3I4NK

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
116
structure length
116
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 29
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3i4nK00
4C3IK 3HOYK 3M4OC 4A3EC 2Y0SD 4YFNA 4X6AC 4G7OA 3EQLA 3HOUC 2NVXK 1R9TC 1Y1WK 2JA7C 2BE5A 3H0GK 2WB1D 2WB1L 3I4MK 3S15C 3GTPC 3K7AC 5IYDC 5IYBK 2R93C 5FLMC 4A3CK 1I6VA 2JA5K 1TWAC 3GTOK 4OIOA 4BY7C 3S1NC 4LK0A 1TWHK 3GTJK 2A6EA 4A93K 5IP9K 2NVQC 4A3DC 4A3LC 5IP7C 4BBSK 3RZOC 3S14C 3HOXK 4A3FK 1BDFA 3S1RC 2A6HA 4OIQA 2NVTK 3HKZD 3HKZL 3GTLK 2YU9C 4BBRC 4YFKA 4A3GC 3RZDK 2B63C 3M3YC 5C4XK 4XLNA 1I50K 4A3KC 2O5IA 3H3VL 3H3VD 4BXXK 4QJVB 3S1QC 3S2DK 3GTQC 1TWFC 5TMCA 4MQ9A 3GTKK 5C4JC 4A3BC 3S16K 1Y1VK 2E2JC 5M5WK 3S1MK 1YNJA 4G7ZA 1TWCC 2NVYK 3FKIK 4GZYA 5IYCC 3PO2K 3HOYC 3PO3K 1TWGC 4ZH4A 3S2HK 2B63K 2JA6C 3HOWK 4XSXA 1Y1WC 4JK1A 1SFOK 2E2HK 3H0GC 3I4MC 5M3MK 4Y52K 4Y7NK 4OIPA 1K83K 5M5XK 1XPPA 4KN4A 2JA5C 1I3QK 3GTOC 3GTJC 1TWHC 3HOVK 4A93C 4LK1A 5IP9C 3HOZC 5C3EK 2A68A 2R92K 1I6HK 1SMYA 1TWAK 1WCMK 3CQZC 5M5YK 3GTMK 3HOXC 4MEXA 3I4NK 4A3FC 4YFXA 4BY1K 3S17K 5FJ8K 3GTGK 1IW7A 2E2IK 2NVTC 4A3JK 5IYDK 2JA8K 2VUMK 2PA8L 4A3MK 3RZDC 4C3JK 2PMZL 2PMZD 1I50C 5C4XC 4BXXC 2R7ZK 3S2DC 4A3IK 4MEYA 5C44K 2YU9K 3CQZK 2NVXC 3WODA 4XLPA 3GTKC 3M4OK 4A3EK 4QJVA 3S16C 1Y1VC 3DXJA 3GTQK 3S1MC 4X6AK 2NVYC 3FKIC 4LLGA 3HOUK 1R9TK 2JA7K 3PO2C 3PO3C 4YG2A 5IYBC 3S2HC 4A3CC 3S15K 3GTPK 4OINA 3K7AK 3HOWC 4XSZA 4C3HK 1TWGK 1SFOC 1HQMA 4AYBD 4AYBL 5FLMK 2Y0SL 4C2MK 2E2HC 2JA6K 4Y52C 4OIRA 4KMUA 4Y7NC 3S1NK 4A3LK 4BBSC 4BY7K 2NVQK 4G7HA 4A3DK 1K83C 2WAQD 2WAQL 5IP7K 3RZOK 2R93K 3GTLC 3S14K 1I3QC 4NOIA 5D4DA 1YNNA 3HOVC 5M3FK 2PA8D 3S1RK 1I6HC 5C3EC 2R92C 3GTMC 1WCMC 4BBRK 3I4NC 2PPBA 4A3GK 4BY1C 3HOZK 4LJZA 3S17C 3M3YK 3GTGC 2E2IC 4A3KK 4A3JC 4Q5SA 2JA8C 2VUMC 4A3MC 4KN7A 3S1QK 1TWFK 5TMFA 1ZYRA 4Q4ZA 2O5JA 5C4JK 4A3BK 2E2JK 2R7ZC 4QIWD 4QIWL 2CW0A 1TWCK 4A3IC 5C44C 5IYCK 2A69A
chains in the Genus database with same CATH superfamily
3HOYK 3M4OC 2RH6A 2Y0SD 3V4GA 3EQLA 2VUMA 2BE5A 2WB1L 1ISEA 3FKIA 4RMFA 5IYBK 4C2MC 4LK0A 4A3LC 2NVQC 1VGXA 4A3FK 1BDFA 3HKZL 1WSVA 1DCHA 4KC6A 3M3YC 1TWAA 4A3KC 2O5IA 4G0UA 1EH1A 4BXXK 4MQ9A 2Y3PA 5IOSA 5C4JC 3S16K 4G7ZA 2V6UA 3FKIK 2XCOA 1TWGC 4GTDA 1J98A 1XZPA 1VH2A 3SZYA 2XCRB 3H0GC 1BJTA 3GTQA 1VJEA 3GTOC 1EI6A 4KATA 3HOVK 1I6HK 5C3EK 1TWAK 3AH5A 3A8KA 2NVTC 3AD9C 2CFAB 2PA8L 5IORA 3L4KA 3GTJA 1O2BA 3LAPA 3S2DC 3G4AA 4A3IK 3S0XA 2YU9K 3M4OK 1F9NA 3GTKC 3FHZA 1Y1VC 3GTQK 3S1MC 4KMAA 1WQHA 4LLGA 5IYBC 1YCLA 2ZUEA 1BS2A 1I50A 4XSZA 1SFOC 2V6SA 4M1XA 4C2MK 4OIRA 1J6VA 4KMUA 4Y7NC 4A3LK 2NVQK 1K83C 4P5AA 3H0GA 1XXBA 1I3QC 1IQ0A 2R92C 1WCMC 3GTOA 4BY1C 3HOZK 3M3YK 1J6WA 2E2IC 4A3KK 4KB2A 4WJ4A 2JA8C 2VUMC 4A3MC 3T00A 2JH3A 3GTLA 1O2FB 1ZYRA 2O5JA 4C45A 5C4JK 4QIWL 2CW0A 5C44C 3CQZC 1O27A 4X6AC 4G7OA 2JA7C 1INNA 2GAGC 3H0GK 2WB1D 3GTKA 1Y1VA 3S15C 3K7AC 5IYDC 4GTEA 3GTOK 1TWAC 4KB4A 2B63A 2A6EA 4KASA 1O2AA 3RZOC 4BBSK 4FM9A 2NVTK 3HKZD 1K83A 3GTLK 5JVOA 4YFKA 1I3QA 2R93A 4XCHA 4XLNA 4KDDA 1WCMA 4QJVB 3S1QC 3S2DK 3GTQC 2E2IA 5TJ3A 3GTKK 1Y1VK 2E2JC 3S1MK 1TWCC 1UV7A 3ADAC 1XZQB 4C3IC 2B63K 3OPFA 3CQZA 3HXAA 4JK1A 1SFOK 3I4MC 4Y7NK 4OIPA 2JA7A 1K83K 3GEIA 1X31C 2JA5C 1PJ6A 1I3QK 3GTJC 4ILDA 5IP9C 3HOZC 2R92K 1SMYA 3OREA 1WCMK 3BP3A 5JFEA 4BY1K 1Y1WA 5FJ8K 2E2IK 1F93A 1PJ5A 2JA8K 1AB4A 2VUMK 4A3MK 3RZDC 1EFWA 1JVIA 1C0AA 2PMZL 1I50C 1B4BA 4BLAA 3GSIA 1USMA 4KMDA 4KAWX 2KWAA 5C44K 3CQZK 4XLPA 4X6AK 2JA7K 3PO2C 4G0VA 1IL2A 3PO3C 3IPJA 3S2HC 3S15K 4GTCA 5CHPA 1TWCA 3K7AK 5IYDK 3AD7C 2Y0SL 3BP8C 4BBSC 4Y52C 1XXAA 2XCQA 4G7HA 5IOTA 2WAQL 3RZOK 3GTLC 3OEPA 3N3YA 2P5MA 2FQTA 2JA5A 3LPXA 3I4NC 4LJZA 3S17C 3GTGC 1WQGA 4KN7A 3S1QK 4C3JC 2CFAA 1O24A 2D6FC 2E2JK 2R7ZC 4QIWD 1GE9A 1TWCK 2B63C 3AQOA 1WOSA 1ZVUA 4C3IK 4A3EC 1F7UA 2FQOA 2EBBA 2W7VA 3GEHA 3I4MK 1DCPA 3A8IA 2GAHC 3GTPC 1DD5A 5E68A 2R93C 4WILA 5FLMC 4A3CK 2JA5K 3GTJK 5IP9K 5IOQA 4A3DC 3S14C 2A6HA 4KM9A 5L46A 3RZDK 1ZXOA 1I50K 3TFJA 4BKWA 2GSUA 3H3VL 3TFIA 3GTGA 5TMCA 3TTGA 3MMLB 1O25A 1YNJA 5IYCC 3PO2K 1USOA 4J3NA 3PO3K 4ZH4A 3S2HK 2R7ZA 4XSXA 1Y1WC 3VA7A 4GT9A 1O29A 1WOPA 1EK8A 5M3MK 4Y52K 4A93C 1TWHC 3GTPA 2A68A 1IS1A 3NUHA 2JA6A 3HOXC 3I4NK 3N0CA 1WORA 4YFXA 3S17K 3GTGK 4C3JK 2PMZD 5C4XC 5CJ9A 1G51A 1WIHA 2R7ZK 4MEYA 3WODA 4A3EK 1VLOA 4QJVA 1WOOA 2NVYC 2V6TA 4A3CC 1ZBSA 3GTPK 3HOWC 1XZQA 2R93K 2E2HC 1HQMA 4AYBL 5FLMK 2JA6K 1JQWA 4A3DK 5HL8A 2NVXA 2WAQD 3S14K 4NOIA 5D4DA 1YNNA 2PA8D 1HI9A 3GTMC 1WQFA 3ERED 1TWHA 1IBAA 4A3JC 4Q5SA 4KMHA 5EGEA 1ZQ1C 5TMFA 1XZPB 5IYCK 1L0WA 4YFNA 4GTLA 1JOEA 3HOUC 3AQPA 3JSTA 2NVXK 1R9TC 1Y1WK 3GDZA 1VRQC 1B4AA 2NVYA 3TFHA 4C3HC 1I6VA 4OIOA 4BY7C 3S1NC 4A93K 1TWHK 4BLBA 2YU9A 1PJ7A 5IP7C 2E2HA 4GTFA 3HOXK 4P9SA 3S1RC 4OIQA 1BGWA 3G4CA 2ZFZA 4BBRC 3QX3A 3GIRA 4A3GC 3FOFA 4G0WA 5C4XK 3GTMA 1O28A 3L4JA 3GEEA 5EGHA 3H3VD 1WSRA 1IE0A 1TWFC 4AH6A 4LQYA 4A3BC 5M5WK 4GZYA 2NVYK 3HOYC 2GSOA 2JA6C 3HOWK 2E2HK 4WJ3M 3FOEA 4KARA 4FZBA 1R9TA 5M5XK 1XPPA 4KN4A 4LR2A 4LK1A 2GSNA 1TWGA 1XXCA 5M5YK 3GTMK 4MEXA 4A3FC 2ZUFA 1IW7A 4A3JK 4LOWA 1RU0A 4KM8A 1EQRA 4BXXC 4DDQA 2NVXC 3S16C 3DXJA 3LAJA 1TWFA 3HOUK 3FKIC 1KQ4A 1R9TK 4YG2A 3T02A 1V5VA 4OINA 4PABA 4C3HK 1TWGK 4AYBD 4BY7K 1J6XA 3S1NK 4O2DA 2P8TA 3SZZA 4GFQA 3T01A 5IP7K 1O26A 3AD8C 3HOVC 2PHCB 5M3FK 3S1RK 3CAGA 1I6HC 5C3EC 3A8JA 4BBRK 2PPBA 4A3GK 1YX2A 4PAAA 1SFOA 3Q3QA 4GTBA 3N0BA 4P5BA 1TWFK 2RGRA 3BUEA 4GTAA 1DCOA 4Q4ZA 4A3BK 2R92A 4A3IC 1F7VA 2YU9C 2A69A
chains in the Genus database with same CATH topology
4C3IK 3HOYK 3M4OC 4A3EC 2Y0SD 4YFNA 4X6AC 4G7OA 3EQLA 3HOUC 2NVXK 1R9TC 1Y1WK 2JA7C 2BE5A 3H0GK 2WB1D 2WB1L 3I4MK 3S15C 3GTPC 3K7AC 5IYDC 5IYBK 2R93C 5FLMC 4A3CK 1I6VA 2JA5K 1TWAC 3GTOK 4OIOA 4BY7C 3S1NC 4LK0A 1TWHK 3GTJK 2A6EA 4A93K 5IP9K 2NVQC 4A3DC 4A3LC 5IP7C 4BBSK 3RZOC 3S14C 3HOXK 4A3FK 1BDFA 3S1RC 2A6HA 4OIQA 2NVTK 3HKZD 3HKZL 3GTLK 2YU9C 4BBRC 4YFKA 4A3GC 3RZDK 2B63C 3M3YC 5C4XK 4XLNA 1I50K 4A3KC 2O5IA 3H3VL 3H3VD 4BXXK 4QJVB 3S1QC 3S2DK 3GTQC 1TWFC 5TMCA 4MQ9A 3GTKK 5C4JC 4A3BC 3S16K 1Y1VK 2E2JC 5M5WK 3S1MK 1YNJA 4G7ZA 1TWCC 2NVYK 3FKIK 4GZYA 5IYCC 3PO2K 3HOYC 3PO3K 1TWGC 4ZH4A 3S2HK 2B63K 2JA6C 3HOWK 4XSXA 1Y1WC 4JK1A 1SFOK 2E2HK 3H0GC 3I4MC 5M3MK 4Y52K 4Y7NK 4OIPA 1K83K 5M5XK 1XPPA 4KN4A 2JA5C 1I3QK 3GTOC 3GTJC 1TWHC 3HOVK 4A93C 4LK1A 5IP9C 3HOZC 5C3EK 2A68A 2R92K 1I6HK 1SMYA 1TWAK 1WCMK 3CQZC 5M5YK 3GTMK 3HOXC 4MEXA 3I4NK 4A3FC 4YFXA 4BY1K 3S17K 5FJ8K 3GTGK 1IW7A 2E2IK 2NVTC 4A3JK 5IYDK 2JA8K 2VUMK 2PA8L 4A3MK 3RZDC 4C3JK 2PMZL 2PMZD 1I50C 5C4XC 4BXXC 2R7ZK 3S2DC 4A3IK 4MEYA 5C44K 2YU9K 3CQZK 2NVXC 3WODA 4XLPA 3GTKC 3M4OK 4A3EK 4QJVA 3S16C 1Y1VC 3DXJA 3GTQK 3S1MC 4X6AK 2NVYC 3FKIC 4LLGA 3HOUK 1R9TK 2JA7K 3PO2C 3PO3C 4YG2A 5IYBC 3S2HC 4A3CC 3S15K 3GTPK 4OINA 3K7AK 3HOWC 4XSZA 4C3HK 1TWGK 1SFOC 1HQMA 4AYBD 4AYBL 5FLMK 2Y0SL 4C2MK 2E2HC 2JA6K 4Y52C 4OIRA 4KMUA 4Y7NC 3S1NK 4A3LK 4BBSC 4BY7K 2NVQK 4G7HA 4A3DK 1K83C 2WAQD 2WAQL 5IP7K 3RZOK 2R93K 3GTLC 3S14K 1I3QC 4NOIA 5D4DA 1YNNA 3HOVC 5M3FK 2PA8D 3S1RK 1I6HC 5C3EC 2R92C 3GTMC 1WCMC 4BBRK 3I4NC 2PPBA 4A3GK 4BY1C 3HOZK 4LJZA 3S17C 3M3YK 3GTGC 2E2IC 4A3KK 4A3JC 4Q5SA 2JA8C 2VUMC 4A3MC 4KN7A 3S1QK 1TWFK 5TMFA 1ZYRA 4Q4ZA 2O5JA 5C4JK 4A3BK 2E2JK 2R7ZC 4QIWD 4QIWL 2CW0A 1TWCK 4A3IC 5C44C 5IYCK 2A69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C3I K;  3HOY K;  3M4O C;  4A3E C;  2Y0S D;  4YFN A;  4X6A C;  4G7O A;  3EQL A;  3HOU C;  2NVX K;  1R9T C;  1Y1W K;  2JA7 C;  2BE5 A;  3H0G K;  2WB1 D;  2WB1 L;  3I4M K;  3S15 C;  3GTP C;  3K7A C;  5IYD C;  5IYB K;  2R93 C;  5FLM C;  4A3C K;  1I6V A;  2JA5 K;  1TWA C;  3GTO K;  4OIO A;  4BY7 C;  3S1N C;  4LK0 A;  1TWH K;  3GTJ K;  2A6E A;  4A93 K;  5IP9 K;  2NVQ C;  4A3D C;  4A3L C;  5IP7 C;  4BBS K;  3RZO C;  3S14 C;  3HOX K;  4A3F K;  1BDF A;  3S1R C;  2A6H A;  4OIQ A;  2NVT K;  3HKZ D;  3HKZ L;  3GTL K;  2YU9 C;  4BBR C;  4YFK A;  4A3G C;  3RZD K;  2B63 C;  3M3Y C;  5C4X K;  4XLN A;  1I50 K;  4A3K C;  2O5I A;  3H3V L;  3H3V D;  4BXX K;  4QJV B;  3S1Q C;  3S2D K;  3GTQ C;  1TWF C;  5TMC A;  4MQ9 A;  3GTK K;  5C4J C;  4A3B C;  3S16 K;  1Y1V K;  2E2J C;  5M5W K;  3S1M K;  1YNJ A;  4G7Z A;  1TWC C;  2NVY K;  3FKI K;  4GZY A;  5IYC C;  3PO2 K;  3HOY C;  3PO3 K;  1TWG C;  4ZH4 A;  3S2H K;  2B63 K;  2JA6 C;  3HOW K;  4XSX A;  1Y1W C;  4JK1 A;  1SFO K;  2E2H K;  3H0G C;  3I4M C;  5M3M K;  4Y52 K;  4Y7N K;  4OIP A;  1K83 K;  5M5X K;  1XPP A;  4KN4 A;  2JA5 C;  1I3Q K;  3GTO C;  3GTJ C;  1TWH C;  3HOV K;  4A93 C;  4LK1 A;  5IP9 C;  3HOZ C;  5C3E K;  2A68 A;  2R92 K;  1I6H K;  1SMY A;  1TWA K;  1WCM K;  3CQZ C;  5M5Y K;  3GTM K;  3HOX C;  4MEX A;  3I4N K;  4A3F C;  4YFX A;  4BY1 K;  3S17 K;  5FJ8 K;  3GTG K;  1IW7 A;  2E2I K;  2NVT C;  4A3J K;  5IYD K;  2JA8 K;  2VUM K;  2PA8 L;  4A3M K;  3RZD C;  4C3J K;  2PMZ L;  2PMZ D;  1I50 C;  5C4X C;  4BXX C;  2R7Z K;  3S2D C;  4A3I K;  4MEY A;  5C44 K;  2YU9 K;  3CQZ K;  2NVX C;  3WOD A;  4XLP A;  3GTK C;  3M4O K;  4A3E K;  4QJV A;  3S16 C;  1Y1V C;  3DXJ A;  3GTQ K;  3S1M C;  4X6A K;  2NVY C;  3FKI C;  4LLG A;  3HOU K;  1R9T K;  2JA7 K;  3PO2 C;  3PO3 C;  4YG2 A;  5IYB C;  3S2H C;  4A3C C;  3S15 K;  3GTP K;  4OIN A;  3K7A K;  3HOW C;  4XSZ A;  4C3H K;  1TWG K;  1SFO C;  1HQM A;  4AYB D;  4AYB L;  5FLM K;  2Y0S L;  4C2M K;  2E2H C;  2JA6 K;  4Y52 C;  4OIR A;  4KMU A;  4Y7N C;  3S1N K;  4A3L K;  4BBS C;  4BY7 K;  2NVQ K;  4G7H A;  4A3D K;  1K83 C;  2WAQ D;  2WAQ L;  5IP7 K;  3RZO K;  2R93 K;  3GTL C;  3S14 K;  1I3Q C;  4NOI A;  5D4D A;  1YNN A;  3HOV C;  5M3F K;  2PA8 D;  3S1R K;  1I6H C;  5C3E C;  2R92 C;  3GTM C;  1WCM C;  4BBR K;  3I4N C;  2PPB A;  4A3G K;  4BY1 C;  3HOZ K;  4LJZ A;  3S17 C;  3M3Y K;  3GTG C;  2E2I C;  4A3K K;  4A3J C;  4Q5S A;  2JA8 C;  2VUM C;  4A3M C;  4KN7 A;  3S1Q K;  1TWF K;  5TMF A;  1ZYR A;  4Q4Z A;  2O5J A;  5C4J K;  4A3B K;  2E2J K;  2R7Z C;  4QIW D;  4QIW L;  2CW0 A;  1TWC K;  4A3I C;  5C44 C;  5IYC K;  2A69 A; 
#chains in the Genus database with same CATH topology
 3HOY K;  3M4O C;  2RH6 A;  2Y0S D;  3V4G A;  3EQL A;  2VUM A;  2BE5 A;  2WB1 L;  1ISE A;  3FKI A;  4RMF A;  5IYB K;  4C2M C;  4LK0 A;  4A3L C;  2NVQ C;  1VGX A;  4A3F K;  1BDF A;  3HKZ L;  1WSV A;  1DCH A;  4KC6 A;  3M3Y C;  1TWA A;  4A3K C;  2O5I A;  4G0U A;  1EH1 A;  4BXX K;  4MQ9 A;  2Y3P A;  5IOS A;  5C4J C;  3S16 K;  4G7Z A;  2V6U A;  3FKI K;  2XCO A;  1TWG C;  4GTD A;  1J98 A;  1XZP A;  1VH2 A;  3SZY A;  2XCR B;  3H0G C;  1BJT A;  3GTQ A;  1VJE A;  3GTO C;  1EI6 A;  4KAT A;  3HOV K;  1I6H K;  5C3E K;  1TWA K;  3AH5 A;  3A8K A;  2NVT C;  3AD9 C;  2CFA B;  2PA8 L;  5IOR A;  3L4K A;  3GTJ A;  1O2B A;  3LAP A;  3S2D C;  3G4A A;  4A3I K;  3S0X A;  2YU9 K;  3M4O K;  1F9N A;  3GTK C;  3FHZ A;  1Y1V C;  3GTQ K;  3S1M C;  4KMA A;  1WQH A;  4LLG A;  5IYB C;  1YCL A;  2ZUE A;  1BS2 A;  1I50 A;  4XSZ A;  1SFO C;  2V6S A;  4M1X A;  4C2M K;  4OIR A;  1J6V A;  4KMU A;  4Y7N C;  4A3L K;  2NVQ K;  1K83 C;  4P5A A;  3H0G A;  1XXB A;  1I3Q C;  1IQ0 A;  2R92 C;  1WCM C;  3GTO A;  4BY1 C;  3HOZ K;  3M3Y K;  1J6W A;  2E2I C;  4A3K K;  4KB2 A;  4WJ4 A;  2JA8 C;  2VUM C;  4A3M C;  3T00 A;  2JH3 A;  3GTL A;  1O2F B;  1ZYR A;  2O5J A;  4C45 A;  5C4J K;  4QIW L;  2CW0 A;  5C44 C;  3CQZ C;  1O27 A;  4X6A C;  4G7O A;  2JA7 C;  1INN A;  2GAG C;  3H0G K;  2WB1 D;  3GTK A;  1Y1V A;  3S15 C;  3K7A C;  5IYD C;  4GTE A;  3GTO K;  1TWA C;  4KB4 A;  2B63 A;  2A6E A;  4KAS A;  1O2A A;  3RZO C;  4BBS K;  4FM9 A;  2NVT K;  3HKZ D;  1K83 A;  3GTL K;  5JVO A;  4YFK A;  1I3Q A;  2R93 A;  4XCH A;  4XLN A;  4KDD A;  1WCM A;  4QJV B;  3S1Q C;  3S2D K;  3GTQ C;  2E2I A;  5TJ3 A;  3GTK K;  1Y1V K;  2E2J C;  3S1M K;  1TWC C;  1UV7 A;  3ADA C;  1XZQ B;  4C3I C;  2B63 K;  3OPF A;  3CQZ A;  3HXA A;  4JK1 A;  1SFO K;  3I4M C;  4Y7N K;  4OIP A;  2JA7 A;  1K83 K;  3GEI A;  1X31 C;  2JA5 C;  1PJ6 A;  1I3Q K;  3GTJ C;  4ILD A;  5IP9 C;  3HOZ C;  2R92 K;  1SMY A;  3ORE A;  1WCM K;  3BP3 A;  5JFE A;  4BY1 K;  1Y1W A;  5FJ8 K;  2E2I K;  1F93 A;  1PJ5 A;  2JA8 K;  1AB4 A;  2VUM K;  4A3M K;  3RZD C;  1EFW A;  1JVI A;  1C0A A;  2PMZ L;  1I50 C;  1B4B A;  4BLA A;  3GSI A;  1USM A;  4KMD A;  4KAW X;  2KWA A;  5C44 K;  3CQZ K;  4XLP A;  4X6A K;  2JA7 K;  3PO2 C;  4G0V A;  1IL2 A;  3PO3 C;  3IPJ A;  3S2H C;  3S15 K;  4GTC A;  5CHP A;  1TWC A;  3K7A K;  5IYD K;  3AD7 C;  2Y0S L;  3BP8 C;  4BBS C;  4Y52 C;  1XXA A;  2XCQ A;  4G7H A;  5IOT A;  2WAQ L;  3RZO K;  3GTL C;  3OEP A;  3N3Y A;  2P5M A;  2FQT A;  2JA5 A;  3LPX A;  3I4N C;  4LJZ A;  3S17 C;  3GTG C;  1WQG A;  4KN7 A;  3S1Q K;  4C3J C;  2CFA A;  1O24 A;  2D6F C;  2E2J K;  2R7Z C;  4QIW D;  1GE9 A;  1TWC K;  2B63 C;  3AQO A;  1WOS A;  1ZVU A;  4C3I K;  4A3E C;  1F7U A;  2FQO A;  2EBB A;  2W7V A;  3GEH A;  3I4M K;  1DCP A;  3A8I A;  2GAH C;  3GTP C;  1DD5 A;  5E68 A;  2R93 C;  4WIL A;  5FLM C;  4A3C K;  2JA5 K;  3GTJ K;  5IP9 K;  5IOQ A;  4A3D C;  3S14 C;  2A6H A;  4KM9 A;  5L46 A;  3RZD K;  1ZXO A;  1I50 K;  3TFJ A;  4BKW A;  2GSU A;  3H3V L;  3TFI A;  3GTG A;  5TMC A;  3TTG A;  3MML B;  1O25 A;  1YNJ A;  5IYC C;  3PO2 K;  1USO A;  4J3N A;  3PO3 K;  4ZH4 A;  3S2H K;  2R7Z A;  4XSX A;  1Y1W C;  3VA7 A;  4GT9 A;  1O29 A;  1WOP A;  1EK8 A;  5M3M K;  4Y52 K;  4A93 C;  1TWH C;  3GTP A;  2A68 A;  1IS1 A;  3NUH A;  2JA6 A;  3HOX C;  3I4N K;  3N0C A;  1WOR A;  4YFX A;  3S17 K;  3GTG K;  4C3J K;  2PMZ D;  5C4X C;  5CJ9 A;  1G51 A;  1WIH A;  2R7Z K;  4MEY A;  3WOD A;  4A3E K;  1VLO A;  4QJV A;  1WOO A;  2NVY C;  2V6T A;  4A3C C;  1ZBS A;  3GTP K;  3HOW C;  1XZQ A;  2R93 K;  2E2H C;  1HQM A;  4AYB L;  5FLM K;  2JA6 K;  1JQW A;  4A3D K;  5HL8 A;  2NVX A;  2WAQ D;  3S14 K;  4NOI A;  5D4D A;  1YNN A;  2PA8 D;  1HI9 A;  3GTM C;  1WQF A;  3ERE D;  1TWH A;  1IBA A;  4A3J C;  4Q5S A;  4KMH A;  5EGE A;  1ZQ1 C;  5TMF A;  1XZP B;  5IYC K;  1L0W A;  4YFN A;  4GTL A;  1JOE A;  3HOU C;  3AQP A;  3JST A;  2NVX K;  1R9T C;  1Y1W K;  3GDZ A;  1VRQ C;  1B4A A;  2NVY A;  3TFH A;  4C3H C;  1I6V A;  4OIO A;  4BY7 C;  3S1N C;  4A93 K;  1TWH K;  4BLB A;  2YU9 A;  1PJ7 A;  5IP7 C;  2E2H A;  4GTF A;  3HOX K;  4P9S A;  3S1R C;  4OIQ A;  1BGW A;  3G4C A;  2ZFZ A;  4BBR C;  3QX3 A;  3GIR A;  4A3G C;  3FOF A;  4G0W A;  5C4X K;  3GTM A;  1O28 A;  3L4J A;  3GEE A;  5EGH A;  3H3V D;  1WSR A;  1IE0 A;  1TWF C;  4AH6 A;  4LQY A;  4A3B C;  5M5W K;  4GZY A;  2NVY K;  3HOY C;  2GSO A;  2JA6 C;  3HOW K;  2E2H K;  4WJ3 M;  3FOE A;  4KAR A;  4FZB A;  1R9T A;  5M5X K;  1XPP A;  4KN4 A;  4LR2 A;  4LK1 A;  2GSN A;  1TWG A;  1XXC A;  5M5Y K;  3GTM K;  4MEX A;  4A3F C;  2ZUF A;  1IW7 A;  4A3J K;  4LOW A;  1RU0 A;  4KM8 A;  1EQR A;  4BXX C;  4DDQ A;  2NVX C;  3S16 C;  3DXJ A;  3LAJ A;  1TWF A;  3HOU K;  3FKI C;  1KQ4 A;  1R9T K;  4YG2 A;  3T02 A;  1V5V A;  4OIN A;  4PAB A;  4C3H K;  1TWG K;  4AYB D;  4BY7 K;  1J6X A;  3S1N K;  4O2D A;  2P8T A;  3SZZ A;  4GFQ A;  3T01 A;  5IP7 K;  1O26 A;  3AD8 C;  3HOV C;  2PHC B;  5M3F K;  3S1R K;  3CAG A;  1I6H C;  5C3E C;  3A8J A;  4BBR K;  2PPB A;  4A3G K;  1YX2 A;  4PAA A;  1SFO A;  3Q3Q A;  4GTB A;  3N0B A;  4P5B A;  1TWF K;  2RGR A;  3BUE A;  4GTA A;  1DCO A;  4Q4Z A;  4A3B K;  2R92 A;  4A3I C;  1F7V A;  2YU9 C;  2A69 A; 
#chains in the Genus database with same CATH homology
 4C3I K;  3HOY K;  3M4O C;  4A3E C;  2Y0S D;  4YFN A;  4X6A C;  4G7O A;  3EQL A;  3HOU C;  2NVX K;  1R9T C;  1Y1W K;  2JA7 C;  2BE5 A;  3H0G K;  2WB1 D;  2WB1 L;  3I4M K;  3S15 C;  3GTP C;  3K7A C;  5IYD C;  5IYB K;  2R93 C;  5FLM C;  4A3C K;  1I6V A;  2JA5 K;  1TWA C;  3GTO K;  4OIO A;  4BY7 C;  3S1N C;  4LK0 A;  1TWH K;  3GTJ K;  2A6E A;  4A93 K;  5IP9 K;  2NVQ C;  4A3D C;  4A3L C;  5IP7 C;  4BBS K;  3RZO C;  3S14 C;  3HOX K;  4A3F K;  1BDF A;  3S1R C;  2A6H A;  4OIQ A;  2NVT K;  3HKZ D;  3HKZ L;  3GTL K;  2YU9 C;  4BBR C;  4YFK A;  4A3G C;  3RZD K;  2B63 C;  3M3Y C;  5C4X K;  4XLN A;  1I50 K;  4A3K C;  2O5I A;  3H3V L;  3H3V D;  4BXX K;  4QJV B;  3S1Q C;  3S2D K;  3GTQ C;  1TWF C;  5TMC A;  4MQ9 A;  3GTK K;  5C4J C;  4A3B C;  3S16 K;  1Y1V K;  2E2J C;  5M5W K;  3S1M K;  1YNJ A;  4G7Z A;  1TWC C;  2NVY K;  3FKI K;  4GZY A;  5IYC C;  3PO2 K;  3HOY C;  3PO3 K;  1TWG C;  4ZH4 A;  3S2H K;  2B63 K;  2JA6 C;  3HOW K;  4XSX A;  1Y1W C;  4JK1 A;  1SFO K;  2E2H K;  3H0G C;  3I4M C;  5M3M K;  4Y52 K;  4Y7N K;  4OIP A;  1K83 K;  5M5X K;  1XPP A;  4KN4 A;  2JA5 C;  1I3Q K;  3GTO C;  3GTJ C;  1TWH C;  3HOV K;  4A93 C;  4LK1 A;  5IP9 C;  3HOZ C;  5C3E K;  2A68 A;  2R92 K;  1I6H K;  1SMY A;  1TWA K;  1WCM K;  3CQZ C;  5M5Y K;  3GTM K;  3HOX C;  4MEX A;  3I4N K;  4A3F C;  4YFX A;  4BY1 K;  3S17 K;  5FJ8 K;  3GTG K;  1IW7 A;  2E2I K;  2NVT C;  4A3J K;  5IYD K;  2JA8 K;  2VUM K;  2PA8 L;  4A3M K;  3RZD C;  4C3J K;  2PMZ L;  2PMZ D;  1I50 C;  5C4X C;  4BXX C;  2R7Z K;  3S2D C;  4A3I K;  4MEY A;  5C44 K;  2YU9 K;  3CQZ K;  2NVX C;  3WOD A;  4XLP A;  3GTK C;  3M4O K;  4A3E K;  4QJV A;  3S16 C;  1Y1V C;  3DXJ A;  3GTQ K;  3S1M C;  4X6A K;  2NVY C;  3FKI C;  4LLG A;  3HOU K;  1R9T K;  2JA7 K;  3PO2 C;  3PO3 C;  4YG2 A;  5IYB C;  3S2H C;  4A3C C;  3S15 K;  3GTP K;  4OIN A;  3K7A K;  3HOW C;  4XSZ A;  4C3H K;  1TWG K;  1SFO C;  1HQM A;  4AYB D;  4AYB L;  5FLM K;  2Y0S L;  4C2M K;  2E2H C;  2JA6 K;  4Y52 C;  4OIR A;  4KMU A;  4Y7N C;  3S1N K;  4A3L K;  4BBS C;  4BY7 K;  2NVQ K;  4G7H A;  4A3D K;  1K83 C;  2WAQ D;  2WAQ L;  5IP7 K;  3RZO K;  2R93 K;  3GTL C;  3S14 K;  1I3Q C;  4NOI A;  5D4D A;  1YNN A;  3HOV C;  5M3F K;  2PA8 D;  3S1R K;  1I6H C;  5C3E C;  2R92 C;  3GTM C;  1WCM C;  4BBR K;  3I4N C;  2PPB A;  4A3G K;  4BY1 C;  3HOZ K;  4LJZ A;  3S17 C;  3M3Y K;  3GTG C;  2E2I C;  4A3K K;  4A3J C;  4Q5S A;  2JA8 C;  2VUM C;  4A3M C;  4KN7 A;  3S1Q K;  1TWF K;  5TMF A;  1ZYR A;  4Q4Z A;  2O5J A;  5C4J K;  4A3B K;  2E2J K;  2R7Z C;  4QIW D;  4QIW L;  2CW0 A;  1TWC K;  4A3I C;  5C44 C;  5IYC K;  2A69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...