3I47A

Crystal structure of putative enoyl coa hydratase/isomerase (crotonase) from legionella pneumophila subsp. pneumophila str. philadelphia 1
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
259
structure length
259
Chain Sequence
SLSDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGKHFSAGADLTWMQSMANFTEEENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLGLIPAVISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLEFTLKYASQISNNAPEAVKNSKQLAQYVANKKIDEELVRYTASLIAHKRVSDEGQEGLKAFLNKEIPNWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF putative enoyl CoA hydratase/isomerase (crotonase) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Lyase
molecule keywords Enoyl CoA hydratase/isomerase (Crotonase)
total genus 101
structure length 259
sequence length 259
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2009-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3i47A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3i47A01
1FC9A 1PIXA 1HZDA 5DL1A 4L6WA 5INIA 1DCIA 4LK5A 5DU6A 3T8BA 2DUBA 4JWVA 1JXZA 2J5GD 5KDRA 4JCTA 1OD2A 3GMAA 1FC6A 2QQ3A 3FDUA 4KD6A 3BF0A 4WZ8B 4Z0MA 3HINA 2VX2A 3ISAA 3MT6A 3FF6A 1HNUA 1SG4A 2BZRA 3T88A 1UYVA 2VREA 4ZDFA 3MYBA 1X0UA 2IEXA 1J7XA 4JSBA 4OLQA 2ZL2A 3TRRA 5DUFA 5INGA 3U9SB 3TDCA 3MFMA 3IBBA 4B3IA 3Q0JA 1EF9A 4Q0GA 2GTRA 3RSIA 1MJ3A 3V5IA 2CBYA 2F9IB 4KNPA 3MOYA 4QFEA 4K29A 5DKPA 1O8UA 4B3JA 1PJHA 5DTWA 3P85A 3K50A 1UYRA 4ELSA 4KPKA 3QXIA 4WCZA 2FBMA 3ZW8A 4JFCA 3T89A 4JVTA 3KTKA 5G1QA 5CTCA 2A81A 5DZKA 1OD4A 4I52A 4WYOB 2J5IA 1UYSA 1YG6A 2HW5A 3HRXA 3K8XA 5IKLB 1UYTA 2VSSE 3IB9A 3R9SA 4K2NA 3H0SA 4JCQA 4FB8A 3H02A 3ZW9A 4B3HA 1N6DA 5G1SA 2ZQRA 2UZFA 4ZU2A 5E0SA 3OC7A 3GLMA 2CE3A 1XX4A 4FZWA 3TLFA 2FW2A 3HLN1 3ZWAA 4ASIA 4U0GA 2WTBA 1ON9A 1Y7OA 2F9YA 4FNDA 3G64A 2FZSA 4OG1A 3T8AA 4RCNA 3RRVA 4JJTA 3R6HA 1EY3A 2J5II 1TG6A 3JU1A 3IAVA 2VSUC 5CTBA 2VSUF 1SZOA 3RSTA 5JBWA 4U19A 3T3WA 1ON3A 3GF7A 4JCSA 3WG5A 4FN7A 2A7SA 1DUBA 4FNBA 1XNYA 4GHNA 3STAA 1UIYA 1RJNA 4EMLA 3H0UA 4QIIA 1XNVA 3PE8A 3TVUA 3QMJA 4JYLA 3DORA 3U9TB 3PZKA 1N6FA 4RYFH 1NZYB 1TYFA 2ZL0A 4I42A 4HC8A 4ZDCA 2D3TA 2F9IA 3ST9A 1WDMA 1VRGA 4KWBA 2Q34A 4NEKA 1YG8A 2PBPA 4U0HA 3H81A 4ZDBA 3HP0A 1WDKA 2VSSA 4ZDEA 4JCRA 3R9QA 3TT6A 4YLHA 3NJBA 2X58A 4MOUA 4OMRA 3NJDA 2ZQQA 3Q1TA 3M6NA 4MXIA 3KTHA 1WDLA 3OMEA 3V5EA 3QWDA 5G1RA 5DU8A 3QYRA 4DI1A 2DEOA 3L3SA 3QK8A 1FC7A 5KDRB 4U0GH 2F6IA 1EF8A 5JBXA 4JOTA 4IZDA 3H0JA 1XO6A 3GKBA 3KTGA 3BEZA 5E0NX 4NNQA 4FJWD 2J5GA 3TZ3A 5DZKH 4JYJA 3TVWA 2VSUA 4EMMA 3I47A 5DU4A 2ZL4A 1RJMA 1FCFA 4RYFA 2Q35A 3LKEA 3LAOA 4ELWA 3Q0GA 2J5SA 3OT6A 2EJ5A 2X24A 3QKAA 4IZCA 4MI2A 3H0QA 1K32A 2ZL3A 3KTJA 5C90A 5C9GA 3M6MA 5E0SH 4K3WA 1W2XA 4U1AA 4I4ZA 1XNWA 3PGQA 3GF3A 2NP9A 5FUSA 5DUCA 4ELXA 4Q1IA 2PG8A 2F6QA 3R9TA 2Q2XA 1WZ8A 3U9RB 3BPPA 2W3PA 4FZWC 1NZYA 1Q51A 3TV5A 5INFA 4HNKA 3SLLA 2J5IB 4U18A 3KTIA 3PEAA 4EMPA 1Q52A 3TT7A 3ZWCA 2A7KA 3R0OA 4QIJA 1N6EA 3N6RB 3DJAA 5MGBA 4ZDDA 3P2LA 3QXZA 2F9YB 2VSUE 4L8KA 3QREA 3KQFA 4FN8A 4GM2A 2PPYA 1HNOA 5DTPA 3Q7HA 3P5MA 3SWXA 4G2RA 3ZWBA 2C8TA 3HE2A 5FIFA 4F47A 1K39A 5KJPA 3VIVA 4IZBA 2VSSF
chains in the Genus database with same CATH superfamily
1FC9A 1PIXA 1HZDA 5DL1A 4J2UA 4L6WA 5INIA 1DCIA 4LK5A 5DU6A 3T8BA 2DUBA 3ADDA 4JWVA 1JXZA 2J5GD 5KDRA 4JCTA 1OD2A 3GMAA 1FC6A 2QQ3A 3W8IB 3FDUA 4KD6A 3BF0A 4WZ8B 4Z0MA 3HINA 2VX2A 3ISAA 3MT6A 3FF6A 1HNUA 1SG4A 2BZRA 3T88A 1UYVA 2VREA 3ADBA 4ZDFA 3MYBA 1X0UA 2IEXA 1J7XA 4JSBA 4OLQA 2ZL2A 3TRRA 5DUFA 5INGA 3U9SB 3TDCA 3MFMA 3IBBA 4B3IA 3Q0JA 1EF9A 4Q0GA 5HUQA 2GTRA 3RSIA 1MJ3A 3V5IA 2CBYA 2F9IB 4KNPA 3MOYA 4QFEA 4K29A 5DKPA 3BPTA 1O8UA 4B3JA 1PJHA 5DTWA 3P85A 3K50A 1UYRA 4ELSA 4KPKA 3QXIA 4WCZA 2FBMA 3ZW8A 4JFCA 3T89A 3RQEA 4JVTA 3KTKA 5G1QA 5CTCA 2A81A 5DZKA 1OD4A 4I52A 4WYOB 2J5IA 1UYSA 1YG6A 2HW5A 3HRXA 3K8XA 5IKLB 1UYTA 2VSSE 3IB9A 3R9SA 4K2NA 2P63A 3H0SA 4JCQA 4FB8A 3H02A 3ZW9A 4B3HA 1N6DA 5G1SA 2ZQRA 3IRBA 3A4NA 2UZFA 4ZU2A 5E0SA 3OC7A 3GLMA 2CE3A 1XX4A 4FZWA 3TLFA 1UX4A 2FW2A 3HLN1 3ZWAA 4ASIA 4U0GA 2WTBA 1ON9A 1Y7OA 2F9YA 4FNDA 3G64A 2FZSA 4OG1A 3T8AA 4RCNA 3RRVA 2YJGA 4JJTA 3R6HA 1EY3A 2J5II 1TG6A 3JU1A 3IAVA 2VSUC 5CTBA 4HDTA 2VSUF 1SZOA 3RSTA 5JBWA 3W8HB 4U19A 3T3WA 1ON3A 3GF7A 4JCSA 3WG5A 4FN7A 2A7SA 1DUBA 4FNBA 1XNYA 4GHNA 3STAA 4GEHB 1UIYA 1RJNA 4EMLA 3AM1A 3H0UA 4QIIA 1XNVA 3PE8A 3TVUA 3QMJA 4JYLA 3DORA 3U9TB 3PZKA 1N6FA 4RYFH 1NZYB 1TYFA 2ZL0A 4I42A 4HC8A 4ZDCA 2D3TA 2F9IA 3ST9A 1WDMA 1VRGA 4KWBA 2Q34A 4NEKA 1YG8A 2PBPA 4U0HA 3H81A 4ZDBA 3HP0A 1WDKA 2VSSA 4ZDEA 4JCRA 3R9QA 3TT6A 4YLHA 3NJBA 2X58A 4MOUA 4OMRA 3NJDA 2ZQQA 3Q1TA 3M6NA 4MXIA 3L8JA 3KTHA 1WDLA 3OMEA 3V5EA 3QWDA 5G1RA 5DU8A 3QYRA 4DI1A 2DEOA 3L3SA 3QK8A 1FC7A 5KDRB 4U0GH 2F6IA 1EF8A 5JBXA 4JOTA 4IZDA 3H0JA 1XO6A 3GKBA 3KTGA 3BEZA 5E0NX 4NNQA 4FJWD 2J5GA 3TZ3A 4NARA 5DZKH 4JYJA 3RQFA 3TVWA 2VSUA 4EMMA 3I47A 3L8IA 5DU4A 2ZL4A 1RJMA 1FCFA 4RYFA 2Q35A 3LKEA 3LAOA 4ELWA 3Q0GA 2J5SA 3OT6A 2EJ5A 2X24A 3QKAA 4IZCA 4MI2A 3H0QA 1K32A 2ZL3A 3KTJA 5C90A 5C9GA 3M6MA 5E0SH 4K3WA 1W2XA 4U1AA 4I4ZA 1XNWA 3PGQA 3GF3A 2NP9A 5FUSA 5DUCA 4ELXA 4Q1IA 2PG8A 2F6QA 3RQGA 3R9TA 3A4MA 2Q2XA 1WZ8A 3U9RB 3A4LA 3BPPA 2W3PA 4FZWC 1NZYA 1Q51A 3AJMA 3TV5A 5INFA 4HNKA 3SLLA 2J5IB 4U18A 3ADCA 3KTIA 3PEAA 4EMPA 1Q52A 3TT7A 3ZWCA 2A7KA 3R0OA 4QIJA 1N6EA 3N6RB 3DJAA 5MGBA 1Y64B 4ZDDA 3P2LA 3QXZA 2F9YB 2VSUE 4L8KA 3QREA 3KQFA 4FN8A 4GM2A 2PPYA 1HNOA 5DTPA 3Q7HA 3P5MA 3SWXA 4G2RA 3ZWBA 2C8TA 3HE2A 5FIFA 4F47A 1K39A 5KJPA 3VIVA 3O4XE 4IZBA 2VSSF 1UX5A
chains in the Genus database with same CATH topology
1FC9A 1PIXA 1HZDA 5DL1A 4J2UA 4L6WA 5INIA 1DCIA 4LK5A 5DU6A 3T8BA 2DUBA 4JWVA 1JXZA 2J5GD 5KDRA 4JCTA 1OD2A 3GMAA 1FC6A 2QQ3A 3FDUA 4KD6A 3BF0A 4WZ8B 4Z0MA 3HINA 2VX2A 3ISAA 3MT6A 3FF6A 1HNUA 1SG4A 2BZRA 3T88A 1UYVA 2VREA 4ZDFA 3MYBA 1X0UA 2IEXA 1J7XA 4JSBA 4OLQA 2ZL2A 3TRRA 5DUFA 5INGA 3U9SB 3TDCA 3MFMA 3IBBA 4B3IA 3Q0JA 1EF9A 4Q0GA 5HUQA 2GTRA 3RSIA 1MJ3A 3V5IA 2CBYA 2F9IB 4KNPA 3MOYA 4QFEA 4K29A 5DKPA 3BPTA 1O8UA 4B3JA 1PJHA 5DTWA 3P85A 3K50A 1UYRA 4ELSA 4KPKA 3QXIA 4WCZA 2FBMA 3ZW8A 4JFCA 3T89A 4JVTA 3KTKA 5G1QA 5CTCA 2A81A 5DZKA 1OD4A 4I52A 4WYOB 2J5IA 1UYSA 1YG6A 2HW5A 3HRXA 3K8XA 5IKLB 1UYTA 2VSSE 3IB9A 3R9SA 4K2NA 3H0SA 4JCQA 4FB8A 3H02A 3ZW9A 4B3HA 1N6DA 5G1SA 2ZQRA 2UZFA 4ZU2A 5E0SA 3OC7A 3GLMA 2CE3A 1XX4A 4FZWA 3TLFA 2FW2A 3HLN1 3ZWAA 4ASIA 4U0GA 2WTBA 1ON9A 1Y7OA 2F9YA 4FNDA 3G64A 2FZSA 4OG1A 3T8AA 4RCNA 3RRVA 2YJGA 4JJTA 3R6HA 1EY3A 2J5II 1TG6A 3JU1A 3IAVA 2VSUC 5CTBA 4HDTA 2VSUF 1SZOA 3RSTA 5JBWA 4U19A 3T3WA 1ON3A 3GF7A 4JCSA 3WG5A 4FN7A 2A7SA 1DUBA 4FNBA 1XNYA 4GHNA 3STAA 1UIYA 1RJNA 4EMLA 3H0UA 4QIIA 1XNVA 3PE8A 3TVUA 3QMJA 4JYLA 3DORA 3U9TB 3PZKA 1N6FA 4RYFH 1NZYB 1TYFA 2ZL0A 4I42A 4HC8A 4ZDCA 2D3TA 2F9IA 3ST9A 1WDMA 1VRGA 4KWBA 2Q34A 4NEKA 1YG8A 2PBPA 4U0HA 3H81A 4ZDBA 3HP0A 1WDKA 2VSSA 4ZDEA 4JCRA 3R9QA 3TT6A 4YLHA 3NJBA 2X58A 4MOUA 4OMRA 3NJDA 2ZQQA 3Q1TA 3M6NA 4MXIA 3KTHA 1WDLA 3OMEA 3V5EA 3QWDA 5G1RA 5DU8A 3QYRA 4DI1A 2DEOA 3L3SA 3QK8A 1FC7A 5KDRB 4U0GH 2F6IA 1EF8A 5JBXA 4JOTA 4IZDA 3H0JA 1XO6A 3GKBA 3KTGA 3BEZA 5E0NX 4NNQA 4FJWD 2J5GA 3TZ3A 4NARA 5DZKH 4JYJA 3TVWA 2VSUA 4EMMA 3I47A 5DU4A 2ZL4A 1RJMA 1FCFA 4RYFA 2Q35A 3LKEA 3LAOA 4ELWA 3Q0GA 2J5SA 3OT6A 2EJ5A 2X24A 3QKAA 4IZCA 4MI2A 3H0QA 1K32A 2ZL3A 3KTJA 5C90A 5C9GA 3M6MA 5E0SH 4K3WA 1W2XA 4U1AA 4I4ZA 1XNWA 3PGQA 3GF3A 2NP9A 5FUSA 5DUCA 4ELXA 4Q1IA 2PG8A 2F6QA 3R9TA 2Q2XA 1WZ8A 3U9RB 3BPPA 2W3PA 4FZWC 1NZYA 1Q51A 3TV5A 5INFA 4HNKA 3SLLA 2J5IB 4U18A 3KTIA 3PEAA 4EMPA 1Q52A 3TT7A 3ZWCA 2A7KA 3R0OA 4QIJA 1N6EA 3N6RB 3DJAA 5MGBA 4ZDDA 3P2LA 3QXZA 2F9YB 2VSUE 4L8KA 3QREA 3KQFA 4FN8A 4GM2A 2PPYA 1HNOA 5DTPA 3Q7HA 3P5MA 3SWXA 4G2RA 3ZWBA 2C8TA 3HE2A 5FIFA 4F47A 1K39A 5KJPA 3VIVA 4IZBA 2VSSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FC9 A;  1PIX A;  1HZD A;  5DL1 A;  4L6W A;  5INI A;  1DCI A;  4LK5 A;  5DU6 A;  3T8B A;  2DUB A;  4JWV A;  1JXZ A;  2J5G D;  5KDR A;  4JCT A;  1OD2 A;  3GMA A;  1FC6 A;  2QQ3 A;  3FDU A;  4KD6 A;  3BF0 A;  4WZ8 B;  4Z0M A;  3HIN A;  2VX2 A;  3ISA A;  3MT6 A;  3FF6 A;  1HNU A;  1SG4 A;  2BZR A;  3T88 A;  1UYV A;  2VRE A;  4ZDF A;  3MYB A;  1X0U A;  2IEX A;  1J7X A;  4JSB A;  4OLQ A;  2ZL2 A;  3TRR A;  5DUF A;  5ING A;  3U9S B;  3TDC A;  3MFM A;  3IBB A;  4B3I A;  3Q0J A;  1EF9 A;  4Q0G A;  2GTR A;  3RSI A;  1MJ3 A;  3V5I A;  2CBY A;  2F9I B;  4KNP A;  3MOY A;  4QFE A;  4K29 A;  5DKP A;  1O8U A;  4B3J A;  1PJH A;  5DTW A;  3P85 A;  3K50 A;  1UYR A;  4ELS A;  4KPK A;  3QXI A;  4WCZ A;  2FBM A;  3ZW8 A;  4JFC A;  3T89 A;  4JVT A;  3KTK A;  5G1Q A;  5CTC A;  2A81 A;  5DZK A;  1OD4 A;  4I52 A;  4WYO B;  2J5I A;  1UYS A;  1YG6 A;  2HW5 A;  3HRX A;  3K8X A;  5IKL B;  1UYT A;  2VSS E;  3IB9 A;  3R9S A;  4K2N A;  3H0S A;  4JCQ A;  4FB8 A;  3H02 A;  3ZW9 A;  4B3H A;  1N6D A;  5G1S A;  2ZQR A;  2UZF A;  4ZU2 A;  5E0S A;  3OC7 A;  3GLM A;  2CE3 A;  1XX4 A;  4FZW A;  3TLF A;  2FW2 A;  3HLN 1;  3ZWA A;  4ASI A;  4U0G A;  2WTB A;  1ON9 A;  1Y7O A;  2F9Y A;  4FND A;  3G64 A;  2FZS A;  4OG1 A;  3T8A A;  4RCN A;  3RRV A;  4JJT A;  3R6H A;  1EY3 A;  2J5I I;  1TG6 A;  3JU1 A;  3IAV A;  2VSU C;  5CTB A;  2VSU F;  1SZO A;  3RST A;  5JBW A;  4U19 A;  3T3W A;  1ON3 A;  3GF7 A;  4JCS A;  3WG5 A;  4FN7 A;  2A7S A;  1DUB A;  4FNB A;  1XNY A;  4GHN A;  3STA A;  1UIY A;  1RJN A;  4EML A;  3H0U A;  4QII A;  1XNV A;  3PE8 A;  3TVU A;  3QMJ A;  4JYL A;  3DOR A;  3U9T B;  3PZK A;  1N6F A;  4RYF H;  1NZY B;  1TYF A;  2ZL0 A;  4I42 A;  4HC8 A;  4ZDC A;  2D3T A;  2F9I A;  3ST9 A;  1WDM A;  1VRG A;  4KWB A;  2Q34 A;  4NEK A;  1YG8 A;  2PBP A;  4U0H A;  3H81 A;  4ZDB A;  3HP0 A;  1WDK A;  2VSS A;  4ZDE A;  4JCR A;  3R9Q A;  3TT6 A;  4YLH A;  3NJB A;  2X58 A;  4MOU A;  4OMR A;  3NJD A;  2ZQQ A;  3Q1T A;  3M6N A;  4MXI A;  3KTH A;  1WDL A;  3OME A;  3V5E A;  3QWD A;  5G1R A;  5DU8 A;  3QYR A;  4DI1 A;  2DEO A;  3L3S A;  3QK8 A;  1FC7 A;  5KDR B;  4U0G H;  2F6I A;  1EF8 A;  5JBX A;  4JOT A;  4IZD A;  3H0J A;  1XO6 A;  3GKB A;  3KTG A;  3BEZ A;  5E0N X;  4NNQ A;  4FJW D;  2J5G A;  3TZ3 A;  5DZK H;  4JYJ A;  3TVW A;  2VSU A;  4EMM A;  3I47 A;  5DU4 A;  2ZL4 A;  1RJM A;  1FCF A;  4RYF A;  2Q35 A;  3LKE A;  3LAO A;  4ELW A;  3Q0G A;  2J5S A;  3OT6 A;  2EJ5 A;  2X24 A;  3QKA A;  4IZC A;  4MI2 A;  3H0Q A;  1K32 A;  2ZL3 A;  3KTJ A;  5C90 A;  5C9G A;  3M6M A;  5E0S H;  4K3W A;  1W2X A;  4U1A A;  4I4Z A;  1XNW A;  3PGQ A;  3GF3 A;  2NP9 A;  5FUS A;  5DUC A;  4ELX A;  4Q1I A;  2PG8 A;  2F6Q A;  3R9T A;  2Q2X A;  1WZ8 A;  3U9R B;  3BPP A;  2W3P A;  4FZW C;  1NZY A;  1Q51 A;  3TV5 A;  5INF A;  4HNK A;  3SLL A;  2J5I B;  4U18 A;  3KTI A;  3PEA A;  4EMP A;  1Q52 A;  3TT7 A;  3ZWC A;  2A7K A;  3R0O A;  4QIJ A;  1N6E A;  3N6R B;  3DJA A;  5MGB A;  4ZDD A;  3P2L A;  3QXZ A;  2F9Y B;  2VSU E;  4L8K A;  3QRE A;  3KQF A;  4FN8 A;  4GM2 A;  2PPY A;  1HNO A;  5DTP A;  3Q7H A;  3P5M A;  3SWX A;  4G2R A;  3ZWB A;  2C8T A;  3HE2 A;  5FIF A;  4F47 A;  1K39 A;  5KJP A;  3VIV A;  4IZB A;  2VSS F; 
#chains in the Genus database with same CATH topology
 1FC9 A;  1PIX A;  1HZD A;  5DL1 A;  4J2U A;  4L6W A;  5INI A;  1DCI A;  4LK5 A;  5DU6 A;  3T8B A;  2DUB A;  3ADD A;  4JWV A;  1JXZ A;  2J5G D;  5KDR A;  4JCT A;  1OD2 A;  3GMA A;  1FC6 A;  2QQ3 A;  3W8I B;  3FDU A;  4KD6 A;  3BF0 A;  4WZ8 B;  4Z0M A;  3HIN A;  2VX2 A;  3ISA A;  3MT6 A;  3FF6 A;  1HNU A;  1SG4 A;  2BZR A;  3T88 A;  1UYV A;  2VRE A;  3ADB A;  4ZDF A;  3MYB A;  1X0U A;  2IEX A;  1J7X A;  4JSB A;  4OLQ A;  2ZL2 A;  3TRR A;  5DUF A;  5ING A;  3U9S B;  3TDC A;  3MFM A;  3IBB A;  4B3I A;  3Q0J A;  1EF9 A;  4Q0G A;  5HUQ A;  2GTR A;  3RSI A;  1MJ3 A;  3V5I A;  2CBY A;  2F9I B;  4KNP A;  3MOY A;  4QFE A;  4K29 A;  5DKP A;  3BPT A;  1O8U A;  4B3J A;  1PJH A;  5DTW A;  3P85 A;  3K50 A;  1UYR A;  4ELS A;  4KPK A;  3QXI A;  4WCZ A;  2FBM A;  3ZW8 A;  4JFC A;  3T89 A;  3RQE A;  4JVT A;  3KTK A;  5G1Q A;  5CTC A;  2A81 A;  5DZK A;  1OD4 A;  4I52 A;  4WYO B;  2J5I A;  1UYS A;  1YG6 A;  2HW5 A;  3HRX A;  3K8X A;  5IKL B;  1UYT A;  2VSS E;  3IB9 A;  3R9S A;  4K2N A;  2P63 A;  3H0S A;  4JCQ A;  4FB8 A;  3H02 A;  3ZW9 A;  4B3H A;  1N6D A;  5G1S A;  2ZQR A;  3IRB A;  3A4N A;  2UZF A;  4ZU2 A;  5E0S A;  3OC7 A;  3GLM A;  2CE3 A;  1XX4 A;  4FZW A;  3TLF A;  1UX4 A;  2FW2 A;  3HLN 1;  3ZWA A;  4ASI A;  4U0G A;  2WTB A;  1ON9 A;  1Y7O A;  2F9Y A;  4FND A;  3G64 A;  2FZS A;  4OG1 A;  3T8A A;  4RCN A;  3RRV A;  2YJG A;  4JJT A;  3R6H A;  1EY3 A;  2J5I I;  1TG6 A;  3JU1 A;  3IAV A;  2VSU C;  5CTB A;  4HDT A;  2VSU F;  1SZO A;  3RST A;  5JBW A;  3W8H B;  4U19 A;  3T3W A;  1ON3 A;  3GF7 A;  4JCS A;  3WG5 A;  4FN7 A;  2A7S A;  1DUB A;  4FNB A;  1XNY A;  4GHN A;  3STA A;  4GEH B;  1UIY A;  1RJN A;  4EML A;  3AM1 A;  3H0U A;  4QII A;  1XNV A;  3PE8 A;  3TVU A;  3QMJ A;  4JYL A;  3DOR A;  3U9T B;  3PZK A;  1N6F A;  4RYF H;  1NZY B;  1TYF A;  2ZL0 A;  4I42 A;  4HC8 A;  4ZDC A;  2D3T A;  2F9I A;  3ST9 A;  1WDM A;  1VRG A;  4KWB A;  2Q34 A;  4NEK A;  1YG8 A;  2PBP A;  4U0H A;  3H81 A;  4ZDB A;  3HP0 A;  1WDK A;  2VSS A;  4ZDE A;  4JCR A;  3R9Q A;  3TT6 A;  4YLH A;  3NJB A;  2X58 A;  4MOU A;  4OMR A;  3NJD A;  2ZQQ A;  3Q1T A;  3M6N A;  4MXI A;  3L8J A;  3KTH A;  1WDL A;  3OME A;  3V5E A;  3QWD A;  5G1R A;  5DU8 A;  3QYR A;  4DI1 A;  2DEO A;  3L3S A;  3QK8 A;  1FC7 A;  5KDR B;  4U0G H;  2F6I A;  1EF8 A;  5JBX A;  4JOT A;  4IZD A;  3H0J A;  1XO6 A;  3GKB A;  3KTG A;  3BEZ A;  5E0N X;  4NNQ A;  4FJW D;  2J5G A;  3TZ3 A;  4NAR A;  5DZK H;  4JYJ A;  3RQF A;  3TVW A;  2VSU A;  4EMM A;  3I47 A;  3L8I A;  5DU4 A;  2ZL4 A;  1RJM A;  1FCF A;  4RYF A;  2Q35 A;  3LKE A;  3LAO A;  4ELW A;  3Q0G A;  2J5S A;  3OT6 A;  2EJ5 A;  2X24 A;  3QKA A;  4IZC A;  4MI2 A;  3H0Q A;  1K32 A;  2ZL3 A;  3KTJ A;  5C90 A;  5C9G A;  3M6M A;  5E0S H;  4K3W A;  1W2X A;  4U1A A;  4I4Z A;  1XNW A;  3PGQ A;  3GF3 A;  2NP9 A;  5FUS A;  5DUC A;  4ELX A;  4Q1I A;  2PG8 A;  2F6Q A;  3RQG A;  3R9T A;  3A4M A;  2Q2X A;  1WZ8 A;  3U9R B;  3A4L A;  3BPP A;  2W3P A;  4FZW C;  1NZY A;  1Q51 A;  3AJM A;  3TV5 A;  5INF A;  4HNK A;  3SLL A;  2J5I B;  4U18 A;  3ADC A;  3KTI A;  3PEA A;  4EMP A;  1Q52 A;  3TT7 A;  3ZWC A;  2A7K A;  3R0O A;  4QIJ A;  1N6E A;  3N6R B;  3DJA A;  5MGB A;  1Y64 B;  4ZDD A;  3P2L A;  3QXZ A;  2F9Y B;  2VSU E;  4L8K A;  3QRE A;  3KQF A;  4FN8 A;  4GM2 A;  2PPY A;  1HNO A;  5DTP A;  3Q7H A;  3P5M A;  3SWX A;  4G2R A;  3ZWB A;  2C8T A;  3HE2 A;  5FIF A;  4F47 A;  1K39 A;  5KJP A;  3VIV A;  3O4X E;  4IZB A;  2VSS F;  1UX5 A; 
#chains in the Genus database with same CATH homology
 1FC9 A;  1PIX A;  1HZD A;  5DL1 A;  4J2U A;  4L6W A;  5INI A;  1DCI A;  4LK5 A;  5DU6 A;  3T8B A;  2DUB A;  4JWV A;  1JXZ A;  2J5G D;  5KDR A;  4JCT A;  1OD2 A;  3GMA A;  1FC6 A;  2QQ3 A;  3FDU A;  4KD6 A;  3BF0 A;  4WZ8 B;  4Z0M A;  3HIN A;  2VX2 A;  3ISA A;  3MT6 A;  3FF6 A;  1HNU A;  1SG4 A;  2BZR A;  3T88 A;  1UYV A;  2VRE A;  4ZDF A;  3MYB A;  1X0U A;  2IEX A;  1J7X A;  4JSB A;  4OLQ A;  2ZL2 A;  3TRR A;  5DUF A;  5ING A;  3U9S B;  3TDC A;  3MFM A;  3IBB A;  4B3I A;  3Q0J A;  1EF9 A;  4Q0G A;  5HUQ A;  2GTR A;  3RSI A;  1MJ3 A;  3V5I A;  2CBY A;  2F9I B;  4KNP A;  3MOY A;  4QFE A;  4K29 A;  5DKP A;  3BPT A;  1O8U A;  4B3J A;  1PJH A;  5DTW A;  3P85 A;  3K50 A;  1UYR A;  4ELS A;  4KPK A;  3QXI A;  4WCZ A;  2FBM A;  3ZW8 A;  4JFC A;  3T89 A;  4JVT A;  3KTK A;  5G1Q A;  5CTC A;  2A81 A;  5DZK A;  1OD4 A;  4I52 A;  4WYO B;  2J5I A;  1UYS A;  1YG6 A;  2HW5 A;  3HRX A;  3K8X A;  5IKL B;  1UYT A;  2VSS E;  3IB9 A;  3R9S A;  4K2N A;  3H0S A;  4JCQ A;  4FB8 A;  3H02 A;  3ZW9 A;  4B3H A;  1N6D A;  5G1S A;  2ZQR A;  2UZF A;  4ZU2 A;  5E0S A;  3OC7 A;  3GLM A;  2CE3 A;  1XX4 A;  4FZW A;  3TLF A;  2FW2 A;  3HLN 1;  3ZWA A;  4ASI A;  4U0G A;  2WTB A;  1ON9 A;  1Y7O A;  2F9Y A;  4FND A;  3G64 A;  2FZS A;  4OG1 A;  3T8A A;  4RCN A;  3RRV A;  2YJG A;  4JJT A;  3R6H A;  1EY3 A;  2J5I I;  1TG6 A;  3JU1 A;  3IAV A;  2VSU C;  5CTB A;  4HDT A;  2VSU F;  1SZO A;  3RST A;  5JBW A;  4U19 A;  3T3W A;  1ON3 A;  3GF7 A;  4JCS A;  3WG5 A;  4FN7 A;  2A7S A;  1DUB A;  4FNB A;  1XNY A;  4GHN A;  3STA A;  1UIY A;  1RJN A;  4EML A;  3H0U A;  4QII A;  1XNV A;  3PE8 A;  3TVU A;  3QMJ A;  4JYL A;  3DOR A;  3U9T B;  3PZK A;  1N6F A;  4RYF H;  1NZY B;  1TYF A;  2ZL0 A;  4I42 A;  4HC8 A;  4ZDC A;  2D3T A;  2F9I A;  3ST9 A;  1WDM A;  1VRG A;  4KWB A;  2Q34 A;  4NEK A;  1YG8 A;  2PBP A;  4U0H A;  3H81 A;  4ZDB A;  3HP0 A;  1WDK A;  2VSS A;  4ZDE A;  4JCR A;  3R9Q A;  3TT6 A;  4YLH A;  3NJB A;  2X58 A;  4MOU A;  4OMR A;  3NJD A;  2ZQQ A;  3Q1T A;  3M6N A;  4MXI A;  3KTH A;  1WDL A;  3OME A;  3V5E A;  3QWD A;  5G1R A;  5DU8 A;  3QYR A;  4DI1 A;  2DEO A;  3L3S A;  3QK8 A;  1FC7 A;  5KDR B;  4U0G H;  2F6I A;  1EF8 A;  5JBX A;  4JOT A;  4IZD A;  3H0J A;  1XO6 A;  3GKB A;  3KTG A;  3BEZ A;  5E0N X;  4NNQ A;  4FJW D;  2J5G A;  3TZ3 A;  4NAR A;  5DZK H;  4JYJ A;  3TVW A;  2VSU A;  4EMM A;  3I47 A;  5DU4 A;  2ZL4 A;  1RJM A;  1FCF A;  4RYF A;  2Q35 A;  3LKE A;  3LAO A;  4ELW A;  3Q0G A;  2J5S A;  3OT6 A;  2EJ5 A;  2X24 A;  3QKA A;  4IZC A;  4MI2 A;  3H0Q A;  1K32 A;  2ZL3 A;  3KTJ A;  5C90 A;  5C9G A;  3M6M A;  5E0S H;  4K3W A;  1W2X A;  4U1A A;  4I4Z A;  1XNW A;  3PGQ A;  3GF3 A;  2NP9 A;  5FUS A;  5DUC A;  4ELX A;  4Q1I A;  2PG8 A;  2F6Q A;  3R9T A;  2Q2X A;  1WZ8 A;  3U9R B;  3BPP A;  2W3P A;  4FZW C;  1NZY A;  1Q51 A;  3TV5 A;  5INF A;  4HNK A;  3SLL A;  2J5I B;  4U18 A;  3KTI A;  3PEA A;  4EMP A;  1Q52 A;  3TT7 A;  3ZWC A;  2A7K A;  3R0O A;  4QIJ A;  1N6E A;  3N6R B;  3DJA A;  5MGB A;  4ZDD A;  3P2L A;  3QXZ A;  2F9Y B;  2VSU E;  4L8K A;  3QRE A;  3KQF A;  4FN8 A;  4GM2 A;  2PPY A;  1HNO A;  5DTP A;  3Q7H A;  3P5M A;  3SWX A;  4G2R A;  3ZWB A;  2C8T A;  3HE2 A;  5FIF A;  4F47 A;  1K39 A;  5KJP A;  3VIV A;  4IZB A;  2VSS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...