3I47A

Crystal structure of putative enoyl coa hydratase/isomerase (crotonase) from legionella pneumophila subsp. pneumophila str. philadelphia 1
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
259
structure length
259
Chain Sequence
b'SLSDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGKHFSAGADLTWMQSMANFTEEENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLGLIPAVISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLEFTLKYASQISNNAPEAVKNSKQLAQYVANKKIDEELVRYTASLIAHKRVSDEGQEGLKAFLNKEIPNWN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl CoA hydratase/isomerase (Crotonase)
publication title CRYSTAL STRUCTURE OF putative enoyl CoA hydratase/isomerase (crotonase) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Lyase
total genus 101
structure length 259
sequence length 259
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2009-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3i47A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3i47A01
3DORA 3HE2A 5FUSA 3GF3A 4U0GH 4I42A 4IZCA 1PIXA 4EMPA 2NP9A 4FJWD 3T8AA 1XX4A 4FB8A 5DU8A 1X0UA 3HLN1 4B3IA 4FZWA 4MXIA 2F9IA 1FCFA 3IB9A 4JWVA 3H0JA 4HC8A 4JCRA 3V5IA 4KD6A 5E0SH 5G1RA 5KJPA 1RJMA 1WDLA 3WG5A 3ST9A 3MFMA 1J7XA 1RJNA 3KTHA 3R9TA 2F9YB 3T88A 1EF8A 5JBXA 1O8UA 2VSUF 1EY3A 5INGA 2ZQRA 3T8BA 1EF9A 2ZL3A 4ZDFA 4L8KA 4FZWC 3H0QA 3L3SA 3R0OA 3BPPA 3QYRA 3ZWBA 3DJAA 5C90A 4RCNA 2J5II 3P5MA 1XNYA 4U0HA 4EMLA 4EMMA 5INFA 2F9YA 3KTKA 1XNVA 4JYLA 2EJ5A 1K32A 4I52A 4L6WA 2PBPA 3PZKA 3TVUA 1HNOA 3QKAA 1W2XA 4ELSA 3GMAA 2F6QA 3K8XA 4WCZA 4OG1A 2VSUA 2W3PA 4HNKA 2F6IA 3H81A 4JFCA 4Q1IA 3QXIA 1YG8A 4QIJA 1OD4A 2X58A 3TZ3A 3RSTA 2ZL0A 3OT6A 4RYFH 3Q0GA 4NEKA 5KDRB 3LKEA 3STAA 5FIFA 3TDCA 1OD2A 2VSSE 3HRXA 2FW2A 3VIVA 4KPKA 3ZWAA 4LK5A 4QIIA 4JVTA 4YLHA 5DUCA 2BZRA 3K50A 3MOYA 3LAOA 4FN7A 2A7KA 1UYSA 2GTRA 2J5GA 4ASIA 3PGQA 3R6HA 4U19A 3GKBA 3IBBA 4KWBA 1ON3A 1TYFA 4KNPA 5DZKA 3SWXA 4U0GA 5KDRA 4I4ZA 5IKLB 1MJ3A 3GLMA 5JBWA 2A7SA 2QQ3A 1UIYA 3QK8A 3Q0JA 3KTIA 5CTCA 3NJDA 3PE8A 2FBMA 3G64A 3U9RB 1HZDA 5G1QA 3FDUA 3SLLA 4ZDBA 4K29A 3MYBA 1DUBA 3T89A 1TG6A 2Q34A 3QREA 1VRGA 4G2RA 1SG4A 3HINA 3OMEA 3ZW9A 4B3HA 3I47A 2J5IB 3MT6A 4WZ8B 2X24A 4K2NA 1YG6A 4OLQA 3P85A 3NJBA 2UZFA 4F47A 4MI2A 3KQFA 1HNUA 1WDKA 1K39A 3H0SA 3Q1TA 4ZDCA 3Q7HA 4JSBA 2J5GD 4JYJA 3U9TB 2DUBA 1Y7OA 4ZDEA 4K3WA 5DTWA 2ZQQA 1DCIA 3QMJA 4ELWA 2HW5A 3OC7A 1WDMA 2VSUE 4GM2A 3TT7A 3PEAA 2CBYA 1N6FA 3TVWA 2VREA 2J5IA 2IEXA 3QXZA 4ZU2A 4U18A 3N6RB 1Q51A 3BEZA 1PJHA 3JU1A 3TLFA 5DZKH 4Q0GA 5DUFA 5G1SA 2VSUC 4OMRA 4Z0MA 2WTBA 2Q35A 3P2LA 1SZOA 5MGBA 5DKPA 3IAVA 4JCQA 3RRVA 2PG8A 3GF7A 1UYTA 1XNWA 3QWDA 2J5SA 3TRRA 4RYFA 2C8TA 4DI1A 1UYVA 4QFEA 1Q52A 4IZBA 4NNQA 1XO6A 3M6NA 4FNDA 3ISAA 3M6MA 5CTBA 3HP0A 3R9SA 1UYRA 5E0SA 4JOTA 2CE3A 5INIA 2VSSF 2D3TA 4B3JA 3V5EA 1FC7A 1N6EA 5DU6A 3TT6A 1NZYB 2ZL4A 1JXZA 5DL1A 5DU4A 3RSIA 4FNBA 4FN8A 3ZWCA 5E0NX 3H02A 1N6DA 4U1AA 3KTGA 2FZSA 1FC9A 4GHNA 4JCTA 4JCSA 4ELXA 3KTJA 2DEOA 2VX2A 5C9GA 4ZDDA 2A81A 3ZW8A 4IZDA 2F9IB 2Q2XA 1ON9A 4JJTA 3TV5A 3T3WA 3FF6A 3H0UA 3R9QA 4MOUA 3U9SB 1WZ8A 3BF0A 1NZYA 2VSSA 4WYOB 2PPYA 1FC6A 2ZL2A 5DTPA
chains in the Genus database with same CATH superfamily
3DORA 3HE2A 5FUSA 3GF3A 4U0GH 4I42A 4IZCA 1PIXA 4EMPA 2NP9A 4FJWD 3T8AA 1XX4A 3RQEA 4FB8A 5DU8A 1X0UA 3HLN1 4B3IA 4FZWA 4MXIA 2F9IA 1FCFA 3IB9A 4JWVA 3H0JA 3ADCA 4HC8A 4JCRA 3V5IA 4KD6A 5E0SH 5G1RA 3IRBA 5KJPA 1RJMA 1WDLA 3WG5A 3ST9A 3MFMA 4J2UA 1J7XA 1RJNA 3KTHA 3R9TA 2F9YB 3T88A 1EF8A 5JBXA 1O8UA 2VSUF 1EY3A 5INGA 2ZQRA 3T8BA 1EF9A 2ZL3A 4ZDFA 4L8KA 4FZWC 2YJGA 3H0QA 3L3SA 3R0OA 3BPPA 3QYRA 3ZWBA 3DJAA 5C90A 4RCNA 2J5II 3P5MA 1XNYA 4U0HA 4EMLA 4EMMA 5INFA 2F9YA 3KTKA 3ADDA 1XNVA 4JYLA 2EJ5A 1K32A 4I52A 4L6WA 2PBPA 3PZKA 3TVUA 1HNOA 3QKAA 1W2XA 4ELSA 3GMAA 4HDTA 2F6QA 3K8XA 4WCZA 4OG1A 2VSUA 2W3PA 4HNKA 2F6IA 3H81A 3AM1A 4JFCA 3W8HB 4Q1IA 3QXIA 1YG8A 4QIJA 1OD4A 2X58A 3TZ3A 3RSTA 2ZL0A 3OT6A 4RYFH 3Q0GA 4NEKA 5HUQA 5KDRB 3LKEA 3STAA 1UX4A 5FIFA 3TDCA 1OD2A 3ADBA 3HRXA 2VSSE 2FW2A 3VIVA 4KPKA 3ZWAA 4LK5A 4QIIA 4JVTA 4YLHA 5DUCA 2BZRA 3K50A 3O4XE 3MOYA 3LAOA 4FN7A 2A7KA 1UYSA 2GTRA 2J5GA 4ASIA 3PGQA 3R6HA 4U19A 3GKBA 3IBBA 4KWBA 1ON3A 1TYFA 4KNPA 5DZKA 3SWXA 4U0GA 5KDRA 4I4ZA 5IKLB 1MJ3A 3GLMA 5JBWA 2A7SA 1UX5A 2QQ3A 1UIYA 3QK8A 3Q0JA 3KTIA 5CTCA 3NJDA 3PE8A 3A4MA 2FBMA 3G64A 3U9RB 1HZDA 5G1QA 3FDUA 3SLLA 4ZDBA 4K29A 3MYBA 1DUBA 3T89A 1TG6A 2Q34A 3QREA 1VRGA 4G2RA 1SG4A 3HINA 3OMEA 3ZW9A 4B3HA 3I47A 2J5IB 3L8JA 3MT6A 4WZ8B 2X24A 4K2NA 1YG6A 4OLQA 3P85A 1Y64B 3NJBA 2UZFA 3L8IA 4F47A 4MI2A 3KQFA 1HNUA 1WDKA 1K39A 3H0SA 4NARA 3Q1TA 4ZDCA 3Q7HA 4JSBA 3W8IB 2J5GD 4JYJA 3U9TB 2DUBA 1Y7OA 3A4NA 4ZDEA 4K3WA 5DTWA 2ZQQA 1DCIA 3QMJA 4ELWA 2HW5A 3OC7A 1WDMA 2VSUE 4GM2A 3TT7A 3PEAA 2CBYA 3BPTA 1N6FA 3TVWA 2VREA 2J5IA 2IEXA 3QXZA 4ZU2A 2P63A 4U18A 3N6RB 1Q51A 3BEZA 1PJHA 3JU1A 3TLFA 5DZKH 4Q0GA 5DUFA 5G1SA 2VSUC 4OMRA 4Z0MA 2WTBA 2Q35A 3P2LA 1SZOA 5MGBA 5DKPA 3IAVA 4JCQA 3RRVA 2PG8A 3GF7A 1UYTA 1XNWA 3QWDA 2J5SA 3TRRA 4RYFA 2C8TA 4DI1A 1UYVA 4QFEA 1Q52A 3RQGA 4IZBA 4NNQA 1XO6A 3M6NA 4FNDA 3ISAA 3M6MA 5CTBA 3HP0A 3R9SA 1UYRA 5E0SA 3A4LA 4JOTA 2CE3A 5INIA 2VSSF 2D3TA 4B3JA 3V5EA 4GEHB 1FC7A 1N6EA 3RQFA 5DU6A 3TT6A 1NZYB 2ZL4A 1JXZA 3AJMA 5DL1A 5DU4A 3RSIA 4FNBA 4FN8A 3ZWCA 5E0NX 3H02A 1N6DA 4U1AA 3KTGA 2FZSA 1FC9A 4GHNA 4JCTA 4JCSA 4ELXA 3KTJA 2DEOA 2VX2A 5C9GA 4ZDDA 2A81A 3ZW8A 4IZDA 2F9IB 2Q2XA 1ON9A 4JJTA 3TV5A 3T3WA 3FF6A 3H0UA 3R9QA 4MOUA 3U9SB 1WZ8A 3BF0A 1NZYA 2VSSA 4WYOB 2PPYA 1FC6A 2ZL2A 5DTPA
chains in the Genus database with same CATH topology
3DORA 3HE2A 5FUSA 3GF3A 4U0GH 4I42A 4IZCA 1PIXA 4EMPA 2NP9A 4FJWD 3T8AA 1XX4A 4FB8A 5DU8A 1X0UA 3HLN1 4B3IA 4FZWA 4MXIA 2F9IA 1FCFA 3IB9A 4JWVA 3H0JA 4HC8A 4JCRA 3V5IA 4KD6A 5E0SH 5G1RA 5KJPA 1RJMA 1WDLA 3WG5A 3ST9A 3MFMA 4J2UA 1J7XA 1RJNA 3KTHA 3R9TA 2F9YB 3T88A 1EF8A 5JBXA 1O8UA 2VSUF 1EY3A 5INGA 2ZQRA 3T8BA 1EF9A 2ZL3A 4ZDFA 4L8KA 4FZWC 2YJGA 3H0QA 3L3SA 3R0OA 3BPPA 3QYRA 3ZWBA 3DJAA 5C90A 4RCNA 2J5II 3P5MA 1XNYA 4U0HA 4EMLA 4EMMA 5INFA 2F9YA 3KTKA 1XNVA 4JYLA 2EJ5A 1K32A 4I52A 4L6WA 2PBPA 3PZKA 3TVUA 1HNOA 3QKAA 1W2XA 4ELSA 3GMAA 4HDTA 2F6QA 3K8XA 4WCZA 4OG1A 2VSUA 2W3PA 4HNKA 2F6IA 3H81A 4JFCA 4Q1IA 3QXIA 1YG8A 4QIJA 1OD4A 2X58A 3TZ3A 3RSTA 2ZL0A 3OT6A 4RYFH 3Q0GA 4NEKA 5HUQA 5KDRB 3LKEA 3STAA 5FIFA 3TDCA 1OD2A 2VSSE 3HRXA 2FW2A 3VIVA 4KPKA 3ZWAA 4LK5A 4QIIA 4JVTA 4YLHA 5DUCA 2BZRA 3K50A 3MOYA 3LAOA 4FN7A 2A7KA 1UYSA 2GTRA 2J5GA 4ASIA 3PGQA 3R6HA 4U19A 3GKBA 3IBBA 4KWBA 1ON3A 1TYFA 4KNPA 5DZKA 3SWXA 4U0GA 5KDRA 4I4ZA 5IKLB 1MJ3A 3GLMA 5JBWA 2A7SA 2QQ3A 1UIYA 3QK8A 3Q0JA 3KTIA 5CTCA 3NJDA 3PE8A 2FBMA 3G64A 3U9RB 1HZDA 5G1QA 3FDUA 3SLLA 4ZDBA 4K29A 3MYBA 1DUBA 3T89A 1TG6A 2Q34A 3QREA 1VRGA 4G2RA 1SG4A 3HINA 3OMEA 3ZW9A 4B3HA 3I47A 2J5IB 3MT6A 4WZ8B 2X24A 4K2NA 1YG6A 4OLQA 3P85A 3NJBA 2UZFA 4F47A 4MI2A 3KQFA 1HNUA 1WDKA 1K39A 3H0SA 4NARA 3Q1TA 4ZDCA 3Q7HA 4JSBA 2J5GD 4JYJA 3U9TB 2DUBA 1Y7OA 4ZDEA 4K3WA 5DTWA 2ZQQA 1DCIA 3QMJA 4ELWA 2HW5A 3OC7A 1WDMA 2VSUE 4GM2A 3TT7A 3PEAA 2CBYA 3BPTA 1N6FA 3TVWA 2VREA 2J5IA 2IEXA 3QXZA 4ZU2A 4U18A 3N6RB 1Q51A 3BEZA 1PJHA 3JU1A 3TLFA 5DZKH 4Q0GA 5DUFA 5G1SA 2VSUC 4OMRA 4Z0MA 2WTBA 2Q35A 3P2LA 1SZOA 5MGBA 5DKPA 3IAVA 4JCQA 3RRVA 2PG8A 3GF7A 1UYTA 1XNWA 3QWDA 2J5SA 3TRRA 4RYFA 2C8TA 4DI1A 1UYVA 4QFEA 1Q52A 4IZBA 4NNQA 1XO6A 3M6NA 4FNDA 3ISAA 3M6MA 5CTBA 3HP0A 3R9SA 1UYRA 5E0SA 4JOTA 2CE3A 5INIA 2VSSF 2D3TA 4B3JA 3V5EA 1FC7A 1N6EA 5DU6A 3TT6A 1NZYB 2ZL4A 1JXZA 5DL1A 5DU4A 3RSIA 4FNBA 4FN8A 3ZWCA 5E0NX 3H02A 1N6DA 4U1AA 3KTGA 2FZSA 1FC9A 4GHNA 4JCTA 4JCSA 4ELXA 3KTJA 2DEOA 2VX2A 5C9GA 4ZDDA 2A81A 3ZW8A 4IZDA 2F9IB 2Q2XA 1ON9A 4JJTA 3TV5A 3T3WA 3FF6A 3H0UA 3R9QA 4MOUA 3U9SB 1WZ8A 3BF0A 1NZYA 2VSSA 4WYOB 2PPYA 1FC6A 2ZL2A 5DTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DOR A;  3HE2 A;  5FUS A;  3GF3 A;  4U0G H;  4I42 A;  4IZC A;  1PIX A;  4EMP A;  2NP9 A;  4FJW D;  3T8A A;  1XX4 A;  4FB8 A;  5DU8 A;  1X0U A;  3HLN 1;  4B3I A;  4FZW A;  4MXI A;  2F9I A;  1FCF A;  3IB9 A;  4JWV A;  3H0J A;  4HC8 A;  4JCR A;  3V5I A;  4KD6 A;  5E0S H;  5G1R A;  5KJP A;  1RJM A;  1WDL A;  3WG5 A;  3ST9 A;  3MFM A;  1J7X A;  1RJN A;  3KTH A;  3R9T A;  2F9Y B;  3T88 A;  1EF8 A;  5JBX A;  1O8U A;  2VSU F;  1EY3 A;  5ING A;  2ZQR A;  3T8B A;  1EF9 A;  2ZL3 A;  4ZDF A;  4L8K A;  4FZW C;  3H0Q A;  3L3S A;  3R0O A;  3BPP A;  3QYR A;  3ZWB A;  3DJA A;  5C90 A;  4RCN A;  2J5I I;  3P5M A;  1XNY A;  4U0H A;  4EML A;  4EMM A;  5INF A;  2F9Y A;  3KTK A;  1XNV A;  4JYL A;  2EJ5 A;  1K32 A;  4I52 A;  4L6W A;  2PBP A;  3PZK A;  3TVU A;  1HNO A;  3QKA A;  1W2X A;  4ELS A;  3GMA A;  2F6Q A;  3K8X A;  4WCZ A;  4OG1 A;  2VSU A;  2W3P A;  4HNK A;  2F6I A;  3H81 A;  4JFC A;  4Q1I A;  3QXI A;  1YG8 A;  4QIJ A;  1OD4 A;  2X58 A;  3TZ3 A;  3RST A;  2ZL0 A;  3OT6 A;  4RYF H;  3Q0G A;  4NEK A;  5KDR B;  3LKE A;  3STA A;  5FIF A;  3TDC A;  1OD2 A;  2VSS E;  3HRX A;  2FW2 A;  3VIV A;  4KPK A;  3ZWA A;  4LK5 A;  4QII A;  4JVT A;  4YLH A;  5DUC A;  2BZR A;  3K50 A;  3MOY A;  3LAO A;  4FN7 A;  2A7K A;  1UYS A;  2GTR A;  2J5G A;  4ASI A;  3PGQ A;  3R6H A;  4U19 A;  3GKB A;  3IBB A;  4KWB A;  1ON3 A;  1TYF A;  4KNP A;  5DZK A;  3SWX A;  4U0G A;  5KDR A;  4I4Z A;  5IKL B;  1MJ3 A;  3GLM A;  5JBW A;  2A7S A;  2QQ3 A;  1UIY A;  3QK8 A;  3Q0J A;  3KTI A;  5CTC A;  3NJD A;  3PE8 A;  2FBM A;  3G64 A;  3U9R B;  1HZD A;  5G1Q A;  3FDU A;  3SLL A;  4ZDB A;  4K29 A;  3MYB A;  1DUB A;  3T89 A;  1TG6 A;  2Q34 A;  3QRE A;  1VRG A;  4G2R A;  1SG4 A;  3HIN A;  3OME A;  3ZW9 A;  4B3H A;  3I47 A;  2J5I B;  3MT6 A;  4WZ8 B;  2X24 A;  4K2N A;  1YG6 A;  4OLQ A;  3P85 A;  3NJB A;  2UZF A;  4F47 A;  4MI2 A;  3KQF A;  1HNU A;  1WDK A;  1K39 A;  3H0S A;  3Q1T A;  4ZDC A;  3Q7H A;  4JSB A;  2J5G D;  4JYJ A;  3U9T B;  2DUB A;  1Y7O A;  4ZDE A;  4K3W A;  5DTW A;  2ZQQ A;  1DCI A;  3QMJ A;  4ELW A;  2HW5 A;  3OC7 A;  1WDM A;  2VSU E;  4GM2 A;  3TT7 A;  3PEA A;  2CBY A;  1N6F A;  3TVW A;  2VRE A;  2J5I A;  2IEX A;  3QXZ A;  4ZU2 A;  4U18 A;  3N6R B;  1Q51 A;  3BEZ A;  1PJH A;  3JU1 A;  3TLF A;  5DZK H;  4Q0G A;  5DUF A;  5G1S A;  2VSU C;  4OMR A;  4Z0M A;  2WTB A;  2Q35 A;  3P2L A;  1SZO A;  5MGB A;  5DKP A;  3IAV A;  4JCQ A;  3RRV A;  2PG8 A;  3GF7 A;  1UYT A;  1XNW A;  3QWD A;  2J5S A;  3TRR A;  4RYF A;  2C8T A;  4DI1 A;  1UYV A;  4QFE A;  1Q52 A;  4IZB A;  4NNQ A;  1XO6 A;  3M6N A;  4FND A;  3ISA A;  3M6M A;  5CTB A;  3HP0 A;  3R9S A;  1UYR A;  5E0S A;  4JOT A;  2CE3 A;  5INI A;  2VSS F;  2D3T A;  4B3J A;  3V5E A;  1FC7 A;  1N6E A;  5DU6 A;  3TT6 A;  1NZY B;  2ZL4 A;  1JXZ A;  5DL1 A;  5DU4 A;  3RSI A;  4FNB A;  4FN8 A;  3ZWC A;  5E0N X;  3H02 A;  1N6D A;  4U1A A;  3KTG A;  2FZS A;  1FC9 A;  4GHN A;  4JCT A;  4JCS A;  4ELX A;  3KTJ A;  2DEO A;  2VX2 A;  5C9G A;  4ZDD A;  2A81 A;  3ZW8 A;  4IZD A;  2F9I B;  2Q2X A;  1ON9 A;  4JJT A;  3TV5 A;  3T3W A;  3FF6 A;  3H0U A;  3R9Q A;  4MOU A;  3U9S B;  1WZ8 A;  3BF0 A;  1NZY A;  2VSS A;  4WYO B;  2PPY A;  1FC6 A;  2ZL2 A;  5DTP A; 
#chains in the Genus database with same CATH topology
 3DOR A;  3HE2 A;  5FUS A;  3GF3 A;  4U0G H;  4I42 A;  4IZC A;  1PIX A;  4EMP A;  2NP9 A;  4FJW D;  3T8A A;  1XX4 A;  3RQE A;  4FB8 A;  5DU8 A;  1X0U A;  3HLN 1;  4B3I A;  4FZW A;  4MXI A;  2F9I A;  1FCF A;  3IB9 A;  4JWV A;  3H0J A;  3ADC A;  4HC8 A;  4JCR A;  3V5I A;  4KD6 A;  5E0S H;  5G1R A;  3IRB A;  5KJP A;  1RJM A;  1WDL A;  3WG5 A;  3ST9 A;  3MFM A;  4J2U A;  1J7X A;  1RJN A;  3KTH A;  3R9T A;  2F9Y B;  3T88 A;  1EF8 A;  5JBX A;  1O8U A;  2VSU F;  1EY3 A;  5ING A;  2ZQR A;  3T8B A;  1EF9 A;  2ZL3 A;  4ZDF A;  4L8K A;  4FZW C;  2YJG A;  3H0Q A;  3L3S A;  3R0O A;  3BPP A;  3QYR A;  3ZWB A;  3DJA A;  5C90 A;  4RCN A;  2J5I I;  3P5M A;  1XNY A;  4U0H A;  4EML A;  4EMM A;  5INF A;  2F9Y A;  3KTK A;  3ADD A;  1XNV A;  4JYL A;  2EJ5 A;  1K32 A;  4I52 A;  4L6W A;  2PBP A;  3PZK A;  3TVU A;  1HNO A;  3QKA A;  1W2X A;  4ELS A;  3GMA A;  4HDT A;  2F6Q A;  3K8X A;  4WCZ A;  4OG1 A;  2VSU A;  2W3P A;  4HNK A;  2F6I A;  3H81 A;  3AM1 A;  4JFC A;  3W8H B;  4Q1I A;  3QXI A;  1YG8 A;  4QIJ A;  1OD4 A;  2X58 A;  3TZ3 A;  3RST A;  2ZL0 A;  3OT6 A;  4RYF H;  3Q0G A;  4NEK A;  5HUQ A;  5KDR B;  3LKE A;  3STA A;  1UX4 A;  5FIF A;  3TDC A;  1OD2 A;  3ADB A;  3HRX A;  2VSS E;  2FW2 A;  3VIV A;  4KPK A;  3ZWA A;  4LK5 A;  4QII A;  4JVT A;  4YLH A;  5DUC A;  2BZR A;  3K50 A;  3O4X E;  3MOY A;  3LAO A;  4FN7 A;  2A7K A;  1UYS A;  2GTR A;  2J5G A;  4ASI A;  3PGQ A;  3R6H A;  4U19 A;  3GKB A;  3IBB A;  4KWB A;  1ON3 A;  1TYF A;  4KNP A;  5DZK A;  3SWX A;  4U0G A;  5KDR A;  4I4Z A;  5IKL B;  1MJ3 A;  3GLM A;  5JBW A;  2A7S A;  1UX5 A;  2QQ3 A;  1UIY A;  3QK8 A;  3Q0J A;  3KTI A;  5CTC A;  3NJD A;  3PE8 A;  3A4M A;  2FBM A;  3G64 A;  3U9R B;  1HZD A;  5G1Q A;  3FDU A;  3SLL A;  4ZDB A;  4K29 A;  3MYB A;  1DUB A;  3T89 A;  1TG6 A;  2Q34 A;  3QRE A;  1VRG A;  4G2R A;  1SG4 A;  3HIN A;  3OME A;  3ZW9 A;  4B3H A;  3I47 A;  2J5I B;  3L8J A;  3MT6 A;  4WZ8 B;  2X24 A;  4K2N A;  1YG6 A;  4OLQ A;  3P85 A;  1Y64 B;  3NJB A;  2UZF A;  3L8I A;  4F47 A;  4MI2 A;  3KQF A;  1HNU A;  1WDK A;  1K39 A;  3H0S A;  4NAR A;  3Q1T A;  4ZDC A;  3Q7H A;  4JSB A;  3W8I B;  2J5G D;  4JYJ A;  3U9T B;  2DUB A;  1Y7O A;  3A4N A;  4ZDE A;  4K3W A;  5DTW A;  2ZQQ A;  1DCI A;  3QMJ A;  4ELW A;  2HW5 A;  3OC7 A;  1WDM A;  2VSU E;  4GM2 A;  3TT7 A;  3PEA A;  2CBY A;  3BPT A;  1N6F A;  3TVW A;  2VRE A;  2J5I A;  2IEX A;  3QXZ A;  4ZU2 A;  2P63 A;  4U18 A;  3N6R B;  1Q51 A;  3BEZ A;  1PJH A;  3JU1 A;  3TLF A;  5DZK H;  4Q0G A;  5DUF A;  5G1S A;  2VSU C;  4OMR A;  4Z0M A;  2WTB A;  2Q35 A;  3P2L A;  1SZO A;  5MGB A;  5DKP A;  3IAV A;  4JCQ A;  3RRV A;  2PG8 A;  3GF7 A;  1UYT A;  1XNW A;  3QWD A;  2J5S A;  3TRR A;  4RYF A;  2C8T A;  4DI1 A;  1UYV A;  4QFE A;  1Q52 A;  3RQG A;  4IZB A;  4NNQ A;  1XO6 A;  3M6N A;  4FND A;  3ISA A;  3M6M A;  5CTB A;  3HP0 A;  3R9S A;  1UYR A;  5E0S A;  3A4L A;  4JOT A;  2CE3 A;  5INI A;  2VSS F;  2D3T A;  4B3J A;  3V5E A;  4GEH B;  1FC7 A;  1N6E A;  3RQF A;  5DU6 A;  3TT6 A;  1NZY B;  2ZL4 A;  1JXZ A;  3AJM A;  5DL1 A;  5DU4 A;  3RSI A;  4FNB A;  4FN8 A;  3ZWC A;  5E0N X;  3H02 A;  1N6D A;  4U1A A;  3KTG A;  2FZS A;  1FC9 A;  4GHN A;  4JCT A;  4JCS A;  4ELX A;  3KTJ A;  2DEO A;  2VX2 A;  5C9G A;  4ZDD A;  2A81 A;  3ZW8 A;  4IZD A;  2F9I B;  2Q2X A;  1ON9 A;  4JJT A;  3TV5 A;  3T3W A;  3FF6 A;  3H0U A;  3R9Q A;  4MOU A;  3U9S B;  1WZ8 A;  3BF0 A;  1NZY A;  2VSS A;  4WYO B;  2PPY A;  1FC6 A;  2ZL2 A;  5DTP A; 
#chains in the Genus database with same CATH homology
 3DOR A;  3HE2 A;  5FUS A;  3GF3 A;  4U0G H;  4I42 A;  4IZC A;  1PIX A;  4EMP A;  2NP9 A;  4FJW D;  3T8A A;  1XX4 A;  4FB8 A;  5DU8 A;  1X0U A;  3HLN 1;  4B3I A;  4FZW A;  4MXI A;  2F9I A;  1FCF A;  3IB9 A;  4JWV A;  3H0J A;  4HC8 A;  4JCR A;  3V5I A;  4KD6 A;  5E0S H;  5G1R A;  5KJP A;  1RJM A;  1WDL A;  3WG5 A;  3ST9 A;  3MFM A;  4J2U A;  1J7X A;  1RJN A;  3KTH A;  3R9T A;  2F9Y B;  3T88 A;  1EF8 A;  5JBX A;  1O8U A;  2VSU F;  1EY3 A;  5ING A;  2ZQR A;  3T8B A;  1EF9 A;  2ZL3 A;  4ZDF A;  4L8K A;  4FZW C;  2YJG A;  3H0Q A;  3L3S A;  3R0O A;  3BPP A;  3QYR A;  3ZWB A;  3DJA A;  5C90 A;  4RCN A;  2J5I I;  3P5M A;  1XNY A;  4U0H A;  4EML A;  4EMM A;  5INF A;  2F9Y A;  3KTK A;  1XNV A;  4JYL A;  2EJ5 A;  1K32 A;  4I52 A;  4L6W A;  2PBP A;  3PZK A;  3TVU A;  1HNO A;  3QKA A;  1W2X A;  4ELS A;  3GMA A;  4HDT A;  2F6Q A;  3K8X A;  4WCZ A;  4OG1 A;  2VSU A;  2W3P A;  4HNK A;  2F6I A;  3H81 A;  4JFC A;  4Q1I A;  3QXI A;  1YG8 A;  4QIJ A;  1OD4 A;  2X58 A;  3TZ3 A;  3RST A;  2ZL0 A;  3OT6 A;  4RYF H;  3Q0G A;  4NEK A;  5HUQ A;  5KDR B;  3LKE A;  3STA A;  5FIF A;  3TDC A;  1OD2 A;  2VSS E;  3HRX A;  2FW2 A;  3VIV A;  4KPK A;  3ZWA A;  4LK5 A;  4QII A;  4JVT A;  4YLH A;  5DUC A;  2BZR A;  3K50 A;  3MOY A;  3LAO A;  4FN7 A;  2A7K A;  1UYS A;  2GTR A;  2J5G A;  4ASI A;  3PGQ A;  3R6H A;  4U19 A;  3GKB A;  3IBB A;  4KWB A;  1ON3 A;  1TYF A;  4KNP A;  5DZK A;  3SWX A;  4U0G A;  5KDR A;  4I4Z A;  5IKL B;  1MJ3 A;  3GLM A;  5JBW A;  2A7S A;  2QQ3 A;  1UIY A;  3QK8 A;  3Q0J A;  3KTI A;  5CTC A;  3NJD A;  3PE8 A;  2FBM A;  3G64 A;  3U9R B;  1HZD A;  5G1Q A;  3FDU A;  3SLL A;  4ZDB A;  4K29 A;  3MYB A;  1DUB A;  3T89 A;  1TG6 A;  2Q34 A;  3QRE A;  1VRG A;  4G2R A;  1SG4 A;  3HIN A;  3OME A;  3ZW9 A;  4B3H A;  3I47 A;  2J5I B;  3MT6 A;  4WZ8 B;  2X24 A;  4K2N A;  1YG6 A;  4OLQ A;  3P85 A;  3NJB A;  2UZF A;  4F47 A;  4MI2 A;  3KQF A;  1HNU A;  1WDK A;  1K39 A;  3H0S A;  4NAR A;  3Q1T A;  4ZDC A;  3Q7H A;  4JSB A;  2J5G D;  4JYJ A;  3U9T B;  2DUB A;  1Y7O A;  4ZDE A;  4K3W A;  5DTW A;  2ZQQ A;  1DCI A;  3QMJ A;  4ELW A;  2HW5 A;  3OC7 A;  1WDM A;  2VSU E;  4GM2 A;  3TT7 A;  3PEA A;  2CBY A;  3BPT A;  1N6F A;  3TVW A;  2VRE A;  2J5I A;  2IEX A;  3QXZ A;  4ZU2 A;  4U18 A;  3N6R B;  1Q51 A;  3BEZ A;  1PJH A;  3JU1 A;  3TLF A;  5DZK H;  4Q0G A;  5DUF A;  5G1S A;  2VSU C;  4OMR A;  4Z0M A;  2WTB A;  2Q35 A;  3P2L A;  1SZO A;  5MGB A;  5DKP A;  3IAV A;  4JCQ A;  3RRV A;  2PG8 A;  3GF7 A;  1UYT A;  1XNW A;  3QWD A;  2J5S A;  3TRR A;  4RYF A;  2C8T A;  4DI1 A;  1UYV A;  4QFE A;  1Q52 A;  4IZB A;  4NNQ A;  1XO6 A;  3M6N A;  4FND A;  3ISA A;  3M6M A;  5CTB A;  3HP0 A;  3R9S A;  1UYR A;  5E0S A;  4JOT A;  2CE3 A;  5INI A;  2VSS F;  2D3T A;  4B3J A;  3V5E A;  1FC7 A;  1N6E A;  5DU6 A;  3TT6 A;  1NZY B;  2ZL4 A;  1JXZ A;  5DL1 A;  5DU4 A;  3RSI A;  4FNB A;  4FN8 A;  3ZWC A;  5E0N X;  3H02 A;  1N6D A;  4U1A A;  3KTG A;  2FZS A;  1FC9 A;  4GHN A;  4JCT A;  4JCS A;  4ELX A;  3KTJ A;  2DEO A;  2VX2 A;  5C9G A;  4ZDD A;  2A81 A;  3ZW8 A;  4IZD A;  2F9I B;  2Q2X A;  1ON9 A;  4JJT A;  3TV5 A;  3T3W A;  3FF6 A;  3H0U A;  3R9Q A;  4MOU A;  3U9S B;  1WZ8 A;  3BF0 A;  1NZY A;  2VSS A;  4WYO B;  2PPY A;  1FC6 A;  2ZL2 A;  5DTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...