3I4NK

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3i4nK00
4KN4A 4Y7NK 4A3BC 3DXJA 1ZYRA 3GTOC 2R93K 4YFXA 2WAQL 1K83C 4QJVB 4XSZA 4A3MK 3I4NK 4KN7A 5C3EK 4KMUA 3FKIK 4A3FK 1XPPA 5IP7K 4G7ZA 1TWHC 3GTLC 4LK1A 5TMCA 2NVXK 3M4OC 3GTPK 3EQLA 4C2MK 2NVTC 3S1NC 4Y52K 3HOUC 3HOZC 3GTMK 5FLMC 3I4MK 3S2HK 3RZOC 5C44C 2JA8K 4A3JK 4G7OA 4BY1K 2PMZD 2NVYC 4A3LK 4YG2A 4G7HA 4AYBL 1R9TC 4Y52C 4OINA 4BXXC 4BBSC 1I6VA 2PA8D 3S1RK 3GTPC 2NVXC 3K7AK 2JA5K 4OIQA 4A3FC 4Q5SA 3GTGK 2JA7K 5M5WK 3I4NC 1HQMA 4XSXA 2E2IK 2YU9C 3RZDC 2BE5A 4QJVA 3GTOK 4A3CK 5C4JK 4BY7K 1I6HC 2VUMK 2WB1D 2A6HA 5D4DA 3GTQC 5FJ8K 3M3YK 3HOYK 1SFOK 2A68A 3S17K 4C3IK 5M3MK 4MEXA 3M3YC 4A3EK 2Y0SL 1TWFK 4BY7C 2R92C 4JK1A 4OIPA 4A3IC 4A3CC 4X6AC 2YU9K 4ZH4A 4QIWL 4BBRK 4Q4ZA 2E2JC 2CW0A 2E2IC 4OIOA 2R7ZK 1TWCC 3H0GC 2JA5C 4YFNA 3PO3C 3HOXC 4A3DC 2O5IA 3S15K 4A93K 2WAQD 3HOWK 1R9TK 4BXXK 3S1MK 1YNNA 2NVYK 4BY1C 4A3LC 3S1QC 3H3VL 4A3JC 4LK0A 3S1QK 2O5JA 1BDFA 4LJZA 4OIRA 5FLMK 3S1MC 3RZOK 4C3HK 3HOUK 3HOZK 1TWGC 1Y1WK 5C4XK 2NVTK 1TWHK 3H3VD 3S1NK 3S15C 3M4OK 3HOXK 4A93C 3PO3K 1TWCK 2WB1L 3H0GK 3FKIC 4MQ9A 5C3EC 4A3GC 4C3JK 1K83K 5M3FK 2E2JK 4A3MC 4MEYA 4X6AK 2R93C 3CQZK 4A3GK 4XLNA 4Y7NC 1TWFC 3S14C 1I3QK 4A3BK 2A69A 2B63K 4GZYA 5IYCK 5M5YK 3S17C 5C4XC 3GTKK 1TWGK 4QIWD 1Y1WC 1SMYA 4YFKA 1SFOC 3HOYC 2PPBA 5IP9K 1WCMK 4AYBD 1TWAK 2JA6C 3HKZL 2VUMC 3PO2K 3S16C 5C4JC 1I6HK 1I50C 1Y1VC 3HOVK 1IW7A 2E2HK 2A6EA 3RZDK 3GTJC 5IYDK 5IYBC 2NVQC 3WODA 3S2DC 5M5XK 5TMFA 4A3KK 2JA7C 3GTGC 3HOWC 4A3DK 3K7AC 4A3KC 1YNJA 3S1RC 2NVQK 4BBSK 2R7ZC 5IYBK 3S2DK 5IYDC 4NOIA 3GTJK 4BBRC 4XLPA 1Y1VK 2E2HC 4A3IK 1I50K 2PA8L 2R92K 3HOVC 2JA8C 3PO2C 3S16K 4A3EC 5IP9C 1WCMC 2Y0SD 1TWAC 5C44K 3HKZD 2JA6K 3GTMC 3I4MC 3S2HC 2PMZL 4LLGA 3GTKC 3GTLK 2B63C 5IYCC 3GTQK 5IP7C 3S14K 1I3QC 3CQZC
chains in the Genus database with same CATH superfamily
3T00A 2R93K 2WAQL 1K83C 4XSZA 3I4NK 4A3FK 2FQOA 4LR2A 5IP7K 4G7ZA 4LK1A 5TMCA 2NVXK 2P5MA 4GTDA 3S2HK 3TFIA 1WIHA 1I50A 3FOFA 4YG2A 4G7HA 4AYBL 4Y52C 4AH6A 2PA8D 3FOEA 3Q3QA 3GTQA 2GSUA 2YU9C 2ZUFA 3SZYA 3GTQC 3M3YK 1XZQA 1EQRA 2ZFZA 2Y3PA 4BY7C 1TWFK 2JA7A 1WQGA 3GEHA 4A3CC 4KASA 4OIOA 3ADAC 1DD5A 1TWCC 3H0GC 3MMLB 4YFNA 3PO3C 3GTLA 3S15K 3OREA 4G0WA 4P5AA 1R9TK 2V6TA 3OEPA 3S1QK 1VGXA 3OPFA 3RZOK 1XXBA 1Y1WK 3S1NK 4A93C 1IE0A 1INNA 4KM8A 2NVXA 3FKIC 2E2JK 1JOEA 2YU9A 4A3GK 3S14C 2B63K 1TWHA 3TFHA 1TWGK 4KB2A 1WORA 1SMYA 1SFOC 4AYBD 3S16C 3QX3A 2A6EA 5IYDK 1WOSA 3GSIA 3HOWC 2CFAA 2JA5A 1ISEA 3G4CA 3T01A 4BBSK 2R7ZC 1JQWA 5IYBK 3S2DK 2FQTA 4KM9A 4XLPA 1Y1VK 1F7UA 4A3IK 3PO2C 2JA8C 1F7VA 1YX2A 1KQ4A 1EFWA 1TWAC 3A8KA 3CQZA 5E68A 3GTMC 4LLGA 3GTPA 1SFOA 3GTKC 3GTLK 5IOQA 4KN4A 4Y7NK 4A3BC 3DXJA 4YFXA 5C3EK 4KMUA 2RGRA 1XPPA 1TWHC 1XZPA 2NVTC 3HOUC 1JVIA 3FHZA 5FLMC 3GTMK 5C44C 5CHPA 2GAGC 4G7OA 4A3LK 1O28A 4KMAA 3NUHA 4WILA 3GTPC 3S1RK 4G0VA 3K7AK 1RU0A 2JA5K 4OIQA 5M5WK 3GDZA 5CJ9A 5TJ3A 1HQMA 1VRQC 3T02A 2BE5A 5IOTA 3GTOK 3AD8C 3G4AA 5C4JK 2VUMK 2A6HA 5D4DA 4C3IC 5FJ8K 1SFOK 3GEIA 3S0XA 3GTKA 2A68A 1USOA 5HL8A 4C3IK 3S17K 4MEXA 5JVOA 2Y0SL 2GAHC 4A3IC 4ZH4A 2E2JC 4GT9A 1UV7A 3AD7C 2O5IA 1VH2A 3HOWK 1B4AA 1XZQB 1O2FB 1TWFA 4A3LC 2VUMA 1BDFA 4OIRA 1X31C 5FLMK 3HOUK 2ZUEA 1TWGC 2XCRB 2NVTK 1IS1A 4KMHA 4KAWX 1V5VA 4A3GC 1GE9A 4MQ9A 3AD9C 5M3FK 3GTOA 4MEYA 1K83A 2R93C 4XLNA 4Y7NC 3BP3A 4A3BK 1I3QK 4GZYA 1DCHA 5IYCK 5M5YK 3S17C 3GTKK 1Y1WC 4YFKA 1TWAK 2XCQA 3HKZL 2VUMC 5C4JC 1I50C 1Y1VC 2E2HK 1HI9A 1O26A 5EGEA 3GTJC 4KATA 5IYBC 3S2DC 5TMFA 4A3KK 4BKWA 1AB4A 1DCOA 3K7AC 4A3KC 1YNJA 3S1RC 3GTGA 5IYDC 1BS2A 2R93A 2GSOA 5C44K 3S2HC 1EI6A 2JA6A 1EH1A 2B63A 1L0WA 2CFAB 1TWGA 2NVYA 2GSNA 4WJ3M 4RMFA 1ZYRA 4BLAA 3GTOC 4DDQA 4KN7A 2R7ZA 1XXAA 3FKIK 3GTLC 1WQHA 3M4OC 3GTPK 3EQLA 3N0BA 3S1NC 4GTFA 3I4MK 3RZOC 3SZZA 3CAGA 4PABA 2JA8K 4A3JK 1Y1VA 1R9TC 4BBSC 1PJ5A 1I6VA 1WOOA 2NVXC 4A3FC 1BJTA 3L4JA 1O29A 3A8JA 3GTGK 1BGWA 3ERED 4XSXA 3RZDC 4A3CK 5IOSA 2WB1D 1WOPA 4FM9A 3LAJA 3M3YC 1WSRA 1IBAA 1YCLA 1O2AA 2R92C 4JK1A 2V6SA 4X6AC 4Q4ZA 1O24A 1IL2A 2CW0A 4P9SA 4O2DA 2R7ZK 4P5BA 1PJ6A 2JA5C 4GTEA 3AQOA 4A93K 2WAQD 1J98A 3S1MK 2NVYK 4ILDA 4LQYA 3S1QC 4C3HK 3FKIA 3S15C 1TWHK 4KC6A 3PO3K 1TWCK 2WB1L 3H0GK 3GTJA 5C3EC 1K83K 1IQ0A 1ZXOA 1TWFC 1Y1WA 1TWAA 3HOYC 2PPBA 1WCMK 5IP9K 3PO2K 3HOVK 1IW7A 2R92A 2EBBA 2PHCB 5M5XK 1I3QA 4GFQA 1ZQ1C 4A3DK 1ZBSA 2NVQK 3JSTA 4NOIA 1WSVA 3HOVC 2PA8L 2E2HA 3S16K 4A3EC 2JA6K 3TTGA 3HKZD 5L46A 1B4BA 2B63C 3GTQK 5IP7C 3S14K 1J6XA 3CQZC 3GTMA 1TWCA 3H0GA 4GTCA 4A3MK 4QJVB 4C3JC 4BLBA 3LAPA 3L4KA 4KDDA 3N3YA 4C2MK 1XXCA 1WCMA 4Y52K 3HOZC 3GEEA 5IORA 1J6VA 4PAAA 2KWAA 4BY1K 2PMZD 1EK8A 2NVYC 2V6UA 4BXXC 4OINA 2P8TA 4G0UA 4FZBA 3BP8C 4Q5SA 2JA7K 5JFEA 3I4NC 2E2IK 4QJVA 4KARA 3AH5A 2RH6A 4BY7K 1I6HC 3HOYK 4KMDA 4WJ4A 1R9TA 5M3MK 4A3EK 4OIPA 2YU9K 4QIWL 4BBRK 2E2IC 2D6FC 1WQFA 4GTBA 3GIRA 1VLOA 3HOXC 4A3DC 1F93A 4BXXK 4C3HC 1YNNA 2XCOA 4LOWA 4BY1C 3H3VL 4A3JC 4LK0A 2O5JA 4J3NA 4LJZA 3S1MC 3HOZK 1C0AA 3LPXA 4C2MC 5C4XK 3H3VD 4GTAA 3M4OK 3HOXK 4GTLA 4C3JK 4A3MC 4M1XA 2E2IA 4X6AK 3CQZK 5EGHA 2A69A 1VJEA 4XCHA 5C4XC 4QIWD 1G51A 1PJ7A 1F9NA 2JA6C 3VA7A 1I6HK 2W7VA 3IPJA 3RZDK 1O2BA 2NVQC 3WODA 2JA7C 3GTGC 1O25A 1DCPA 3TFJA 3HXAA 3V4GA 3AQPA 4BBRC 3GTJK 1J6WA 2E2HC 1ZVUA 1USMA 1I50K 3N0CA 2R92K 2JH3A 1WCMC 2Y0SD 5IP9C 1XZPB 3I4MC 2PMZL 4KB4A 1O27A 5IYCC 3A8IA 3BUEA 4C45A 1I3QC
chains in the Genus database with same CATH topology
4KN4A 4Y7NK 4A3BC 3DXJA 1ZYRA 3GTOC 2R93K 4YFXA 2WAQL 1K83C 4QJVB 4XSZA 4A3MK 3I4NK 4KN7A 5C3EK 4KMUA 3FKIK 4A3FK 1XPPA 5IP7K 4G7ZA 1TWHC 3GTLC 4LK1A 5TMCA 2NVXK 3M4OC 3GTPK 3EQLA 4C2MK 2NVTC 3S1NC 4Y52K 3HOUC 3HOZC 3GTMK 5FLMC 3I4MK 3S2HK 3RZOC 5C44C 2JA8K 4A3JK 4G7OA 4BY1K 2PMZD 2NVYC 4A3LK 4YG2A 4G7HA 4AYBL 1R9TC 4Y52C 4OINA 4BXXC 4BBSC 1I6VA 2PA8D 3S1RK 3GTPC 2NVXC 3K7AK 2JA5K 4OIQA 4A3FC 4Q5SA 3GTGK 2JA7K 5M5WK 3I4NC 1HQMA 4XSXA 2E2IK 2YU9C 3RZDC 2BE5A 4QJVA 3GTOK 4A3CK 5C4JK 4BY7K 1I6HC 2VUMK 2WB1D 2A6HA 5D4DA 3GTQC 5FJ8K 3M3YK 3HOYK 1SFOK 2A68A 3S17K 4C3IK 5M3MK 4MEXA 3M3YC 4A3EK 2Y0SL 1TWFK 4BY7C 2R92C 4JK1A 4OIPA 4A3IC 4A3CC 4X6AC 2YU9K 4ZH4A 4QIWL 4BBRK 4Q4ZA 2E2JC 2CW0A 2E2IC 4OIOA 2R7ZK 1TWCC 3H0GC 2JA5C 4YFNA 3PO3C 3HOXC 4A3DC 2O5IA 3S15K 4A93K 2WAQD 3HOWK 1R9TK 4BXXK 3S1MK 1YNNA 2NVYK 4BY1C 4A3LC 3S1QC 3H3VL 4A3JC 4LK0A 3S1QK 2O5JA 1BDFA 4LJZA 4OIRA 5FLMK 3S1MC 3RZOK 4C3HK 3HOUK 3HOZK 1TWGC 1Y1WK 5C4XK 2NVTK 1TWHK 3H3VD 3S1NK 3S15C 3M4OK 3HOXK 4A93C 3PO3K 1TWCK 2WB1L 3H0GK 3FKIC 4MQ9A 5C3EC 4A3GC 4C3JK 1K83K 5M3FK 2E2JK 4A3MC 4MEYA 4X6AK 2R93C 3CQZK 4A3GK 4XLNA 4Y7NC 1TWFC 3S14C 1I3QK 4A3BK 2A69A 2B63K 4GZYA 5IYCK 5M5YK 3S17C 5C4XC 3GTKK 1TWGK 4QIWD 1Y1WC 1SMYA 4YFKA 1SFOC 3HOYC 2PPBA 5IP9K 1WCMK 4AYBD 1TWAK 2JA6C 3HKZL 2VUMC 3PO2K 3S16C 5C4JC 1I6HK 1I50C 1Y1VC 3HOVK 1IW7A 2E2HK 2A6EA 3RZDK 3GTJC 5IYDK 5IYBC 2NVQC 3WODA 3S2DC 5M5XK 5TMFA 4A3KK 2JA7C 3GTGC 3HOWC 4A3DK 3K7AC 4A3KC 1YNJA 3S1RC 2NVQK 4BBSK 2R7ZC 5IYBK 3S2DK 5IYDC 4NOIA 3GTJK 4BBRC 4XLPA 1Y1VK 2E2HC 4A3IK 1I50K 2PA8L 2R92K 3HOVC 2JA8C 3PO2C 3S16K 4A3EC 5IP9C 1WCMC 2Y0SD 1TWAC 5C44K 3HKZD 2JA6K 3GTMC 3I4MC 3S2HC 2PMZL 4LLGA 3GTKC 3GTLK 2B63C 5IYCC 3GTQK 5IP7C 3S14K 1I3QC 3CQZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN4 A;  4Y7N K;  4A3B C;  3DXJ A;  1ZYR A;  3GTO C;  2R93 K;  4YFX A;  2WAQ L;  1K83 C;  4QJV B;  4XSZ A;  4A3M K;  3I4N K;  4KN7 A;  5C3E K;  4KMU A;  3FKI K;  4A3F K;  1XPP A;  5IP7 K;  4G7Z A;  1TWH C;  3GTL C;  4LK1 A;  5TMC A;  2NVX K;  3M4O C;  3GTP K;  3EQL A;  4C2M K;  2NVT C;  3S1N C;  4Y52 K;  3HOU C;  3HOZ C;  3GTM K;  5FLM C;  3I4M K;  3S2H K;  3RZO C;  5C44 C;  2JA8 K;  4A3J K;  4G7O A;  4BY1 K;  2PMZ D;  2NVY C;  4A3L K;  4YG2 A;  4G7H A;  4AYB L;  1R9T C;  4Y52 C;  4OIN A;  4BXX C;  4BBS C;  1I6V A;  2PA8 D;  3S1R K;  3GTP C;  2NVX C;  3K7A K;  2JA5 K;  4OIQ A;  4A3F C;  4Q5S A;  3GTG K;  2JA7 K;  5M5W K;  3I4N C;  1HQM A;  4XSX A;  2E2I K;  2YU9 C;  3RZD C;  2BE5 A;  4QJV A;  3GTO K;  4A3C K;  5C4J K;  4BY7 K;  1I6H C;  2VUM K;  2WB1 D;  2A6H A;  5D4D A;  3GTQ C;  5FJ8 K;  3M3Y K;  3HOY K;  1SFO K;  2A68 A;  3S17 K;  4C3I K;  5M3M K;  4MEX A;  3M3Y C;  4A3E K;  2Y0S L;  1TWF K;  4BY7 C;  2R92 C;  4JK1 A;  4OIP A;  4A3I C;  4A3C C;  4X6A C;  2YU9 K;  4ZH4 A;  4QIW L;  4BBR K;  4Q4Z A;  2E2J C;  2CW0 A;  2E2I C;  4OIO A;  2R7Z K;  1TWC C;  3H0G C;  2JA5 C;  4YFN A;  3PO3 C;  3HOX C;  4A3D C;  2O5I A;  3S15 K;  4A93 K;  2WAQ D;  3HOW K;  1R9T K;  4BXX K;  3S1M K;  1YNN A;  2NVY K;  4BY1 C;  4A3L C;  3S1Q C;  3H3V L;  4A3J C;  4LK0 A;  3S1Q K;  2O5J A;  1BDF A;  4LJZ A;  4OIR A;  5FLM K;  3S1M C;  3RZO K;  4C3H K;  3HOU K;  3HOZ K;  1TWG C;  1Y1W K;  5C4X K;  2NVT K;  1TWH K;  3H3V D;  3S1N K;  3S15 C;  3M4O K;  3HOX K;  4A93 C;  3PO3 K;  1TWC K;  2WB1 L;  3H0G K;  3FKI C;  4MQ9 A;  5C3E C;  4A3G C;  4C3J K;  1K83 K;  5M3F K;  2E2J K;  4A3M C;  4MEY A;  4X6A K;  2R93 C;  3CQZ K;  4A3G K;  4XLN A;  4Y7N C;  1TWF C;  3S14 C;  1I3Q K;  4A3B K;  2A69 A;  2B63 K;  4GZY A;  5IYC K;  5M5Y K;  3S17 C;  5C4X C;  3GTK K;  1TWG K;  4QIW D;  1Y1W C;  1SMY A;  4YFK A;  1SFO C;  3HOY C;  2PPB A;  5IP9 K;  1WCM K;  4AYB D;  1TWA K;  2JA6 C;  3HKZ L;  2VUM C;  3PO2 K;  3S16 C;  5C4J C;  1I6H K;  1I50 C;  1Y1V C;  3HOV K;  1IW7 A;  2E2H K;  2A6E A;  3RZD K;  3GTJ C;  5IYD K;  5IYB C;  2NVQ C;  3WOD A;  3S2D C;  5M5X K;  5TMF A;  4A3K K;  2JA7 C;  3GTG C;  3HOW C;  4A3D K;  3K7A C;  4A3K C;  1YNJ A;  3S1R C;  2NVQ K;  4BBS K;  2R7Z C;  5IYB K;  3S2D K;  5IYD C;  4NOI A;  3GTJ K;  4BBR C;  4XLP A;  1Y1V K;  2E2H C;  4A3I K;  1I50 K;  2PA8 L;  2R92 K;  3HOV C;  2JA8 C;  3PO2 C;  3S16 K;  4A3E C;  5IP9 C;  1WCM C;  2Y0S D;  1TWA C;  5C44 K;  3HKZ D;  2JA6 K;  3GTM C;  3I4M C;  3S2H C;  2PMZ L;  4LLG A;  3GTK C;  3GTL K;  2B63 C;  5IYC C;  3GTQ K;  5IP7 C;  3S14 K;  1I3Q C;  3CQZ C; 
#chains in the Genus database with same CATH topology
 3T00 A;  2R93 K;  2WAQ L;  1K83 C;  4XSZ A;  3I4N K;  4A3F K;  2FQO A;  4LR2 A;  5IP7 K;  4G7Z A;  4LK1 A;  5TMC A;  2NVX K;  2P5M A;  4GTD A;  3S2H K;  3TFI A;  1WIH A;  1I50 A;  3FOF A;  4YG2 A;  4G7H A;  4AYB L;  4Y52 C;  4AH6 A;  2PA8 D;  3FOE A;  3Q3Q A;  3GTQ A;  2GSU A;  2YU9 C;  2ZUF A;  3SZY A;  3GTQ C;  3M3Y K;  1XZQ A;  1EQR A;  2ZFZ A;  2Y3P A;  4BY7 C;  1TWF K;  2JA7 A;  1WQG A;  3GEH A;  4A3C C;  4KAS A;  4OIO A;  3ADA C;  1DD5 A;  1TWC C;  3H0G C;  3MML B;  4YFN A;  3PO3 C;  3GTL A;  3S15 K;  3ORE A;  4G0W A;  4P5A A;  1R9T K;  2V6T A;  3OEP A;  3S1Q K;  1VGX A;  3OPF A;  3RZO K;  1XXB A;  1Y1W K;  3S1N K;  4A93 C;  1IE0 A;  1INN A;  4KM8 A;  2NVX A;  3FKI C;  2E2J K;  1JOE A;  2YU9 A;  4A3G K;  3S14 C;  2B63 K;  1TWH A;  3TFH A;  1TWG K;  4KB2 A;  1WOR A;  1SMY A;  1SFO C;  4AYB D;  3S16 C;  3QX3 A;  2A6E A;  5IYD K;  1WOS A;  3GSI A;  3HOW C;  2CFA A;  2JA5 A;  1ISE A;  3G4C A;  3T01 A;  4BBS K;  2R7Z C;  1JQW A;  5IYB K;  3S2D K;  2FQT A;  4KM9 A;  4XLP A;  1Y1V K;  1F7U A;  4A3I K;  3PO2 C;  2JA8 C;  1F7V A;  1YX2 A;  1KQ4 A;  1EFW A;  1TWA C;  3A8K A;  3CQZ A;  5E68 A;  3GTM C;  4LLG A;  3GTP A;  1SFO A;  3GTK C;  3GTL K;  5IOQ A;  4KN4 A;  4Y7N K;  4A3B C;  3DXJ A;  4YFX A;  5C3E K;  4KMU A;  2RGR A;  1XPP A;  1TWH C;  1XZP A;  2NVT C;  3HOU C;  1JVI A;  3FHZ A;  5FLM C;  3GTM K;  5C44 C;  5CHP A;  2GAG C;  4G7O A;  4A3L K;  1O28 A;  4KMA A;  3NUH A;  4WIL A;  3GTP C;  3S1R K;  4G0V A;  3K7A K;  1RU0 A;  2JA5 K;  4OIQ A;  5M5W K;  3GDZ A;  5CJ9 A;  5TJ3 A;  1HQM A;  1VRQ C;  3T02 A;  2BE5 A;  5IOT A;  3GTO K;  3AD8 C;  3G4A A;  5C4J K;  2VUM K;  2A6H A;  5D4D A;  4C3I C;  5FJ8 K;  1SFO K;  3GEI A;  3S0X A;  3GTK A;  2A68 A;  1USO A;  5HL8 A;  4C3I K;  3S17 K;  4MEX A;  5JVO A;  2Y0S L;  2GAH C;  4A3I C;  4ZH4 A;  2E2J C;  4GT9 A;  1UV7 A;  3AD7 C;  2O5I A;  1VH2 A;  3HOW K;  1B4A A;  1XZQ B;  1O2F B;  1TWF A;  4A3L C;  2VUM A;  1BDF A;  4OIR A;  1X31 C;  5FLM K;  3HOU K;  2ZUE A;  1TWG C;  2XCR B;  2NVT K;  1IS1 A;  4KMH A;  4KAW X;  1V5V A;  4A3G C;  1GE9 A;  4MQ9 A;  3AD9 C;  5M3F K;  3GTO A;  4MEY A;  1K83 A;  2R93 C;  4XLN A;  4Y7N C;  3BP3 A;  4A3B K;  1I3Q K;  4GZY A;  1DCH A;  5IYC K;  5M5Y K;  3S17 C;  3GTK K;  1Y1W C;  4YFK A;  1TWA K;  2XCQ A;  3HKZ L;  2VUM C;  5C4J C;  1I50 C;  1Y1V C;  2E2H K;  1HI9 A;  1O26 A;  5EGE A;  3GTJ C;  4KAT A;  5IYB C;  3S2D C;  5TMF A;  4A3K K;  4BKW A;  1AB4 A;  1DCO A;  3K7A C;  4A3K C;  1YNJ A;  3S1R C;  3GTG A;  5IYD C;  1BS2 A;  2R93 A;  2GSO A;  5C44 K;  3S2H C;  1EI6 A;  2JA6 A;  1EH1 A;  2B63 A;  1L0W A;  2CFA B;  1TWG A;  2NVY A;  2GSN A;  4WJ3 M;  4RMF A;  1ZYR A;  4BLA A;  3GTO C;  4DDQ A;  4KN7 A;  2R7Z A;  1XXA A;  3FKI K;  3GTL C;  1WQH A;  3M4O C;  3GTP K;  3EQL A;  3N0B A;  3S1N C;  4GTF A;  3I4M K;  3RZO C;  3SZZ A;  3CAG A;  4PAB A;  2JA8 K;  4A3J K;  1Y1V A;  1R9T C;  4BBS C;  1PJ5 A;  1I6V A;  1WOO A;  2NVX C;  4A3F C;  1BJT A;  3L4J A;  1O29 A;  3A8J A;  3GTG K;  1BGW A;  3ERE D;  4XSX A;  3RZD C;  4A3C K;  5IOS A;  2WB1 D;  1WOP A;  4FM9 A;  3LAJ A;  3M3Y C;  1WSR A;  1IBA A;  1YCL A;  1O2A A;  2R92 C;  4JK1 A;  2V6S A;  4X6A C;  4Q4Z A;  1O24 A;  1IL2 A;  2CW0 A;  4P9S A;  4O2D A;  2R7Z K;  4P5B A;  1PJ6 A;  2JA5 C;  4GTE A;  3AQO A;  4A93 K;  2WAQ D;  1J98 A;  3S1M K;  2NVY K;  4ILD A;  4LQY A;  3S1Q C;  4C3H K;  3FKI A;  3S15 C;  1TWH K;  4KC6 A;  3PO3 K;  1TWC K;  2WB1 L;  3H0G K;  3GTJ A;  5C3E C;  1K83 K;  1IQ0 A;  1ZXO A;  1TWF C;  1Y1W A;  1TWA A;  3HOY C;  2PPB A;  1WCM K;  5IP9 K;  3PO2 K;  3HOV K;  1IW7 A;  2R92 A;  2EBB A;  2PHC B;  5M5X K;  1I3Q A;  4GFQ A;  1ZQ1 C;  4A3D K;  1ZBS A;  2NVQ K;  3JST A;  4NOI A;  1WSV A;  3HOV C;  2PA8 L;  2E2H A;  3S16 K;  4A3E C;  2JA6 K;  3TTG A;  3HKZ D;  5L46 A;  1B4B A;  2B63 C;  3GTQ K;  5IP7 C;  3S14 K;  1J6X A;  3CQZ C;  3GTM A;  1TWC A;  3H0G A;  4GTC A;  4A3M K;  4QJV B;  4C3J C;  4BLB A;  3LAP A;  3L4K A;  4KDD A;  3N3Y A;  4C2M K;  1XXC A;  1WCM A;  4Y52 K;  3HOZ C;  3GEE A;  5IOR A;  1J6V A;  4PAA A;  2KWA A;  4BY1 K;  2PMZ D;  1EK8 A;  2NVY C;  2V6U A;  4BXX C;  4OIN A;  2P8T A;  4G0U A;  4FZB A;  3BP8 C;  4Q5S A;  2JA7 K;  5JFE A;  3I4N C;  2E2I K;  4QJV A;  4KAR A;  3AH5 A;  2RH6 A;  4BY7 K;  1I6H C;  3HOY K;  4KMD A;  4WJ4 A;  1R9T A;  5M3M K;  4A3E K;  4OIP A;  2YU9 K;  4QIW L;  4BBR K;  2E2I C;  2D6F C;  1WQF A;  4GTB A;  3GIR A;  1VLO A;  3HOX C;  4A3D C;  1F93 A;  4BXX K;  4C3H C;  1YNN A;  2XCO A;  4LOW A;  4BY1 C;  3H3V L;  4A3J C;  4LK0 A;  2O5J A;  4J3N A;  4LJZ A;  3S1M C;  3HOZ K;  1C0A A;  3LPX A;  4C2M C;  5C4X K;  3H3V D;  4GTA A;  3M4O K;  3HOX K;  4GTL A;  4C3J K;  4A3M C;  4M1X A;  2E2I A;  4X6A K;  3CQZ K;  5EGH A;  2A69 A;  1VJE A;  4XCH A;  5C4X C;  4QIW D;  1G51 A;  1PJ7 A;  1F9N A;  2JA6 C;  3VA7 A;  1I6H K;  2W7V A;  3IPJ A;  3RZD K;  1O2B A;  2NVQ C;  3WOD A;  2JA7 C;  3GTG C;  1O25 A;  1DCP A;  3TFJ A;  3HXA A;  3V4G A;  3AQP A;  4BBR C;  3GTJ K;  1J6W A;  2E2H C;  1ZVU A;  1USM A;  1I50 K;  3N0C A;  2R92 K;  2JH3 A;  1WCM C;  2Y0S D;  5IP9 C;  1XZP B;  3I4M C;  2PMZ L;  4KB4 A;  1O27 A;  5IYC C;  3A8I A;  3BUE A;  4C45 A;  1I3Q C; 
#chains in the Genus database with same CATH homology
 4KN4 A;  4Y7N K;  4A3B C;  3DXJ A;  1ZYR A;  3GTO C;  2R93 K;  4YFX A;  2WAQ L;  1K83 C;  4QJV B;  4XSZ A;  4A3M K;  3I4N K;  4KN7 A;  5C3E K;  4KMU A;  3FKI K;  4A3F K;  1XPP A;  5IP7 K;  4G7Z A;  1TWH C;  3GTL C;  4LK1 A;  5TMC A;  2NVX K;  3M4O C;  3GTP K;  3EQL A;  4C2M K;  2NVT C;  3S1N C;  4Y52 K;  3HOU C;  3HOZ C;  3GTM K;  5FLM C;  3I4M K;  3S2H K;  3RZO C;  5C44 C;  2JA8 K;  4A3J K;  4G7O A;  4BY1 K;  2PMZ D;  2NVY C;  4A3L K;  4YG2 A;  4G7H A;  4AYB L;  1R9T C;  4Y52 C;  4OIN A;  4BXX C;  4BBS C;  1I6V A;  2PA8 D;  3S1R K;  3GTP C;  2NVX C;  3K7A K;  2JA5 K;  4OIQ A;  4A3F C;  4Q5S A;  3GTG K;  2JA7 K;  5M5W K;  3I4N C;  1HQM A;  4XSX A;  2E2I K;  2YU9 C;  3RZD C;  2BE5 A;  4QJV A;  3GTO K;  4A3C K;  5C4J K;  4BY7 K;  1I6H C;  2VUM K;  2WB1 D;  2A6H A;  5D4D A;  3GTQ C;  5FJ8 K;  3M3Y K;  3HOY K;  1SFO K;  2A68 A;  3S17 K;  4C3I K;  5M3M K;  4MEX A;  3M3Y C;  4A3E K;  2Y0S L;  1TWF K;  4BY7 C;  2R92 C;  4JK1 A;  4OIP A;  4A3I C;  4A3C C;  4X6A C;  2YU9 K;  4ZH4 A;  4QIW L;  4BBR K;  4Q4Z A;  2E2J C;  2CW0 A;  2E2I C;  4OIO A;  2R7Z K;  1TWC C;  3H0G C;  2JA5 C;  4YFN A;  3PO3 C;  3HOX C;  4A3D C;  2O5I A;  3S15 K;  4A93 K;  2WAQ D;  3HOW K;  1R9T K;  4BXX K;  3S1M K;  1YNN A;  2NVY K;  4BY1 C;  4A3L C;  3S1Q C;  3H3V L;  4A3J C;  4LK0 A;  3S1Q K;  2O5J A;  1BDF A;  4LJZ A;  4OIR A;  5FLM K;  3S1M C;  3RZO K;  4C3H K;  3HOU K;  3HOZ K;  1TWG C;  1Y1W K;  5C4X K;  2NVT K;  1TWH K;  3H3V D;  3S1N K;  3S15 C;  3M4O K;  3HOX K;  4A93 C;  3PO3 K;  1TWC K;  2WB1 L;  3H0G K;  3FKI C;  4MQ9 A;  5C3E C;  4A3G C;  4C3J K;  1K83 K;  5M3F K;  2E2J K;  4A3M C;  4MEY A;  4X6A K;  2R93 C;  3CQZ K;  4A3G K;  4XLN A;  4Y7N C;  1TWF C;  3S14 C;  1I3Q K;  4A3B K;  2A69 A;  2B63 K;  4GZY A;  5IYC K;  5M5Y K;  3S17 C;  5C4X C;  3GTK K;  1TWG K;  4QIW D;  1Y1W C;  1SMY A;  4YFK A;  1SFO C;  3HOY C;  2PPB A;  5IP9 K;  1WCM K;  4AYB D;  1TWA K;  2JA6 C;  3HKZ L;  2VUM C;  3PO2 K;  3S16 C;  5C4J C;  1I6H K;  1I50 C;  1Y1V C;  3HOV K;  1IW7 A;  2E2H K;  2A6E A;  3RZD K;  3GTJ C;  5IYD K;  5IYB C;  2NVQ C;  3WOD A;  3S2D C;  5M5X K;  5TMF A;  4A3K K;  2JA7 C;  3GTG C;  3HOW C;  4A3D K;  3K7A C;  4A3K C;  1YNJ A;  3S1R C;  2NVQ K;  4BBS K;  2R7Z C;  5IYB K;  3S2D K;  5IYD C;  4NOI A;  3GTJ K;  4BBR C;  4XLP A;  1Y1V K;  2E2H C;  4A3I K;  1I50 K;  2PA8 L;  2R92 K;  3HOV C;  2JA8 C;  3PO2 C;  3S16 K;  4A3E C;  5IP9 C;  1WCM C;  2Y0S D;  1TWA C;  5C44 K;  3HKZ D;  2JA6 K;  3GTM C;  3I4M C;  3S2H C;  2PMZ L;  4LLG A;  3GTK C;  3GTL K;  2B63 C;  5IYC C;  3GTQ K;  5IP7 C;  3S14 K;  1I3Q C;  3CQZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...