3I47A

Crystal structure of putative enoyl coa hydratase/isomerase (crotonase) from legionella pneumophila subsp. pneumophila str. philadelphia 1
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
259
structure length
259
Chain Sequence
SLSDLLYEIQDKVGLLTMNRISKHNAFDNQLLTEMRIRLDSAINDTNVRVIVLKANGKHFSAGADLTWMQSMANFTEEENLEDSLVLGNLMYSISQSPKPTIAMVQGAAFGGGAGLAAACDIAIASTSARFCFSEVKLGLIPAVISPYVVRAIGERAAKMLFMSAEVFDATRAYSLNLVQHCVPDDTLLEFTLKYASQISNNAPEAVKNSKQLAQYVANKKIDEELVRYTASLIAHKRVSDEGQEGLKAFLNKEIPNWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF putative enoyl CoA hydratase/isomerase (crotonase) from Legionella pneumophila subsp. pneumophila str. Philadelphia 1
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Lyase
molecule keywords Enoyl CoA hydratase/isomerase (Crotonase)
total genus 101
structure length 259
sequence length 259
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2009-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3i47A02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3i47A01
5MGBA 3GKBA 3P5MA 4HNKA 5DTWA 5DZKA 4QFEA 1DCIA 1FC6A 2BZRA 3GLMA 3PEAA 1OD4A 1K32A 4I52A 3WG5A 2VSUC 1EF8A 3TT7A 4JSBA 2VREA 4GM2A 1SZOA 3Q0JA 2A81A 1UYTA 4JVTA 4LK5A 2FBMA 4ELSA 2ZL0A 4RYFH 2VSUF 3T89A 3QKAA 3R9QA 4FZWA 2FW2A 2J5GA 5KJPA 2ZL4A 3TVWA 3DORA 5CTBA 4WCZA 3KTKA 1X0UA 5DZKH 1XNYA 3T88A 4ZDFA 4IZBA 3RSIA 3H81A 3P85A 3KTHA 2ZQRA 4G2RA 3Q0GA 4DI1A 1WDKA 2HW5A 4JWVA 4EMPA 4FJWD 1TG6A 1RJMA 3M6NA 3HRXA 3NJBA 2F9YA 4K2NA 3P2LA 5DUCA 4B3HA 3STAA 1YG8A 3ZWBA 2GTRA 4ELWA 4RCNA 4JCQA 2J5II 4QIJA 2DEOA 1UYVA 4JYLA 3L3SA 4KD6A 3V5EA 3QYRA 3ZW9A 4U0HA 2VSUA 3PZKA 3ST9A 1N6DA 1NZYB 3SWXA 3QXIA 2F6QA 2VSUE 4FNBA 4U1AA 4IZDA 4WZ8B 3H02A 2VSSF 1FC9A 3LKEA 1MJ3A 1XO6A 5G1SA 4FZWC 3TZ3A 4ZDCA 2PBPA 2A7SA 2VX2A 2F9IA 3Q1TA 1PIXA 3GMAA 4RYFA 4FB8A 3I47A 4L8KA 5DU6A 3IAVA 4GHNA 4Q0GA 3FDUA 3QREA 4B3JA 3HP0A 1UYSA 2F6IA 3TDCA 3G64A 5INGA 5INIA 2QQ3A 2Q2XA 1J7XA 5DU8A 3IBBA 4JJTA 2J5SA 1HNUA 4OMRA 1N6FA 2Q34A 1EF9A 4KNPA 3ISAA 2ZQQA 2J5IB 3T8BA 4B3IA 5G1RA 4QIIA 4MI2A 3TV5A 4WYOB 1Q52A 2C8TA 3H0UA 4MXIA 5JBXA 5E0SH 5DL1A 1PJHA 1DUBA 1ON3A 3RRVA 2F9IB 4EMLA 3TRRA 3R9TA 3KTJA 3JU1A 1FC7A 2W3PA 3V5IA 4ASIA 5KDRA 3H0JA 4U0GA 3T8AA 1WDLA 3KQFA 4Q1IA 4NEKA 1HZDA 3OC7A 1HNOA 1W2XA 3OT6A 3HINA 3ZWCA 3MT6A 4I42A 1O8UA 5INFA 3T3WA 2UZFA 4K3WA 2IEXA 3QWDA 1N6EA 5DUFA 2PG8A 5FUSA 1XX4A 4YLHA 2DUBA 3MOYA 2J5GD 5E0SA 1XNWA 3HLN1 2ZL2A 3K50A 3TVUA 2CE3A 3U9RB 3U9TB 3GF3A 3H0SA 3BEZA 5C9GA 4JCSA 4I4ZA 3N6RB 3KTIA 3NJDA 2D3TA 1TYFA 1WDMA 1FCFA 4FN7A 3R6HA 2VSSA 4ZU2A 3ZW8A 3LAOA 3R9SA 1RJNA 3PE8A 5KDRB 4FN8A 3ZWAA 5DKPA 3KTGA 1UIYA 4JCTA 5E0NX 1ON9A 2EJ5A 4HC8A 4JYJA 3SLLA 2X58A 4OG1A 5FIFA 2NP9A 4JFCA 4KWBA 3QK8A 5CTCA 4U19A 4NNQA 3BPPA 3QXZA 3M6MA 5DU4A 4JOTA 1JXZA 4MOUA 2J5IA 2WTBA 4ZDDA 4L6WA 4IZCA 3TT6A 4ELXA 3PGQA 3RSTA 3TLFA 2Q35A 3BF0A 2FZSA 3U9SB 2F9YB 1OD2A 5IKLB 1YG6A 1Q51A 4OLQA 5C90A 3VIVA 4FNDA 4F47A 3MYBA 5G1QA 4ZDEA 2VSSE 3MFMA 1UYRA 1K39A 3R0OA 2PPYA 3GF7A 3IB9A 1WZ8A 2A7KA 4KPKA 3HE2A 4K29A 2CBYA 5JBWA 3DJAA 1Y7OA 3QMJA 4U18A 2ZL3A 1VRGA 3OMEA 4U0GH 2X24A 4EMMA 3FF6A 1NZYA 3H0QA 1SG4A 4Z0MA 4ZDBA 3K8XA 4JCRA 5DTPA 1EY3A 3Q7HA 1XNVA
chains in the Genus database with same CATH superfamily
4NARA 5MGBA 3GKBA 3P5MA 4HNKA 5DTWA 5DZKA 4QFEA 1DCIA 1FC6A 2BZRA 3GLMA 3PEAA 1OD4A 1K32A 4J2UA 4I52A 3WG5A 2VSUC 1EF8A 3TT7A 4JSBA 2VREA 4GM2A 1SZOA 3Q0JA 2A81A 1UYTA 4JVTA 3L8IA 4LK5A 2FBMA 4ELSA 2ZL0A 4RYFH 2VSUF 1Y64B 3T89A 3QKAA 3R9QA 4FZWA 2FW2A 2J5GA 5KJPA 2ZL4A 3TVWA 3DORA 5CTBA 4WCZA 3A4LA 3KTKA 1X0UA 4GEHB 5DZKH 1XNYA 3T88A 4ZDFA 4IZBA 3RSIA 3O4XE 3H81A 3P85A 3KTHA 2ZQRA 4G2RA 3Q0GA 4DI1A 1WDKA 2HW5A 4JWVA 4EMPA 4FJWD 1TG6A 1RJMA 3M6NA 3HRXA 3NJBA 2F9YA 4K2NA 3P2LA 5DUCA 4B3HA 3STAA 1YG8A 3ZWBA 2GTRA 4ELWA 2YJGA 4RCNA 4JCQA 2J5II 4QIJA 2DEOA 1UYVA 4JYLA 2P63A 3L3SA 4KD6A 3V5EA 3QYRA 3ZW9A 4U0HA 2VSUA 3PZKA 3ST9A 1N6DA 1NZYB 3SWXA 3QXIA 2F6QA 2VSUE 4FNBA 4U1AA 4IZDA 4WZ8B 3H02A 2VSSF 1FC9A 3LKEA 3W8IB 1MJ3A 1XO6A 5G1SA 3AM1A 4FZWC 3TZ3A 4ZDCA 2PBPA 2A7SA 2VX2A 2F9IA 3Q1TA 1PIXA 3GMAA 4RYFA 4FB8A 3I47A 4L8KA 5DU6A 3IAVA 4GHNA 4Q0GA 3FDUA 3QREA 5HUQA 4B3JA 3HP0A 1UYSA 2F6IA 3TDCA 3G64A 5INGA 5INIA 2QQ3A 3ADCA 2Q2XA 1J7XA 5DU8A 3IBBA 4JJTA 2J5SA 1HNUA 4OMRA 1N6FA 2Q34A 1EF9A 4KNPA 3ISAA 2ZQQA 2J5IB 3T8BA 4B3IA 5G1RA 4QIIA 4MI2A 3TV5A 4WYOB 1Q52A 2C8TA 3H0UA 4MXIA 5JBXA 5E0SH 5DL1A 1PJHA 1DUBA 3A4NA 1ON3A 3RRVA 2F9IB 4EMLA 3TRRA 3R9TA 3KTJA 3JU1A 1FC7A 2W3PA 3V5IA 4ASIA 5KDRA 3H0JA 4U0GA 3T8AA 1WDLA 3KQFA 4Q1IA 4NEKA 1HZDA 3OC7A 1HNOA 1W2XA 3OT6A 3HINA 3RQGA 3ZWCA 3MT6A 4I42A 1O8UA 5INFA 3T3WA 2UZFA 4K3WA 2IEXA 3QWDA 1UX5A 1N6EA 5DUFA 2PG8A 5FUSA 1XX4A 4YLHA 2DUBA 3MOYA 2J5GD 5E0SA 1XNWA 3HLN1 2ZL2A 3K50A 3TVUA 2CE3A 3AJMA 3U9RB 3U9TB 3GF3A 3H0SA 3BEZA 5C9GA 4JCSA 4I4ZA 3N6RB 3KTIA 3NJDA 2D3TA 1TYFA 1WDMA 1FCFA 4FN7A 3R6HA 2VSSA 3RQEA 4ZU2A 3ZW8A 3LAOA 3R9SA 4HDTA 1RJNA 3PE8A 5KDRB 4FN8A 3ZWAA 5DKPA 3KTGA 1UIYA 4JCTA 5E0NX 1ON9A 2EJ5A 4HC8A 4JYJA 3SLLA 2X58A 4OG1A 5FIFA 2NP9A 4JFCA 4KWBA 3QK8A 5CTCA 4NNQA 4U19A 3IRBA 3BPPA 3QXZA 3ADDA 3M6MA 5DU4A 4JOTA 1JXZA 4MOUA 2J5IA 2WTBA 4ZDDA 4L6WA 4IZCA 3TT6A 4ELXA 3BPTA 1UX4A 3PGQA 3RSTA 3TLFA 2Q35A 3BF0A 2FZSA 3U9SB 2F9YB 1OD2A 5IKLB 1YG6A 1Q51A 4OLQA 5C90A 3VIVA 4FNDA 4F47A 3MYBA 5G1QA 4ZDEA 2VSSE 3MFMA 1UYRA 1K39A 3R0OA 3L8JA 2PPYA 3GF7A 3IB9A 3RQFA 1WZ8A 2A7KA 4KPKA 3W8HB 3HE2A 4K29A 2CBYA 5JBWA 3ADBA 3DJAA 1Y7OA 3QMJA 4U18A 2ZL3A 1VRGA 3OMEA 4U0GH 2X24A 4EMMA 3FF6A 1NZYA 3H0QA 1SG4A 4Z0MA 4ZDBA 3A4MA 3K8XA 4JCRA 5DTPA 1EY3A 3Q7HA 1XNVA
chains in the Genus database with same CATH topology
4NARA 5MGBA 3GKBA 3P5MA 4HNKA 5DTWA 5DZKA 4QFEA 1DCIA 1FC6A 2BZRA 3GLMA 3PEAA 1OD4A 1K32A 4J2UA 4I52A 3WG5A 2VSUC 1EF8A 3TT7A 4JSBA 2VREA 4GM2A 1SZOA 3Q0JA 2A81A 1UYTA 4JVTA 4LK5A 2FBMA 4ELSA 2ZL0A 4RYFH 2VSUF 3T89A 3QKAA 3R9QA 4FZWA 2FW2A 2J5GA 5KJPA 2ZL4A 3TVWA 3DORA 5CTBA 4WCZA 3KTKA 1X0UA 5DZKH 1XNYA 3T88A 4ZDFA 4IZBA 3RSIA 3H81A 3P85A 3KTHA 2ZQRA 4G2RA 3Q0GA 4DI1A 1WDKA 2HW5A 4JWVA 4EMPA 4FJWD 1TG6A 1RJMA 3M6NA 3HRXA 3NJBA 2F9YA 4K2NA 3P2LA 5DUCA 4B3HA 3STAA 1YG8A 3ZWBA 2GTRA 4ELWA 2YJGA 4RCNA 4JCQA 2J5II 4QIJA 2DEOA 1UYVA 4JYLA 3L3SA 4KD6A 3V5EA 3QYRA 3ZW9A 4U0HA 2VSUA 3PZKA 3ST9A 1N6DA 1NZYB 3SWXA 3QXIA 2F6QA 2VSUE 4FNBA 4U1AA 4IZDA 4WZ8B 3H02A 2VSSF 1FC9A 3LKEA 1MJ3A 1XO6A 5G1SA 4FZWC 3TZ3A 4ZDCA 2PBPA 2A7SA 2VX2A 2F9IA 3Q1TA 1PIXA 3GMAA 4RYFA 4FB8A 3I47A 4L8KA 5DU6A 3IAVA 4GHNA 4Q0GA 3FDUA 3QREA 5HUQA 4B3JA 3HP0A 1UYSA 2F6IA 3TDCA 3G64A 5INGA 5INIA 2QQ3A 2Q2XA 1J7XA 5DU8A 3IBBA 4JJTA 2J5SA 1HNUA 4OMRA 1N6FA 2Q34A 1EF9A 4KNPA 3ISAA 2ZQQA 2J5IB 3T8BA 4B3IA 5G1RA 4QIIA 4MI2A 3TV5A 4WYOB 1Q52A 2C8TA 3H0UA 4MXIA 5JBXA 5E0SH 5DL1A 1PJHA 1DUBA 1ON3A 3RRVA 2F9IB 4EMLA 3TRRA 3R9TA 3KTJA 3JU1A 1FC7A 2W3PA 3V5IA 4ASIA 5KDRA 3H0JA 4U0GA 3T8AA 1WDLA 3KQFA 4Q1IA 4NEKA 1HZDA 3OC7A 1HNOA 1W2XA 3OT6A 3HINA 3ZWCA 3MT6A 4I42A 1O8UA 5INFA 3T3WA 2UZFA 4K3WA 2IEXA 3QWDA 1N6EA 5DUFA 2PG8A 5FUSA 1XX4A 4YLHA 2DUBA 3MOYA 2J5GD 5E0SA 1XNWA 3HLN1 2ZL2A 3K50A 3TVUA 2CE3A 3U9RB 3U9TB 3GF3A 3H0SA 3BEZA 5C9GA 4JCSA 4I4ZA 3N6RB 3KTIA 3NJDA 2D3TA 1TYFA 1WDMA 1FCFA 4FN7A 3R6HA 2VSSA 4ZU2A 3ZW8A 3LAOA 3R9SA 4HDTA 1RJNA 3PE8A 5KDRB 4FN8A 3ZWAA 5DKPA 3KTGA 1UIYA 4JCTA 5E0NX 1ON9A 2EJ5A 4HC8A 4JYJA 3SLLA 2X58A 4OG1A 5FIFA 2NP9A 4JFCA 4KWBA 3QK8A 5CTCA 4U19A 4NNQA 3BPPA 3QXZA 3M6MA 5DU4A 4JOTA 1JXZA 4MOUA 2J5IA 2WTBA 4ZDDA 4L6WA 4IZCA 3TT6A 4ELXA 3BPTA 3PGQA 3RSTA 3TLFA 2Q35A 3BF0A 2FZSA 3U9SB 2F9YB 1OD2A 5IKLB 1YG6A 1Q51A 4OLQA 5C90A 3VIVA 4FNDA 4F47A 3MYBA 5G1QA 4ZDEA 2VSSE 3MFMA 1UYRA 1K39A 3R0OA 2PPYA 3GF7A 3IB9A 1WZ8A 2A7KA 4KPKA 3HE2A 4K29A 2CBYA 5JBWA 3DJAA 1Y7OA 3QMJA 4U18A 2ZL3A 1VRGA 3OMEA 4U0GH 2X24A 4EMMA 3FF6A 1NZYA 3H0QA 1SG4A 4Z0MA 4ZDBA 3K8XA 4JCRA 5DTPA 1EY3A 3Q7HA 1XNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5MGB A;  3GKB A;  3P5M A;  4HNK A;  5DTW A;  5DZK A;  4QFE A;  1DCI A;  1FC6 A;  2BZR A;  3GLM A;  3PEA A;  1OD4 A;  1K32 A;  4I52 A;  3WG5 A;  2VSU C;  1EF8 A;  3TT7 A;  4JSB A;  2VRE A;  4GM2 A;  1SZO A;  3Q0J A;  2A81 A;  1UYT A;  4JVT A;  4LK5 A;  2FBM A;  4ELS A;  2ZL0 A;  4RYF H;  2VSU F;  3T89 A;  3QKA A;  3R9Q A;  4FZW A;  2FW2 A;  2J5G A;  5KJP A;  2ZL4 A;  3TVW A;  3DOR A;  5CTB A;  4WCZ A;  3KTK A;  1X0U A;  5DZK H;  1XNY A;  3T88 A;  4ZDF A;  4IZB A;  3RSI A;  3H81 A;  3P85 A;  3KTH A;  2ZQR A;  4G2R A;  3Q0G A;  4DI1 A;  1WDK A;  2HW5 A;  4JWV A;  4EMP A;  4FJW D;  1TG6 A;  1RJM A;  3M6N A;  3HRX A;  3NJB A;  2F9Y A;  4K2N A;  3P2L A;  5DUC A;  4B3H A;  3STA A;  1YG8 A;  3ZWB A;  2GTR A;  4ELW A;  4RCN A;  4JCQ A;  2J5I I;  4QIJ A;  2DEO A;  1UYV A;  4JYL A;  3L3S A;  4KD6 A;  3V5E A;  3QYR A;  3ZW9 A;  4U0H A;  2VSU A;  3PZK A;  3ST9 A;  1N6D A;  1NZY B;  3SWX A;  3QXI A;  2F6Q A;  2VSU E;  4FNB A;  4U1A A;  4IZD A;  4WZ8 B;  3H02 A;  2VSS F;  1FC9 A;  3LKE A;  1MJ3 A;  1XO6 A;  5G1S A;  4FZW C;  3TZ3 A;  4ZDC A;  2PBP A;  2A7S A;  2VX2 A;  2F9I A;  3Q1T A;  1PIX A;  3GMA A;  4RYF A;  4FB8 A;  3I47 A;  4L8K A;  5DU6 A;  3IAV A;  4GHN A;  4Q0G A;  3FDU A;  3QRE A;  4B3J A;  3HP0 A;  1UYS A;  2F6I A;  3TDC A;  3G64 A;  5ING A;  5INI A;  2QQ3 A;  2Q2X A;  1J7X A;  5DU8 A;  3IBB A;  4JJT A;  2J5S A;  1HNU A;  4OMR A;  1N6F A;  2Q34 A;  1EF9 A;  4KNP A;  3ISA A;  2ZQQ A;  2J5I B;  3T8B A;  4B3I A;  5G1R A;  4QII A;  4MI2 A;  3TV5 A;  4WYO B;  1Q52 A;  2C8T A;  3H0U A;  4MXI A;  5JBX A;  5E0S H;  5DL1 A;  1PJH A;  1DUB A;  1ON3 A;  3RRV A;  2F9I B;  4EML A;  3TRR A;  3R9T A;  3KTJ A;  3JU1 A;  1FC7 A;  2W3P A;  3V5I A;  4ASI A;  5KDR A;  3H0J A;  4U0G A;  3T8A A;  1WDL A;  3KQF A;  4Q1I A;  4NEK A;  1HZD A;  3OC7 A;  1HNO A;  1W2X A;  3OT6 A;  3HIN A;  3ZWC A;  3MT6 A;  4I42 A;  1O8U A;  5INF A;  3T3W A;  2UZF A;  4K3W A;  2IEX A;  3QWD A;  1N6E A;  5DUF A;  2PG8 A;  5FUS A;  1XX4 A;  4YLH A;  2DUB A;  3MOY A;  2J5G D;  5E0S A;  1XNW A;  3HLN 1;  2ZL2 A;  3K50 A;  3TVU A;  2CE3 A;  3U9R B;  3U9T B;  3GF3 A;  3H0S A;  3BEZ A;  5C9G A;  4JCS A;  4I4Z A;  3N6R B;  3KTI A;  3NJD A;  2D3T A;  1TYF A;  1WDM A;  1FCF A;  4FN7 A;  3R6H A;  2VSS A;  4ZU2 A;  3ZW8 A;  3LAO A;  3R9S A;  1RJN A;  3PE8 A;  5KDR B;  4FN8 A;  3ZWA A;  5DKP A;  3KTG A;  1UIY A;  4JCT A;  5E0N X;  1ON9 A;  2EJ5 A;  4HC8 A;  4JYJ A;  3SLL A;  2X58 A;  4OG1 A;  5FIF A;  2NP9 A;  4JFC A;  4KWB A;  3QK8 A;  5CTC A;  4U19 A;  4NNQ A;  3BPP A;  3QXZ A;  3M6M A;  5DU4 A;  4JOT A;  1JXZ A;  4MOU A;  2J5I A;  2WTB A;  4ZDD A;  4L6W A;  4IZC A;  3TT6 A;  4ELX A;  3PGQ A;  3RST A;  3TLF A;  2Q35 A;  3BF0 A;  2FZS A;  3U9S B;  2F9Y B;  1OD2 A;  5IKL B;  1YG6 A;  1Q51 A;  4OLQ A;  5C90 A;  3VIV A;  4FND A;  4F47 A;  3MYB A;  5G1Q A;  4ZDE A;  2VSS E;  3MFM A;  1UYR A;  1K39 A;  3R0O A;  2PPY A;  3GF7 A;  3IB9 A;  1WZ8 A;  2A7K A;  4KPK A;  3HE2 A;  4K29 A;  2CBY A;  5JBW A;  3DJA A;  1Y7O A;  3QMJ A;  4U18 A;  2ZL3 A;  1VRG A;  3OME A;  4U0G H;  2X24 A;  4EMM A;  3FF6 A;  1NZY A;  3H0Q A;  1SG4 A;  4Z0M A;  4ZDB A;  3K8X A;  4JCR A;  5DTP A;  1EY3 A;  3Q7H A;  1XNV A; 
#chains in the Genus database with same CATH topology
 4NAR A;  5MGB A;  3GKB A;  3P5M A;  4HNK A;  5DTW A;  5DZK A;  4QFE A;  1DCI A;  1FC6 A;  2BZR A;  3GLM A;  3PEA A;  1OD4 A;  1K32 A;  4J2U A;  4I52 A;  3WG5 A;  2VSU C;  1EF8 A;  3TT7 A;  4JSB A;  2VRE A;  4GM2 A;  1SZO A;  3Q0J A;  2A81 A;  1UYT A;  4JVT A;  3L8I A;  4LK5 A;  2FBM A;  4ELS A;  2ZL0 A;  4RYF H;  2VSU F;  1Y64 B;  3T89 A;  3QKA A;  3R9Q A;  4FZW A;  2FW2 A;  2J5G A;  5KJP A;  2ZL4 A;  3TVW A;  3DOR A;  5CTB A;  4WCZ A;  3A4L A;  3KTK A;  1X0U A;  4GEH B;  5DZK H;  1XNY A;  3T88 A;  4ZDF A;  4IZB A;  3RSI A;  3O4X E;  3H81 A;  3P85 A;  3KTH A;  2ZQR A;  4G2R A;  3Q0G A;  4DI1 A;  1WDK A;  2HW5 A;  4JWV A;  4EMP A;  4FJW D;  1TG6 A;  1RJM A;  3M6N A;  3HRX A;  3NJB A;  2F9Y A;  4K2N A;  3P2L A;  5DUC A;  4B3H A;  3STA A;  1YG8 A;  3ZWB A;  2GTR A;  4ELW A;  2YJG A;  4RCN A;  4JCQ A;  2J5I I;  4QIJ A;  2DEO A;  1UYV A;  4JYL A;  2P63 A;  3L3S A;  4KD6 A;  3V5E A;  3QYR A;  3ZW9 A;  4U0H A;  2VSU A;  3PZK A;  3ST9 A;  1N6D A;  1NZY B;  3SWX A;  3QXI A;  2F6Q A;  2VSU E;  4FNB A;  4U1A A;  4IZD A;  4WZ8 B;  3H02 A;  2VSS F;  1FC9 A;  3LKE A;  3W8I B;  1MJ3 A;  1XO6 A;  5G1S A;  3AM1 A;  4FZW C;  3TZ3 A;  4ZDC A;  2PBP A;  2A7S A;  2VX2 A;  2F9I A;  3Q1T A;  1PIX A;  3GMA A;  4RYF A;  4FB8 A;  3I47 A;  4L8K A;  5DU6 A;  3IAV A;  4GHN A;  4Q0G A;  3FDU A;  3QRE A;  5HUQ A;  4B3J A;  3HP0 A;  1UYS A;  2F6I A;  3TDC A;  3G64 A;  5ING A;  5INI A;  2QQ3 A;  3ADC A;  2Q2X A;  1J7X A;  5DU8 A;  3IBB A;  4JJT A;  2J5S A;  1HNU A;  4OMR A;  1N6F A;  2Q34 A;  1EF9 A;  4KNP A;  3ISA A;  2ZQQ A;  2J5I B;  3T8B A;  4B3I A;  5G1R A;  4QII A;  4MI2 A;  3TV5 A;  4WYO B;  1Q52 A;  2C8T A;  3H0U A;  4MXI A;  5JBX A;  5E0S H;  5DL1 A;  1PJH A;  1DUB A;  3A4N A;  1ON3 A;  3RRV A;  2F9I B;  4EML A;  3TRR A;  3R9T A;  3KTJ A;  3JU1 A;  1FC7 A;  2W3P A;  3V5I A;  4ASI A;  5KDR A;  3H0J A;  4U0G A;  3T8A A;  1WDL A;  3KQF A;  4Q1I A;  4NEK A;  1HZD A;  3OC7 A;  1HNO A;  1W2X A;  3OT6 A;  3HIN A;  3RQG A;  3ZWC A;  3MT6 A;  4I42 A;  1O8U A;  5INF A;  3T3W A;  2UZF A;  4K3W A;  2IEX A;  3QWD A;  1UX5 A;  1N6E A;  5DUF A;  2PG8 A;  5FUS A;  1XX4 A;  4YLH A;  2DUB A;  3MOY A;  2J5G D;  5E0S A;  1XNW A;  3HLN 1;  2ZL2 A;  3K50 A;  3TVU A;  2CE3 A;  3AJM A;  3U9R B;  3U9T B;  3GF3 A;  3H0S A;  3BEZ A;  5C9G A;  4JCS A;  4I4Z A;  3N6R B;  3KTI A;  3NJD A;  2D3T A;  1TYF A;  1WDM A;  1FCF A;  4FN7 A;  3R6H A;  2VSS A;  3RQE A;  4ZU2 A;  3ZW8 A;  3LAO A;  3R9S A;  4HDT A;  1RJN A;  3PE8 A;  5KDR B;  4FN8 A;  3ZWA A;  5DKP A;  3KTG A;  1UIY A;  4JCT A;  5E0N X;  1ON9 A;  2EJ5 A;  4HC8 A;  4JYJ A;  3SLL A;  2X58 A;  4OG1 A;  5FIF A;  2NP9 A;  4JFC A;  4KWB A;  3QK8 A;  5CTC A;  4NNQ A;  4U19 A;  3IRB A;  3BPP A;  3QXZ A;  3ADD A;  3M6M A;  5DU4 A;  4JOT A;  1JXZ A;  4MOU A;  2J5I A;  2WTB A;  4ZDD A;  4L6W A;  4IZC A;  3TT6 A;  4ELX A;  3BPT A;  1UX4 A;  3PGQ A;  3RST A;  3TLF A;  2Q35 A;  3BF0 A;  2FZS A;  3U9S B;  2F9Y B;  1OD2 A;  5IKL B;  1YG6 A;  1Q51 A;  4OLQ A;  5C90 A;  3VIV A;  4FND A;  4F47 A;  3MYB A;  5G1Q A;  4ZDE A;  2VSS E;  3MFM A;  1UYR A;  1K39 A;  3R0O A;  3L8J A;  2PPY A;  3GF7 A;  3IB9 A;  3RQF A;  1WZ8 A;  2A7K A;  4KPK A;  3W8H B;  3HE2 A;  4K29 A;  2CBY A;  5JBW A;  3ADB A;  3DJA A;  1Y7O A;  3QMJ A;  4U18 A;  2ZL3 A;  1VRG A;  3OME A;  4U0G H;  2X24 A;  4EMM A;  3FF6 A;  1NZY A;  3H0Q A;  1SG4 A;  4Z0M A;  4ZDB A;  3A4M A;  3K8X A;  4JCR A;  5DTP A;  1EY3 A;  3Q7H A;  1XNV A; 
#chains in the Genus database with same CATH homology
 4NAR A;  5MGB A;  3GKB A;  3P5M A;  4HNK A;  5DTW A;  5DZK A;  4QFE A;  1DCI A;  1FC6 A;  2BZR A;  3GLM A;  3PEA A;  1OD4 A;  1K32 A;  4J2U A;  4I52 A;  3WG5 A;  2VSU C;  1EF8 A;  3TT7 A;  4JSB A;  2VRE A;  4GM2 A;  1SZO A;  3Q0J A;  2A81 A;  1UYT A;  4JVT A;  4LK5 A;  2FBM A;  4ELS A;  2ZL0 A;  4RYF H;  2VSU F;  3T89 A;  3QKA A;  3R9Q A;  4FZW A;  2FW2 A;  2J5G A;  5KJP A;  2ZL4 A;  3TVW A;  3DOR A;  5CTB A;  4WCZ A;  3KTK A;  1X0U A;  5DZK H;  1XNY A;  3T88 A;  4ZDF A;  4IZB A;  3RSI A;  3H81 A;  3P85 A;  3KTH A;  2ZQR A;  4G2R A;  3Q0G A;  4DI1 A;  1WDK A;  2HW5 A;  4JWV A;  4EMP A;  4FJW D;  1TG6 A;  1RJM A;  3M6N A;  3HRX A;  3NJB A;  2F9Y A;  4K2N A;  3P2L A;  5DUC A;  4B3H A;  3STA A;  1YG8 A;  3ZWB A;  2GTR A;  4ELW A;  2YJG A;  4RCN A;  4JCQ A;  2J5I I;  4QIJ A;  2DEO A;  1UYV A;  4JYL A;  3L3S A;  4KD6 A;  3V5E A;  3QYR A;  3ZW9 A;  4U0H A;  2VSU A;  3PZK A;  3ST9 A;  1N6D A;  1NZY B;  3SWX A;  3QXI A;  2F6Q A;  2VSU E;  4FNB A;  4U1A A;  4IZD A;  4WZ8 B;  3H02 A;  2VSS F;  1FC9 A;  3LKE A;  1MJ3 A;  1XO6 A;  5G1S A;  4FZW C;  3TZ3 A;  4ZDC A;  2PBP A;  2A7S A;  2VX2 A;  2F9I A;  3Q1T A;  1PIX A;  3GMA A;  4RYF A;  4FB8 A;  3I47 A;  4L8K A;  5DU6 A;  3IAV A;  4GHN A;  4Q0G A;  3FDU A;  3QRE A;  5HUQ A;  4B3J A;  3HP0 A;  1UYS A;  2F6I A;  3TDC A;  3G64 A;  5ING A;  5INI A;  2QQ3 A;  2Q2X A;  1J7X A;  5DU8 A;  3IBB A;  4JJT A;  2J5S A;  1HNU A;  4OMR A;  1N6F A;  2Q34 A;  1EF9 A;  4KNP A;  3ISA A;  2ZQQ A;  2J5I B;  3T8B A;  4B3I A;  5G1R A;  4QII A;  4MI2 A;  3TV5 A;  4WYO B;  1Q52 A;  2C8T A;  3H0U A;  4MXI A;  5JBX A;  5E0S H;  5DL1 A;  1PJH A;  1DUB A;  1ON3 A;  3RRV A;  2F9I B;  4EML A;  3TRR A;  3R9T A;  3KTJ A;  3JU1 A;  1FC7 A;  2W3P A;  3V5I A;  4ASI A;  5KDR A;  3H0J A;  4U0G A;  3T8A A;  1WDL A;  3KQF A;  4Q1I A;  4NEK A;  1HZD A;  3OC7 A;  1HNO A;  1W2X A;  3OT6 A;  3HIN A;  3ZWC A;  3MT6 A;  4I42 A;  1O8U A;  5INF A;  3T3W A;  2UZF A;  4K3W A;  2IEX A;  3QWD A;  1N6E A;  5DUF A;  2PG8 A;  5FUS A;  1XX4 A;  4YLH A;  2DUB A;  3MOY A;  2J5G D;  5E0S A;  1XNW A;  3HLN 1;  2ZL2 A;  3K50 A;  3TVU A;  2CE3 A;  3U9R B;  3U9T B;  3GF3 A;  3H0S A;  3BEZ A;  5C9G A;  4JCS A;  4I4Z A;  3N6R B;  3KTI A;  3NJD A;  2D3T A;  1TYF A;  1WDM A;  1FCF A;  4FN7 A;  3R6H A;  2VSS A;  4ZU2 A;  3ZW8 A;  3LAO A;  3R9S A;  4HDT A;  1RJN A;  3PE8 A;  5KDR B;  4FN8 A;  3ZWA A;  5DKP A;  3KTG A;  1UIY A;  4JCT A;  5E0N X;  1ON9 A;  2EJ5 A;  4HC8 A;  4JYJ A;  3SLL A;  2X58 A;  4OG1 A;  5FIF A;  2NP9 A;  4JFC A;  4KWB A;  3QK8 A;  5CTC A;  4U19 A;  4NNQ A;  3BPP A;  3QXZ A;  3M6M A;  5DU4 A;  4JOT A;  1JXZ A;  4MOU A;  2J5I A;  2WTB A;  4ZDD A;  4L6W A;  4IZC A;  3TT6 A;  4ELX A;  3BPT A;  3PGQ A;  3RST A;  3TLF A;  2Q35 A;  3BF0 A;  2FZS A;  3U9S B;  2F9Y B;  1OD2 A;  5IKL B;  1YG6 A;  1Q51 A;  4OLQ A;  5C90 A;  3VIV A;  4FND A;  4F47 A;  3MYB A;  5G1Q A;  4ZDE A;  2VSS E;  3MFM A;  1UYR A;  1K39 A;  3R0O A;  2PPY A;  3GF7 A;  3IB9 A;  1WZ8 A;  2A7K A;  4KPK A;  3HE2 A;  4K29 A;  2CBY A;  5JBW A;  3DJA A;  1Y7O A;  3QMJ A;  4U18 A;  2ZL3 A;  1VRG A;  3OME A;  4U0G H;  2X24 A;  4EMM A;  3FF6 A;  1NZY A;  3H0Q A;  1SG4 A;  4Z0M A;  4ZDB A;  3K8X A;  4JCR A;  5DTP A;  1EY3 A;  3Q7H A;  1XNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...