;  1WWJ A;  4V2N A;  4YAP A;  2LKU A;  3TGZ A;  3IK7 A;  4G10 A;  3QDN A;  3LXT A;  3Q18 A;  1GTI A;  2F8A A;  3L9U A;  4NV5 A;  1KEB A;  3FZ4 A;  2BJX A;  4EO3 A;  3CSH A;  4IGJ A;  1GNE A;  3G7I A;  1XIY A;  1OC9 A;  2HXK A;  1XW9 A;  2H0H A;  2KOK A;  4LA1 A;  4IJI A;  2CZ3 A;  4O5R A;  5IOW A;  1GH2 A;  2H74 A;  4K0G A;  4FYC A;  1VF1 A;  1EOG A;  4D73 B;  1A8Y A;  3KJY A;  1K0B A;  1SL2 B;  3MAK A;  1EEM A;  16GS A;  1K0C A;  1GUM A;  3FR9 A;  5IMC A;  4PNF A;  4TN8 A;  3LGC A;  4L0W A;  3D4T A;  7GSS A;  1F6M C;  1MDI A;  2H1G A;  1TRS A;  2FWH A;  1FB6 A;  3IDV A;  2DBC A;  1B4Q A;  2VCZ A;  3PR8 A;  13GS A;  1UVZ A;  2X8C A;  2EC4 A;  2IMF A;  1PX7 A;  3FR6 A;  5ECH B;  1SL0 B;  5J3R A;  1A0R P;  2B5E A;  4KE3 A;  1XWC A;  3HYP A;  1B4P A;  3ED3 A;  4KDU A;  3ZMK A;  2K8V A;  5ABR A;  1B48 A;  3EMX A;  2F51 A;  3VWW A;  4MJB A;  4F2I A;  4YQU A;  6GSW A;  1R7H A;  4JED A;  2C4J A;  2HE3 A;  3ME7 A;  2YAN A;  1K0D A;  1WIK A;  2WZ9 A;  1A23 A;  1V40 A;  2LST A;  1OC3 A;  3M3M A;  4EUY A;  4PQH A;  3J7Y b;  2R6K A;  5B8B A;  3HY2 A;  3UOM A;  2LQO A;  4GLT A;  1XWA A;  3G9B A;  5F06 A;  1BG5 A;  3LOR A;  2GTU A;  12GS A;  3M9K A;  5ID2 A;  1XW5 A;  1ABA A;  5J41 A;  4K1F A;  1A2J A;  4WR5 A;  4PXO A;  5ECO B;  1ZYQ B;  1KNG A;  5DBQ A;  1H75 A;  2H1A A;  1U88 A;  4ECB A;  5IMF A;  1MDJ A;  3ZFB A;  2KLX A;  3FHK A;  5IIZ A;  2VCQ A;  2HZE B;  2JU5 A;  4X0X A;  2VUP A;  3A2X A;  1DE2 A;  1Y6E A;  2IME A;  3QAG A;  4BA7 A;  5D73 A;  3LJR A;  1JLW A;  3LXZ A;  2DC5 A;  1O8W A;  3GUR A;  4KDX A;  1JFU A;  4O92 A;  4OMV A;  1FVK A;  3GKM A;  4HOJ A;  1OE8 A;  3WGX A;  1T4Y A;  6GSX A;  4ECC A;  4HEA 2;  3VPT A;  1OYJ A;  2GZP A;  4NPB A;  3BOA A;  3UJ1 A;  3GRX A;  3O3T A;  1Q98 A;  3QD9 A;  1XWK A;  1USB A;  2YP6 A;  4EE0 A;  3GFK A;  2CX3 A;  2DJ1 A;  1J0F A;  5G1L A;  1AC1 A;  2GT6 A;  2YN1 A;  3WD6 A;  1EV4 A;  2VIM A;  2I3Y A;  2E2M A;  3G7J A;  3TRQ A;  3UIW A;  4TKY A;  3M8N A;  1JZO A;  2C3N A;  2B6M A;  5L71 A;  3DD3 A;  1OC9 B;  2QC7 A;  2H73 A;  3KH9 A;  1THO A;  3GL5 A;  5D9X A;  1SU9 A;  1J9B A;  2WS2 A;  2PN8 A;  2VCV A;  18GS A;  2A2R A;  1JZW A;  3QFB C;  2L57 A;  4DSS A;  2A2S A;  1SYR A;  2OAC A;  5ECN B;  4N0Z A;  3WYW A;  1ZZY A;  2N5B A;  1TTZ A;  4IQA A;  3I69 A;  1JZD A;  2B1K A;  2KP1 A;  4GCI A;  5GAN D;  9GSS A;  5J9B A;  2IMI A;  4RI7 A;  4WBR D;  2B7K A;  4XTS A;  1W89 A;  3HVS A;  4POM A;  3ZIJ A;  1PSQ A;  4XRD A;  1EOH A;  4QL7 A;  4KW6 A;  2YV9 A;  4LMV A;  3O6T A;  4ISD A;  4WEY A;  5CRE A;  3LYK A;  5EL8 A;  2G0F A;  4PQI A;  3UEM A;  3A5W A;  2VOC A;  5IMV A;  2CAQ A;  3KCM A;  4MF5 A;  3CRT A;  4IHU A;  3HZ8 A;  2JZS A;  3VWU A;  1DBY A;  6GST A;  1IYH A;  2R37 A;  1WP0 A;  2C1Y A;  1ZYE A;  4KDY A;  1GSU A;  2B7J A;  2JSY A;  3IOS A;  3BJ5 A;  5IO2 A;  3K8N A;  4MJE A;  4I2T A;  2CT6 A;  2VL3 A;  2P0G A;  4GSN A;  4JU5 A;  2MMO A;  4KCE A;  1WOU A;  5EVO A;  3QMX A;  2X99 A;  2LJR A;  2O87 A;  2OKA A;  1OVN A;  1GWC A;  5A4U A;  3LG6 A;  3GX8 A;  3UAR A;  4LMW A;  1SK1 A;  3C7M A;  5INY A;  4DVC A;  5ID2 B;  1DUG A;  2CZ2 A;  3GX0 A;  1K0M A;  1YKC A;  2H01 A;  1GUK A;  4EF0 A;  3LSZ A;  3WGE A;  1QXH A;  5IPG A;  2VCT A;  1W4V A;  3P7X A;  1HNB A;  5B7C A;  4AJ8 A;  3KTL A;  4KGI A;  1S3A A;  3R2Q A;  2CVD A;  3ZIV A;  2H0I A;  4EDY A;  3DVX A;  4OCE A;  4N11 A;  2V6O A;  1ERW A;  3NZN A;  5G5F A;  3Q19 A;  3M9J A;  4I5Q A;  3ERW A;  2VLV A;  3KP8 A;  3C1R A;  5ECK B;  1XVW A;  5JWO B;  3S9F A;  1TRW A;  1HD2 A;  4CW9 A;  4IVF A;  5FHI A;  4K2D A;  3GTU A;  3FZ9 A;  3LFL A;  3KP9 A;  2H75 A;  2AUV A;  4NHW A;  3LYP A;  1ERV A;  3GH6 A;  5DAL A;  2DML A;  3E0U A;  5F07 A;  3F4S A;  3QFA C;  4GF0 A;  2XPD A;  2JZR A;  4TW5 A;  1T7P B;  1YEX A;  1M99 A;  2L59 A;  4MMM A;  4KSO A;  3ZTL A;  3IR4 A;  4RI6 A;  4ZL9 A;  1BQ7 A;  3ZZX A;  4RQR A;  1TRV A;  3TJJ A;  1JHB A;  4DEJ A;  3RAZ A;  3W8J A;  1GUH A;  4NV2 A;  4MZB A;  3MSZ A;  3MWH A;  3TRX A;  2FWF A;  3GKK A;  1HYU A;  1Q4J A;  4IBP A;  1MDK A;  4ZIL A;  2JZT A;  5D9W A;  2X8G A;  1OAZ A;  3ZFL A;  1XFL A;  1EP7 A;  5DCG A;  1TJD A;  2GGT A;  4PUA A;  4TOP A;  3TCO A;  1B9X C;  2C8U A;  2LTK A;  5CRW A;  2R5G A;  4YH2 A;  1EGR A;  2GDR A;  3CSI A;  2OA7 A;  1R5A A;  2AB6 A;  4K7O A;  1WJK A;  4NHZ A;  1PRX A;  4KA0 A;  2O85 A;  2VM1 A;  4MH3 A;  4MPF A;  5A4W A;  4HQZ A;  4MCU A;  2DSA A;  5CAX A;  10GS A;  3FYG A;  4MA9 A;  3BCK A;  1K0N A;  2EIR A;  1F3A A;  2YZH A;  3VI7 A;  4PNG A;  3F4T A;  1O8X A;  4NMU A;  3MNG A;  3UVH A;  4F0B A;  3SBC A;  3WT1 A;  5ECI B;  1R5P A;  2XHF A;  4MAB A;  2V2G A;  2YZU A;  2DJK A;  3ZRE A;  1GSY A;  3TRP A;  5B8A A;  5HR3 A;  5B6M A;  3D22 A;  2K8S A;  2CX4 A;  5ECR B;  2IJY A;  5D9T A;  2VCW A;  4KCA A;  2CV4 A;  1DSB A;  5GSS A;  2GQK A;  3GH9 A;  4AJ7 A;  3EYT A;  4Q5R A;  3VK9 A;  1M2A A;  4WF4 A;  5AIV A;  1YY7 A;  3KXO A;  2LEG A;  2WDU A;  2FA4 A;  1O7U A;  3UL3 A;  2J9H A;  3GSS A;  4YQM A;  2OBI A;  2MYG A;  4IP1 A;  3H1N A;  1GTA A;  4ACS A;  1TI1 A;  4TR4 A;  1RQM A;  1O85 A;  4IW9 A;  2J23 A;  1GSD A;  2HRN A;  1EGO A;  3HJO A;  2PWJ A;  5DQY A;  4GTU A;  2R2J A;  4G19 A;  4ZB8 A;  3ZRD A;  1YDK A;  2IPA A;  1AXD A;  2WB9 A;  4BPY A;  5D96 A;  3D6I A;  3BD2 A;  2IWT A;  1B8X A;  4E8E A;  1NW2 A;  4N0V A;  1EZK A;  4NXI A;  1CQG A;  2RUF A;  2C0G A;  1S3D A;  1F3B A;  3TKP A;  1FHE A;  2FY6 A;  3GTU B;  2MZC A;  5ECP B;  3DEX A;  3CRU A;  3ME8 A;  2CAI A;  2FWE A;  3DRN A;  3CSJ A;  4OFM A;  2F8F A;  1G6Y A;  1AQV A;  2H8L A;  2L6D A;  2P31 A;  1A0F A;  2YNX A;  5GST A;  3DVW A;  3L78 A;  4TRX A;  2H72 A;  5HQP A;  5AIX A;  3F9U A;  2HFD A;  2IL3 A;  3H79 A;  2GVP A;  2F3M A;  1YQ1 A;  5HR1 A;  2AYT A;  4OD7 A;  1SK0 A;  3VPQ A;  2XBI A;  3AY8 A;  4X43 A;  5DDL A;  5GAP D;  2IFQ A;  1GSQ A;  3C1S A;  1ZL9 A;  2GSS A;  4ULX A;  1NHY A;  3A2V A;  1G7O A;  1RK4 A;  1ILO A;  3TJB A;  2YCD A;  2H0G A;  2K9F A;  4HS1 A;  4HJM A;  5B6N A;  2QGV A;  2VCX A;  5G31 A;  2KHP A;  2VL2 C;  3NOF A;  4MF7 A;  4Q5Q A;  2TRX A;  4KSM A;  2PMT A;  2H76 A;  4IJ3 A;  2Z9S A;  1X5D A;  3WGD A;  3D4M A;  1TK5 B;  3D21 A;  3F3Q A;  2B1L A;  3TKQ A;  5FT3 A;  1T4Z A;  1Z5Y E;  1YF0 A;  1KTE A;  3KEB A;  3Q74 A;  3FY7 A;  3UBL A;  4K6X A;  4YAV A;  4J2F A;  3LWA A;  1SKR B;  4HU9 A;  2WFC A;  4V2M A;  1SJI A;  5AN1 A;  2E2G A;  2CVK A;  3TUE A;  2YWO A;  2LRC A;  4WET A;  4V2L A;  4ZXG A;  1JLV A;  3EU3 A;  1XOB A;  5G2Z A;  1M2B A;  3IA1 A;  3DXB A;  4XCS A;  4Q5F A;  5JCG A;  2OE0 A;  3EU4 A;  1XOA A;  3GKN A;  2HYX A;  2BMX A;  4EVM A;  1Z3E A;  5KN1 A;  1ACV A;  1VF2 A;  3L0H A;  4EXJ A;  1PD2 1;  2MMA A;  1BJX A;  4V1A g;  4FH8 A;  1TK8 B;  4O7H A;  2FUG 2;  1AUC A;  2R3X A;  3U6V A;  2HI7 A;  2PUK C;  4GSS A;  1K0O A;  2H1B A;  3TKR A;  3V1W A;  4ZL7 A;  2D2Z A;  1F9M A;  2GQM A;  1IYI A;  3W8S A;  3ZML A;  1PN9 A;  1TOF A;  3DWV A;  3H4K A;  2GZZ A;  4TR1 A;  2NPB A;  4AF2 A;  4K7I A;  4IEL A;  1PMT A;  1M7T A;  3D0Z A;  3GMF A;  3MDK A;  1SD8 A;  5CNW A;  2WGR A;  2BTO T;  4BWQ A;  1Z7R A;  2YV7 A;  3LEF A;  5IMA A;  3QCP A;  2X8H A;  2B5X A;  1ZMA A;  2VD0 A;  4ZB9 A;  3F4R A;  1SKW B;  2HLS A;  5ECQ B;  3KMO A;  2F9S A;  2P5R A;  1TDI A;  4X1U A;  1WPI A;  1RW1 A;  2VD1 A;  5H5R A;  4K8M A;  2VO4 A;  3GYK A;  2HSY A;  3RHC A;  2OE3 A;  5EY6 A;  3GIX A;  1TRU A;  1I5G A;  1VGL A;  2EIO A;  2PVO C;  3F3R A;  3KD0 A;  1X9W B;  4D73 A;  5J4U A;  2GLR A;  3GUS A;  2IFQ B;  3L9S A;  1GNW A;  1HNA A;  4ML6 A;  1SJZ A;  4GWR A;  1THX A;  2I1U A;  5H5S A;  3IRA A;  4YQV A;  2DJJ A;  4ILF A;  1GLP A;  1CQH A;  1FW1 A;  2C3Q A;  2VL2 A;  3CBU A;  4ML1 A;  3FKF A;  3L9V A;  2WCI A;  2FGX A;  5IO0 A;  2GT5 A;  3IHQ A;  2PGT A;  2DIZ A;  4EDZ A;  17GS A;  2FA8 A;  1K3L A;  1QFN A;  2H70 A;  4GXZ A;  4I6X A;  2XBQ A;  2MBT A;  1HQO A;  1T00 A;  2H1D A;  5CRG A;  1AQW A;  3ZVJ A;  2PPT A;  1Z9H A;  4PX1 A;  2NTO A;  5HFI A;  1SYX A;  4HU7 A;  2E0Q A;  3EIN A;  2HSH A;  4HZ2 A;  3DML A;  5C04 A;  2WRT A;  2FNO A;  5DJM A;  4JRR A;  3LQ7 A;  4OO4 A;  1X0R A;  4KAE A;  1U3I A;  3SWL A;  4F82 A;  1DE1 A;  2YJ7 A;  1M0U A;  2H19 A;  3HCZ A;  4LLR A;  1T1V A;  3N5O A;  4TR3 A;  2M72 A;  3I9V 2;  3KGK A;  3F6D A;  3APS A;  5KN3 A;  1XBS A;  4BVX A;  6GSU A;  5IMZ A;  4IKH A;  3APQ A;  3O76 A;  1GSF A;  3VUR A;  1SJ6 A;  1V9W A;  4L5O A;  1WMJ A;  1JZR A;  4GRF A;  3DYR A;  1FB0 A;  3FRC A;  4XS1 A;  2H6X A;  4HZ4 A;  3TKS C;  1MD3 A;  2KUC A;  2N5A A;  4POL A;  3IBH A;  2O7K A;  2N5F A;  1GTU A;  1XWG A;  3HKR A;  5F05 A;  2YWN A;  2P5Q A;  2GZY A;  2O8V B;  1QMV A;  3VFI A;  1ML6 A;  3IV4 A;  3IE3 A;  4WBJ A;  3QPM A;  4DSS B;  5AIS A;  1QUW A;  4N30 A;  2B3S A;  2H66 A;  1GTB A;  2ZNM A;  2E7P A;  4JR6 A;  5LNK e;  3FK8 A;  4BWS A;  3HVV A;  22GS A;  1T3B A;  3GA4 A;  3CYN A;  5ECM B;  1WE0 A;  4QL9 A;  4IN0 A;  1LBK A;  2YOI A;  5COH A;  4JE1 A;  2MMZ A;  2AAW A;  3TOT A;  3GKX A;  3N9J A;  3GST A;  4TR1 B;  1LJR A;  4F03 A;  5A4V A;  3GHA A;  3RPP A;  1YF1 A;  1VF4 A;  3HVX A;  1XZO A;  2QKE A;  1AAZ A;  4PGT A;  3ZL5 A;  2FD3 A;  3TJG A;  3F0I A;  5DVB A;  2DJ0 A;  1LU4 A;  2IMK A;  2DJ2 A;  4BVY A;  3FEU A;  3H8Q A;  2L4Q A;  3IAS 2;  6GSV A;  4MJC A;  1PGT A;  4XHM A;  2M46 A;  4FIW A;  4FYU A;  1YJ6 A;  5ENU A;  1C72 A;  3VI5 A;  1XW6 A;  1A24 A;  1KBN A;  4L0U A;  2C3T A;  4E8H A;  1ON4 A;  2CQ9 A;  3KZQ A;  5A5K A;  4G2E A;  1Z6N A;  2L5O A;  2MMN A;  2K6V A;  2RLI A;  4TXO A;  2NVL A;  1V57 A;  4MH2 A;  2DJ3 A;  4JZQ A;  2OJL A;  5LCZ A;  3HHV A;  1F37 A;  1NHO A;  4DSQ A;  2CA8 A;  2FWG A;  1Z6M A;  5CRD A;  4MZC A;  5CO3 A;  3UBK A;  1TP9 A;  2FLS A;  4ZB6 A;  3M1G A;  1Z7P A;  2A4V A;  5IQY A;  3DGQ A;  1N8J A;  2LV3 A;  3TKS E;  3CXG A;  4HJ2 A;  4MPG A;  4F0C A;  2LUS A;  2JAC A;  3U5R E;  2HNL A;  2R4V A;  3I6A A;  4FYB A;  4XRA A;  5D8I A;  1K3O A;  1TXX A;  4ID0 A;  5IOX A;  2RM6 A;  2NDO A;  2LQQ A;  3H93 A;  3EVI A;  3TJF A;  5E59 A;  5CP1 A;  2DIY A;  2EIQ A;  1BX9 A;  5D93 A;  1SD9 A;  4L8E A;  2OBK A;  4XIH A;  3HZ4 A;  4P3Y B;  1BAY A;  5DAL B;  3GV1 A;  1AW9 A;  4KH7 A;  1SEN A;  2ZCT A;  3M0F A;  3WT2 A;  6GSY A;  2LJA A;  1EP8 A;  5KN0 A;  2IIY A;  1B9Y C;  3HD5 A;  1PX6 A;  1NM3 A;  4JBB A;  3IAM 2;  2HZF A;  1UA5 A;  1U6T A;  2V32 A;  1OKD A;  3ERF A;  3ERG A;  3HA9 A;  1K3Y A;  3RBT A;  5ELA A;  4ECI A;  4PUF C;  5IMD A;  1FOV A;  1PKZ A;  3OR5 A;  1GSE A;  4OWY A;  5CYY A;  1V98 A;  1OC8 A;  2ON7 A;  3IK9 A;  3TKS A;  3GNJ A;  1TI3 A;  3I43 A;  1O81 A;  3G7Y A;  2QSI A;  4IP6 A;  1X9S B;  1M2D A;  1EV9 A;  4HUA A;  4EKZ A;  4MP4 A;  1NSW A;  2AHE A;  4ZBD A;  3UVT A;  2AV4 A;  2H71 A;  3F8U A;  2H6Z A;  1XCC A;  3KIJ A;  2OAD A;  2C0D A;  5F8B A;  3ZVJ D;  3ZLP A;  2YWM A;  1TU8 A;  3PGT A;  1TU7 A;  3EC3 A;  1O73 A;  2YJH A;  2H6Y A;  5GZZ B;  4FO5 A;  2C0E A;  4GST A;  4RUV A;  1VRS D;  2VLT A;  2JL4 A;  4MDC A;  5KEJ A;  1X5C A;  1U3A A;  1Y25 A;  1XVQ A;  2RM5 A;  1I9D A;  5JWQ B;  2GST A;  1FO5 A;  5HFK A;  3E3E A;  4HI7 A;  1X9M B;  20GS A;  5JWR B;  4ZL8 A;  1AIU A;  3QOU A;  5DAK A;  1GRX A;  3HXS A;  2B5Y A;  2L6C A;  1X5E A;  2PU9 C;  3DKS A;  2ES7 A;  3QAV A;  1A2M A;  2LNT A;  3QR6 A;  2AJQ B;  4N10 A;  5E4W A;  4H86 A;  2I4A A;  3FZA A;  3PH9 A;  1UN2 A;  2I81 A;  5DQS A;  5G30 A;  4OCF A;  4J56 E;  3RDW A;  4JR4 A;  2PVQ A;  1OE7 A;  2TRC P;  4XS4 A;  5KN2 A;  5G5E A;  2VAF A;  2V41 A;  11GS A;  3HDC A;  2PER A;  2K18 A;  4WXT A;  4XS6 A;  4DSR A;  4CHS A;  2DMM A;  2LJK A;  4HDE A;  4TXO B;  3A2W A;  2JSZ A;  4EL1 A;  4MZW A;  1GL8 A;  2LNS A;  5D9V A;  3DIE A;  4HQS A;  2GSQ A;  2TIR A;  3TJK A;  1EEJ A;  1TW9 A;  3P90 A;  4AJ6 A;  1SK2 A;  19GS A;  1GLQ A;  2L4C A;  4OFT A;  4K0N A;  4K9Z A;  1HNC A;  3CMI A;  4G9H A;  1GP1 A;  5EPF A;  2PBJ A;  4KB3 A;  4IS0 A;  2IMD A;  3CTF A;  1SKS B;  3FZ5 A;  3KMN A;  1YEP A;  4TXV A;  4F9Z A;  1G6W A;  5DCH A;  2WJU A;  4CDO A;  3VLN A;  3RPN A;  3TOU A;  4WR4 A;  1U87 A;  2VM2 A;  2YPM A;  1R4W A;  4WKW A;  4WF5 A;  4GQF A;  4KUN A;  5HR2 A;  1H4O A;  3GL3 A;  3EE2 A;  1PL1 A;  4I2U A;  1PQN A;  1YKA A;  3A3T A;  4Z7X A;  1PA3 A;  2OE1 A;  1S3C A;  1E2Y A;  1A8L A;  1YZX A;  1O6J A;  4I8B A;  8GSS A;  4GQC A;  4Q5N A;  1ERU A;  2V1M A;  1VF3 A;  4KX4 A;  4TVE A;  4KND A;  3IC4 A;  1R26 A;  3EUR A;  3L4N A;  3Q6O A;  1ERT A;  1FAA A;  1M9A A;  1QK8 A;  3ISO A;  5AGY A;  1G7E A;  5ELG A;  3E9J B;  1MTC A;  2JAD A;  1MEK A;  4RQX A;  1URM A;  2X64 A;  4PUR A;  5HR0 A;  4ECJ A;  5J5N A;  3D5J A;  3J7Y k;  1G0T A;  2KP2 A;  1V2A A;  3C71 A;  5JCW A;  1F2E A;  1V58 A;  2VL9 A;  2VLU A;  1BYE A;  2LRN A;  3ZIT A;  1QQ2 A;  3APO A;  3EWL A;  1PKW A;  2FHE A;  3PIN A;  2ON5 A;  1T8E B;  2FCH A;  2RII A;  2HRF A;  1M9B A;  5FWG A;  1ST9 A;  2O89 A;  1UC7 A;  5JCU A;  3W6G A;  1MD4 A;  3FR3 A;  3BCI A;  3FW2 A;  3CTG A;  1ZOF A;  4OO5 A;  3VWV A;  2HT9 A;  2I9H A;  3NIV A; 
#chains in the Genus database with same CATH topology
 5C00 A;  3TB2 A;  4BL7 A;  4EC0 A;  3BBY A;  4ZBB A;  3UMA A;  3F6F A;  2LRT A;  1SL1 B;  3QAW A;  3C8E A;  4I97 A;  4AGS A;  5DAK B;  2ALB A;  4K7N A;  3TDG A;  2DLX A;  5IM9 A;  4MF6 A;  4L5L A;  3P2A A;  1GUL A;  2GS3 A;  1FVJ A;  3GN3 A;  3JCM L;  1GSS A;  1N2A A;  3UAP A;  3C73 A;  4LL1 B;  4MK3 A;  2YWI A;  2XC2 A;  2GQL A;  2NBS A;  5H5Q A;  3US3 A;  2LS5 A;  2L5L A;  2M80 A;  4LL4 B;  1E6B A;  1QGV A;  4XS4 B;  5ECS A;  3KH7 A;  1K0A A;  14GS A;  1BED A;  1TK0 B;  2RUE A;  3VWX A;  2WUL A;  5HFG A;  1ZCP A;  2C80 A;  3EMP A;  5ECL B;  1ZGN A;  3KM6 A;  2CVB A;  2H30 A;  2XPE A;  4PQ1 A;  3IXR A;  4ZIJ A;  3KTB A;  5LD0 A;  1PL2 A;  4TR0 A;  1WRY A;  2HZE A;  1XWB A;  5G1K A;  4MJA A;  5CRH A;  2ZUP A;  5F0G A;  3RHB A;  5IPH A;  2V6K A;  4MNN A;  4IQ1 A;  5DJL A;  3ZYW A;  2REM A;  1EWX A;  4O32 A;  3F63 A;  2IN3 A;  1J08 A;  2GSR A;  2MBS A;  1OKT A;  2HSM A;  3IPZ A;  4MLY A;  4POK A;  4NAX A;  2G2Q A;  1A2L A;  4J57 E;  1FG4 A;  3HJP A;  2C0F A;  3P8W A;  4ZBA A;  5J9C A;  4QQ7 A;  4NWY A;  1TKD B;  6GSS A;  1AQX A;  1XXU A;  3HJM A;  1XPV A;  4V1A p;  4OFN A;  4POB A;  1WWJ A;  4V2N A;  4YAP A;  2LKU A;  3TGZ A;  4G0I A;  3IK7 A;  4G10 A;  3QDN A;  3LXT A;  3Q18 A;  1GTI A;  2F8A A;  3L9U A;  4NV5 A;  1KEB A;  3FZ4 A;  2BJX A;  4EO3 A;  3CSH A;  4IGJ A;  1GNE A;  3G7I A;  1XIY A;  1OC9 A;  2HXK A;  1XW9 A;  2H0H A;  2KOK A;  4LA1 A;  4IJI A;  2CZ3 A;  4O5R A;  5IOW A;  1GH2 A;  2H74 A;  4K0G A;  4FYC A;  1VF1 A;  1EOG A;  4D73 B;  1A8Y A;  3KJY A;  1K0B A;  1SL2 B;  3MAK A;  1EEM A;  16GS A;  1K0C A;  1GUM A;  3FR9 A;  5IMC A;  4PNF A;  4FQU A;  4TN8 A;  3LGC A;  4L0W A;  3D4T A;  7GSS A;  1F6M C;  1MDI A;  2H1G A;  1TRS A;  2FWH A;  1FB6 A;  3IDV A;  2DBC A;  1B4Q A;  2VCZ A;  3PR8 A;  13GS A;  1UVZ A;  2X8C A;  2EC4 A;  2IMF A;  1PX7 A;  3FR6 A;  5ECH B;  1SL0 B;  5J3R A;  1A0R P;  2B5E A;  4KE3 A;  1XWC A;  3HYP A;  1B4P A;  3ED3 A;  4KDU A;  3ZMK A;  2K8V A;  5ABR A;  1B48 A;  3EMX A;  2UZ8 A;  4BL7 B;  2F51 A;  3VWW A;  4MJB A;  4F2I A;  4YQU A;  6GSW A;  1R7H A;  4JED A;  2C4J A;  2HE3 A;  3ME7 A;  2YAN A;  1K0D A;  1WIK A;  2WZ9 A;  1A23 A;  1V40 A;  2LST A;  1OC3 A;  3M3M A;  4EUY A;  4PQH A;  3J7Y b;  2R6K A;  5B8B A;  3HY2 A;  3UOM A;  2LQO A;  4GLT A;  1XWA A;  3G9B A;  5F06 A;  1BG5 A;  3LOR A;  2GTU A;  12GS A;  3M9K A;  5ID2 A;  1XW5 A;  1ABA A;  5J41 A;  4K1F A;  1A2J A;  4WR5 A;  4PXO A;  5ECO B;  1ZYQ B;  1KNG A;  5DBQ A;  1H75 A;  2H1A A;  1U88 A;  4ECB A;  5IMF A;  1MDJ A;  3ZFB A;  2KLX A;  3FHK A;  5IIZ A;  2VCQ A;  2HZE B;  2JU5 A;  4X0X A;  2VUP A;  3A2X A;  1DE2 A;  1Y6E A;  2IME A;  3QAG A;  4BA7 A;  4YKG A;  5D73 A;  3LJR A;  1JLW A;  2QA2 A;  3LXZ A;  2DC5 A;  1O8W A;  3GUR A;  4KDX A;  1JFU A;  4O92 A;  4OMV A;  1FVK A;  3GKM A;  4HOJ A;  1OE8 A;  3WGX A;  1T4Y A;  6GSX A;  4K2X A;  4ECC A;  4HEA 2;  4K5R A;  3VPT A;  1OYJ A;  2GZP A;  4NPB A;  3BOA A;  3UJ1 A;  3GRX A;  3O3T A;  1Q98 A;  4BVY B;  3QD9 A;  1XWK A;  1USB A;  2YP6 A;  4EE0 A;  3GFK A;  2CX3 A;  2DJ1 A;  1J0F A;  5G1L A;  1AC1 A;  2GT6 A;  2YN1 A;  3WD6 A;  1EV4 A;  2VIM A;  4ICY A;  2I3Y A;  2E2M A;  3G7J A;  3TRQ A;  3UIW A;  4TKY A;  3M8N A;  1JZO A;  2C3N A;  2B6M A;  5L71 A;  3DD3 A;  1OC9 B;  2QC7 A;  2H73 A;  3KH9 A;  1THO A;  3GL5 A;  5D9X A;  1SU9 A;  1J9B A;  2WS2 A;  2PN8 A;  2VCV A;  18GS A;  3HVN A;  2A2R A;  1JZW A;  3QFB C;  2L57 A;  4DSS A;  2A2S A;  1SYR A;  2OAC A;  5ECN B;  4N0Z A;  3WYW A;  1ZZY A;  2N5B A;  1TTZ A;  4IQA A;  3I69 A;  1JZD A;  2B1K A;  2KP1 A;  4GCI A;  5GAN D;  9GSS A;  5J9B A;  2IMI A;  4RI7 A;  4WBR D;  2B7K A;  4XTS A;  1W89 A;  3HVS A;  4POM A;  3ZIJ A;  1PSQ A;  4XRD A;  1EOH A;  4QL7 A;  4KW6 A;  2YV9 A;  4LMV A;  3O6T A;  4ISD A;  4WEY A;  5CRE A;  3LYK A;  5EL8 A;  2G0F A;  4PQI A;  3UEM A;  3A5W A;  2VOC A;  5IMV A;  2CAQ A;  3KCM A;  4MF5 A;  3CRT A;  4IHU A;  3HZ8 A;  2JZS A;  3VWU A;  1DBY A;  6GST A;  1IYH A;  2R37 A;  2DKI A;  1WP0 A;  2C1Y A;  1ZYE A;  4KDY A;  1GSU A;  2B7J A;  4EIP A;  2JSY A;  3IOS A;  3BJ5 A;  5IO2 A;  3K8N A;  4MJE A;  4I2T A;  2CT6 A;  2VL3 A;  2P0G A;  4GSN A;  4JU5 A;  2MMO A;  4KCE A;  1WOU A;  5EVO A;  3QMX A;  2X99 A;  2LJR A;  2O87 A;  2OKA A;  1OVN A;  1GWC A;  5A4U A;  3LG6 A;  3GX8 A;  3UAR A;  4LMW A;  1SK1 A;  3C7M A;  5INY A;  4DVC A;  5ID2 B;  1DUG A;  2CZ2 A;  3GX0 A;  1ZYP A;  1K0M A;  1YKC A;  2H01 A;  1GUK A;  4EF0 A;  3LSZ A;  3WGE A;  1QXH A;  5IPG A;  2VCT A;  1W4V A;  3P7X A;  1HNB A;  5B7C A;  4AJ8 A;  3KTL A;  4KGI A;  1S3A A;  3R2Q A;  2CVD A;  3ZIV A;  2H0I A;  4EDY A;  3DVX A;  4OCE A;  4N11 A;  2V6O A;  1ERW A;  3NZN A;  5G5F A;  3Q19 A;  3M9J A;  4I5Q A;  3ERW A;  2VLV A;  3KP8 A;  3C1R A;  5ECK B;  1XVW A;  5JWO B;  3S9F A;  1TRW A;  1PN0 A;  1HD2 A;  4CW9 A;  4IVF A;  5FHI A;  4K2D A;  3GTU A;  3FZ9 A;  3LFL A;  3KP9 A;  2H75 A;  2AUV A;  4NHW A;  3LYP A;  1ERV A;  3GH6 A;  5DAL A;  2DML A;  3E0U A;  5F07 A;  3F4S A;  3QFA C;  4GF0 A;  2XPD A;  1XG8 A;  2JZR A;  4TW5 A;  1T7P B;  1YEX A;  1M99 A;  2L59 A;  4MMM A;  4KSO A;  4USS A;  3ZTL A;  3IR4 A;  4RI6 A;  4ZL9 A;  1BQ7 A;  3ZZX A;  4RQR A;  4O5U A;  1TRV A;  3TJJ A;  1JHB A;  4DEJ A;  3RAZ A;  3W8J A;  1GUH A;  4NV2 A;  4MZB A;  3MSZ A;  3MWH A;  3TRX A;  2FWF A;  3GKK A;  3MIX A;  1HYU A;  1Q4J A;  4IBP A;  1MDK A;  4ZIL A;  2JZT A;  5D9W A;  2X8G A;  1OAZ A;  3ZFL A;  1XFL A;  3IC8 A;  1EP7 A;  5DCG A;  1TJD A;  2GGT A;  4PUA A;  4TOP A;  2QA1 A;  3TCO A;  1B9X C;  2C8U A;  2LTK A;  3CQF A;  5CRW A;  2R5G A;  4YH2 A;  1EGR A;  2GDR A;  3CSI A;  2OA7 A;  1R5A A;  2HRA A;  2AB6 A;  4K7O A;  1WJK A;  4NHZ A;  1PRX A;  4KA0 A;  2O85 A;  2VM1 A;  4MH3 A;  4MPF A;  5A4W A;  4HQZ A;  4MCU A;  2DSA A;  5CAX A;  10GS A;  3FYG A;  4MA9 A;  3BCK A;  1K0N A;  2EIR A;  1F3A A;  2YZH A;  3VI7 A;  4PNG A;  3F4T A;  1O8X A;  4NMU A;  3MNG A;  3UVH A;  4F0B A;  3SBC A;  3WT1 A;  5ECI B;  1R5P A;  2XHF A;  4MAB A;  2V2G A;  2YZU A;  2DJK A;  3ZRE A;  1GSY A;  4G0K A;  3TRP A;  5B8A A;  5HR3 A;  5B6M A;  3D22 A;  2K8S A;  2CX4 A;  5ECR B;  4CY8 A;  2IJY A;  5D9T A;  2VCW A;  4KCA A;  2CV4 A;  1DSB A;  5GSS A;  2GQK A;  3GH9 A;  4AJ7 A;  3EYT A;  4Q5R A;  3VK9 A;  1M2A A;  4WF4 A;  5AIV A;  1YY7 A;  3KXO A;  2LEG A;  2WDU A;  2DKH A;  2FA4 A;  1O7U A;  3UL3 A;  2J9H A;  3GSS A;  4YQM A;  2OBI A;  2MYG A;  4IP1 A;  3H1N A;  1GTA A;  4ACS A;  1TI1 A;  4TR4 A;  1RQM A;  1O85 A;  4IW9 A;  2J23 A;  1GSD A;  2HRN A;  1EGO A;  3HJO A;  2PWJ A;  5DQY A;  4GTU A;  2R2J A;  4G19 A;  4ZB8 A;  3ZRD A;  1YDK A;  2IPA A;  1AXD A;  2WB9 A;  4BPY A;  5D96 A;  3D6I A;  3BD2 A;  2IWT A;  1B8X A;  4E8E A;  1NW2 A;  4N0V A;  1EZK A;  4NXI A;  1CQG A;  2RUF A;  2C0G A;  1S3D A;  1F3B A;  3TKP A;  1FHE A;  2FY6 A;  3GTU B;  2MZC A;  5ECP B;  3DEX A;  3CRU A;  3ME8 A;  2CAI A;  2FWE A;  3DRN A;  3CSJ A;  4OFM A;  2F8F A;  1G6Y A;  1AQV A;  2H8L A;  2L6D A;  2P31 A;  1A0F A;  2YNX A;  5GST A;  3DVW A;  3L78 A;  4TRX A;  2A4H A;  2H72 A;  5HQP A;  5AIX A;  3F9U A;  2HFD A;  2IL3 A;  3H79 A;  2GVP A;  2F3M A;  1YQ1 A;  5HR1 A;  2AYT A;  4OD7 A;  1SK0 A;  3VPQ A;  4HSC X;  2XBI A;  3AY8 A;  4X43 A;  5DDL A;  5GAP D;  2IFQ A;  1GSQ A;  3C1S A;  4G0L A;  1ZL9 A;  2GSS A;  4ULX A;  1NHY A;  3A2V A;  1G7O A;  1RK4 A;  1ILO A;  3TJB A;  2YCD A;  2H0G A;  2R0G A;  2K9F A;  4HS1 A;  4HJM A;  5B6N A;  2QGV A;  2VCX A;  5G31 A;  2KHP A;  2VL2 C;  3NOF A;  4MF7 A;  4Q5Q A;  2TRX A;  4KSM A;  2PMT A;  2H76 A;  4IJ3 A;  2Z9S A;  1X5D A;  3WGD A;  3D4M A;  1TK5 B;  3D21 A;  3F3Q A;  2B1L A;  3TKQ A;  5FT3 A;  1T4Z A;  1Z5Y E;  1YF0 A;  1KTE A;  3KEB A;  3Q74 A;  3FY7 A;  3UBL A;  4K6X A;  4YAV A;  4J2F A;  3LWA A;  1SKR B;  4HU9 A;  2WFC A;  4V2M A;  1SJI A;  5AN1 A;  2E2G A;  3PPU A;  2CVK A;  3TUE A;  2YWO A;  2LRC A;  4WET A;  4V2L A;  4ZXG A;  1JLV A;  3EU3 A;  1XOB A;  5G2Z A;  1M2B A;  3IA1 A;  3DXB A;  4XCS A;  4O5Q A;  3FMW A;  4Q5F A;  5JCG A;  2OE0 A;  3EU4 A;  1XOA A;  3GKN A;  2HYX A;  2BMX A;  4CY6 A;  4Z2R A;  4EVM A;  1Z3E A;  5KN1 A;  1ACV A;  1VF2 A;  2X4A A;  3L0H A;  4EXJ A;  1PD2 1;  2MMA A;  1BJX A;  4V1A g;  4FH8 A;  1TK8 B;  4O7H A;  2FUG 2;  1AUC A;  2R3X A;  3U6V A;  2HI7 A;  2PUK C;  4GSS A;  1K0O A;  2H1B A;  3TKR A;  3V1W A;  4ZL7 A;  2D2Z A;  1F9M A;  3LW9 A;  2GQM A;  1IYI A;  3W8S A;  3ZML A;  1PN9 A;  1TOF A;  3DWV A;  3H4K A;  2GZZ A;  4TR1 A;  2NPB A;  4AF2 A;  4K7I A;  4IEL A;  1PMT A;  1M7T A;  3D0Z A;  3GMF A;  3MDK A;  1SD8 A;  5CNW A;  2WGR A;  2BTO T;  4BWQ A;  1Z7R A;  2YV7 A;  3LEF A;  5IMA A;  3QCP A;  2X8H A;  2B5X A;  1ZMA A;  2VD0 A;  4ZB9 A;  3F4R A;  1SKW B;  2HLS A;  5ECQ B;  3KMO A;  2F9S A;  2P5R A;  1TDI A;  4X1U A;  1WPI A;  1RW1 A;  2VD1 A;  5H5R A;  4K8M A;  2VO4 A;  3GYK A;  2HSY A;  3RHC A;  2OE3 A;  5EY6 A;  3GIX A;  1TRU A;  1I5G A;  1VGL A;  2EIO A;  2PVO C;  4YKF A;  3F3R A;  3KD0 A;  1X9W B;  4PTS A;  4D73 A;  4EIQ A;  5J4U A;  2GLR A;  3GUS A;  2IFQ B;  3L9S A;  1GNW A;  1HNA A;  4ML6 A;  1SJZ A;  1M3J A;  4GWR A;  1THX A;  2I1U A;  5H5S A;  3IRA A;  4YQV A;  2DJJ A;  4ILF A;  1GLP A;  1CQH A;  1FW1 A;  4K5S A;  2C3Q A;  2VL2 A;  3CBU A;  4ML1 A;  3FKF A;  3L9V A;  2WCI A;  2FGX A;  2HRK A;  5IO0 A;  3IHG A;  2GT5 A;  3IHQ A;  2PGT A;  2DIZ A;  4EDZ A;  17GS A;  2FA8 A;  1K3L A;  1QFN A;  2H70 A;  4GXZ A;  4I6X A;  2XBQ A;  2MBT A;  4A5P A;  1HQO A;  1T00 A;  2H1D A;  5CRG A;  1AQW A;  3ZVJ A;  2PPT A;  1Z9H A;  4PX1 A;  2NTO A;  5HFI A;  1SYX A;  4HU7 A;  2E0Q A;  3EIN A;  5KOW A;  2HSH A;  4HZ2 A;  3DML A;  5C04 A;  2WRT A;  2FNO A;  5DJM A;  4JRR A;  3LQ7 A;  4OO4 A;  1X0R A;  4KAE A;  1U3I A;  3SWL A;  4F82 A;  1DE1 A;  2YJ7 A;  1M0U A;  2H19 A;  3HCZ A;  4LLR A;  1T1V A;  3N5O A;  4TR3 A;  2M72 A;  3I9V 2;  3KGK A;  3F6D A;  3APS A;  5KN3 A;  1XBS A;  4BVX A;  5KOX A;  1FOH A;  6GSU A;  5IMZ A;  4IKH A;  3APQ A;  3O76 A;  1GSF A;  3VUR A;  1SJ6 A;  1V9W A;  4L5O A;  1WMJ A;  1JZR A;  4GRF A;  3DYR A;  1FB0 A;  3FRC A;  4X4J A;  4XS1 A;  2H6X A;  4HZ4 A;  3TKS C;  1MD3 A;  2KUC A;  2N5A A;  4POL A;  3IBH A;  2O7K A;  2N5F A;  1GTU A;  1XWG A;  3HKR A;  5F05 A;  2YWN A;  2P5Q A;  2GZY A;  2O8V B;  1QMV A;  3VFI A;  1ML6 A;  3IV4 A;  3IE3 A;  4WBJ A;  3QPM A;  4DSS B;  5AIS A;  2A2P A;  1QUW A;  4N30 A;  2B3S A;  2H66 A;  1GTB A;  2ZNM A;  2E7P A;  4JR6 A;  5LNK e;  3FK8 A;  4BWS A;  3HVV A;  22GS A;  1T3B A;  3GA4 A;  3MYD A;  3CYN A;  5ECM B;  1WE0 A;  4QL9 A;  4IN0 A;  1LBK A;  2YOI A;  5COH A;  4JE1 A;  2MMZ A;  2AAW A;  3TOT A;  3GKX A;  3N9J A;  3GST A;  4TR1 B;  1LJR A;  4F03 A;  5A4V A;  3GHA A;  3RPP A;  1YF1 A;  1VF4 A;  3HVX A;  1XZO A;  2QKE A;  1AAZ A;  4PGT A;  3ZL5 A;  2FD3 A;  3TJG A;  3F0I A;  5DVB A;  2DJ0 A;  1LU4 A;  2IMK A;  1M3I A;  2DJ2 A;  4BVY A;  3FEU A;  3H8Q A;  2L4Q A;  3IAS 2;  6GSV A;  4MJC A;  1PGT A;  4XHM A;  2M46 A;  4FIW A;  4FYU A;  1YJ6 A;  5ENU A;  1C72 A;  3VI5 A;  1XW6 A;  1A24 A;  1KBN A;  4L0U A;  2C3T A;  4E8H A;  1ON4 A;  2CQ9 A;  3KZQ A;  5A5K A;  5BMU A;  4G2E A;  1Z6N A;  2L5O A;  2MMN A;  2K6V A;  2RLI A;  4TXO A;  2NVL A;  1V57 A;  4MH2 A;  4Z2U A;  2DJ3 A;  4JZQ A;  2OJL A;  5LCZ A;  3HHV A;  1F37 A;  1ZYN A;  1NHO A;  4DSQ A;  2CA8 A;  2FWG A;  1Z6M A;  5CRD A;  4MZC A;  5CO3 A;  3UBK A;  1TP9 A;  2FLS A;  4ZB6 A;  3M1G A;  1Z7P A;  2A4V A;  5IQY A;  3DGQ A;  1N8J A;  2LV3 A;  3TKS E;  3EPT A;  3CXG A;  4HJ2 A;  4MPG A;  4F0C A;  2LUS A;  2JAC A;  3U5R E;  2HNL A;  2R4V A;  3I6A A;  4FYB A;  4XRA A;  5D8I A;  1K3O A;  1TXX A;  4ID0 A;  5IOX A;  2RM6 A;  2NDO A;  2LQQ A;  3H93 A;  3EVI A;  3TJF A;  5E59 A;  5CP1 A;  2DIY A;  2EIQ A;  1BX9 A;  5D93 A;  1SD9 A;  4L8E A;  2OBK A;  4XIH A;  3HZ4 A;  4P3Y B;  1BAY A;  5DAL B;  3GV1 A;  1AW9 A;  4KH7 A;  1SEN A;  3R3E A;  2ZCT A;  3M0F A;  3WT2 A;  6GSY A;  2LJA A;  1EP8 A;  5KN0 A;  2IIY A;  1B9Y C;  3HD5 A;  1PX6 A;  1NM3 A;  4JBB A;  3IAM 2;  2HZF A;  1UA5 A;  1U6T A;  2V32 A;  1OKD A;  3ERF A;  3ERG A;  3HA9 A;  1K3Y A;  3RBT A;  5ELA A;  4ECI A;  4PUF C;  5IMD A;  1FOV A;  1PKZ A;  4BVX B;  3OR5 A;  1GSE A;  4OWY A;  3A5I A;  5CYY A;  1V98 A;  1OC8 A;  2ON7 A;  3IK9 A;  3TKS A;  3GNJ A;  1TI3 A;  3I43 A;  1O81 A;  3G7Y A;  2QSI A;  4IP6 A;  1X9S B;  1M2D A;  1EV9 A;  4HUA A;  4EKZ A;  4MP4 A;  1NSW A;  2AHE A;  4ZBD A;  3UVT A;  2AV4 A;  2H71 A;  3F8U A;  2H6Z A;  1XCC A;  3KIJ A;  2OAD A;  2C0D A;  5F8B A;  3ZVJ D;  3ZLP A;  2R0C A;  2YWM A;  1TU8 A;  3PGT A;  1TU7 A;  3EC3 A;  1O73 A;  2YJH A;  2H6Y A;  5GZZ B;  4FO5 A;  2C0E A;  4GST A;  4RUV A;  1VRS D;  2VLT A;  2JL4 A;  4MDC A;  5KEJ A;  1X5C A;  1U3A A;  1Y25 A;  1XVQ A;  2RM5 A;  1I9D A;  5JWQ B;  2GST A;  1FO5 A;  5HFK A;  3E3E A;  4HI7 A;  1X9M B;  20GS A;  5JWR B;  4ZL8 A;  1AIU A;  3QOU A;  5DAK A;  1GRX A;  3HXS A;  2B5Y A;  2L6C A;  1X5E A;  2PU9 C;  3DKS A;  2ES7 A;  3QAV A;  1A2M A;  2LNT A;  3QR6 A;  2AJQ B;  4N10 A;  5E4W A;  2X49 A;  4H86 A;  2I4A A;  3FZA A;  3PH9 A;  1UN2 A;  2I81 A;  5DQS A;  5G30 A;  4OCF A;  4J56 E;  3RDW A;  2R0P A;  4JR4 A;  2PVQ A;  1OE7 A;  2TRC P;  4XS4 A;  5KN2 A;  5G5E A;  2VAF A;  2V41 A;  11GS A;  3HDC A;  2PER A;  2K18 A;  4WXT A;  4XS6 A;  4DSR A;  4KF9 A;  4CHS A;  2DMM A;  2LJK A;  4HDE A;  4TXO B;  3A2W A;  2JSZ A;  4EL1 A;  4MZW A;  1GL8 A;  2LNS A;  5D9V A;  3DIE A;  4HQS A;  2GSQ A;  2TIR A;  3TJK A;  1EEJ A;  1TW9 A;  3P90 A;  4AJ6 A;  1SK2 A;  19GS A;  1GLQ A;  2L4C A;  4OFT A;  4K0N A;  4K9Z A;  1HNC A;  3CMI A;  4G9H A;  1GP1 A;  5EPF A;  2PBJ A;  4KB3 A;  4IS0 A;  2IMD A;  3CTF A;  1SKS B;  3FZ5 A;  3KMN A;  1YEP A;  4TXV A;  4F9Z A;  1G6W A;  5DCH A;  4Z2T A;  2WJU A;  4CDO A;  3VLN A;  3RPN A;  3TOU A;  4WR4 A;  1U87 A;  2VM2 A;  4BIK A;  2YPM A;  1R4W A;  4WKW A;  4WF5 A;  4GQF A;  4KUN A;  5HR2 A;  1H4O A;  3GL3 A;  3EE2 A;  1PL1 A;  4I2U A;  1PQN A;  1YKA A;  3A3T A;  4Z7X A;  1PA3 A;  2OE1 A;  1S3C A;  1E2Y A;  1A8L A;  1YZX A;  1O6J A;  1PFO A;  4I8B A;  8GSS A;  4GQC A;  4Q5N A;  1ERU A;  2V1M A;  1VF3 A;  4KX4 A;  4TVE A;  4KND A;  3IC4 A;  1R26 A;  3EUR A;  3L4N A;  3Q6O A;  1ERT A;  1FAA A;  1M9A A;  1QK8 A;  3ISO A;  5AGY A;  1G7E A;  5ELG A;  3E9J B;  1MTC A;  2JAD A;  1MEK A;  4RQX A;  1URM A;  2X64 A;  4PUR A;  5HR0 A;  4ECJ A;  5J5N A;  3D5J A;  3J7Y k;  1G0T A;  2KP2 A;  1V2A A;  3C71 A;  5JCW A;  1F2E A;  1S3R A;  1V58 A;  2VL9 A;  2VLU A;  1BYE A;  2LRN A;  3ZIT A;  1QQ2 A;  3APO A;  3EWL A;  1PKW A;  2FHE A;  3PIN A;  2ON5 A;  1T8E B;  2FCH A;  2RII A;  2HRF A;  1M9B A;  5FWG A;  5BRT A;  1ST9 A;  2O89 A;  1UC7 A;  5JCU A;  3W6G A;  1MD4 A;  3FR3 A;  3BCI A;  3FW2 A;  3CTG A;  1ZOF A;  4OO5 A;  3VWV A;  2HT9 A;  2I9H A;  3NIV A; 
#chains in the Genus database with same CATH homology
 5C00 A;  3TB2 A;  4BL7 A;  4EC0 A;  3BBY A;  4ZBB A;  3UMA A;  3F6F A;  2LRT A;  1SL1 B;  3QAW A;  3C8E A;  4I97 A;  4AGS A;  5DAK B;  2ALB A;  4K7N A;  3TDG A;  2DLX A;  5IM9 A;  4MF6 A;  4L5L A;  3P2A A;  1GUL A;  2GS3 A;  1FVJ A;  3GN3 A;  3JCM L;  1GSS A;  1N2A A;  3UAP A;  3C73 A;  4LL1 B;  4MK3 A;  2YWI A;  2XC2 A;  2GQL A;  2NBS A;  5H5Q A;  3US3 A;  2LS5 A;  2L5L A;  2M80 A;  4LL4 B;  1E6B A;  1QGV A;  4XS4 B;  5ECS A;  3KH7 A;  1K0A A;  14GS A;  1BED A;  1TK0 B;  2RUE A;  3VWX A;  2WUL A;  5HFG A;  1ZCP A;  2C80 A;  3EMP A;  5ECL B;  1ZGN A;  3KM6 A;  2CVB A;  2H30 A;  2XPE A;  4PQ1 A;  3IXR A;  4ZIJ A;  3KTB A;  5LD0 A;  1PL2 A;  4TR0 A;  1WRY A;  2HZE A;  1XWB A;  5G1K A;  4MJA A;  5CRH A;  2ZUP A;  5F0G A;  3RHB A;  5IPH A;  2V6K A;  4MNN A;  4IQ1 A;  5DJL A;  3ZYW A;  2REM A;  1EWX A;  4O32 A;  3F63 A;  2IN3 A;  1J08 A;  2GSR A;  2MBS A;  1OKT A;  2HSM A;  3IPZ A;  4MLY A;  4POK A;  4NAX A;  2G2Q A;  1A2L A;  4J57 E;  1FG4 A;  3HJP A;  2C0F A;  3P8W A;  4ZBA A;  5J9C A;  4QQ7 A;  4NWY A;  1TKD B;  6GSS A;  1AQX A;  1XXU A;  3HJM A;  1XPV A;  4V1A p;  4OFN A;  4POB A;  1WWJ A;  4V2N A;  4YAP A;  2LKU A;  3TGZ A;  4G0I A;  3IK7 A;  4G10 A;  3QDN A;  3LXT A;  3Q18 A;  1GTI A;  2F8A A;  3L9U A;  4NV5 A;  1KEB A;  3FZ4 A;  2BJX A;  4EO3 A;  3CSH A;  4IGJ A;  1GNE A;  3G7I A;  1XIY A;  1OC9 A;  2HXK A;  1XW9 A;  2H0H A;  2KOK A;  4LA1 A;  4IJI A;  2CZ3 A;  4O5R A;  5IOW A;  1GH2 A;  2H74 A;  4K0G A;  4FYC A;  1VF1 A;  1EOG A;  4D73 B;  1A8Y A;  3KJY A;  1K0B A;  1SL2 B;  3MAK A;  1EEM A;  16GS A;  1K0C A;  1GUM A;  3FR9 A;  5IMC A;  4PNF A;  4FQU A;  4TN8 A;  3LGC A;  4L0W A;  3D4T A;  7GSS A;  1F6M C;  1MDI A;  2H1G A;  1TRS A;  2FWH A;  1FB6 A;  3IDV A;  2DBC A;  1B4Q A;  2VCZ A;  3PR8 A;  13GS A;  1UVZ A;  2X8C A;  2EC4 A;  2IMF A;  1PX7 A;  3FR6 A;  5ECH B;  1SL0 B;  5J3R A;  1A0R P;  2B5E A;  4KE3 A;  1XWC A;  3HYP A;  1B4P A;  3ED3 A;  4KDU A;  3ZMK A;  2K8V A;  5ABR A;  1B48 A;  3EMX A;  2UZ8 A;  4BL7 B;  2F51 A;  3VWW A;  4MJB A;  4F2I A;  4YQU A;  6GSW A;  1R7H A;  4JED A;  2C4J A;  2HE3 A;  3ME7 A;  2YAN A;  1K0D A;  1WIK A;  2WZ9 A;  1A23 A;  1V40 A;  2LST A;  1OC3 A;  3M3M A;  4EUY A;  4PQH A;  3J7Y b;  2R6K A;  5B8B A;  3HY2 A;  3UOM A;  2LQO A;  4GLT A;  1XWA A;  3G9B A;  5F06 A;  1BG5 A;  3LOR A;  2GTU A;  12GS A;  3M9K A;  5ID2 A;  1XW5 A;  1ABA A;  5J41 A;  4K1F A;  1A2J A;  4WR5 A;  4PXO A;  5ECO B;  1ZYQ B;  1KNG A;  5DBQ A;  1H75 A;  2H1A A;  1U88 A;  4ECB A;  5IMF A;  1MDJ A;  3ZFB A;  2KLX A;  3FHK A;  5IIZ A;  2VCQ A;  2HZE B;  2JU5 A;  4X0X A;  2VUP A;  3A2X A;  1DE2 A;  1Y6E A;  2IME A;  3QAG A;  4BA7 A;  4YKG A;  5D73 A;  3LJR A;  1JLW A;  2QA2 A;  3LXZ A;  2DC5 A;  1O8W A;  3GUR A;  4KDX A;  1JFU A;  4O92 A;  4OMV A;  1FVK A;  3GKM A;  4HOJ A;  1OE8 A;  3WGX A;  1T4Y A;  6GSX A;  4K2X A;  4ECC A;  4HEA 2;  4K5R A;  3VPT A;  1OYJ A;  2GZP A;  4NPB A;  3BOA A;  3UJ1 A;  3GRX A;  3O3T A;  1Q98 A;  4BVY B;  3QD9 A;  1XWK A;  1USB A;  2YP6 A;  4EE0 A;  3GFK A;  2CX3 A;  2DJ1 A;  1J0F A;  5G1L A;  1AC1 A;  2GT6 A;  2YN1 A;  3WD6 A;  1EV4 A;  2VIM A;  4ICY A;  2I3Y A;  2E2M A;  3G7J A;  3TRQ A;  3UIW A;  4TKY A;  3M8N A;  1JZO A;  2C3N A;  2B6M A;  5L71 A;  3DD3 A;  1OC9 B;  2QC7 A;  2H73 A;  3KH9 A;  1THO A;  3GL5 A;  5D9X A;  1SU9 A;  1J9B A;  2WS2 A;  2PN8 A;  2VCV A;  18GS A;  2A2R A;  1JZW A;  3QFB C;  2L57 A;  4DSS A;  2A2S A;  1SYR A;  2OAC A;  5ECN B;  4N0Z A;  3WYW A;  1ZZY A;  2N5B A;  1TTZ A;  4IQA A;  3I69 A;  1JZD A;  2B1K A;  2KP1 A;  4GCI A;  5GAN D;  9GSS A;  5J9B A;  2IMI A;  4RI7 A;  4WBR D;  2B7K A;  4XTS A;  1W89 A;  3HVS A;  4POM A;  3ZIJ A;  1PSQ A;  4XRD A;  1EOH A;  4QL7 A;  4KW6 A;  2YV9 A;  4LMV A;  3O6T A;  4ISD A;  4WEY A;  5CRE A;  3LYK A;  5EL8 A;  2G0F A;  4PQI A;  3UEM A;  3A5W A;  2VOC A;  5IMV A;  2CAQ A;  3KCM A;  4MF5 A;  3CRT A;  4IHU A;  3HZ8 A;  2JZS A;  3VWU A;  1DBY A;  6GST A;  1IYH A;  2R37 A;  2DKI A;  1WP0 A;  2C1Y A;  1ZYE A;  4KDY A;  1GSU A;  2B7J A;  4EIP A;  2JSY A;  3IOS A;  3BJ5 A;  5IO2 A;  3K8N A;  4MJE A;  4I2T A;  2CT6 A;  2VL3 A;  2P0G A;  4GSN A;  4JU5 A;  2MMO A;  4KCE A;  1WOU A;  5EVO A;  3QMX A;  2X99 A;  2LJR A;  2O87 A;  2OKA A;  1OVN A;  1GWC A;  5A4U A;  3LG6 A;  3GX8 A;  3UAR A;  4LMW A;  1SK1 A;  3C7M A;  5INY A;  4DVC A;  5ID2 B;  1DUG A;  2CZ2 A;  3GX0 A;  1ZYP A;  1K0M A;  1YKC A;  2H01 A;  1GUK A;  4EF0 A;  3LSZ A;  3WGE A;  1QXH A;  5IPG A;  2VCT A;  1W4V A;  3P7X A;  1HNB A;  5B7C A;  4AJ8 A;  3KTL A;  4KGI A;  1S3A A;  3R2Q A;  2CVD A;  3ZIV A;  2H0I A;  4EDY A;  3DVX A;  4OCE A;  4N11 A;  2V6O A;  1ERW A;  3NZN A;  5G5F A;  3Q19 A;  3M9J A;  4I5Q A;  3ERW A;  2VLV A;  3KP8 A;  3C1R A;  5ECK B;  1XVW A;  5JWO B;  3S9F A;  1TRW A;  1PN0 A;  1HD2 A;  4CW9 A;  4IVF A;  5FHI A;  4K2D A;  3GTU A;  3FZ9 A;  3LFL A;  3KP9 A;  2H75 A;  2AUV A;  4NHW A;  3LYP A;  1ERV A;  3GH6 A;  5DAL A;  2DML A;  3E0U A;  5F07 A;  3F4S A;  3QFA C;  4GF0 A;  2XPD A;  2JZR A;  4TW5 A;  1T7P B;  1YEX A;  1M99 A;  2L59 A;  4MMM A;  4KSO A;  4USS A;  3ZTL A;  3IR4 A;  4RI6 A;  4ZL9 A;  1BQ7 A;  3ZZX A;  4RQR A;  4O5U A;  1TRV A;  3TJJ A;  1JHB A;  4DEJ A;  3RAZ A;  3W8J A;  1GUH A;  4NV2 A;  4MZB A;  3MSZ A;  3MWH A;  3TRX A;  2FWF A;  3GKK A;  3MIX A;  1HYU A;  1Q4J A;  4IBP A;  1MDK A;  4ZIL A;  2JZT A;  5D9W A;  2X8G A;  1OAZ A;  3ZFL A;  1XFL A;  3IC8 A;  1EP7 A;  5DCG A;  1TJD A;  2GGT A;  4PUA A;  4TOP A;  2QA1 A;  3TCO A;  1B9X C;  2C8U A;  2LTK A;  5CRW A;  2R5G A;  4YH2 A;  1EGR A;  2GDR A;  3CSI A;  2OA7 A;  1R5A A;  2HRA A;  2AB6 A;  4K7O A;  1WJK A;  4NHZ A;  1PRX A;  4KA0 A;  2O85 A;  2VM1 A;  4MH3 A;  4MPF A;  5A4W A;  4HQZ A;  4MCU A;  2DSA A;  5CAX A;  10GS A;  3FYG A;  4MA9 A;  3BCK A;  1K0N A;  2EIR A;  1F3A A;  2YZH A;  3VI7 A;  4PNG A;  3F4T A;  1O8X A;  4NMU A;  3MNG A;  3UVH A;  4F0B A;  3SBC A;  3WT1 A;  5ECI B;  1R5P A;  2XHF A;  4MAB A;  2V2G A;  2YZU A;  2DJK A;  3ZRE A;  1GSY A;  4G0K A;  3TRP A;  5B8A A;  5HR3 A;  5B6M A;  3D22 A;  2K8S A;  2CX4 A;  5ECR B;  4CY8 A;  2IJY A;  5D9T A;  2VCW A;  4KCA A;  2CV4 A;  1DSB A;  5GSS A;  2GQK A;  3GH9 A;  4AJ7 A;  3EYT A;  4Q5R A;  3VK9 A;  1M2A A;  4WF4 A;  5AIV A;  1YY7 A;  3KXO A;  2LEG A;  2WDU A;  2DKH A;  2FA4 A;  1O7U A;  3UL3 A;  2J9H A;  3GSS A;  4YQM A;  2OBI A;  2MYG A;  4IP1 A;  3H1N A;  1GTA A;  4ACS A;  1TI1 A;  4TR4 A;  1RQM A;  1O85 A;  4IW9 A;  2J23 A;  1GSD A;  2HRN A;  1EGO A;  3HJO A;  2PWJ A;  5DQY A;  4GTU A;  2R2J A;  4G19 A;  4ZB8 A;  3ZRD A;  1YDK A;  2IPA A;  1AXD A;  2WB9 A;  4BPY A;  5D96 A;  3D6I A;  3BD2 A;  2IWT A;  1B8X A;  4E8E A;  1NW2 A;  4N0V A;  1EZK A;  4NXI A;  1CQG A;  2RUF A;  2C0G A;  1S3D A;  1F3B A;  3TKP A;  1FHE A;  2FY6 A;  3GTU B;  2MZC A;  5ECP B;  3DEX A;  3CRU A;  3ME8 A;  2CAI A;  2FWE A;  3DRN A;  3CSJ A;  4OFM A;  2F8F A;  1G6Y A;  1AQV A;  2H8L A;  2L6D A;  2P31 A;  1A0F A;  2YNX A;  5GST A;  3DVW A;  3L78 A;  4TRX A;  2A4H A;  2H72 A;  5HQP A;  5AIX A;  3F9U A;  2HFD A;  2IL3 A;  3H79 A;  2GVP A;  2F3M A;  1YQ1 A;  5HR1 A;  2AYT A;  4OD7 A;  1SK0 A;  3VPQ A;  2XBI A;  3AY8 A;  4X43 A;  5DDL A;  5GAP D;  2IFQ A;  1GSQ A;  3C1S A;  4G0L A;  1ZL9 A;  2GSS A;  4ULX A;  1NHY A;  3A2V A;  1G7O A;  1RK4 A;  1ILO A;  3TJB A;  2YCD A;  2H0G A;  2R0G A;  2K9F A;  4HS1 A;  4HJM A;  5B6N A;  2QGV A;  2VCX A;  5G31 A;  2KHP A;  2VL2 C;  3NOF A;  4MF7 A;  4Q5Q A;  2TRX A;  4KSM A;  2PMT A;  2H76 A;  4IJ3 A;  2Z9S A;  1X5D A;  3WGD A;  3D4M A;  1TK5 B;  3D21 A;  3F3Q A;  2B1L A;  3TKQ A;  5FT3 A;  1T4Z A;  1Z5Y E;  1YF0 A;  1KTE A;  3KEB A;  3Q74 A;  3FY7 A;  3UBL A;  4K6X A;  4YAV A;  4J2F A;  3LWA A;  1SKR B;  4HU9 A;  2WFC A;  4V2M A;  1SJI A;  5AN1 A;  2E2G A;  3PPU A;  2CVK A;  3TUE A;  2YWO A;  2LRC A;  4WET A;  4V2L A;  4ZXG A;  1JLV A;  3EU3 A;  1XOB A;  5G2Z A;  1M2B A;  3IA1 A;  3DXB A;  4XCS A;  4O5Q A;  3FMW A;  4Q5F A;  5JCG A;  2OE0 A;  3EU4 A;  1XOA A;  3GKN A;  2HYX A;  2BMX A;  4CY6 A;  4Z2R A;  4EVM A;  1Z3E A;  5KN1 A;  1ACV A;  1VF2 A;  2X4A A;  3L0H A;  4EXJ A;  1PD2 1;  2MMA A;  1BJX A;  4V1A g;  4FH8 A;  1TK8 B;  4O7H A;  2FUG 2;  1AUC A;  2R3X A;  3U6V A;  2HI7 A;  2PUK C;  4GSS A;  1K0O A;  2H1B A;  3TKR A;  3V1W A;  4ZL7 A;  2D2Z A;  1F9M A;  3LW9 A;  2GQM A;  1IYI A;  3W8S A;  3ZML A;  1PN9 A;  1TOF A;  3DWV A;  3H4K A;  2GZZ A;  4TR1 A;  2NPB A;  4AF2 A;  4K7I A;  4IEL A;  1PMT A;  1M7T A;  3D0Z A;  3GMF A;  3MDK A;  1SD8 A;  5CNW A;  2WGR A;  2BTO T;  4BWQ A;  1Z7R A;  2YV7 A;  3LEF A;  5IMA A;  3QCP A;  2X8H A;  2B5X A;  1ZMA A;  2VD0 A;  4ZB9 A;  3F4R A;  1SKW B;  2HLS A;  5ECQ B;  3KMO A;  2F9S A;  2P5R A;  1TDI A;  4X1U A;  1WPI A;  1RW1 A;  2VD1 A;  5H5R A;  4K8M A;  2VO4 A;  3GYK A;  2HSY A;  3RHC A;  2OE3 A;  5EY6 A;  3GIX A;  1TRU A;  1I5G A;  1VGL A;  2EIO A;  2PVO C;  4YKF A;  3F3R A;  3KD0 A;  1X9W B;  4PTS A;  4D73 A;  4EIQ A;  5J4U A;  2GLR A;  3GUS A;  2IFQ B;  3L9S A;  1GNW A;  1HNA A;  4ML6 A;  1SJZ A;  4GWR A;  1THX A;  2I1U A;  5H5S A;  3IRA A;  4YQV A;  2DJJ A;  4ILF A;  1GLP A;  1CQH A;  1FW1 A;  4K5S A;  2C3Q A;  2VL2 A;  3CBU A;  4ML1 A;  3FKF A;  3L9V A;  2WCI A;  2FGX A;  2HRK A;  5IO0 A;  3IHG A;  2GT5 A;  3IHQ A;  2PGT A;  2DIZ A;  4EDZ A;  17GS A;  2FA8 A;  1K3L A;  1QFN A;  2H70 A;  4GXZ A;  4I6X A;  2XBQ A;  2MBT A;  4A5P A;  1HQO A;  1T00 A;  2H1D A;  5CRG A;  1AQW A;  3ZVJ A;  2PPT A;  1Z9H A;  4PX1 A;  2NTO A;  5HFI A;  1SYX A;  4HU7 A;  2E0Q A;  3EIN A;  5KOW A;  2HSH A;  4HZ2 A;  3DML A;  5C04 A;  2WRT A;  2FNO A;  5DJM A;  4JRR A;  3LQ7 A;  4OO4 A;  1X0R A;  4KAE A;  1U3I A;  3SWL A;  4F82 A;  1DE1 A;  2YJ7 A;  1M0U A;  2H19 A;  3HCZ A;  4LLR A;  1T1V A;  3N5O A;  4TR3 A;  2M72 A;  3I9V 2;  3KGK A;  3F6D A;  3APS A;  5KN3 A;  1XBS A;  4BVX A;  5KOX A;  1FOH A;  6GSU A;  5IMZ A;  4IKH A;  3APQ A;  3O76 A;  1GSF A;  3VUR A;  1SJ6 A;  1V9W A;  4L5O A;  1WMJ A;  1JZR A;  4GRF A;  3DYR A;  1FB0 A;  3FRC A;  4X4J A;  4XS1 A;  2H6X A;  4HZ4 A;  3TKS C;  1MD3 A;  2KUC A;  2N5A A;  4POL A;  3IBH A;  2O7K A;  2N5F A;  1GTU A;  1XWG A;  3HKR A;  5F05 A;  2YWN A;  2P5Q A;  2GZY A;  2O8V B;  1QMV A;  3VFI A;  1ML6 A;  3IV4 A;  3IE3 A;  4WBJ A;  3QPM A;  4DSS B;  5AIS A;  2A2P A;  1QUW A;  4N30 A;  2B3S A;  2H66 A;  1GTB A;  2ZNM A;  2E7P A;  4JR6 A;  5LNK e;  3FK8 A;  4BWS A;  3HVV A;  22GS A;  1T3B A;  3GA4 A;  3MYD A;  3CYN A;  5ECM B;  1WE0 A;  4QL9 A;  4IN0 A;  1LBK A;  2YOI A;  5COH A;  4JE1 A;  2MMZ A;  2AAW A;  3TOT A;  3GKX A;  3N9J A;  3GST A;  4TR1 B;  1LJR A;  4F03 A;  5A4V A;  3GHA A;  3RPP A;  1YF1 A;  1VF4 A;  3HVX A;  1XZO A;  2QKE A;  1AAZ A;  4PGT A;  3ZL5 A;  2FD3 A;  3TJG A;  3F0I A;  5DVB A;  2DJ0 A;  1LU4 A;  2IMK A;  2DJ2 A;  4BVY A;  3FEU A;  3H8Q A;  2L4Q A;  3IAS 2;  6GSV A;  4MJC A;  1PGT A;  4XHM A;  2M46 A;  4FIW A;  4FYU A;  1YJ6 A;  5ENU A;  1C72 A;  3VI5 A;  1XW6 A;  1A24 A;  1KBN A;  4L0U A;  2C3T A;  4E8H A;  1ON4 A;  2CQ9 A;  3KZQ A;  5A5K A;  5BMU A;  4G2E A;  1Z6N A;  2L5O A;  2MMN A;  2K6V A;  2RLI A;  4TXO A;  2NVL A;  1V57 A;  4MH2 A;  4Z2U A;  2DJ3 A;  4JZQ A;  2OJL A;  5LCZ A;  3HHV A;  1F37 A;  1ZYN A;  1NHO A;  4DSQ A;  2CA8 A;  2FWG A;  1Z6M A;  5CRD A;  4MZC A;  5CO3 A;  3UBK A;  1TP9 A;  2FLS A;  4ZB6 A;  3M1G A;  1Z7P A;  2A4V A;  5IQY A;  3DGQ A;  1N8J A;  2LV3 A;  3TKS E;  3EPT A;  3CXG A;  4HJ2 A;  4MPG A;  4F0C A;  2LUS A;  2JAC A;  3U5R E;  2HNL A;  2R4V A;  3I6A A;  4FYB A;  4XRA A;  5D8I A;  1K3O A;  1TXX A;  4ID0 A;  5IOX A;  2RM6 A;  2NDO A;  2LQQ A;  3H93 A;  3EVI A;  3TJF A;  5E59 A;  5CP1 A;  2DIY A;  2EIQ A;  1BX9 A;  5D93 A;  1SD9 A;  4L8E A;  2OBK A;  4XIH A;  3HZ4 A;  4P3Y B;  1BAY A;  5DAL B;  3GV1 A;  1AW9 A;  4KH7 A;  1SEN A;  3R3E A;  2ZCT A;  3M0F A;  3WT2 A;  6GSY A;  2LJA A;  1EP8 A;  5KN0 A;  2IIY A;  1B9Y C;  3HD5 A;  1PX6 A;  1NM3 A;  4JBB A;  3IAM 2;  2HZF A;  1UA5 A;  1U6T A;  2V32 A;  1OKD A;  3ERF A;  3ERG A;  3HA9 A;  1K3Y A;  3RBT A;  5ELA A;  4ECI A;  4PUF C;  5IMD A;  1FOV A;  1PKZ A;  4BVX B;  3OR5 A;  1GSE A;  4OWY A;  3A5I A;  5CYY A;  1V98 A;  1OC8 A;  2ON7 A;  3IK9 A;  3TKS A;  3GNJ A;  1TI3 A;  3I43 A;  1O81 A;  3G7Y A;  2QSI A;  4IP6 A;  1X9S B;  1M2D A;  1EV9 A;  4HUA A;  4EKZ A;  4MP4 A;  1NSW A;  2AHE A;  4ZBD A;  3UVT A;  2AV4 A;  2H71 A;  3F8U A;  2H6Z A;  1XCC A;  3KIJ A;  2OAD A;  2C0D A;  5F8B A;  3ZVJ D;  3ZLP A;  2R0C A;  2YWM A;  1TU8 A;  3PGT A;  1TU7 A;  3EC3 A;  1O73 A;  2YJH A;  2H6Y A;  5GZZ B;  4FO5 A;  2C0E A;  4GST A;  4RUV A;  1VRS D;  2VLT A;  2JL4 A;  4MDC A;  5KEJ A;  1X5C A;  1U3A A;  1Y25 A;  1XVQ A;  2RM5 A;  1I9D A;  5JWQ B;  2GST A;  1FO5 A;  5HFK A;  3E3E A;  4HI7 A;  1X9M B;  20GS A;  5JWR B;  4ZL8 A;  1AIU A;  3QOU A;  5DAK A;  1GRX A;  3HXS A;  2B5Y A;  2L6C A;  1X5E A;  2PU9 C;  3DKS A;  2ES7 A;  3QAV A;  1A2M A;  2LNT A;  3QR6 A;  2AJQ B;  4N10 A;  5E4W A;  2X49 A;  4H86 A;  2I4A A;  3FZA A;  3PH9 A;  1UN2 A;  2I81 A;  5DQS A;  5G30 A;  4OCF A;  4J56 E;  3RDW A;  2R0P A;  4JR4 A;  2PVQ A;  1OE7 A;  2TRC P;  4XS4 A;  5KN2 A;  5G5E A;  2VAF A;  2V41 A;  11GS A;  3HDC A;  2PER A;  2K18 A;  4WXT A;  4XS6 A;  4DSR A;  4KF9 A;  4CHS A;  2DMM A;  2LJK A;  4HDE A;  4TXO B;  3A2W A;  2JSZ A;  4EL1 A;  4MZW A;  1GL8 A;  2LNS A;  5D9V A;  3DIE A;  4HQS A;  2GSQ A;  2TIR A;  3TJK A;  1EEJ A;  1TW9 A;  3P90 A;  4AJ6 A;  1SK2 A;  19GS A;  1GLQ A;  2L4C A;  4OFT A;  4K0N A;  4K9Z A;  1HNC A;  3CMI A;  4G9H A;  1GP1 A;  5EPF A;  2PBJ A;  4KB3 A;  4IS0 A;  2IMD A;  3CTF A;  1SKS B;  3FZ5 A;  3KMN A;  1YEP A;  4TXV A;  4F9Z A;  1G6W A;  5DCH A;  4Z2T A;  2WJU A;  4CDO A;  3VLN A;  3RPN A;  3TOU A;  4WR4 A;  1U87 A;  2VM2 A;  2YPM A;  1R4W A;  4WKW A;  4WF5 A;  4GQF A;  4KUN A;  5HR2 A;  1H4O A;  3GL3 A;  3EE2 A;  1PL1 A;  4I2U A;  1PQN A;  1YKA A;  3A3T A;  4Z7X A;  1PA3 A;  2OE1 A;  1S3C A;  1E2Y A;  1A8L A;  1YZX A;  1O6J A;  4I8B A;  8GSS A;  4GQC A;  4Q5N A;  1ERU A;  2V1M A;  1VF3 A;  4KX4 A;  4TVE A;  4KND A;  3IC4 A;  1R26 A;  3EUR A;  3L4N A;  3Q6O A;  1ERT A;  1FAA A;  1M9A A;  1QK8 A;  3ISO A;  5AGY A;  1G7E A;  5ELG A;  3E9J B;  1MTC A;  2JAD A;  1MEK A;  4RQX A;  1URM A;  2X64 A;  4PUR A;  5HR0 A;  4ECJ A;  5J5N A;  3D5J A;  3J7Y k;  1G0T A;  2KP2 A;  1V2A A;  3C71 A;  5JCW A;  1F2E A;  1V58 A;  2VL9 A;  2VLU A;  1BYE A;  2LRN A;  3ZIT A;  1QQ2 A;  3APO A;  3EWL A;  1PKW A;  2FHE A;  3PIN A;  2ON5 A;  1T8E B;  2FCH A;  2RII A;  2HRF A;  1M9B A;  5FWG A;  5BRT A;  1ST9 A;  2O89 A;  1UC7 A;  5JCU A;  3W6G A;  1MD4 A;  3FR3 A;  3BCI A;  3FW2 A;  3CTG A;  1ZOF A;  4OO5 A;  3VWV A;  2HT9 A;  2I9H A;  3NIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...