3I4PA

Crystal structure of asnc family transcriptional regulator from agrobacterium tumefaciens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
153
structure length
153
Chain Sequence
MDRLDRKILRILQEDSTLAVADLAKKVGLSTTPCWRRIQKMEEDGVIRRRVALLDPVKVNTKVTVFVSIRTASHSIEWLKRFSEVVSEFPEVVEFYRMSGDVDYLLRVVVPDIAAYDAFYKRMIAKIEIRDVSSAFAMEQIKYTTELPLDYML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, AsnC family
publication title Crystal structure of AsnC family transcriptional regulator from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Transcription regulator
total genus 33
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i4pA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i4pA02
2RVCA 1XMAA 5DV5A 3J80K 1J75A 3EYIA 4KT5C 3V7CA 1EH8A 2Q8KA 4A0XA 3LAPA 2DO7A 2FE3A 4CO8A 4ASNA 5A2QZ 4K2EA 3IRRA 2F2EA 3HRUA 1IXCA 4NQWA 4G94A 2IVMA 3F8NA 3ZPLA 1ZG5A 5L3BA 1LEAA 3E5UA 2EK5A 1BI2A 1BI0A 1TW3A 4G7OF 4A6DA 2BGCA 4YIIA 4GYGA 2H09A 1ZN2A 1SMYF 2MC3A 4WK8F 1AWCA 1ZLKA 2AS5F 4HW0A 2O6GE 5ERIA 2QVOA 5CVUA 2RNJA 2A61A 4N0BA 5HDNA 1FLIA 5IT9K 2P7CB 3R0AA 2PMHA 3E5XA 5CVIA 3GX4X 2GAUA 1R23A 3J80Z 1RI7A 1SD4A 4ZYDA 1V3FA 2P5VA 5HOOA 1WQ2A 1IN4A 3RIRA 3ULQB 3K1PA 1UHWA 2MA3A 1UCRA 4HDUA 2L54A 1FC3A 2VODA 1ULYA 2VN2A 3BY6A 5D8KB 3RPQA 3H3ZA 2VXZA 4L9TA 5LHIA 1MJ9A 5BPIA 1BI1A 1O7LA 3FXRA 4IHTA 1TNTA 1ZG3A 4M74A 5ICCA 1B6AA 4B8XA 5IT9Z 3R6SA 2Z4PA 5HLGA 3CUQB 2GWRA 1XSDA 3EQLF 2H27A 1QPMA 1HKQA 1BJAA 3VODA 5L3EA 4OMYA 2PI0A 3Q5FA 4P96A 5HDGA 3KLNA 4Q47A 1R1VA 5ILSA 2V1XA 3HRTA 3I0TA 1USTA 2P7VB 4U88A 2P6SA 4QWQA 5HDKA 2EV5A 4KFCA 1KGSA 1MJAA 3V7SA 2PBIA 2E1NA 4I98B 2ISYA 2V79A 4YFKF 4RB3C 4EJWA 2L4AA 4WXCA 3LWFA 4CXFA 2C6YA 4A0YA 3I64A 2DU9A 1RUOA 1E2XA 5CLSA 4OMZA 3ISPA 2HWVA 1FBUA 3ECOA 2DPDA 1I6XA 4MQ9F 1W4MA 2CFXA 2CWEA 2FA5A 3W6KB 2G7HA 2DFIA 3PFIA 4EM1A 1XD7A 4LFUA 1ZRFA 4TV7A 3KCCA 4EVIA 1FT9A 2AXLA 2H6CA 1XDSA 1RUNA 1FBSA 5FD6A 3C3WA 2EV0A 1LNWA 2KKOA 4MTEA 5J6XA 2BBYA 4FX4A 2OD5A 4L5JA 3ABUA 1R36A 2LNBA 1KYWA 2ZNZA 3QRFF 3LQRA 1S29A 4R8HA 1ZG1A 5FFXA 3WTTC 4OIOF 2CW0F 2A6HF 2K4JA 2CYYA 4KIFA 2KRFA 1Z05A 1EV7A 3BOQA 4LJZF 1K6OA 2M1BA 2FBHA 1TW2A 1U5TC 2JZYA 3L2CA 1ZH5A 3MEXA 5K5OA 2ELHA 4EJOA 3D5LA 3HRSA 1Z1DA 4L0ZB 4XSXF 4MHGA 4OIPF 4A2UA 2HOEA 3FWEA 2FBIA 1W7PA 5E1ZB 5F6FA 1R00A 4E70A 2Z9OA 2Q0OA 3T1BA 2QBYA 1SAXA 3CTAA 2W85A 5ICEA 1UHMA 3HTSB 4UV8A 4LMYA 5DCMB 2ZMEB 2TDXA 1IZ1A 1TQIA 3OV8A 2BV6A 5HLHA 4KUMA 4ETSA 2HKOA 1YW9A 3T5XA 3F6VA 5D6FA 3WU0A 4F7ZA 5LHHA 1H9GA 2EFPA 2QQ9A 1O3QA 4ESFA 2FNAA 3JTHA 1XGNA 4G6QA 1K79A 1U6GA 3E6CC 2KIFA 3F8BA 4G7HF 1CF7A 2STWA 4IVNA 4UVBA 1XMKA 5ICGA 3REOA 5D5WB 1R22A 4MGRA 5DEQA 1UFMA 3HYIA 5HLIA 1GVJA 1V4RA 1XGSA 3EDPA 5D5XB 4U7DA 3F6OA 4RGXA 2O3FA 5DUIA 3KP7A 1BC7C 3ZMDA 2LF8A 4MTDA 3HRMA 5D5UB 4RAZA 2XAQA 3ZMZA 3HUGA 1ZYRF 2HTSA 1TQPA 3WTZA 3ROUA 4JQFA 2E7WA 5HS9A 4WXHA 1OYWA 2DBBA 3IHUA 2DW4A 1R1TA 3WG9A 2FMYA 3V8JA 4Y17A 1J5YA 3T0YA 4HX7A 1XSXA 2OQGA 4ENJA 2X4HA 1T0FA 4EJUA 1U5TB 4JK1X 1B9NA 5DUKA 3J81K 3ZN1A 1S7AA 2HQNA 3BPVA 3VEPA 5LRSA 3LA2A 4KA4A 4BH9A 4G6DA 1YIOA 3I59B 1HSTA 5LBQA 2W25A 3CO6C 3R60A 4RS8A 4EGZA 1IN5A 1G3SA 1XB4A 3QP6A 3KP5A 5E8IA 2H94A 4LB6B 4L9VA 4WXDA 1IXRC 3DPLC 1MD0A 3JTGA 3HTUA 1IXSB 2NRAC 1DPUA 1EH6A 3KP6A 2PG4A 1EH7A 4BAYA 1KU2A 3E5QA 4RGSA 4CYDA 3QU6A 4WCGA 3OOPA 2D2WA 1YFHA 2FEZA 4P55A 1QNTA 3O2PE 3GYHX 4IRGA 1JE8A 2Y0MA 5K5QA 2DJWA 2XHKA 5L3DA 5ILVA 3RKYA 2RV8A 5LGNA 1FYLA 3VFZA 3HHHA 2VT3A 1KYZA 1FWZA 2XV4S 1Z6TA 2CO5A 3J81Z 4I0AA 4L9JA 2P5LC 2H6BA 3ZMSA 2BEOA 2V6CA 3RYRA 4U0VA 4M9XA 5LEJA 3FX3A 4I09A 3WTWC 4HAMA 2PLYA 1BC8C 2GA1A 4Y15A 1DUXC 4FX0A 2CSOA 2DQLA 5F1RA 1B59A 4Y13A 3JAMK 5DYMA 3CUQC 2A69F 4S04A 2PEXA 3BJOA 1HKTA 1ZGJA 3ABTA 1LDDA 2WWYA 4WX9A 2FSWA 1YLFA 2QUFA 4H0EA 4GO1A 4ESBA 1YYVA 4EJTA 5FB2A 2VOPA 1GXPA 3RTRA 3ZP5A 3J7AO 4AWXB 5LGUA 1YG2A 2WV0A 1BM9A 4HLYA 1U78A 1FBQA 3JSPA 1IUYA 5CVVA 1ZRCA 1W7PD 1L0OC 4ON0A 2YPRA 2VBXA 1HW1A 1MGTA 5ICFA 2VBWA 2ESNA 5KK1A 3V8LA 4BXUA 1ODDA 1IRGA 4MQVA 3LA3A 2K7LA 1FP1D 3SQNA 3COAC 1Z9CA 2HKXA 3SFZA 3P7NA 2A68F 4Z2YA 4GGGA 3GLXA 4KMUX 1U8RA 1WRJA 2QQBA 4A5MA 3I58A 2IJLA 2K4BA 3Q9SA 1D3YA 1P92A 3L00A 4PDKA 2DAOA 4PGHA 3GFLA 4L0YB 5CYVA 2RKHA 1I5ZA 5J8FA 3RJPA 3GFJA 4I01A 2FRHA 1BOAA 1E17A 4KMFA 1P4AA 2HR3A 4AIHA 4ZZLA 2MD5A 2Z33A 2HTJA 2Z5UA 3F8CA 2HS5A 3L9FA 5IT3A 2P6TA 3L09A 4QLCU 1ZHFA 5BMZA 2OAZA 1HXDA 2STTA 3DPTA 1KU9A 1KU3A 1IN8A 1F5TA 3TGNA 1IN6A 2Y75A 3O6BB 1CGPA 1B9MA 1ON2A 1J9IA 2VC1A 2M45A 2ZNYA 3WTVC 1QGPA 4PZJA 2J5OA 3WE2A 2HZTA 4M9ZA 3V8KA 3E3VA 2HEOA 3I5UA 1MDMB 1QZZA 3I4PA 4IPAA 3ZMUA 1I27A 4U7BA 5E20A 1G3WA 3GFMA 4HLXA 1PUEE 4OIQF 1O57A 3IWZA 5L3GA 1HKSA 3MCZA 4Q48A 3GZ5A 3K0LA 2PQ8A 1T2KA 5H20A 1LJ9A 4FT8A 1F1ZA 4ENKA 1LDJA 4M6YA 5KVRA 3WGHA 3CDHA 4IXAA 4CICA 3FMSA 2G9WA 3JSOA 2VE9A 4LK1F 4AD9A 4I7HA 4Q4ZF 5AIPA 3BJ6A 5DD8A 2DLLA 3E6BA 2DQRA 3F22A 4KN4X 2EFQA 4G8XA 2F5DA 3FM3A 2A6EF 2F5EA 1R58A 1XDUA 2VOOA 4LG0A 2ZXJA 4O3MA 1TQMA 3TDZC 3HOTA 4HX4A 5AONA 1RIOH 4GCVA 3LA7A 3FMRA 3NRVA 5JI6A 1XGOA 2NNYA 3TQNA 2CG4A 1ZGAA 1TTYA 1REPC 3B02A 3BZ6A 2VBYA 2PN6A 2JSXA 1I1GA 4LLGF 6PAXA 3RKWA 3EUHA 3RDIA 3EYYA 1U2WA 4YFNF 5LHGA 1ONVA 3G73A 4LK0F 1WI9A 2EFNA 5JR3A 3RI4A 1OYIA 2VONA 3SHFA 2L02A 2RC4A 4EQQA 3BDDA 2J5PA 1G3YA 4LD5A 1FSEA 5FFZA 1JHFA 1DDNA 5HVQC 2YR2A 5JVTA 2FBKA 4CDGA 3IRQA 4FHTA 4NB5A 3TO9A 1K7AA 5E1XA 3F8FA 1W5SA 1OMIA 1T6SA 2EJRA 4HF2A 4IF4A 3JW4A 1FYMA 2PFBA 3CLOA 4AIKA 1KQ9A 2OA4A 2XRNA 2COMA 4EM0B 2PMUA 4HF1A 3DFGA 2K86A 3V7RA 1S3JA 3H3UA 3RYPA 3C7JA 2NNNA 4L9NA 2JTVA 3GUDA 1GXQA 5K5RA 4S05A 1YW8A 4N9IA 2R3SA 1Q1HA 5DCFA 3QPTA 2QENA 5EEGA 1R5HA 1PDNC 4HQMA 2DK5A 3GEZA 1J59A 2D1HA 3R0JA 1YS6A 2OZUA 3WGIA 1OR7A 1R7JA 2ZBKA 3GF2A 2L01A 4B09A 4HV5A 1F4KA 5HS7A 2O8XA 4XLPF 2KJCA 1SD7A 4UNOA 2JPCA 3HHGA 4M73A 2UZKA 1D8KA 3FHZA 4ZYGA 1FPQA 4DQ2A 4Q5SF 4OIRF 4HOBA 2JT1A 4LLLA 1Y0UA 3KZZA 4XSZF 5FLXK 1ON1A 1QZYA 2D1VA 4KIBA 4OU0A 1IN7A 3TKYA 4R79A 4YG2F 3FXQA 3S2WA 5E18F 3ELKA 3KP2A 1BN5A 4ZYHA 1P4WA 4U0WA 2O61A 4KNYA 1IRFA 4O5VA 1JHHA 2ESHA 4HV6A 2E1AA 2G7UA 4HZFA 3ZQ7A 3K9TA 2WC2A 3PQJA 4P5OA 1IW7F 4LLNA 1T38A 1LDKB 1C0WA 2EWNA 1BIBA 3WTXC 2XROA 2MH9A 4LB5A 1BBYA 3BJAA 2O0YA 1DP7P 1FY7A 1RZ4A 2ZCWA 1KQ8A 4A0ZA 1G3TA 1FSHA 2IPQX 4ENNA 5H6RA 3RPUA 3NQOA 4ZH4F 1O3TA 1D8JA 4HDVA 3M9AA 2ZKZA 3U2RA 1XGMA 2YSRA 3IKVA 5ILUA 2LSOA 4GXOA 2ADUA 1R5GA 4CGZA 3TO6A 1BI3A 2FOKA 2ACJA 2ISZA 2Y48A 1Z7UA 4BNCA 5LRRA 3GZ6A 2DTRA 3QOPA 4EJVA 3N4MA 5BOXA 2W57A 5BPDA 1IAWA 3VB2A 1KU7A 1W7PB 2O03A 2M30A 3PQKA 4EM2A 5L3CA 2QBYB 4UXNA 5DD4A 3P9IA 2MH2A 2YX7A 5LLQA 2XAHA 3VOEA 3BP8A 4PGGA 3U9GA 4L5IA 3F21A 1MJBA 2DI3A 3F23A 2NS0A 1JGSA 2FQ3A 2XGXA 5K1YA 3CUQA 5FGMA 2JSCA 4KN7X 1T98A 3K1MA 3GXOA 5ED4A 2HQRA 1A04A 1KA8A 1YO5C 3HIFA 3WTUC 4HF0A 2ZFWA 1CF7B 2OU2A 3BROA 4RB1A 1G4DA 2P4WA 3KZYA 2P5KA 4IRHA 4HX8A 3KFWX 1STZA 2QWWA 3L7WA 3DP7A 1SFEA 2ZJ2A 2KIMA 3LAJA 5CVJA 1J7KA 3SXYA 1QO0D 1IF1A 3KP4A 1R1UA 4MNUA 2W24A 2E7XA 3IL2A 2UXNA 1Z91A 3WTSC 3TOAA 4OINF 4OOIA 2D45A 1J0RA 3N97A 3FZVA 3QPHA 3F3XA 2A5YB 3Q9VA 2GZWA 2XKPA 5E17F 4IRIA 3G3ZA 2A07F 1W5TA 1FOKA 1YQAA 3ZMTA 3K1NA 1LVAA 3JAMZ 3FMQA 4YFXF 5FD5A 3ZN0A 2Q2EA 2MBFA 4RB2C 2XIGA 2GXBA 2XAFA 5CVRA 3FXUA 2BYVE 4KYWA 4EGYA 2RN7A 1P4XA 5AIQA 3GVAA 2CVIA 1WWXA 1SMTA 3U1DA 1ZLJA 2IRFG 5DDGA 4GYIA 2F5CA 1S6LA 1S7OA 5CJ9A 2YU3A 2GA2A 3ERED 2OQRA 3DQVC 2OBPA 1AOYA 1YW7A 1K78A 3NEUA 1X3UA 4PCQA 3I54A 1OPCA 1MKMA 1B1BA 1H0MA 3R61A 5BS6A 3IWFA 2XUBA 4I02A 3HOSA 3QU3A 1JXSA 4CZZA 3HSRA 5EEHA 3LQQA 2KIUA 4P9UA 1HBXG 4XLNF 1P2FA 2HGCA 2QZ8A 4ZYEA 1QBJA 2JPBA 5DCMA 2ZMEA 2QM3A 1SFXA 2IT0A 1SD6A 2LF7A 2VE8A 2CQKA 2MLGA 3F72A 4HYEA 1XCBA 3H92A 2RDPA 3P9KA 3K69A 4G7ZF 4BQAA 1I1SA 3M8EA 1XSVA 3GWZA 2P8TA 2FMLA 3GW2A 4UVCA 1O3RA 2K02A 3WODF 3RKXA 1G6NA 5D4SA 3O3KA 2QLZA 2A3SA 1FYKA 1S8NA 4JBAA 3MFKA 4IHSA 2RGVA 5FO5A 2XVCA 1KQ0A 3WE3A 2ZO4A 3FM5A 5H6QA 4KICA 2Z3YA 3E6MA 2R7FA 4N9HA 2DPUA 4BYYA 2VT2A 4UV9A 4L18B 3DF8A 3TOBA 1ZAOA 2XKOA 3V4GA 3E97A 5L3FA 2NAZA 1YS7A 1U5TA 2R7DA 4I0BA 5J8CA 3ZMVA 1FX7A 4U0YA 3P9CA 4I2OA 1OKRA 2WTEA 2XAJA 4A6EA 1Z6RA 5D4RA 3I59A 2UXXA 2Z99A 1O7FA 1RNLA 3AAFA 3KEOA 2V1DA 1WSUA 1DPRA 3EETA 1O3SA 4ESJA 4M71A 2JRTA 3I53A 2RQPA 4BHPA 1NHAA 2YX4A 2HFHA 1PP7U 3T8RA 3LSTA 3CO7C 2KJBA 4UVAA 2EA4A 1K78B 2EFWA 1B4AA 3TO7A 3BWGA 3DXJF 4NHJA 2IA2A 2UWMA 1LQ1A 5D6EA 5HS8A 3HSEA 2BE5F 1U3EM 5D8LB 2HYGD 2NYXA 1HW2A 3D0SA 4DNCA 2IA0A 4G9YA 1YTYA 2FNPA 3M1EA 2M8EA 4BHCA 3I71A 2X0LA 3K2ZA 4EV0A 3B73A 3F8MA 5TJJA 3MWMA 2ETHA 2HDCA 2MLKA 4M9SA 2LDUA 5LGTA 1LEBA 1VTNC 4IJAA 4MEYF 3IC7A 2XASA 1HQCA 2K27A 4XBFA 4D0PA 1ZREA 1HW5A 4KIGA 3MAJA 1OYYA 4LGWA 2XAGA 4BHBA 4WWCA 2EA2A 1LB2A 3KLOA 4WF2A 1SD5A 4EMSA 3DKWA 2DK8A 3ECHA 3CUOA 2IP2A 3C1DA 2V1UA 1TLHB 5E1WA 1F9NA 4LG0B 4HA8A 2ZBCA 3C18A 3MZHA 1HSJA 1L3LA 2M5WA 3BPXA 3WGGA 1UB9A 1H9TA 3FF5A 3LFKA 1FNNA 3TDUC 4AVPA 2GQQA 1GHCA 1TBXA 1XN7A 2OZ6A 2DT5A 3E6DA 3IKTA 3ML6A 4XRFA 4RGUA 5TRDA 3DEUA 4HQEA 4AIJA 2F5FA 2FU4A 1XCVA 3SZPA 3WTYC 5D5VB 2EB7A 3MZYA 2LKPA 3CJNA 4ZZDA 3MQ0A 4RAYA 3GO5A 1TNSA 5F64A 3HSFA 5FLXZ 3M8FA 3KP3A 3W6JB 4R1HA 2EFOA 4A12A 2L3DA 3KEQA 2QYOA 1P6RA 2M87A 3R4KA 2VC0A 1D5VA 5LEKA 2EV6A 1ZARA 2CGPA 1SFUA 3QP5A 2PJPA 3QAHA 4MEXF 4RB0A 1BIAA 5A2QK 1QQIA 3WU1B 4P9FA 4HBLA 2B0LA 5E8GA 2FXAA 1ZRDA 2QQAA 1MZBA 1FP2A 2GIVA 5BQTA 1PP8F 2V9VA 4RGRA 4CHUA 4ENMA 1FZPB 2HYFA 1MDMA 2FF4A 3DV8A 4YIFA 4KDPA 2L4MA 1WKMA 4M6XA 2IA1A 2IW5A 4UHTA 3GFIA 1T39A 3T8TA 4M72A 4O6JA 1USSA 4UUVA 3M7GA 3SZTA 2E1CA 5JFRA 2W84A 2GXGA 3KETA 3KE2A 2VBZA 4A5NA 5JHUA 1J2XA
chains in the Genus database with same CATH superfamily
2RVCA 1FJLA 3OWTA 2F48A 3ZNUA 3LPYA 5H9EK 2RE1A 1Y3KA 2QSFA 3AJ1A 2CPEA 4F02A 3JRFA 2PEBA 1HWJA 1UMQA 1CQTA 2FE3A 1LWEA 2H51B 2XYHB 5A2QZ 1IXCA 4G94A 4USVA 2LBFA 1OFCX 9ANTA 1UETA 2AV5A 1W25A 4IH5A 1LEAA 5LSRA 2DK2A 4LR8A 1BI0A 2Y69H 2MQQA 5BNGA 3GTKJ 1FMVA 4OZ1A 2M9HA 4F8RA 1KDNA 5HROB 2K7KA 1R31A 2IJFA 1TWFJ 2B3TB 1V5FA 2HWHA 4ZVUB 5L39A 3LSPA 3CCJI 4CCOA 5LOQA 4U7UK 2JHEA 5ERIA 3PIOF 4NLXA 2RNJA 2QCOA 3GCXP 2AQFA 2ZC4A 2GM4A 4DL3A 3O5TB 2XF7A 5IT9K 3M32A 4KPYA 1N0UA 2IHR1 1H7XA 2DNLA 3J80Z 4FXWA 4XLCA 5CKTA 1EZZB 4UT4A 1U49A 3C8YA 1B0VA 3DLJA 3G6ES 4E7HA 2AJ0A 4I7FA 3CCJS 3RTVA 4P2MA 3S8SA 2R8HA 1JJ4A 3CJ0A 3K1PA 4MYTA 2X6OA 3H9GA 5GTIC 2EG2A 2EZLA 1D09B 2J9DA 4C8YA 1XTAA 4CCNA 3K59A 4ECTA 1S1UA 1R8HA 1MMNA 3PXGa 4OI3A 5JXSA 2M5YA 1EX8A 1UCRA 2H5EA 3WIVA 2VA3A 2YNIA 3TJAA 1PCAA 2L54A 3DOMA 4Q2LA 5A8WB 1TK5A 4KTQA 1CJKB 1M5VC 2VN2A 1EQ0A 3B78A 3UPFA 3DOLA 2QFIA 4L9TA 5FKLA 2V8DA 2X1AA 2LLZA 5K9FA 1MJ9A 5BPIA 2FHJD 5DETA 4ZJZA 1X1CA 4CLZA 1QSYA 2DXEA 1TNTA 4M74A 3DLEA 4B9TA 3V81B 1HQ2A 4M5LA 1IWAA 2COLA 4RU2A 3QRQA 1WJFA 4NX9A 4OHZA 1S97A 7FD1A 4ALZA 1TUGB 3CUQB 4C9YA 2HQCA 1HKQA 1ETXA 2KHMA 2APOA 3E1SA 1SJQA 4JUZA 1QLNA 2TCTA 3TAPA 3MMAA 1XN9A 1IO2A 4O4RA 5DGAA 4Q47A 1R1VA 5F0HA 2CNNB 2IJRA 1JUPA 4A3EJ 3TUJC 1USTA 2HNHA 3EGNA 5HDKA 2U1AA 4IG0A 2BE9B 2PBIA 3M7VA 5F0WA 4I98B 3TJ8A 2B8QA 5JVGF 2DPJA 2HLUA 4RWWA 1RLDA 4U67Q 2V79A 4B47A 3TQ1A 1F1BB 4RB3C 3R9LA 2HQ3A 2L4AA 3LWFA 2XMWA 4X4TA 3PIOQ 1QE1A 3CJ2A 5FLXU 4IRKA 1SIWB 4NA3A 4KC5A 1HHQA 3BR3A 3LW5C 5CLSA 4OMZA 3GB0A 3ISPA 3MR6A 3WC0A 5BXIA 3DPUA 1Z21A 3TW6A 4AQYF 2FA5A 3T5KA 1A7GE 4Q8EA 4PJ0C 1ZRFA 4TV7A 3CCYA 1PG5B 1VBKA 2DNNA 2AXLA 1HYSB 1JKPC 1FBSA 1B72B 4M1KA 2EV0A 2B8PA 3THVA 2D69A 3UDVA 2VQFF 2KZZA 1WG4A 1S99A 2COBA 1IDYA 2CADA 3GYXB 2BBYA 1N6QB 3QRRA 3G2XA 2DY1A 2LNBA 1M5HA 3QRFF 1YQHA 1D0ZA 1UZCA 3CDUA 4NASA 3DOKA 5K14A 5AT1B 4BLGA 1D9DA 1TKZB 2HFUA 1QAJA 3WTTC 2GQ2A 2JEFA 4B17A 4KIFA 1KEKA 2UVVA 3OSGA 3BOQA 1Q16B 1K6OA 1U5TC 3L2CA 2RSQA 5K5OA 4P52A 3G9CA 1MWQA 3D5LA 5EN1A 4XSXF 2KT3A 2QSFX 1RWVB 3I9V2 3KG0A 4A2UA 5KT6A 3OXLA 3TVKA 3W9IA 1FOWA 1WI6A 5E1ZB 1RT4A 5F6FA 3FRYA 1R00A 1ZA1B 3A02A 3ZQQA 2Q0OA 2M0MA 4M3DA 3FKBA 1HWIA 4NXMF 4PYAA 2FTRA 3HXMA 1SEUA 2DMUA 1UHMA 1WG5A 2DGSA 4ETXA 2VG5A 2L0KA 4ZPVR 2MSTA 5DCMB 4I4BA 2TDXA 3MAAA 1IZ1A 3QFHA 2HEKA 1T3NA 4J19A 5JVGQ 1DBDA 1Y00A 3PNVA 3FMWA 2CQQA 3OYKA 3FFIA 4WXWA 1N77A 3IV5A 4EO8A 2HKOA 2KISA 4QYZK 5EUHA 5AE1A 3PDNA 4F7ZA 1ZR4A 1YHQI 1DJ0A 2LH9A 2VLAA 1H9GA 2QQ9A 3FXLA 1MH4A 1XGNA 4G6QA 3V42A 2E5GA 1K79A 3Q8YA 2GFFA 2B9YA 1VK3A 3EXCX 4ECXA 3NCRA 2STWA 4IVNA 4AUKA 5GAGI 2OTLS 5ICGA 1VQLS 5HQLA 3REOA 1R22A 5D5WB 1VQOI 4DUZF 4AQYJ 2CRLA 3BG5A 3NKYA 1OSCA 4RGXA 1OR7C 2DOAA 4OHXA 5DUIA 3DI6B 1GMWD 5HMWA 2JDJA 2FUG9 4MTDA 3MM9B 3CDWA 1ENHA 1HHTP 1LUJB 5B1BH 3CO0P 1KVIA 2VQFJ 1TC3C 3HUGA 4RBOA 2HS4A 3G87A 1Q8BA 1OY6A 3J7YI 4L3NA 5HQ8A 2YH0A 1R1TA 3WG9A 1SVDA 3IG1B 4BCAA 2KMUA 3R7NB 3TARA 1FK9B 2FMYA 2V8HA 3BCAA 4KPCA 3HEFA 1UELB 3W5YA 2WV1A 2OMLA 1UW9A 4NE9C 4LF2A 3KLEB 4WKYA 3ZNJ1 4ENJA 1QVUA 1T0FA 4P10A 1QZEA 3RRHA 2H5IB 4GFBA 2Y9ZA 5DUKA 1JKHB 3ZN1A 1A35A 1S7AA 3EWGA 1UVKA 3S1RJ 3ETMA 4NA2A 2M8DB 1JUSA 1YJUA 1OJLA 1HNIB 3VAKA 3OY9A 3IP4B 2AD9A 2J6UA 4OX8A 2J9DE 4XLHA 4K4ZA 2Y30A 1HSTA 5LBQA 4FNHA 1LXJA 2FJDB 4Y7NJ 3CO6C 5IQQA 3BQ2A 3MFHA 2XMAA 2EW9A 1G3SA 3ERMA 1MMSA 2OPRB 4RLQA 4WXDA 2Q43A 2N4CA 2LQ9A 1IXSB 2QLJB 2PG4A 1KU2A 1TV6A 3FBEA 5KT4A 3GTGJ 3L2UA 4ETZA 1IBCB 3KK1B 1YFHA 4PPZA 2EK1A 4R0EA 4UW2A 1YJWI 4KV8A 3O2PE 4IRGA 2XS2A 4K0KJ 3LP2B 4TU9A 1FWKA 1W0UA 4HI2A 3PEJA 2VB6A 5LGNA 3HOXJ 4M5MA 3VFZA 4BACA 2CQ3A 3KK3A 1FWZA 2XV4S 2CAJA 4ELVA 3HKZA 1Q82T 3O3LA 3W3SA 2MYFA 1G59A 1TMJA 3G1MA 1HNWF 1GTEA 5K20B 4DUZJ 2ZUGA 4C0BA 2BEOA 2V6CA 1YJWS 4AXIA 1N75A 3D1QA 1C4AA 4M9XA 2NCKL 2HZVA 2ZOGA 2RKIB 2LKXA 5JMNA 3FX3A 4DV3F 2PIIA 3V6HA 2TRTA 2GGPA 2VZ9A 2GA1A 3AKZA 1U1LA 1B59A 5IC6B 4Y13A 2ILYA 4EYIB 1S7EA 4YB5A 3CUQC 2A69F 2VUGA 2PEXA 5DG9A 2XBPA 2FHKA 2QA2A 5KFCA 2DODA 3BJOA 3ITHB 1HKTA 3PRVA 4M63A 2N7CA 2HMIA 2IRXA 3DEWA 1ZGJA 4CT8A 2BJ3A 1T03B 4UUTA 1Q7LB 2WVFA 5A6PA 1YLFA 1LFPA 2DB1A 1RADB 1U1KA 2VOPA 1TUWA 1FVQA 3ZP5A 3J7AO 4AWXB 2ZZMA 4QIEA 4UQGA 1DY3A 3EGVA 2M7SA 3PKMA 1U78A 1IUYA 4NCBA 4PXEA 3KMSA 1JIHA 3M6UA 2VBXA 4IZZA 3H3VK 2UUBF 1MGTA 1NCLA 1NDKA 5ICFA 4AYBA 2IFXA 1AZSB 1RWKB 1BR4A 3A01A 4E7JA 3KUHA 4X2BA 3W61A 3UCGA 3EM1A 3V8LA 4DCPB 1XMXA 5E3RA 3QIPB 2DGUA 1Q5VA 4G1QB 2CUYA 4DFKA 1B4SA 4C97A 1LW0A 2FYXA 1URNA 3QSYB 2P9CA 4FKYA 2OPPA 5T7LA 1UCNA 4CA0A 1U8RA 1URRA 4JI0F 2K4BA 3Q9SA 1VDHA 2R2RA 3I0RA 4GO5X 2WOMB 3LH2S 3GFLA 1REGX 2RKHA 2O7OA 2X1DA 2UVRA 1N54B 4JV5J 2V63A 2DA6A 2Z8QA 4A4JA 2M2EA 1E17A 4XLFA 1O5JA 4ZZLA 1FO1A 5HP1A 3R5JB 2HTJA 3IWXA 2K9QA 2FQ4A 2HS5A 1U6ZA 1X4BA 5BMZA 2OAZA 3DPTA 4RKUC 1KU9A 1Y10A 3QPIA 1Y5NB 2Y0SD 2AQEA 3DTKA 2R5ZB 4HL9A 4HPQA 3TGNA 1IN6A 1CGPA 4AL5A 2AYMA 2KZMA 1ON2A 1J9IA 1GT0C 3PO4A 2M45A 1YI2S 2ZNYA 3WTVC 1WJBA 2VKZG 4IRCA 1QGPA 3JAMY 4DV3J 3I5UA 2VIXA 3BH7B 3PEHA 2GNKA 1QZZA 1I94F 4Y52J 1BC6A 4IL6C 3ENWA 4OLPA 3ZMUA 2J8SA 2I8DA 2WVDA 5E20A 3CJTA 4HLXA 4OIQF 1EQMA 2CQCA 2JH3A 1T9UA 3IWZA 5L3GA 1HKSA 3MCZA 1T9XA 3OQ2A 4MT1A 2MGZA 1FOYA 1QTNB 2VD3A 2HWTA 4YELA 1NSKL 4Y6IA 4DL4A 1WTFA 1BQMA 3N6LA 5J2NB 5LMUJ 3Q24A 4X84A 4QQBA 2FZGB 1JWWA 3MKLA 3HLUA 4RW9A 4OX7A 1NK0A 1C0TA 3HZEA 1CSJA 1Y56A 4LK1F 4AD9A 4ZHRA 2Y9HA 4I7HA 1AA1B 1NJWA 3H5UA 3R7BB 5C3EJ 2FHOB 2UUBJ 4AL7A 3RUBL 4RW6B 2DD8S 1NBEB 2VF3A 2EFQA 2W9CB 2M34A 5KFAA 2F5DA 2QFJA 5B0EA 1R58A 2VOOA 3M05A 1S6QA 1FRIA 5KT7A 3MZ8A 3KLHA 4AC0A 1YX2A 3PW2A 4B3AA 2Z30B 4M8LA 3T1YF 1Y1WJ 4J90A 1SQGA 2K7JA 1I5OB 2JEIA 1JJ8C 2BKOA 2AHQA 4UOFA 1DTTA 5M3FJ 5D0EA 1F9HA 2DHHA 1RPWA 1TTYA 4CI0B 3NWSA 3TZXA 2W7OA 3MEEA 5ETSA 3BDEA 3TR5A 1C0UB 2JN6A 3EUHA 1OMSA 3I55S 1U2WA 4B3MF 1FVSA 1ONVA 3G73A 1MH3A 2PDAA 4ZDLA 3EPIA 4RWXA 2JA2A 2QMUB 3I4MJ 2XAUA 3DLLF 4A3KJ 3ZQCA 5L9XA 4M5GA 2DR8A 4G3IA 5DS9A 1JLBA 3RBDA 2POKA 4C8LA 2J5PA 1G3YA 1H2VZ 3C16A 1VQ5S 4ED1A 2CJAA 3HM9A 1DFDA 5FFZA 3SXLA 2ZB9A 4K50A 3I9ZA 1JHFA 4WF9Q 3H5YA 1YRXA 1OJ4A 3TAMB 5I3UB 5BJRA 1RHUB 4C2MJ 2L9RA 2O8KA 3BTIA 2VA2A 1I94J 2KRBA 5HODA 1RXOB 2BANA 4DSEA 2WK4A 2BEFA 3HFZB 1R0CB 1TTHB 3LGHA 1F36A 1MSEC 3PHTA 2JLGA 1S1TB 1OMIA 5IFMA 1KTQA 4CRJA 3KHRA 3DHXA 3TP2A 4IF4A 4AE5A 3CDLA 3TA0A 2HDDA 4AIKA 2YNGA 4DI6A 5GMKa 5ETPA 3BR1A 3UN2A 2L7KA 1Q79A 3FNNA 5C42A 3CJKB 5IM0B 3HJFA 3DFGA 5KFQA 1PAEX 3Q8VA 4BJ5C 2JTVA 3LOUA 1LKZA 3QWUA 1RWXB 2KKHA 4HTIA 3QT7A 4J9SA 3GZ7A 4LBIA 4N9IA 2R3SA 1K61A 2WAQD 3KJVA 4ABZA 4X4OA 3MM7A 3G71S 2IAJB 2B4VA 4CNZA 3D6TB 1R5HA 5AJ3F 1IKWA 2L9DA 4C11A 5TGTA 4PSXA 3MM8B 2W9BB 4DL2A 4ZP7A 3SEZA 4ZCKA 4FETA 1R7JA 2F4OB 2L01A 1RT3B 4ANJA 2JPCA 4UB8C 3T1YJ 2HVHA 2B7CB 2UZKA 3FHZA 4ZYGA 2DT7B 1FPQA 2R7OA 4HEA2 3AY0A 4GRIA 1RC9A 4Q5SF 3AD8C 4OIRF 2IY5B 3C46A 3C6UA 1DURA 1UZHA 3I6PA 1R7IA 4QJVA 3IBFB 5EEAA 4XSZF 2M4KA 3UDCA 5FLXK 2DRAA 1R8BA 2OC6A 2D1VA 4U9RA 5MAOA 3GILA 2AO9A 4R79A 3PO5A 2W4PA 3BREA 3S2WA 4HSTA 1J5EF 5I4MA 2Q66A 4DQRA 4ZYHA 3E2EA 1P4WA 2DYRH 3O8GA 1JLQA 2ZKTA 4U8YA 5FD1A 1QM9A 2HBZB 3NY0A 4RW4A 1RAJA 4HZFA 4F4ZA 5EWGA 1TKDA 4TVAB 4DV5F 2L9NA 3PQJA 1XMBA 5GAEI 1D8YA 1CS4A 5FDLA 2ZM6F 2ICWG 2ADCA 3MMJA 1LDKB 2F4FA 3HXLA 3KG1A 3WTXC 2JSPA 3VQTA 2UU9F 4ID5A 4LB5A 4N5SA 5M3MJ 1BBYA 3JRHA 4XN3A 1DP7P 2ROEA 1FY7A 4K5RA 4BEHA 1GTHA 2CJQA 1KQ8A 4I56A 2I5JB 4FP9A 3MD3A 3TX8A 2MW8A 4H4OB 2UUAJ 1G3TA 4ZCIA 2VG7A 1S77D 3OR1B 5JHFA 4ED8A 3WZ0A 4ENNA 2PFFB 4Y2IA 5DO2A 3RZAA 4HDVA 3M9AA 1WDTA 5CAAA 1SB6A 1UJ5A 2HW3A 4FYYB 3R1LA 3L2VA 1Q4RA 2ADUA 3TO6A 1BI3A 2ACJA 5JJBA 5KG5A 2Y48A 2JA6J 2LXIA 3GZ6A 4XK8C 1HPZB 3D9BA 4HACB 1M1EB 2KZVA 4DU8A 1B70B 5AJ3J 5BOXA 2A2DA 1ETOA 2L08A 5BPDA 3LUYA 1IAWA 1KU7A 3QGGA 2XQCA 2M30A 1RESA 3K5NA 3JSYA 3PQKA 3KJQB 4E7KA 3F0NA 4EM2A 5L3CA 4ECSA 1HDPA 1Y6IA 3M6WA 4P75A 2YX7A 4NMXA 5F3TA 2VDIA 1RT6A 2YU9J 3HD1A 3NGUA 3DYAA 1N52B 1NSQA 1YITS 1XMQF 2NS0A 2JEJA 2GMHA 2XGXA 2AQ4A 2DNOA 1JLFB 1BQNA 2V4JB 4KN7X 2C22A 2CUEA 4KT6A 2P0WA 4D5CA 5IT4A 2HQRA 8AT1B 4PJJA 2R2SA 1KA8A 4K4YA 3JRAA 1SQEA 3PJWA 3WTUC 2GAHC 4HF0A 5HATA 2WY8Q 1CJVB 2OU2A 4YP3A 3OL8A 7AT1B 5BYSA 4HX8A 3D28A 3K4LA 1WC1A 3L7WA 5JVHQ 3LGMA 3QYFA 1SFEA 2KIMA 2QA4G 1IN0A 2DGQA 2HSEB 1N5VA 1RWMB 3L1PA 1QA6A 1BMQB 5B0BA 4X6AJ 1IF1A 3KP4A 1HMVB 3QLHA 2E5IA 2WVCA 2UU9J 3KYCB 3BGFA 2G0CA 4DL0C 2ZXWH 5KFIA 4OOIA 2OD4A 4S0MA 1WH7A 3L95X 1J0RA 4MMOA 1OQYA 4AUXA 2A5YB 2X6YA 3A2KA 2GZWA 1N34F 4IYQA 3MVPA 4IRIA 2A07F 1W5TA 4ICLB 1BOBA 1X3ZB 1XX5A 3K1NA 2H9ZA 1LVAA 2RF2A 3TP3A 3MMYB 5F0CA 1A36A 2LK2A 1OWXA 4XK4A 4ZPBA 3CCLI 3VYRB 1O8BA 1RQ0A 2XAFA 5CVRA 4DIQA 3VGTA 3W65A 1REVA 4O3OA 3OYDA 4EGYA 2GJ2A 1P4XA 2E34A 4RO0A 3IP0A 2JRMA 3C15B 2AZ1A 1ZTTA 3CC2I 1RE1B 1S7OA 3NOCA 2EKYA 4DV0F 1YRNA 2FIUA 3IA0A 5IP6A 2C2DA 3SI8A 3NEUA 1JUMA 2QYCA 3K2YA 4JI4J 1MKMA 2LY9A 2EIJH 3UKGA 1H0MA 3FDSA 5BS6A 1ZZFA 3OUYA 1Q78A 3IWFA 4P72A 2XUBA 4II2A 2AYBA 4ZN3A 1NJIT 1NAQA 2BZTA 4O44B 3CC2S 2DA4A 4QWDA 1HBUA 3SZ2A 2WSFC 5HJXA 1FXDA 5KFYA 3W5XA 4IFYB 1MU2B 2DJIA 2GCFA 2UP1A 4JI2J 4FYDA 1TZLA 4XLNF 1HWUA 2HGCA 2BRLA 4IO9Q 2YWWA 1QBJA 1HL6A 3OYAA 1ORKA 4LVNP 4MAKA 3BTCA 2IT0A 2V4RA 3HGGA 2LF7A 1JXLA 1I39A 4KT0C 1WACA 3ABMH 2H4WB 4XTTA 4JI8F 3MM6B 2V94A 4CLFA 1HDDC 2AX0A 3GMGA 1TWHJ 2RILA 3ZZ0A 3K5PA 3P9KA 3QYBA 3A4CA 3K69A 1MNDA 2HNYA 5T41A 3V4MA 3M1VA 4URSA 5C25B 4M94A 2DDAA 1H2TZ 3KEYA 2AGPA 1N34J 3OIQA 4BU2A 3F44A 2BXZA 3GWZA 3TP0A 1HLWA 3OR2A 3C19A 3GW2A 3CCWA 3WODF 4J37A 3DKYA 3PHEA 5CYMA 1G6NA 1HA1A 4H4KC 4PWWA 1FYKA 4UUSA 4WKRA 2DNRA 4XPEA 3HK2A 2EFVA 1VJWA 1KTVA 1K8AT 2CU7A 3EICA 3BO4A 2CPJA 3PFEA 1NZ8A 5FO5A 3OTCA 2R8IA 1KQ0A 1U9OA 1WJ5A 3HGYA 4CZCA 4KICA 5C44J 2RQKA 3M30B 1POGA 2YUSA 1S72S 3N6NA 3D1NI 2YX1A 3HB9A 1XIQA 1N0VC 1XEZA 3GTPJ 3OFGA 5AXMA 5L3FA 2NAZA 1QSLA 2HOTA 4DV0J 1U5TA 2LQ5A 1QAXA 1FFGB 2WSCC 3FUYA 1EIYB 2JVGA 3ZMVA 1FX7A 3HHLD 3P9CA 4U0YA 1OKRA 1U1PA 1PUFB 2R42A 3FCVA 3I59A 1V5GA 4PXBA 1RNLA 3GZNB 3AAFA 4ECUA 2BE2A 3H4BA 1WSUA 1DPRA 3SSSA 1O3SA 1F0XA 2PMZD 2E9RX 3DN9A 3IAS2 3MM5B 3H5RA 3J81j 1QVGR 1FEHA 5SUHA 5KFLA 3HULA 1K78B 3D3CJ 4F4WA 1B4AA 3OR1C 1KWMA 3ZQIA 4ANCA 3VSKA 3ONQA 3DTIA 2K85A 1EJ9A 1J2VA 3ELHA 1D3WA 2NYXA 1HW2A 2Z57B 4F50A 4KHRA 3A1YG 1X4FA 2DFHA 4Q2MA 1N5YA 1M5PC 4DNCA 2IRUA 1OY9A 2XF6A 2IA0A 4FISA 1RTDA 1YTYA 3BKFA 2B0GA 4LQ3A 3M1EA 1H3DA 4KGVB 1RDRA 3G4SI 3I71A 2X0LA 1C1CA 3K2ZA 3CJRB 3OYIA 1X5PA 2W8KA 3B73A 1GV2A 5F08A 4PXCA 3H2LA 3MWMA 1C2PA 1JK9B 1UG2A 1MNEA 4CCHA 3BPDA 1BD6A 1TQLA 3PSIA 4I64A 2K27A 4D0PA 4X1EA 4JX6A 2J7KA 2CIMA 1HW5A 2LVWA 2XS5A 1FA0A 5HSPA 1VQ7I 4F4XA 2GMLA 4B3SF 1X4CA 1GMUA 3G4SS 4LGWA 4BGDA 4YQWA 3DRSB 1QU3A 4N7TA 2EA2A 2WONB 3JAMU 2MHNA 3ZTPA 3OYNA 5GTHC 1SD5A 1KOOA 3HPOA 4EMSA 2X6WA 3T9ZA 5GAHU 3OYFA 3OSNA 3ECHA 1KHWA 1UKUA 5CH7B 2JA7J 4JV0A 4HA8A 1WF0A 4X62F 3J7ZT 2E9ZA 5DDPC 1HNXF 2ID6A 2A05A 2M5WA 2BA9A 2VJVA 1B8IA 3BPXA 5F9LA 1KBRA 2CPFA 4J7CA 1H9TA 3AFHA 4DR6F 4FF4A 1HWKA 4LF5F 4X64F 3C2HA 5IYCJ 5HROA 2C3UA 2DMQA 1SC3B 1MWYA 2JVRA 1NK6A 3N05A 1XN7A 2XCPA 2DXDA 2E2HJ 2L7ZA 1R49A 3G1LA 4F3OA 4RUHA 1FDBA 3E6DA 3PNIA 4LRFA 2JEGA 2CPDA 1VQ8I 1MWZA 4WXOA 3A0BC 3OHBA 3HOYJ 3BZCA 2CNKB 3D67A 3DEUA 4HQEA 3QPSA 2DN0A 2V2VA 5KT3A 3EYZA 1XCVA 3WTYC 3AT1B 1YWXA 1WEYA 2LKPA 2RDIA 5JUMA 3Q23A 3GO5A 1NK7A 2H3EB 5FLXZ 3M8FA 1SVOA 3V6KA 2L3DA 3ZQLA 1VQ8S 1RTIA 4CYUB 2QYOA 2ZJQF 3W66A 2PMWA 2ZH1A 3LF0A 2MDAA 4IH6A 2WAQN 4Q44A 3R4KA 4A3IJ 3ZFVA 2VC0A 4ITVA 2BR0A 1D5VA 4RUCA 5LEKA 2AEFA 2JLFA 2EV6A 3THTA 2YKPA 5K7ZA 3EXYA 3DU5A 3IWLA 5A8WA 2LDIA 4L5EA 4RB0A 4CYCB 3TNVA 4BS2A 1AROP 4KO0A 1X31C 3HFKA 1JJHA 4B3SJ 3LL7A 3CD5A 4RNNA 3H5NA 2DCEA 4FNIA 4HLBA 3NGSA 4USMA 4PJMA 4S0HB 2ZITA 2G4BA 2M88A 2L4MA 4FZVA 4F4KA 2LY1A 4N4NB 3DBHB 4ELTA 4MFDA 1XERA 4RW7A 2XB0X 1ZGWA 3JSRA 1MBFA 2E1CA 5JFRA 3CNQP 1XNQJ 1CJUB 2LYVA 1YJTA 5DGBA 1UA0A 1HNXJ 2AJFE 5M2UA 2MQ8A 4F55A 3VDXA 1PSDA 4O0IA 3CD6I 4AU7A 5RUBA 5DV5A 4DR6J 1LE8B 2Y1JA 4W92B 3EYIA 1RAGB 2GO9A 2E36A 1M1HA 2Z2YB 4LF5J 1EH8A 4KB7A 4X64J 1OYEA 1YVFA 4E98A 1TL7B 1DQAA 4CO8A 4PFPA 1DTQB 2BW3A 1KQKA 2CJKA 2FJWA 2J9EA 3OYJA 1Y39A 2GOMA 5EWFA 4NQWA 2IVMA 4CP5A 3H2VE 4MK9A 1VGYA 3ZPLA 4K4UA 4QIVA 3FCHA 1M1KT 1NPPA 1S9GB 1BWEA 4TY9A 2WRMA 1N5TA 2IC3A 2EIKH 2CWXA 1UWBA 1ACIA 1TW3A 3ILIA 4IHYA 5D15A 1F5AA 4YIIA 4GYGA 2PFDA 2R9LA 2H09A 4BC9A 3U1NA 2GIZA 1ZN2A 4WK8F 2MC3A 1AWCA 4AVZA 2M70A 4TYBA 3HOVJ 4G12A 2CPXA 3OFEA 4HW0A 2XLIA 2QVOA 5CVUA 3UDEA 4N0BA 5HDNA 2IM1A 2ZVIA 1D1BA 1FDDA 3FQLA 4LT6A 1U6BA 2ZJQQ 4Y00A 3ZR8X 1NB2A 2P7CB 3BQYA 3GX4X 1VIXA 2BJ1A 2GAUA 4KGZB 1R23A 1N78A 4ZLNA 4ZPCA 2HHPA 2HGNA 2NXEA 5A2QY 2P5VA 3E8OA 1WQ2A 1NLKL 4QIWD 1IN4A 3UR0A 2E5NA 2CDRB 2UVWA 3Q3SA 2CQ7A 2B4OA 5L46A 5IZHA 2ZH4A 1XR7A 4GRSA 4WTOB 4Y65A 5L1KA 2X3GA 4IX7A 1RAAB 3I0SB 1U1NA 4DV7F 3HDDA 5EF6A 3UE2A 1WOSA 3L9ZA 3PO3J 1KNZA 2M2BA 1S9HA 3RBXA 3GR1A 1G2HA 4ES3A 1L5UA 1FX4A 2HRYA 3MCOA 3MWBA 5J2MB 3LSGA 2NOGA 2MSSA 4IEJA 1ULYA 3D5RC 1WELA 3NARA 2UXDJ 3FHNA 3BY6A 1K83J 5D8KB 1TKXB 4HT5A 1VC6A 1GX6A 1VI0A 3H3ZA 2YKOA 4ZP6A 3FBIB 5FLMJ 2ZHBA 2DH8A 3AB4B 4YY3F 1ZAWA 3J80Y 3FXRA 1ZG3A 3C14B 2WTFA 3W60A 2LYCA 4B8XA 2R7UA 2F4VJ 3EUKL 4B44A 3JYTB 2HYIB 1FTCA 2EINH 1VJQA 2MKKA 5HLGA 1S1WB 3EMTA 4OZNA 3C2BA 4NEZA 4OMYA 2MQOA 3GQCA 3MD1A 1K44A 2F4IA 3D2WA 4P96A 3DRPB 5KFFA 3R6LB 2LKSA 3HHLB 3NAIA 4A3MJ 2NZ4A 1IKXA 1T33A 3S1NJ 2EBEA 1FWLA 1MMDA 2ZOMA 2P7VB 4U88A 2P6SA 4QWQA 4J9LA 1C1BB 4KFCA 2A1BA 3R5BA 5AE3A 2YBVA 2E1NA 4BQQA 4PG4A 2HPMA 4I6AA 2ZMEC 3FSIA 2WB1D 4M95A 2QTWA 3Q22A 2MPUA 4JP8A 1IRXA 2KT2A 4CXFA 1V6HA 5EGOB 3AXKA 1TP4A 2XZDB 1ZETA 3OL6A 2DU9A 4IR9A 2W2MP 4ILRA 3G82B 2G0JA 2DGXA 3FKIJ 1FBUA 4ZVGA 3ECOA 4MFBA 1CC7A 3VAMA 4MQ9F 1Z2LA 3NBPB 4IDKB 1W4MA 3GIJA 3CIMA 3V6DB 2F5VA 1VBZA 2E1MB 2FUG2 4WPAA 3MMCA 3RYLA 3W7BA 4ZCMA 2BXJA 5GAGU 4EVIA 2CDQA 1V54H 2H6CA 1XDSA 2H1LA 1GQEA 1WHUA 3OVAA 1NJZA 1NDCA 3NEKA 1RYRA 2ATCB 1T7PA 4KYZA 4DV7J 5J6XA 3O44A 2HHXA 4FYWB 3ABUA 1R36A 4XKBA 4AXJA 3HHDA 4OI0A 1HBOB 2ZNZA 3LSRA 3QYYA 2FJAB 3L2QA 2GIQA 2HG4A 4ANEA 3IFEA 3LQRA 5KAFC 4X4RA 4DJBA 2KTQA 1S29A 2GO8A 1PYSB 3ASNH 1LW2B 2XPWA 1ZG1A 1WHVA 1UFWA 5GVQA 1I3OB 4TYAA 3C2PA 5ETNA 3MR2A 4E0DA 4DMZA 2CYYA 3OLBA 1FFWB 1IBLJ 2ZFUA 5B0AA 1Z05A 2M1BA 2FBHA 3HT0A 1TW2A 1D1AA 2M3AA 1ZH5A 5CCLA 1RHQB 4QIGA 3EPGA 3HRSA 4DUYF 4L0ZB 1XPXA 5E3PA 3KLGA 1KLNA 2IYIA 2D1CA 5BYQA 1AA7A 1U1QA 2VG6A 4HRIA 2EZHA 2GZOA 3FWEA 4CH0S 3LP2A 3HOWJ 4E70A 2LQBA 1FKPB 3MKZA 3GIMA 2QBYA 3CTAA 4O4GB 1N5SA 1NG7A 3QAUA 1X1AA 3K5OA 1BQXA 5H9FK 4Z7CA 4UV8A 2FJEB 3RU0A 4I2QB 4LMYA 1IR1A 1FF2A 2M9KA 4WTYA 1P7IA 1O6XA 4RNMA 2LA4A 3OYCA 5IV4A 4ATNA 5HLHA 4RJVA 3HVTB 4KUMA 3GTMJ 3IMQJ 1A6LA 3F6VA 3M4XA 3MECA 3MPVA 3BG7A 3CT9A 3NGKA 2NS1B 4CLKA 2EFPA 4ESFA 3JTHA 1SKWA 1XS9A 3MCSA 1XC5A 2WSEC 3E6CC 2KIFA 2M8GX 2AW0A 2FVPA 3D6HB 2VKDA 4UVBA 1XMKA 1TMMA 1N56A 4RW8B 1UFMA 3MTKA 5D5XB 2CJXB 1X4DA 3F6OA 3THPA 2J8AA 1WWHA 3R6GB 1SVLA 1VBYA 2LRDA 3FBFA 3LSHA 2CS3A 1KKHA 4A93J 2BOLA 4M5HA 4D3HA 1S12A 5D5UB 3MURP 2IVFB 3B4MA 2QGFB 1RAEB 1TQPA 3WTZA 3ROUA 3CCSI 2PC6A 2IYGA 1LKXA 4KH0B 1OYWA 3KYDB 2MZSA 2DBBA 3ZZPA 2DW4A 2D74B 4ES1A 2VQLA 5HLFB 1OCZH 2EK6A 2F63A 3DMJB 1WC6A 2MXYA 1PJRA 2RNGA 3EUAA 1DU6A 5LXRA 4HX7A 5KG4A 2N8GA 2OQGA 7FDRA 3TW7A 1P27B 5GPCA 1W26A 4FVCA 2R2TA 1B9NA 2YVSA 4NLGA 2HPIA 2F4MB 3K4CA 5F8HA 1Q86T 2HHHF 3CCSS 3TMOA 3PACA 4YOEA 1PYTA 1UJ4A 1YIOA 2JFKA 4DFPA 5KHDA 2V34A 2UV8G 3S01A 1MMGA 5FJ8J 3CJSA 1K47A 5KFXA 3R60A 3AL0B 1U45A 4RS8A 4PWDB 4OI4A 1IN5A 3KP5A 3ASOH 4EYHB 5DQIA 2H94A 4LB6B 1FHTA 3UD5A 1IXRC 4EU0A 3DPLC 1SKSA 1V5IB 3T6BA 4RM3A 3KP6A 1EH7A 1EB0A 1HLVA 4CO1A 2M7BA 3AHPA 3QO9B 3E5QA 3CF2A 1EP4B 2A18A 4WCGA 1U0SA 3SQGB 3OOPA 1KLMB 1EAYC 4LF8F 1T02A 2D2WA 2FEZA 3BR8A 2KJVA 3EE3A 4P55A 1WI8A 2HOAA 2IVYA 3KNGA 4ZJLA 3F73A 1IWGA 4F93B 5DJBA 5GPAA 1RKJA 2Y0MA 1BE4A 1S57A 1FNMA 4YEJA 5ILVA 3RKYA 5EDNA 3KX2A 2VT3A 1JGGA 3M2VA 1RT2A 1ZR2A 3Q0VA 1GVDA 3N79A 3J81Z 2XO6A 3BR5A 1T05B 5A8KB 4L9JA 4WP8A 4CTAA 1Q1KA 5LMNF 2L7FP 2P2CB 2BQ3A 4J9VA 3HG9A 3C6TB 3R7SB 3RYRA 1RT5A 1TK8A 2PA8D 3A13A 3BB5A 3LPEA 4TKTA 5KAKA 2GJFA 2M52A 3WTWC 1JLAA 4HAMA 1EARA 2PLYA 4OYWA 2K1RA 2KU7A 1XC9A 3KJFB 1DUXC 4F4AA 5F1RA 2XMJA 1BGXT 3CP8A 3JAMK 5DYMA 3GPAA 4S04A 5L38A 3Q0AA 4L72B 2K9SA 2EC0A 3ET6A 2ZOFA 3TQEA 3ABTA 2B5JB 3MEDB 3U1KA 2WWYA 1ZA2B 4L3KA 1FCAA 4H4MA 2QF7A 4P7TA 4GO1A 4ESBA 1YYVA 2XLJA 5CYQA 1EETA 4YRVA 3HHLC 4EJTA 2RREA 3V4IB 4FBTA 5FIIA 5B08A 1K1QA 3S2DJ 5FRNA 3DXSX 3RTRA 2RVJA 3ZZRA 3SIPB 1H72C 5M2RA 3DGPB 2JWNA 3TBIA 5LGUA 3CJQA 4D5FA 3MEGB 2ZD1A 1YG2A 1BM9A 3OXFA 3JSPA 1WHXA 2J9CA 4DR7F 3K4NA 1FXLA 4CM2A 2VPXB 3GTYX 3P8BB 1HW1A 2W7AA 3CD0A 3D3BJ 5E2QA 3VWSA 4UY8I 5J1EA 2IGKA 5D3GB 2ESNA 1B7YB 5KK1A 2V50A 3DRRB 5KFGA 5LXYA 1UVNA 2FLPA 2KHCA 1S6PA 1C4CA 1RTHA 2H8WA 2RUGA 3SQNA 3S3NA 1Z9CA 2HKXA 3IBCB 4ANDA 3V2UC 4IHVA 3GLXA 2BVZA 2QQBA 3M8QA 2IJLA 2ZH2A 4FKXA 1D3YA 2JUCA 4Y2AA 3UO0A 2K5CA 2IDLA 4LF8J 2BX6A 4J9QA 2ZE2A 2MQPA 4L0YB 5CYVA 1U0JA 3GJRB 4M3BA 2HNZB 3Q89A 4B3XA 3H9QA 3GFJA 3MAHA 4PRFA 2FRHA 1BY9A 1GMWA 1BOAA 1XK8A 1ETWA 3K7AJ 2EC2A 5I3UA 1N33J 4M3FA 2QKMB 3MCNA 2XSJB 2Z33A 3W2AA 2MLYA 1LK7A 2VPLA 2Z5UA 1TKTB 5KT2A 4KJZA 1R6RA 5HLTA 1D0EA 3L9FA 3IGNA 2P6TA 3F9KA 4QLCU 1SUQB 1RHMB 1SKRA 1IJEB 5LMNJ 1IN8A 1A0OB 1F5TA 2C2NA 2Y75A 4FF1A 2FGOA 1B9MA 1I3AA 1VF9A 1ZTRA 3M8PB 1NPRA 2GVDA 3SJMA 3K58A 4JI1F 2ZFHA 4J9OA 2GX8A 2J5OA 1ZZNA 3E3VA 2HEOA 1ZPWX 2JVHA 1S10A 2HGMA 2RU9A 2ZJPF 2M3DA 4IPAA 3H9JA 4U7BA 3D1OA 2N82B 2HVIA 1Q8IA 4MIMA 1NH3A 5B09A 3S1QJ 2DA7A 3TYTA 4J9KA 1RTJA 1QUVA 3GZ5A 3BZQA 4JV1A 3UD3P 4N47A 3MM8A 4UUXA 3GV7B 2AHOB 4ENKA 2DEJA 4KQZA 3ABKH 2HURA 4I6WA 5KVRA 3CDHA 2K9LA 3BGLA 4H4KA 2M4MA 4IXAA 4O3PA 1WHYA 4TLRA 3FMSA 3FSYA 2HZAA 2G9WA 1U1RA 4YR0A 5LD2C 2IGNA 1N5QA 5FRMA 1LWEB 5KNLA 3P96A 1L3SA 2ZXHA 3E6BA 2I1RA 2KRRA 2ELKA 3Q8RB 4DSLA 1KP6A 5CHCB 4O3MA 4NYOA 3TDZC 3HOTA 1R27B 4HR2A 1KD1T 3VCDA 2UXBF 4OIXA 4XKCA 3DM2B 2MQNA 2ZC2A 2IMWP 4X4UA 4EK2A 3NRVA 3Q0UA 3CD7A 2NNYA 2YKAA 2RRAA 3TQNA 2CG4A 1T0TV 1X9SA 1OCOH 1AFIA 3BZ6A 4HH0A 2ZH7A 1YJRA 3HKZD 3LWLA 2JSXA 2VJ5A 1I1GA 5BR8F 2HIQA 2OFHX 3KK2A 4DV1F 5ETTA 2G1DA 2VFRA 3OBIA 1X5OA 3RDIA 1IUFA 3E51A 3M32B 3TANA 4YFNF 2W48A 2LY2A 1W0TA 4H4OA 4HT7A 1AUSL 3NCQA 1PBAA 1OYIA 2KXFA 3MHYA 2CQ4A 2XMUA 3CMAI 2R8JA 3H59A 3KPHA 1T8IA 3W3CA 1HR0F 3BDDA 1YZ6A 3IC1A 4LD5A 4OWRB 3SDBA 4M5KA 4C2MA 4A3CJ 2X9DA 4LSLA 2C2ZB 3GYNA 4QU6A 3MPDA 5LSOA 1DDNA 3SCKE 3S3OA 3OTBA 5JVTA 4KBIA 3O2IA 1MROA 5GAEU 2NYIA 2Z2ZA 1NK5A 3IRQA 4ER8A 1AU7A 1JLEA 4DR1J 4NB5A 3M9NB 2YNIB 1PILA 1RAIB 3KLFB 4OYPA 5CXTA 3DOMB 2LP0A 1N36J 2NS8A 3CMAS 5ETOA 1ITYA 4E6KG 4CO2A 3AL0C 1KQ9A 2OA4A 2XRNA 5A2QU 3W2VA 3H90A 1VR6A 3MXHP 2COMA 3DLEB 4EM0B 2VIHA 4HF1A 2K86A 1JXEA 3V7RA 2Z58B 4JYAF 3C7JA 4A3JJ 2CKWA 1GXQA 1OPIA 3DNCA 4KHMA 5K5RA 3MUMP 1R71A 5DM6Q 3NGDA 3QPLA 1P6TA 2BHZA 2JC1A 5DCFA 3QPTA 4CLWA 1NKCA 4WWSA 4BJTA 1FXRA 3T5HA 4IRDA 3MMAB 2BKPA 1UFKA 3GTQJ 3GEZA 1J59A 2D1HA 1X9MA 1M5SA 3R0JA 2M7AA 1SJFA 4RUAA 2OZUA 4WYWA 2ZBKA 3GF2A 4TQSA 4TXSA 3I4HX 1HI1A 4B09A 2VJ4A 4HV5A 3L7PA 2DNYA 3I96A 4IG0B 2R7TA 3PNTA 3VALA 2OIHA 2HWIA 3BLYA 3HHGA 3J80U 1D8KA 2HQFA 1R0AA 1Q0NA 2DO4A 2NVQJ 5IOYA 4ZVRB 2P81A 2G0EA 4UZBA 4E8UA 3S32A 2JT1A 4LLLA 3B54A 2MD0A 1QE1B 2BYCA 1N48A 3KZZA 4XKWA 5MLCV 5C7PA 4KITB 3VGVA 3Q2SC 4TY8B 2GA7A 4RAGA 4DV1J 2ASLA 2LC2A 4KIBA 1TL3A 1IN7A 3M2UA 4IFVA 3TKYA 1FRJA 2R8KA 3FXQA 2AF6A 1TT5B 1VRUB 3KP2A 3PX0A 2OF7A 4U0WA 2JQ7A 3H5SA 2B6AA 4A8WA 2LMIA 2MKIA 1NKBA 1S0OA 2G7UA 3G8SA 2AJ2A 4IG3A 3K9TA 4LFCF 2WC2A 2E2JJ 1HR0J 4P5OA 1RACB 1IW7F 2J7WA 5D8HB 4LLNA 2C3OA 2DTZA 4DBRA 1RA6A 2DH9A 4UUWA 5ETRA 4DR4F 1FERA 1XR5A 2XROA 2MH9A 3VVTA 4V19K 1JKRC 1WJCA 2FY1A 1RZ4A 3DBRB 1JNZB 4R5PA 1ACMB 2YQ3A 4HDGA 3HSJA 4PSWA 2NXCA 4RBTA 3DOKB 1H8AC 5K14B 4NI2A 3M9OB 1S48A 5H6RA 1CQNA 3RPUA 2B7BB 1O3TA 2NZCA 3I9V9 1I50J 3MR3A 1XGMA 3F0CA 4JYAJ 2UV1A 2HI3A 5E3AA 4GXOA 2P8IA 2FOKA 4C48A 1Z7UA 2XG8A 3DLKA 2WVEA 1E3OC 5LRRA 4MLOA 4EJVA 2DMTA 1XBWA 4DZPA 3BSNA 5J1NA 5HBMA 3QAEA 3C2GA 4ZDPA 1KSPA 4R25A 2Q1LA 3VV2B 2CPZA 1RT4B 3H98A 2O03A 5J4VA 2H1YA 4Y3OA 4UXNA 3DXBA 4I6YA 2CUJA 2B9EA 4QWAA 4DV6J 2MH2A 2N3OA 5LLQA 3QT5A 1YGYA 4BBSJ 4LG3A 2XAHA 3VOEA 2VG5B 3K6GA 3BP8A 4PGGA 2FD2A 3LSIA 4FTHA 1NHKL 2PD1A 4DX8H 3U9GA 2XSJC 3BGRA 3RB3A 3MAAB 3VR1A 1MJBA 4IFYA 3F23A 1YKWA 4OHYA 5KFMA 3PW7A 2R3VA 1JGSA 2FQ3A 3FFIB 1MW7A 2EXUA 1Z4UA 2XM3A 5FGMA 4LRAA 2GC8A 4B43A 2EH3A 1T98A 3N28A 4OJGA 2F8EX 3DDKA 4C3JJ 1ROFA 2MG4A 3I5BA 4ED0A 3PUFA 1A04A 4FE4A 5EG0A 2ALZA 2R7WA 4B1RA 4I67A 2RH3A 4IOCQ 4RB1A 2EEYA 3NCPA 2VJJA 3K89A 4WU2A 3KZYA 4RR5A 4IRHA 3QWPA 3KUGA 1STZA 2QG9B 2HHSA 3LAJA 2NVUB 5CVJA 5J1YA 1TT0A 2CJ9A 4LFCJ 2BW2A 1J7KA 4FQGA 4PG5A 4QZVB 3B6BA 3HUGB 4DU7A 3SXYA 3A8IA 5GAGJ 4ZITA 4DR4J 2BHYA 1RCXB 2ZHAA 4YB6A 1MG7A 3IL2A 1WCMJ 3QMQA 3HVAA 1Z91A 4ZVTB 1HBMA 2I38A 4V19J 3MAQA 5F0FA 1DLOA 2D45A 5IOZA 3CCES 2WAQA 1UL3A 3QODA 2XKPA 4NXNF 2LVSA 4PABA 4WFZA 3G6EI 2IM0A 5ETQA 3OL7A 3G3ZA 2GS8A 4P6QA 4EEYA 2WW8A 2RHSB 3QZ7A 4IR1A 2YWHA 1FOKA 3D1HA 2HVQA 1O4XA 4XL9A 3JAMZ 3CMYA 3SFIA 1NU4A 1S49A 1Z77A 5D4PA 3GTJJ 5GP9A 2Q2EA 2ZSHB 2YPZA 2R0QC 5EHHA 2GXBA 2MY8A 5I42A 1E6YA 2BYVE 1T11A 5K8PA 2RN7A 2E1OA 1X1DA 1IRZA 2FVRA 3GVAA 2CVIA 5EX0A 3CJ3A 1VBXA 3SSQA 1CPZA 3W6VA 4ILLA 2VJIA 3NNAA 1ZLJA 1E3HA 1H7WA 3SCIE 1RWOB 4K4SA 1BJZA 1TV6B 2DHXA 2XGCA 4IOAQ 2W4DA 4E7IA 3R5CA 3WG7H 4DW6A 1S0NA 4KKOA 3DQVC 1YW7A 3CTRA 1S5LC 1K78A 1VHIA 4KV8B 4R8UA 4NPOA 4F04B 2RHQB 3NRBA 3I54A 3W2WB 1B1BA 5CABA 4Y4RA 1VRTB 4QIFA 1T08B 3KK3B 3CJ5A 5KFTA 4AFFA 4I69A 3HOSA 3QU3A 2OHDA 2XYGB 1P7JA 3CJRA 4FF3A 2BDPA 4P9UA 4C8OA 3OSFA 1R8CA 4K4TA 1HBXG 4GVLA 1P2FA 4ZYEA 2F1FA 3IS9A 3CC7S 1S6UA 2VDHA 4ZVFA 3BS9A 1VISA 1U1OA 4ZTFA 4QR2A 2ZMEA 3BBCA 2QM3A 4M5NA 1WJAA 3L3CA 3FQKA 3PIPF 2LKZA 1S79A 2GHVC 2GGPB 1KZHA 5H9EJ 4OI1A 1GAOA 2VUMJ 1MBHA 1Q95G 2EQRA 4BXXJ 2A6OA 1NO8A 2HMIB 4X0GA 3QZ8A 2XHCA 4U7CA 2K9MA 1PBUA 1S6OA 3CC4S 3R8YA 2OLWA 2RMLA 1DHMA 5KFUA 1U2CA 1WFXA 3OTDA 1I1SA 2YY3A 4OI6A 1K73T 3QQCD 3T1HF 1SKUB 4TU8A 4Q0BA 1RBAA 8ATCB 4NXNJ 2JJ4D 1FRXA 3R27A 3AAWB 6FDRA 3LA0A 1QRYA 4LJMA 3RR8A 1YJNS 3O3KA 2QLZA 2ZWPA 2OEKA 2ZWOA 2VFSA 3EGWB 2G9OA 2A6TA 3MFKA 5F8MA 4NCGA 1WKJA 2K3IA 2RGVA 4YUDA 5HMXA 3RZOJ 2XVCA 2ZO4A 3FM5A 5DZ6A 4CLYA 1RAOA 2NYHA 4K2XA 3VZHA 2XLKA 3JCUC 2L41A 1A6IA 2Z3YA 4DF4A 1NK8A 4PQUA 3TVZA 2NQPA 1RAFB 3AA9A 3WU2C 3CF5F 3PJXA 2QT7A 1LW0B 2OSRA 2DPUA 4USTA 4ELUA 2MABA 4UV9A 1Y8QB 1IC8A 3LP1A 2OPPB 2ROGA 5T7LB 4BC7A 3V4GA 2YNFA 1YS7A 2XMMA 1TVRB 1W7WA 4FYXB 1HI8A 3I0RB 2I10A 5J8CA 3VTIA 2XY7A 3BKTA 2VASA 1DU0A 3ZZUA 2V6AA 1OPZA 3AD9C 2WTEA 2XAJA 3NAUA 4A6EA 3QT6A 4PG7A 1Z6RA 4F7VA 4YR3A 4PUOA 2GOXB 2Z99A 1O7FA 4A47A 4OJHA 2GVZA 5C5JA 5HP1B 4I68A 1QD1A 4KH1B 2NVYJ 4WE1A 1V3RA 4KFBA 1X5SA 1NHAA 2WAFA 5HO4A 5J3LA 1S0MA 2XGDA 3LSTA 4UVAA 3BWGA 1V3SA 2UWMA 1G8XA 5HS8A 2KG1A 3HSEA 3H42A 3O8HA 1U3EM 1WC4A 2YKNA 3PIPQ 4A8FA 3J7AN 4IQXA 4YDDB 2XYPB 2HFOA 3K4KA 5FROA 4D7NA 3UQSA 4TU7A 3GE9A 3A03A 4XOPA 3VAHA 1UVMA 1MSWD 3I5AA 2RT3A 2IJNA 1RHKB 2IS6A 4DX5A 2J6SA 4E7SA 3O6QA 3F8MA 3ZTSA 5KG7A 2I5UA 1A9NB 2ETHA 4NLSA 4PQAA 2L9VA 1X4OA 2MGZB 4M9SA 1VQ4S 4CH7A 1WEZA 4O3RA 2LEAA 5LGTA 2OTLI 4NA1A 1VQLI 1VTNC 4MEYF 3IC7A 2NXNA 3PKYA 1HQCA 1BQMB 3T1HJ 3RRKA 4BQNA 1W5CC 2QEXI 5ETMA 3EVOA 3KTQA 3KG4A 4I2PA 4K0KF 4RW9B 3G6XA 1C0TB 4B02A 1R5ID 2EIMH 1SBRA 3NS7B 1BW5A 2CQNA 3SYZA 4WWCA 2QMXA 2CQXA 4WF2A 3T9NA 4XORA 4ZOSA 2LQJA 2P9EA 3DKWA 2DK8A 2PA3A 1J27A 3VF0B 1RR7A 3R2CJ 4XOTA 2V1UA 2QRRA 4NBQA 1TLHB 5E1WA 2Y3YA 1F9NA 1S6QB 4LR7A 3KLHB 4ED6A 4XLEA 2QEXS 4YHHF 3BQ1A 4M5JA 2RAQA 4MKYA 1CULA 2OPQA 3O1LA 3WGGA 1IKYB 4E2FB 1S9GA 3L7OA 3MF5A 4DL6A 2F8HA 5FKKA 1DTTB 4ECYA 3CDIA 1YDLA 1FJEB 4KSEB 3MOJB 2QQ8A 2QSHX 3BR0A 1B64A 3LFKA 1RBOB 2HNDA 2LECA 2FB0A 4K4XA 2GQQA 5E3LA 1D9AA 4P7VA 4OAZA 3MEEB 2L9WA 3IRXA 1VC5A 1NKEA 1WORA 4U87A 2JNJA 4HHHA 2X48A 2J5AA 4NZ0A 4M5DA 4DQPA 5I3PA 2RQCA 1UTAA 4RU9A 1WH5A 1M5OC 3HF5A 2OUGA 1LFBA 3GCMA 1AKHB 4BUPA 5FKOA 5TRDA 3JRDA 1XWLA 4AIJA 3LFUA 3OTEA 1IR2A 2FU4A 3BGUA 1JLBB 4I0WA 2IMOA 2O5RA 2H1KA 2EB7A 3MZYA 3CJNA 2WW4A 3DKXA 2QA4I 4DSJA 2DNZA 1FX2A 1S1XA 5F64A 2CFOA 5IT0A 3SCLE 4R1HA 4UY8T 3SFUA 2CQHA 2BANB 3I0SA 3P4UB 1ZM3A 4Q5VA 2X51A 3OIOA 2Q6CA 1IKVA 4I76A 2YNGB 2WADA 4A3DJ 1SFUA 4HVZA 3QP5A 2O67A 2CQPA 5C42B 3PX6A 2BQUA 3HFVA 3KJNB 2QA4S 4LBPA 5CQGA 4NMLA 5A2QK 2DCLA 4JP0A 3TWZA 3PZPA 4P9FA 2NVTJ 5KFOA 4CLTA 1U8WA 4DBQA 3N5FA 4JV5F 2B51A 1FP2A 3KJVB 4UOGA 1PP8F 3MM7B 2V9VA 4RGRA 4N76A 4QYZJ 2BOAA 1FZPB 1MDMA 3DV8A 2YNHA 1FD2A 3CCUS 3UD4P 4C11B 1N88A 2YKMB 4ZJQA 4K2JA 5CZVA 2VQGA 3JRCA 2NXJA 4RBUA 4OJ1A 4HEA9 3MMBA 4M72A 2LFVA 2LTPA 3P3DA 4NLUA 4UUVA 2D3UA 1HQEB 3OFHA 4ERDA 3HHLA 2LD5A 2XRLA 3CZ6A 4YHHJ 1JB0C 1JLCA 4JI3J 2VBZA 2HOSA 1ZTWA 4A5NA 4DR2J 2VL8A 2F65A 2NLWA 3H25A 1XMAA 3J80K 4LSNB 1J75A 5D77A 3QJJA 3H5AA 3C6UB 2EZKA 4KT5C 3GG1A 1FKOA 4N41A 3D4JA 4KE5A 2Q8KA 5M5XJ 1GLNA 3VQSA 4BE0A 4C3KA 3LAPA 1X5TA 1RAHB 1GEHA 3QT8A 4ZVQB 3OL4A 4ASNA 4XDDA 4K2EA 2DMNA 3IRRA 4I6ZA 4WZQA 1V9OA 5F3ZA 2I9SA 3VYSB 3F8NA 2OEJA 1ZG5A 1JLQB 5LMUF 1U02A 2Y9YA 5IP9J 5L3BA 1T9WA 3E5UA 3IBWA 1K0VA 4RW4B 1U6FA 1BI2A 1ICEB 4G7OF 5A8RB 1NJYA 2R7VA 4FYVB 4A6DA 2BGCA 2BACA 2OP5A 4BHQA 2VJUA 4CNYA 5FDLB 4F2SA 1DAXA 1Z3YA 2AS5F 2AIRB 4ID5B 3MKWB 3M8YA 3FK4A 1JJ2R 2R93J 2A61A 3TUIC 4BEHB 2KLOA 1RBLA 3U27A 1VFJA 3J7A1 1R6VA 1PGZA 2E1PA 2VG7B 2KT5A 2BJ9A 4LREA 2BJEA 5GAEJ 3DBLB 2J0XA 1RI7A 4ZYDA 1HBOA 1V5EA 4FS2A 2LLKA 1V3FA 3E01A 3DWLE 1VNDA 3IR6B 5HOOA 1SJ1A 1ZKGA 1HQUA 3E3XA 4O3QA 4IH7A 1SANA 3R5DA 2AYGA 5HVFA 2HPUA 4XO0A 2EILH 2DRDA 1YI2I 4HNVA 4YFUA 1UJ8A 3RBEA 3N5BA 2QN6B 1UHWA 3FXMA 1LOUA 4UY85 2DRBA 3S1MJ 4DS5A 2MA3A 3M8JA 1OYDA 1FC3A 3UCZP 1NZAA 5KG3A 2CJBA 5IXUA 5B1AH 2MSYA 1BHNA 1BL0A 3QJLA 3CCTA 1BI1A 2BVLA 3E0JB 4KIAA 4IHTA 5ICCA 1LWCA 3B8HA 1B6AA 3NNCA 4M3GA 2MJNA 5IT9Z 2OSQA 2O9LA 3MZIA 1XSDA 4BBYA 3EQLF 2H27A 1BQNB 1RA7A 1BJAA 3VODA 3IM8A 1KFSA 5L3EA 1RKIA 1WC5A 3K5MA 2PI0A 1V5VA 3NGTA 5B7WA 3HJVA 1X2MA 2HDWA 1KS2A 4LF4F 3HVTA 3VYUB 3KLNA 1HI0P 2BY0A 4KISA 2KQRA 3HRTA 2HVRA 4URQU 1F5CA 4DN9A 3GIKA 3LSJA 4L74A 4AIDA 2WAEA 3QFWA 4XR6A 5JLXA 4ZLJA 4NZ7A 8RUCA 1Z7LA 4RA2A 5J1RA 1SI9A 2AT1B 2WY7Q 2X6XA 3V7SA 1QHGA 6FD1A 4EMDA 1VC0A 3IH3A 4ZPWR 2HIYA 4ECZA 2ISYA 1CJTA 2FOWA 1UG0A 2JRSA 4LVOP 3HDSA 4YFKF 3BBBA 4EJWA 4USWA 4WXCA 3G1OA 3L2WA 3QLHB 4F25A 3JTNA 3I64A 5EWEA 4DGWB 1S0VA 1RUOA 1E2XA 2CG8A 1NPKA 3I55I 1R8AA 1I6XA 3ZQGA 1UP1A 5FKNA 4ZP8A 4USUA 1NM2A 2CFXA 4O0NA 1NRKA 3FBCA 4PJNA 3W6KB 4DPTA 4F67A 1VQKS 3JQJA 4EM1A 1N25A 1TL1A 4LFUA 1VQNI 3W9JA 3SCJE 2CRGA 5KTQA 2FZCB 5FD6A 3C3WA 4WFNQ 2O66A 2RF2B 3S15J 4TLQA 1GK8A 2QL7B 4A48A 1VQ5I 4MTEA 2ZH5A 3BQ0A 1HWLA 2OD5A 3AG2H 4P73A 3Q2TC 2XSDC 2KFYA 1REVB 5L8RC 3QWLA 3GJQB 2CQBA 1DGWY 2E5HA 1IUJA 1AFJA 1L3TA 4JX5A 1VQNS 1NEEA 2HHQA 2QL9B 3RQ4A 3OSPA 1CVJA 5KOWA 3M2RA 1GUUA 2A6HF 2CW0F 1VQ6S 2V4QA 1YRNB 2K4JA 2BE7D 1B0PA 2RUSA 1EV7A 1H98A 2KFDA 4LJZF 1X19A 3AJ2A 2JZYA 2D7SA 1TAUA 3R97A 1I6JA 2Z56B 2ELHA 2E19A 2UUAF 4MHGA 3G71I 1U09A 3OUYB 2MZTA 1WEXA 4XIUA 4OIPF 4LF4J 5E7OB 2HOEA 2W2QP 1OCTC 2FBIA 2FVQA 1W7PA 4LR9A 1HBUB 2RS2A 4Y0FA 3T1BA 1PC4A 5M2PA 2UUCF 1FD8A 3N01A 2W85A 3OV7A 3OJUA 2RRBA 2JJ7A 3NAHA 1QHHD 1TR0A 4CO0A 1HD0A 1T05A 1DARA 2Y1LB 2VH7A 1X0FA 3WX4A 1YIJI 3OV8A 3DC2A 2RJZA 2JMWA 4G1IA 3GV5B 2KHDA 4ETSA 1RRJA 2VKRA 1YRUA 1UMJA 1Y1VJ 1YW9A 3U21A 3T5XA 1RETA 3WU0A 1LFWA 4DX6A 2FNAA 2CZ4A 2FD5A 3D0IE 1U6GA 1M0SA 2HNYB 1K1SA 4G7HF 3F8BA 1CF7A 1H38A 2OJ3A 1NH8A 3M1VB 5A6WA 1RJJA 2ZHOA 4A8MP 1YIJS 3CE8A 3ESWB 5HLIA 1GVJA 1FDNA 3QQAA 3EDPA 4U7DA 3OR2B 4OX6A 1VQMS 4C3IJ 3S17J 5B5EC 3S8PA 1WPKA 5CYMB 1RK8A 3CDEA 1BC7C 1YJ7A 1EHWA 1JLGA 5J47A 5KFEA 4UUSB 5KG1A 1HNZF 3ZMDA 3V4IA 2LF8A 3PJRA 3JSBA 3HRMA 4NC6A 1S76D 2Y31A 3ZOBA 4DFJA 3US5A 2XI3A 1FTZA 1ZYRF 2HTSA 1UEUA 2I6WA 2RS8A 2B4PA 2XNQA 4JQFA 3KHHA 2MKHA 3KHLA 2E7WA 5HS9A 4WXHA 1SC7A 4OL8A 3MGJA 3A1YA 4D1QA 4ZTJA 2XY6A 4M6VA 3VGSA 3F56A 1W2IA 2MQMA 3ENVA 3CW2C 3DLLQ 5D3GA 3FZBA 1UFLA 2W2OP 3HZGA 3G8QA 1RR8C 2PEHA 4XRMA 4OZ3A 2UXCJ 2OV7A 2X4HA 2NSCA 1T9VA 4EJUA 3NL0A 1U5TB 2C28A 3G6YA 2YS9A 3IAS9 4OX9F 5AXLA 3IAM9 3GIIA 3R2DJ 1Z2ZA 3LA2A 4BH9A 4XPCA 2Y8YA 4G6DA 2V2KA 4NLQA 4LFBF 3MCMA 1U26A 3I59B 2FVSA 4JOUA 2W25A 4BDPA 3HZJA 3V6JA 4EGZA 3M9MB 1XB4A 1SPBP 2PJRA 3QP6A 3QIDA 1S1VA 2BBEA 1IV8A 4B3OB 4HNTA 4CLLA 1UVIA 2NRAC 2QLXA 3H20A 3PYGA 4KGXB 2UUCJ 1RT7A 3HKWA 2XZWA 1TKTA 2R7QA 3A3PB 2V6EA 1YITI 2HK3A 2VQEF 1UHSA 4KY3A 4FDFA 1N5YB 1NG6A 1RTDB 2OD6A 1WTBA 3GYHX 1JE8A 5K5QA 3K57A 3CCVS 2XHKA 1C1CB 3H36A 1S7HA 3A12A 4GVBA 1FYLA 2CO5A 3UI3A 4WZMA 3M6VA 5C2CA 4DPWA 2V1NA 3KLIA 5HMYA 1YJ9I 2H6BA 4J00A 5DM7F 1FT8A 1VQPS 3ZMSA 4QR0A 1FJGF 3GONA 3FCWA 2ZC3A 2XI2A 5H1SV 5EX3A 4JI4F 2B4UA 2LA6A 3K0JA 3PM1A 4I09A 1S9FA 1HNZJ 2K3PA 1SV5A 3L7UA 2CSOA 2DQLA 3GTLJ 4Y34A 5HMZA 3LANA 1E6VA 1B7FA 4NLVA 1YJ9S 4C98A 3I3LA 4JI2F 4DG1A 5IV3A 2OAUA 2MHEA 2ZZNA 2ROPA 1LDDA 5A0YB 2PE8A 5C24A 4WX9A 3EZUA 3S93A 3BR6A 4LITA 4IQ4A 3OYLA 2HGLA 3ILOA 1VI7A 2V69A 3SDGA 1WC0A 1B8IB 3AOBA 3J81Y 5FB2A 2CW8A 2KFNA 1GXPA 3HOZJ 3ZZYA 3SZGA 1LWFA 2WV0A 2KYZA 4OX9J 3DM2A 3CEDA 1S9EA 2MB0B 1H74A 1BWVA 2G13A 4ON0A 1L0OC 2YPRA 1M5KC 3GSDA 4IKAA 4LFBJ 2BY2A 1RWPB 2R7SA 4BJ6C 5LFAA 2VBWA 2J0WA 3HP6A 3B6AA 1RYSA 4OZLA 4B9VA 1FE4A 3D68A 1IRGA 2CXEA 3DDNA 2BVMA 3A8JA 3LA3A 1T9TA 3PRDA 3SFZA 3P7NA 2A68F 1NTCA 4Z2YA 4GGGA 3BTLA 1SFKA 3W63A 4F91B 3CQZJ 1WRJA 3LP0A 5CD4A 4C2UA 2GQCA 4BDZA 4PYDA 1P92A 2DAOA 5HI7A 3RR7A 2VQEJ 2XO7A 2X85A 4PGHA 4DQIA 1WF2A 1I5ZA 5J8FA 2QC3A 2E29A 4OYOA 4WK3A 2H65B 1RTIB 5IQ6A 4Z2XA 2HR3A 4AIHA 1WC3A 4F3QA 2U2FA 4ENOA 3FC9A 1DP3A 3KLFA 1HOMA 4Y2MA 1ZHFA 2STTA 1HXDA 5DM7Q 1SJ4P 3EPZA 1KU3A 2E35A 1FJGJ 2KDOA 4KAIA 2KH9A 4HI1A 4KO0B 1N32J 1H6KX 4DQSA 5U47A 2VC1A 2CPHA 2W2NP 2IPOB 5D78A 5GADU 4KRWA 2HZTA 3V8KA 3DLAA 1ZBTA 4WIIA 2X3DA 1X7VA 2HQIA 3I4PA 3JR9A 2MQLA 4N4OB 2A6MA 2HHTA 1RT1A 3RB6A 1YSJA 1TL4A 1D0XA 2DVIA 2O01C 3GFMA 3JSMA 3CVKA 5IPAA 4NOHA 4RW7B 4Q48A 3HM5A 2HVZA 5KFVA 1YX3A 1SH2A 1LJ9A 4FT8A 1F1ZA 2OCEA 4XN0A 3CCQI 1NDPA 2LU1A 1LDJA 4M6YA 3N9UC 3WGHA 2V5HG 1YRTA 2VL1A 3FGVA 1IG7A 3SEQA 1ZS6A 5F41A 1K0TA 2I0XA 1UAWA 4GKKF 1W36D 2W1BA 1APSA 2RQQA 3RG6A 4CWBA 4RNFA 1W1WE 1X8DA 4Q4ZF 3NGRA 4PAAA 3BJ6A 4DL7A 1OQ6A 1UZDA 2FJ1A 2BW3B 3P49B 2DQRA 4KN4X 4MIWA 4NQWB 3ULHA 2OCCH 2WBMA 4AL6A 3CCQS 3GMEA 3GP9A 4LG0A 4TY8A 4B3TF 2R92J 2KP6A 1S72I 3BR2A 4P1WA 1U0HB 1TQMA 1SH3A 3LTOA 3P5BP 2IC3B 4HX4A 4EO6A 5AONA 1UWBB 1WF1A 1RIOH 4X4QA 1VRUA 2HKEA 3LA7A 2ATLA 1SC1B 2WB4A 2GBYA 4OZ5A 4M3EA 5JI6A 2RU3A 1XGOA 3OR2C 1REPC 3NS6A 3B02A 3G86A 2VBYA 2PN6A 4E7LA 4N56A 3BQZA 1KVJA 2KFZA 2YWKA 6PAXA 2KB2A 2QYGA 2IXSA 5J4YA 4J9UE 2MY7A 4RMNA 3MPYA 3EYYA 1GH8A 3OYGA 2K2PA 1WI9A 1LWXA 5JR3A 1SC6A 1UA1A 3RI4A 2DYSH 3RB4A 2HBRB 4A8QA 1U7LA 5DS7A 3K17A 2CQ2A 2L02A 2RC4A 3TZZA 3M1CA 4EQQA 4DYQA 2Y0SN 3TOQA 2GHPA 2MC4A 2BXYA 2FY8A 2W7NA 3W8GA 3WHCA 3RW7A 2ERRA 3CULA 2IEKA 2CMP