3I4NK

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 29
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3i4nK00
3S16C 4A3IK 3GTGK 2R7ZK 1TWHK 3HKZL 5IYCK 4C2MK 2A6HA 3S14K 5IYBK 1YNJA 4YG2A 4BY7C 3S1MK 3HOXK 3S2HC 2WB1D 5IP7K 2WAQL 4A3FK 1Y1WC 1BDFA 5FLMK 1TWFC 2E2HC 4A3CC 3RZDK 4QJVA 3GTMC 2B63C 3GTPK 4KN7A 2Y0SL 4BY1K 3S16K 4BXXC 3HOVC 2NVTC 4BY7K 5TMCA 1SMYA 4MEYA 4LLGA 3S2HK 2JA7C 4BY1C 4OINA 2O5JA 1Y1WK 1Y1VC 2E2HK 1TWFK 4KMUA 4A3CK 3S2DC 5M3FK 3RZOC 1I6HC 4XSXA 4AYBD 3GTMK 2B63K 2JA5C 3GTKC 2NVYC 4BXXK 3HOYC 4OIRA 5C44C 3HOVK 2NVTK 4C3JK 3H3VD 2A68A 4QIWL 4JK1A 2JA7K 1YNNA 1TWGC 1Y1VK 4C3HK 2PMZL 4OIQA 4GZYA 1I6HK 3S2DK 3RZOK 4A3BC 2WAQD 3M3YC 4A3KC 3GTPC 4A93C 2NVXC 2PA8D 2JA5K 5M5YK 3GTKK 2NVYK 4OIOA 4XLNA 3HOYK 2A69A 3GTLC 5C44K 3S1QC 1I3QC 3GTOC 2Y0SD 1I6VA 1IW7A 4Q4ZA 3S15C 1TWGK 4Q5SA 3DXJA 4QJVB 5FJ8K 5C4XC 1SFOC 4BBSC 4A3BK 4A93K 4YFKA 3HOWC 4A3KK 3I4MC 3M3YK 2NVXK 3S1RC 3PO3C 3M4OC 3GTLK 3S1QK 2WB1L 1I3QK 4KN4A 3GTOK 1WCMC 2A6EA 3S15K 4XLPA 2JA6C 3HOZC 2YU9K 5C4XK 3S17C 5D4DA 2R92C 3HKZD 4QIWD 1SFOK 3S1NC 4G7OA 4BBSK 4OIPA 3I4MK 3HOWK 4MEXA 1ZYRA 3S1RK 3PO3K 4LK1A 5IP9C 2PMZD 4A3GC 4X6AK 3M4OK 2CW0A 2JA8C 2R93C 2VUMC 1TWAC 1WCMK 3I4NC 1HQMA 2JA6K 3K7AC 3HOZK 3S17K 5C3EC 2R92K 4AYBL 2YU9C 4C3IK 3S1NK 4MQ9A 3CQZC 4ZH4A 4YFXA 1XPPA 4XSZA 4G7HA 4NOIA 5IP9K 4A3GK 5IYDC 3H3VL 3GTQC 2JA8K 2R93K 4X6AC 2VUMK 1TWAK 2BE5A 2E2IC 2NVQC 3I4NK 3K7AK 3HOUC 3FKIC 3H0GC 4A3JC 5C3EK 4A3DC 4A3EC 2PA8L 4LK0A 5C4JC 3CQZK 1TWCC 3WODA 4A3MC 4A3LC 1K83C 1R9TC 2PPBA 1I50C 3GTJC 5TMFA 3PO2C 4Y52C 5IYDK 3GTQK 4Y7NC 4BBRC 2E2JC 2E2IK 2NVQK 4A3IC 2R7ZC 3GTGC 1TWHC 3HOUK 5M5XK 5IYCC 3FKIK 3H0GK 5IYBC 4A3JK 3S14C 4A3EK 3S1MC 4A3DK 3HOXC 4G7ZA 5M5WK 5C4JK 5IP7C 4A3FC 1TWCK 4A3MK 4A3LK 1K83K 5M3MK 1R9TK 1I50K 5FLMC 4LJZA 3GTJK 3PO2K 4Y52K 3RZDC 4YFNA 2O5IA 4Y7NK 4BBRK 3EQLA 2E2JK
chains in the Genus database with same CATH superfamily
3HKZL 4FM9A 2A6HA 1O27A 1YNJA 2ZUFA 1ZVUA 2WB1D 4LOWA 2WAQL 4KB4A 2XCRB 1TWFC 4G0WA 2PHCB 2B63C 1USOA 3GTPK 4KN7A 2GAGC 2JA7C 1IS1A 2E2HK 1I6HC 3N0BA 3T01A 1B4AA 3GDZA 4XSXA 1JVIA 4AYBD 3GTKA 5EGHA 1IQ0A 2JA5C 3OREA 1PJ5A 3HOVK 4C3JK 2GAHC 1DCOA 1TWGC 3BUEA 4C3HK 4GZYA 2NVXA 4A3BC 3M3YC 1WSVA 5M5YK 2NVYK 4XLNA 3S1QC 2ZFZA 2Y0SD 3MMLB 4Q4ZA 4C45A 4Q5SA 1SFOA 1Y1VA 4BBSC 3I4MC 3HOWC 3GEIA 3TTGA 3N3YA 3AD8C 3M4OC 4M1XA 4KN4A 2JA6C 3T00A 5D4DA 4RMFA 3HKZD 4QIWD 2V6TA 3S1NC 1EQRA 1ZYRA 1KQ4A 2JH3A 5IP9C 3S1RK 1O24A 3GTLA 2R93C 1WCMK 3K7AC 2V6UA 5C3EC 3S17K 2YU9C 1EK8A 4G7HA 4A3GK 3H3VL 3GTQC 2D6FC 1VLOA 3OPFA 4GT9A 2E2IC 3FKIA 3GEEA 2NVQC 4GTDA 3SZZA 2Y3PA 5C4JC 3CQZK 1HI9A 2CFAA 1WOPA 4GTBA 1R9TC 1WSRA 3PO2C 2RGRA 1INNA 5HL8A 1TWHA 2E2JC 4KMDA 3LPXA 3N0CA 4A3EK 4KMHA 5M5WK 1K83K 5M3MK 4LJZA 1XZPB 1VH2A 2FQOA 3CAGA 3GTPC 1F7VA 4A3IK 3GTGK 2R7ZK 4PAAA 4LQYA 5IYBK 4YG2A 3GIRA 1O2BA 1TWFA 1F93A 1BDFA 1TWCA 1O26A 5FLMK 2E2HC 2B63A 4P5AA 1ZBSA 2Y0SL 4BY1K 1USMA 3HOVC 4BY7K 4C3JC 2JA7A 4MEYA 3S2HK 3L4KA 3SZYA 1Y1WK 4C3HC 1J6VA 2JA5A 5M3FK 3GTMK 2NVYC 4BXXK 3A8IA 1BGWA 2NVTK 3H3VD 1TWGA 3G4CA 4QIWL 4JK1A 2XCOA 3TFJA 1Y1VK 4J3NA 3S2DK 3RZOK 4GTAA 2A69A 1O28A 4KM9A 1YCLA 3ADAC 5FJ8K 3TFHA 5IOQA 4A93K 3S1RC 4AH6A 3GTLK 2FQTA 1I3QK 1JOEA 3GTOK 4GTFA 1WCMC 2JA6A 2A6EA 3S15K 3TFIA 5C4XK 3S17C 1VGXA 3PO3K 4A3GC 4ILDA 5E68A 2R93A 4X6AK 1WORA 1YX2A 1RU0A 3QX3A 4G0VA 4KMAA 1HQMA 3HOZK 2YU9A 2R92K 3VA7A 4C3IK 5CJ9A 3CQZC 4ZH4A 1BS2A 4XSZA 3AD7C 3GTQA 1F7UA 2JA8K 2GSUA 2E2IA 2VUMK 3FOEA 1TWAK 1PJ6A 1J6XA 4A3EC 1EI6A 4LK0A 1R9TA 1K83C 2PPBA 1ZXOA 5IYDK 5IOTA 3AQOA 1O2FB 4A3IC 2R7ZC 3GTGC 5M5XK 1XZPA 5IYBC 4KC6A 3LAPA 4KASA 1TWCK 1I50K 5FLMC 4KARA 3GTJK 3OEPA 4WILA 4KAWX 4BBRK 3EQLA 4BY1C 1O25A 4BY7C 4C2MK 3H0GA 3S1MK 3HOXK 3S2HC 1WQGA 2E2HA 1Y1WC 1DCPA 2P8TA 1DD5A 3GTMC 2RH6A 4WJ4A 3S16K 4BXXC 1XZQB 3AD9C 2NVTC 5TMCA 1SMYA 1O2AA 1Y1VC 1VJEA 4A3CK 3S2DC 1B4BA 3RZOC 2NVYA 1BJTA 4OIRA 4KDDA 2EBBA 1IL2A 1VRQC 2A68A 1YNNA 5IOSA 1J98A 4OIQA 4A93C 1ISEA 3BP8C 3GTKK 4KM8A 3HOYK 5EGEA 3GTLC 5C44K 1I3QC 3GTOC 1I6VA 3S15C 1XXCA 3DXJA 5C4XC 1GE9A 2P5MA 1C0AA 4YFKA 4A3KK 1WQFA 2NVXK 3PO3C 1EH1A 2W7VA 3AH5A 4XLPA 4G0UA 3HOZC 2YU9K 2R92C 4C3IC 1SFOK 1XXBA 1EFWA 3ERED 2PMZD 2CW0A 2JA8C 2VUMC 4LR2A 1TWAC 1IE0A 3CQZA 1AB4A 4YFXA 3IPJA 5IYDC 5TJ3A 2BE5A 3I4NK 1XXAA 2PA8L 5JFEA 1K83A 1IBAA 3Q3QA 1TWCC 3WODA 4WJ3M 4GFQA 1I50C 3GTJC 4BBRC 3GTGA 2R7ZA 1ZQ1C 3AQPA 4KATA 3HOUK 4C2MC 3FKIK 3H0GK 4A3JK 2GSNA 4FZBA 3S1MC 4A3DK 3HOXC 4GTEA 4A3MK 4A3LK 4O2DA 4Y52K 4Y7NK 3NUHA 1O29A 3S16C 1DCHA 3FHZA 1WQHA 1TWHK 5IYCK 3S14K 4P5BA 5CHPA 1Y1WA 3V4GA 5IP7K 4A3FK 1XZQA 3GTMA 4A3CC 3RZDK 5JVOA 4QJVA 4BLBA 1PJ7A 4LLGA 2O5JA 4OINA 1TWFK 4KMUA 2B63K 1WOSA 3GTPA 3GTKC 3HOYC 3HXAA 4P9SA 1X31C 5IORA 5C44C 1UV7A 2JA7K 3A8JA 1L0WA 2PMZL 1I6HK 2WAQD 1JQWA 4A3KC 2NVXC 2PA8D 2JA5K 4OIOA 1I3QA 3GTOA 3GSIA 2XCQA 1IW7A 2GSOA 1TWGK 4QJVB 1SFOC 4A3BK 3M3YK 1J6WA 3S1QK 2WB1L 2R92A 2V6SA 4G7OA 4BBSK 1WOOA 4OIPA 3I4MK 3HOWK 4MEXA 4GTLA 4LK1A 3L4JA 2VUMA 3M4OK 1WIHA 1TWAA 3G4AA 3T02A 3I4NC 2JA6K 2ZUEA 4AYBL 3S1NK 4MQ9A 2KWAA 3S0XA 1XPPA 4NOIA 5IP9K 2R93K 4X6AC 3FOFA 1WCMA 4XCHA 4KB2A 3K7AK 3HOUC 3FKIC 3H0GC 4BLAA 5C3EK 1G51A 4A3JC 4A3DC 1V5VA 3BP3A 1I50A 3GTJA 4A3MC 4A3LC 5TMFA 4BKWA 4Y52C 4DDQA 3GTQK 4Y7NC 3A8KA 3GEHA 4GTCA 3JSTA 2CFAB 2E2IK 4PABA 2NVQK 1TWHC 5IYCC 3S14C 3LAJA 4G7ZA 5C4JK 5IP7C 4A3FC 1F9NA 1R9TK 5L46A 3PO2K 3RZDC 4YFNA 2O5IA 2E2JK
chains in the Genus database with same CATH topology
3S16C 4A3IK 3GTGK 2R7ZK 1TWHK 3HKZL 5IYCK 4C2MK 2A6HA 3S14K 5IYBK 1YNJA 4YG2A 4BY7C 3S1MK 3HOXK 3S2HC 2WB1D 5IP7K 2WAQL 4A3FK 1Y1WC 1BDFA 5FLMK 1TWFC 2E2HC 4A3CC 3RZDK 4QJVA 3GTMC 2B63C 3GTPK 4KN7A 2Y0SL 4BY1K 3S16K 4BXXC 3HOVC 2NVTC 4BY7K 5TMCA 1SMYA 4MEYA 4LLGA 3S2HK 2JA7C 4BY1C 4OINA 2O5JA 1Y1WK 1Y1VC 2E2HK 1TWFK 4KMUA 4A3CK 3S2DC 5M3FK 3RZOC 1I6HC 4XSXA 4AYBD 3GTMK 2B63K 2JA5C 3GTKC 2NVYC 4BXXK 3HOYC 4OIRA 5C44C 3HOVK 2NVTK 4C3JK 3H3VD 2A68A 4QIWL 4JK1A 2JA7K 1YNNA 1TWGC 1Y1VK 4C3HK 2PMZL 4OIQA 4GZYA 1I6HK 3S2DK 3RZOK 4A3BC 2WAQD 3M3YC 4A3KC 3GTPC 4A93C 2NVXC 2PA8D 2JA5K 5M5YK 3GTKK 2NVYK 4OIOA 4XLNA 3HOYK 2A69A 3GTLC 5C44K 3S1QC 1I3QC 3GTOC 2Y0SD 1I6VA 1IW7A 4Q4ZA 3S15C 1TWGK 4Q5SA 3DXJA 4QJVB 5FJ8K 5C4XC 1SFOC 4BBSC 4A3BK 4A93K 4YFKA 3HOWC 4A3KK 3I4MC 3M3YK 2NVXK 3S1RC 3PO3C 3M4OC 3GTLK 3S1QK 2WB1L 1I3QK 4KN4A 3GTOK 1WCMC 2A6EA 3S15K 4XLPA 2JA6C 3HOZC 2YU9K 5C4XK 3S17C 5D4DA 2R92C 3HKZD 4QIWD 1SFOK 3S1NC 4G7OA 4BBSK 4OIPA 3I4MK 3HOWK 4MEXA 1ZYRA 3S1RK 3PO3K 4LK1A 5IP9C 2PMZD 4A3GC 4X6AK 3M4OK 2CW0A 2JA8C 2R93C 2VUMC 1TWAC 1WCMK 3I4NC 1HQMA 2JA6K 3K7AC 3HOZK 3S17K 5C3EC 2R92K 4AYBL 2YU9C 4C3IK 3S1NK 4MQ9A 3CQZC 4ZH4A 4YFXA 1XPPA 4XSZA 4G7HA 4NOIA 5IP9K 4A3GK 5IYDC 3H3VL 3GTQC 2JA8K 2R93K 4X6AC 2VUMK 1TWAK 2BE5A 2E2IC 2NVQC 3I4NK 3K7AK 3HOUC 3FKIC 3H0GC 4A3JC 5C3EK 4A3DC 4A3EC 2PA8L 4LK0A 5C4JC 3CQZK 1TWCC 3WODA 4A3MC 4A3LC 1K83C 1R9TC 2PPBA 1I50C 3GTJC 5TMFA 3PO2C 4Y52C 5IYDK 3GTQK 4Y7NC 4BBRC 2E2JC 2E2IK 2NVQK 4A3IC 2R7ZC 3GTGC 1TWHC 3HOUK 5M5XK 5IYCC 3FKIK 3H0GK 5IYBC 4A3JK 3S14C 4A3EK 3S1MC 4A3DK 3HOXC 4G7ZA 5M5WK 5C4JK 5IP7C 4A3FC 1TWCK 4A3MK 4A3LK 1K83K 5M3MK 1R9TK 1I50K 5FLMC 4LJZA 3GTJK 3PO2K 4Y52K 3RZDC 4YFNA 2O5IA 4Y7NK 4BBRK 3EQLA 2E2JK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S16 C;  4A3I K;  3GTG K;  2R7Z K;  1TWH K;  3HKZ L;  5IYC K;  4C2M K;  2A6H A;  3S14 K;  5IYB K;  1YNJ A;  4YG2 A;  4BY7 C;  3S1M K;  3HOX K;  3S2H C;  2WB1 D;  5IP7 K;  2WAQ L;  4A3F K;  1Y1W C;  1BDF A;  5FLM K;  1TWF C;  2E2H C;  4A3C C;  3RZD K;  4QJV A;  3GTM C;  2B63 C;  3GTP K;  4KN7 A;  2Y0S L;  4BY1 K;  3S16 K;  4BXX C;  3HOV C;  2NVT C;  4BY7 K;  5TMC A;  1SMY A;  4MEY A;  4LLG A;  3S2H K;  2JA7 C;  4BY1 C;  4OIN A;  2O5J A;  1Y1W K;  1Y1V C;  2E2H K;  1TWF K;  4KMU A;  4A3C K;  3S2D C;  5M3F K;  3RZO C;  1I6H C;  4XSX A;  4AYB D;  3GTM K;  2B63 K;  2JA5 C;  3GTK C;  2NVY C;  4BXX K;  3HOY C;  4OIR A;  5C44 C;  3HOV K;  2NVT K;  4C3J K;  3H3V D;  2A68 A;  4QIW L;  4JK1 A;  2JA7 K;  1YNN A;  1TWG C;  1Y1V K;  4C3H K;  2PMZ L;  4OIQ A;  4GZY A;  1I6H K;  3S2D K;  3RZO K;  4A3B C;  2WAQ D;  3M3Y C;  4A3K C;  3GTP C;  4A93 C;  2NVX C;  2PA8 D;  2JA5 K;  5M5Y K;  3GTK K;  2NVY K;  4OIO A;  4XLN A;  3HOY K;  2A69 A;  3GTL C;  5C44 K;  3S1Q C;  1I3Q C;  3GTO C;  2Y0S D;  1I6V A;  1IW7 A;  4Q4Z A;  3S15 C;  1TWG K;  4Q5S A;  3DXJ A;  4QJV B;  5FJ8 K;  5C4X C;  1SFO C;  4BBS C;  4A3B K;  4A93 K;  4YFK A;  3HOW C;  4A3K K;  3I4M C;  3M3Y K;  2NVX K;  3S1R C;  3PO3 C;  3M4O C;  3GTL K;  3S1Q K;  2WB1 L;  1I3Q K;  4KN4 A;  3GTO K;  1WCM C;  2A6E A;  3S15 K;  4XLP A;  2JA6 C;  3HOZ C;  2YU9 K;  5C4X K;  3S17 C;  5D4D A;  2R92 C;  3HKZ D;  4QIW D;  1SFO K;  3S1N C;  4G7O A;  4BBS K;  4OIP A;  3I4M K;  3HOW K;  4MEX A;  1ZYR A;  3S1R K;  3PO3 K;  4LK1 A;  5IP9 C;  2PMZ D;  4A3G C;  4X6A K;  3M4O K;  2CW0 A;  2JA8 C;  2R93 C;  2VUM C;  1TWA C;  1WCM K;  3I4N C;  1HQM A;  2JA6 K;  3K7A C;  3HOZ K;  3S17 K;  5C3E C;  2R92 K;  4AYB L;  2YU9 C;  4C3I K;  3S1N K;  4MQ9 A;  3CQZ C;  4ZH4 A;  4YFX A;  1XPP A;  4XSZ A;  4G7H A;  4NOI A;  5IP9 K;  4A3G K;  5IYD C;  3H3V L;  3GTQ C;  2JA8 K;  2R93 K;  4X6A C;  2VUM K;  1TWA K;  2BE5 A;  2E2I C;  2NVQ C;  3I4N K;  3K7A K;  3HOU C;  3FKI C;  3H0G C;  4A3J C;  5C3E K;  4A3D C;  4A3E C;  2PA8 L;  4LK0 A;  5C4J C;  3CQZ K;  1TWC C;  3WOD A;  4A3M C;  4A3L C;  1K83 C;  1R9T C;  2PPB A;  1I50 C;  3GTJ C;  5TMF A;  3PO2 C;  4Y52 C;  5IYD K;  3GTQ K;  4Y7N C;  4BBR C;  2E2J C;  2E2I K;  2NVQ K;  4A3I C;  2R7Z C;  3GTG C;  1TWH C;  3HOU K;  5M5X K;  5IYC C;  3FKI K;  3H0G K;  5IYB C;  4A3J K;  3S14 C;  4A3E K;  3S1M C;  4A3D K;  3HOX C;  4G7Z A;  5M5W K;  5C4J K;  5IP7 C;  4A3F C;  1TWC K;  4A3M K;  4A3L K;  1K83 K;  5M3M K;  1R9T K;  1I50 K;  5FLM C;  4LJZ A;  3GTJ K;  3PO2 K;  4Y52 K;  3RZD C;  4YFN A;  2O5I A;  4Y7N K;  4BBR K;  3EQL A;  2E2J K; 
#chains in the Genus database with same CATH topology
 3HKZ L;  4FM9 A;  2A6H A;  1O27 A;  1YNJ A;  2ZUF A;  1ZVU A;  2WB1 D;  4LOW A;  2WAQ L;  4KB4 A;  2XCR B;  1TWF C;  4G0W A;  2PHC B;  2B63 C;  1USO A;  3GTP K;  4KN7 A;  2GAG C;  2JA7 C;  1IS1 A;  2E2H K;  1I6H C;  3N0B A;  3T01 A;  1B4A A;  3GDZ A;  4XSX A;  1JVI A;  4AYB D;  3GTK A;  5EGH A;  1IQ0 A;  2JA5 C;  3ORE A;  1PJ5 A;  3HOV K;  4C3J K;  2GAH C;  1DCO A;  1TWG C;  3BUE A;  4C3H K;  4GZY A;  2NVX A;  4A3B C;  3M3Y C;  1WSV A;  5M5Y K;  2NVY K;  4XLN A;  3S1Q C;  2ZFZ A;  2Y0S D;  3MML B;  4Q4Z A;  4C45 A;  4Q5S A;  1SFO A;  1Y1V A;  4BBS C;  3I4M C;  3HOW C;  3GEI A;  3TTG A;  3N3Y A;  3AD8 C;  3M4O C;  4M1X A;  4KN4 A;  2JA6 C;  3T00 A;  5D4D A;  4RMF A;  3HKZ D;  4QIW D;  2V6T A;  3S1N C;  1EQR A;  1ZYR A;  1KQ4 A;  2JH3 A;  5IP9 C;  3S1R K;  1O24 A;  3GTL A;  2R93 C;  1WCM K;  3K7A C;  2V6U A;  5C3E C;  3S17 K;  2YU9 C;  1EK8 A;  4G7H A;  4A3G K;  3H3V L;  3GTQ C;  2D6F C;  1VLO A;  3OPF A;  4GT9 A;  2E2I C;  3FKI A;  3GEE A;  2NVQ C;  4GTD A;  3SZZ A;  2Y3P A;  5C4J C;  3CQZ K;  1HI9 A;  2CFA A;  1WOP A;  4GTB A;  1R9T C;  1WSR A;  3PO2 C;  2RGR A;  1INN A;  5HL8 A;  1TWH A;  2E2J C;  4KMD A;  3LPX A;  3N0C A;  4A3E K;  4KMH A;  5M5W K;  1K83 K;  5M3M K;  4LJZ A;  1XZP B;  1VH2 A;  2FQO A;  3CAG A;  3GTP C;  1F7V A;  4A3I K;  3GTG K;  2R7Z K;  4PAA A;  4LQY A;  5IYB K;  4YG2 A;  3GIR A;  1O2B A;  1TWF A;  1F93 A;  1BDF A;  1TWC A;  1O26 A;  5FLM K;  2E2H C;  2B63 A;  4P5A A;  1ZBS A;  2Y0S L;  4BY1 K;  1USM A;  3HOV C;  4BY7 K;  4C3J C;  2JA7 A;  4MEY A;  3S2H K;  3L4K A;  3SZY A;  1Y1W K;  4C3H C;  1J6V A;  2JA5 A;  5M3F K;  3GTM K;  2NVY C;  4BXX K;  3A8I A;  1BGW A;  2NVT K;  3H3V D;  1TWG A;  3G4C A;  4QIW L;  4JK1 A;  2XCO A;  3TFJ A;  1Y1V K;  4J3N A;  3S2D K;  3RZO K;  4GTA A;  2A69 A;  1O28 A;  4KM9 A;  1YCL A;  3ADA C;  5FJ8 K;  3TFH A;  5IOQ A;  4A93 K;  3S1R C;  4AH6 A;  3GTL K;  2FQT A;  1I3Q K;  1JOE A;  3GTO K;  4GTF A;  1WCM C;  2JA6 A;  2A6E A;  3S15 K;  3TFI A;  5C4X K;  3S17 C;  1VGX A;  3PO3 K;  4A3G C;  4ILD A;  5E68 A;  2R93 A;  4X6A K;  1WOR A;  1YX2 A;  1RU0 A;  3QX3 A;  4G0V A;  4KMA A;  1HQM A;  3HOZ K;  2YU9 A;  2R92 K;  3VA7 A;  4C3I K;  5CJ9 A;  3CQZ C;  4ZH4 A;  1BS2 A;  4XSZ A;  3AD7 C;  3GTQ A;  1F7U A;  2JA8 K;  2GSU A;  2E2I A;  2VUM K;  3FOE A;  1TWA K;  1PJ6 A;  1J6X A;  4A3E C;  1EI6 A;  4LK0 A;  1R9T A;  1K83 C;  2PPB A;  1ZXO A;  5IYD K;  5IOT A;  3AQO A;  1O2F B;  4A3I C;  2R7Z C;  3GTG C;  5M5X K;  1XZP A;  5IYB C;  4KC6 A;  3LAP A;  4KAS A;  1TWC K;  1I50 K;  5FLM C;  4KAR A;  3GTJ K;  3OEP A;  4WIL A;  4KAW X;  4BBR K;  3EQL A;  4BY1 C;  1O25 A;  4BY7 C;  4C2M K;  3H0G A;  3S1M K;  3HOX K;  3S2H C;  1WQG A;  2E2H A;  1Y1W C;  1DCP A;  2P8T A;  1DD5 A;  3GTM C;  2RH6 A;  4WJ4 A;  3S16 K;  4BXX C;  1XZQ B;  3AD9 C;  2NVT C;  5TMC A;  1SMY A;  1O2A A;  1Y1V C;  1VJE A;  4A3C K;  3S2D C;  1B4B A;  3RZO C;  2NVY A;  1BJT A;  4OIR A;  4KDD A;  2EBB A;  1IL2 A;  1VRQ C;  2A68 A;  1YNN A;  5IOS A;  1J98 A;  4OIQ A;  4A93 C;  1ISE A;  3BP8 C;  3GTK K;  4KM8 A;  3HOY K;  5EGE A;  3GTL C;  5C44 K;  1I3Q C;  3GTO C;  1I6V A;  3S15 C;  1XXC A;  3DXJ A;  5C4X C;  1GE9 A;  2P5M A;  1C0A A;  4YFK A;  4A3K K;  1WQF A;  2NVX K;  3PO3 C;  1EH1 A;  2W7V A;  3AH5 A;  4XLP A;  4G0U A;  3HOZ C;  2YU9 K;  2R92 C;  4C3I C;  1SFO K;  1XXB A;  1EFW A;  3ERE D;  2PMZ D;  2CW0 A;  2JA8 C;  2VUM C;  4LR2 A;  1TWA C;  1IE0 A;  3CQZ A;  1AB4 A;  4YFX A;  3IPJ A;  5IYD C;  5TJ3 A;  2BE5 A;  3I4N K;  1XXA A;  2PA8 L;  5JFE A;  1K83 A;  1IBA A;  3Q3Q A;  1TWC C;  3WOD A;  4WJ3 M;  4GFQ A;  1I50 C;  3GTJ C;  4BBR C;  3GTG A;  2R7Z A;  1ZQ1 C;  3AQP A;  4KAT A;  3HOU K;  4C2M C;  3FKI K;  3H0G K;  4A3J K;  2GSN A;  4FZB A;  3S1M C;  4A3D K;  3HOX C;  4GTE A;  4A3M K;  4A3L K;  4O2D A;  4Y52 K;  4Y7N K;  3NUH A;  1O29 A;  3S16 C;  1DCH A;  3FHZ A;  1WQH A;  1TWH K;  5IYC K;  3S14 K;  4P5B A;  5CHP A;  1Y1W A;  3V4G A;  5IP7 K;  4A3F K;  1XZQ A;  3GTM A;  4A3C C;  3RZD K;  5JVO A;  4QJV A;  4BLB A;  1PJ7 A;  4LLG A;  2O5J A;  4OIN A;  1TWF K;  4KMU A;  2B63 K;  1WOS A;  3GTP A;  3GTK C;  3HOY C;  3HXA A;  4P9S A;  1X31 C;  5IOR A;  5C44 C;  1UV7 A;  2JA7 K;  3A8J A;  1L0W A;  2PMZ L;  1I6H K;  2WAQ D;  1JQW A;  4A3K C;  2NVX C;  2PA8 D;  2JA5 K;  4OIO A;  1I3Q A;  3GTO A;  3GSI A;  2XCQ A;  1IW7 A;  2GSO A;  1TWG K;  4QJV B;  1SFO C;  4A3B K;  3M3Y K;  1J6W A;  3S1Q K;  2WB1 L;  2R92 A;  2V6S A;  4G7O A;  4BBS K;  1WOO A;  4OIP A;  3I4M K;  3HOW K;  4MEX A;  4GTL A;  4LK1 A;  3L4J A;  2VUM A;  3M4O K;  1WIH A;  1TWA A;  3G4A A;  3T02 A;  3I4N C;  2JA6 K;  2ZUE A;  4AYB L;  3S1N K;  4MQ9 A;  2KWA A;  3S0X A;  1XPP A;  4NOI A;  5IP9 K;  2R93 K;  4X6A C;  3FOF A;  1WCM A;  4XCH A;  4KB2 A;  3K7A K;  3HOU C;  3FKI C;  3H0G C;  4BLA A;  5C3E K;  1G51 A;  4A3J C;  4A3D C;  1V5V A;  3BP3 A;  1I50 A;  3GTJ A;  4A3M C;  4A3L C;  5TMF A;  4BKW A;  4Y52 C;  4DDQ A;  3GTQ K;  4Y7N C;  3A8K A;  3GEH A;  4GTC A;  3JST A;  2CFA B;  2E2I K;  4PAB A;  2NVQ K;  1TWH C;  5IYC C;  3S14 C;  3LAJ A;  4G7Z A;  5C4J K;  5IP7 C;  4A3F C;  1F9N A;  1R9T K;  5L46 A;  3PO2 K;  3RZD C;  4YFN A;  2O5I A;  2E2J K; 
#chains in the Genus database with same CATH homology
 3S16 C;  4A3I K;  3GTG K;  2R7Z K;  1TWH K;  3HKZ L;  5IYC K;  4C2M K;  2A6H A;  3S14 K;  5IYB K;  1YNJ A;  4YG2 A;  4BY7 C;  3S1M K;  3HOX K;  3S2H C;  2WB1 D;  5IP7 K;  2WAQ L;  4A3F K;  1Y1W C;  1BDF A;  5FLM K;  1TWF C;  2E2H C;  4A3C C;  3RZD K;  4QJV A;  3GTM C;  2B63 C;  3GTP K;  4KN7 A;  2Y0S L;  4BY1 K;  3S16 K;  4BXX C;  3HOV C;  2NVT C;  4BY7 K;  5TMC A;  1SMY A;  4MEY A;  4LLG A;  3S2H K;  2JA7 C;  4BY1 C;  4OIN A;  2O5J A;  1Y1W K;  1Y1V C;  2E2H K;  1TWF K;  4KMU A;  4A3C K;  3S2D C;  5M3F K;  3RZO C;  1I6H C;  4XSX A;  4AYB D;  3GTM K;  2B63 K;  2JA5 C;  3GTK C;  2NVY C;  4BXX K;  3HOY C;  4OIR A;  5C44 C;  3HOV K;  2NVT K;  4C3J K;  3H3V D;  2A68 A;  4QIW L;  4JK1 A;  2JA7 K;  1YNN A;  1TWG C;  1Y1V K;  4C3H K;  2PMZ L;  4OIQ A;  4GZY A;  1I6H K;  3S2D K;  3RZO K;  4A3B C;  2WAQ D;  3M3Y C;  4A3K C;  3GTP C;  4A93 C;  2NVX C;  2PA8 D;  2JA5 K;  5M5Y K;  3GTK K;  2NVY K;  4OIO A;  4XLN A;  3HOY K;  2A69 A;  3GTL C;  5C44 K;  3S1Q C;  1I3Q C;  3GTO C;  2Y0S D;  1I6V A;  1IW7 A;  4Q4Z A;  3S15 C;  1TWG K;  4Q5S A;  3DXJ A;  4QJV B;  5FJ8 K;  5C4X C;  1SFO C;  4BBS C;  4A3B K;  4A93 K;  4YFK A;  3HOW C;  4A3K K;  3I4M C;  3M3Y K;  2NVX K;  3S1R C;  3PO3 C;  3M4O C;  3GTL K;  3S1Q K;  2WB1 L;  1I3Q K;  4KN4 A;  3GTO K;  1WCM C;  2A6E A;  3S15 K;  4XLP A;  2JA6 C;  3HOZ C;  2YU9 K;  5C4X K;  3S17 C;  5D4D A;  2R92 C;  3HKZ D;  4QIW D;  1SFO K;  3S1N C;  4G7O A;  4BBS K;  4OIP A;  3I4M K;  3HOW K;  4MEX A;  1ZYR A;  3S1R K;  3PO3 K;  4LK1 A;  5IP9 C;  2PMZ D;  4A3G C;  4X6A K;  3M4O K;  2CW0 A;  2JA8 C;  2R93 C;  2VUM C;  1TWA C;  1WCM K;  3I4N C;  1HQM A;  2JA6 K;  3K7A C;  3HOZ K;  3S17 K;  5C3E C;  2R92 K;  4AYB L;  2YU9 C;  4C3I K;  3S1N K;  4MQ9 A;  3CQZ C;  4ZH4 A;  4YFX A;  1XPP A;  4XSZ A;  4G7H A;  4NOI A;  5IP9 K;  4A3G K;  5IYD C;  3H3V L;  3GTQ C;  2JA8 K;  2R93 K;  4X6A C;  2VUM K;  1TWA K;  2BE5 A;  2E2I C;  2NVQ C;  3I4N K;  3K7A K;  3HOU C;  3FKI C;  3H0G C;  4A3J C;  5C3E K;  4A3D C;  4A3E C;  2PA8 L;  4LK0 A;  5C4J C;  3CQZ K;  1TWC C;  3WOD A;  4A3M C;  4A3L C;  1K83 C;  1R9T C;  2PPB A;  1I50 C;  3GTJ C;  5TMF A;  3PO2 C;  4Y52 C;  5IYD K;  3GTQ K;  4Y7N C;  4BBR C;  2E2J C;  2E2I K;  2NVQ K;  4A3I C;  2R7Z C;  3GTG C;  1TWH C;  3HOU K;  5M5X K;  5IYC C;  3FKI K;  3H0G K;  5IYB C;  4A3J K;  3S14 C;  4A3E K;  3S1M C;  4A3D K;  3HOX C;  4G7Z A;  5M5W K;  5C4J K;  5IP7 C;  4A3F C;  1TWC K;  4A3M K;  4A3L K;  1K83 K;  5M3M K;  1R9T K;  1I50 K;  5FLM C;  4LJZ A;  3GTJ K;  3PO2 K;  4Y52 K;  3RZD C;  4YFN A;  2O5I A;  4Y7N K;  4BBR K;  3EQL A;  2E2J K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...