3I4PA

Crystal structure of asnc family transcriptional regulator from agrobacterium tumefaciens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
153
structure length
153
Chain Sequence
MDRLDRKILRILQEDSTLAVADLAKKVGLSTTPCWRRIQKMEEDGVIRRRVALLDPVKVNTKVTVFVSIRTASHSIEWLKRFSEVVSEFPEVVEFYRMSGDVDYLLRVVVPDIAAYDAFYKRMIAKIEIRDVSSAFAMEQIKYTTELPLDYML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AsnC family transcriptional regulator from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, AsnC family
total genus 33
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i4pA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i4pA02
2HWVA 2OZ6A 5FD5A 3JTHA 3F6OA 5ICGA 1OYWA 6PAXA 4L5JA 1R58A 1R23A 3HOSA 2H6BA 2MD5A 5KK1A 3F8NA 3BROA 3DQVC 1ZRCA 4KUMA 1J5YA 2M45A 4G9YA 1IN8A 1LJ9A 4Q47A 1T2KA 4OMZA 3CDHA 5J6XA 5BPIA 1LNWA 5CVVA 4G6QA 1T98A 1E17A 5D5WB 3HTSB 4A0ZA 3KP4A 3J81Z 3ABUA 4XSZF 3KEOA 2IPQX 1Z6RA 4ASNA 1X3UA 1SD5A 3N97A 1OR7A 3BJAA 4G6DA 4CYDA 4ENKA 5K5QA 1QZZA 1OMIA 1UHWA 4G7HF 2FE3A 5DCFA 1IRFA 2GXGA 2NAZA 1XSVA 3DKWA 3HIFA 2NRAC 1SD6A 2XV4S 4RAYA 4A2UA 5HDGA 3WTSC 3C18A 2EFQA 1SMYF 4YFXF 1QO0D 2V79A 1HBXG 2K86A 2IW5A 5LGUA 1BIBA 2JRTA 4CHUA 3JSPA 3M1EA 4WK8F 1R00A 1V3FA 4MQVA 2DJWA 2CFXA 3KETA 1MZBA 2DK5A 4A5MA 3SXYA 1IN6A 2EV6A 1RUNA 1TBXA 2GZWA 2EV0A 2D2WA 3E5XA 3KZYA 1W4MA 4BH9A 1E2XA 2J5OA 4P9FA 3HSRA 5LGNA 4R8HA 2V1XA 2P5LC 5D4SA 5FGMA 2V9VA 1LDJA 1TW2A 1YO5C 3KE2A 4HW0A 3WE2A 2LNBA 1BI3A 1A04A 1PDNC 3DXJF 4PGGA 4HA8A 3O3KA 2BV6A 5AONA 4RB2C 3K0LA 5H6RA 2HFHA 2DTRA 3ZN1A 2HTJA 2HYGD 4OU0A 2XHKA 3TOBA 2COMA 2HKOA 4ENJA 3BOQA 4UUVA 4XBFA 2M30A 3U9GA 4NHJA 4LJZF 3REOA 1XGSA 2CG4A 2A68F 4ESFA 3F8MA 3ZN0A 3WGGA 5DDGA 1RZ4A 1GHCA 1QBJA 4UHTA 2QLZA 1W7PD 2Y48A 3SZTA 2D45A 5CLSA 4IRHA 1ZGJA 1IN7A 3FXRA 3RI4A 4M73A 1JE8A 5K5OA 2PFBA 2VE9A 4Q4ZF 4MNUA 4EGYA 2DK8A 4HLYA 4I09A 4P55A 3MQ0A 5E8GA 3H3UA 2D1HA 1H9TA 1SFXA 3DEUA 4ZYHA 2X0LA 3MAJA 4BXUA 3D5LA 5FLXZ 4XRFA 3QP6A 2A6HF 5E1ZB 2OQRA 2YX4A 1D8KA 3LSTA 4MTEA 2BGCA 2FSWA 5ILVA 1FYKA 4XLPF 2VT2A 1FZPB 2WWYA 4KIBA 4EVIA 3QPTA 4PDKA 4KMUX 1RNLA 3EUHA 5FD6A 4L5IA 2E1CA 1Z1DA 2CVIA 1MD0A 1U8RA 2VE8A 2WTEA 1YS7A 4OINF 2P4WA 3E97A 4P5OA 4ENMA 2DBBA 4ZH4F 5CVUA 3SQNA 1W5SA 4YIIA 4BHBA 2IT0A 5HOOA 1KU7A 2DO7A 3EQLF 4LLGF 2K27A 3LAPA 2F5EA 4N9IA 2DI3A 2A61A 1FBUA 3R4KA 4RGUA 2KKOA 4HZFA 3RYRA 4UV8A 3ZQ7A 5A2QK 2XAJA 3BPVA 3CUOA 3QAHA 4BHCA 5LRSA 5L3DA 3V4GA 3C7JA 5D5VB 2IA1A 1J0RA 3GW2A 2HOEA 4EJOA 2Z5UA 1F4KA 3BJOA 1O7FA 4ESJA 4JBAA 4O5VA 5E1XA 4I0BA 2OQGA 3CUQC 2FMLA 1W7PB 2PQ8A 1J7KA 1MKMA 1TLHB 2CQKA 3VEPA 4DNCA 4ENNA 3LA3A 4OIQF 4IRIA 2Z9OA 5LHIA 1P92A 3EETA 3SFZA 1H0MA 2QVOA 3ECHA 1YTYA 1TQPA 4A0YA 1YG2A 1Z7UA 2STWA 3W6KB 4TV7A 2QZ8A 4RS8A 1ON2A 3ZPLA 4IHSA 3V7CA 3GWZA 4EQQA 3MFKA 4AIKA 3SHFA 5CVJA 3HRSA 2F5CA 4A6EA 1J59A 1C0WA 3OOPA 2MA3A 2PJPA 4LK0F 3KLNA 2EFWA 3VOEA 4CICA 3C1DA 4MQ9F 1ZG3A 2W25A 4GO1A 3ML6A 1UHMA 1R1VA 1J9IA 3QU3A 2M87A 4E70A 1ZRDA 2V6CA 4L18B 2A3SA 3JAMZ 4Z2YA 1JXSA 1R5GA 3DPLC 1K6OA 3QP5A 1XN7A 2Z99A 1B4AA 1S29A 1LEBA 2W57A 3GFMA 2L02A 4RB1A 4P9UA 2PG4A 1XSXA 3MZYA 5DUIA 4EV0A 4ZYDA 2IA2A 3I58A 3FZVA 1ZHFA 5FLXK 1ZN2A 3WGIA 3WE3A 1U2WA 2MC3A 3GEZA 2BEOA 3ECOA 4A0XA 4Q5SF 1NHAA 1S3JA 2IJLA 5JHUA 2L01A 1VTNC 3VODA 2O3FA 2W24A 1L3LA 4CZZA 1HSJA 3RDIA 3T0YA 3M8FA 2VXZA 1HKQA 4U7BA 3VB2A 3WTYC 1D8JA 3KLOA 5LHHA 1HXDA 2XAFA 4AWXB 3TO9A 4HX4A 3F8CA 4L9TA 1U5TA 4ZZDA 1HSTA 2F2EA 3GX4X 3QRFF 2GAUA 3HSEA 4WX9A 3KEQA 1Z9CA 1B9NA 2G7UA 5L3GA 1G3SA 2PBIA 1SFEA 3BY6A 2P6TA 3V8KA 2QQAA 3G73A 5E17F 2MH2A 2XUBA 1D5VA 1SD4A 1K79A 2FA5A 5ED4A 1I27A 3KP5A 2HQRA 2YU3A 2RKHA 4UNOA 2KRFA 3L2CA 4H0EA 1U78A 4BAYA 5L3CA 3K1MA 1QGPA 4I02A 1ULYA 4BNCA 2NS0A 2OBPA 3R60A 1LQ1A 1S8NA 2K4BA 4U88A 2EA4A 1B59A 1RI7A 3K2ZA 1OYYA 3ERED 3E6DA 2EV5A 2FBIA 3AAFA 2VBXA 1QZYA 4HYEA 1W5TA 2AXLA 2XKOA 2OA4A 4CGZA 3P9IA 2ESNA 3HHHA 2HR3A 5FFXA 3WGHA 1K78A 5JVTA 3W6JB 1I1SA 4YFKF 4HOBA 1FWZA 5ICFA 2ZCWA 4M6XA 5L3FA 3GLXA 1L0OC 3ROUA 1J2XA 5BMZA 2FBHA 3RTRA 3GFLA 4HV6A 5E8IA 1YW8A 1BI2A 2NYXA 5HLHA 3E6CC 1ONVA 2MH9A 5HVQC 1UCRA 3F6VA 5CYVA 3ZMDA 4NQWA 2JSCA 3V8LA 1FY7A 4KYWA 3R0AA 1R7JA 1FBSA 1PP7U 2XAQA 2XAGA 2VC0A 5DCMB 4MEXF 4M71A 1HKSA 4M74A 4I98B 4G7ZF 3FXQA 2IRFG 3SZPA 3FMRA 1MJBA 4HAMA 5ICCA 2EA2A 1XCVA 3MEXA 2R7FA 4UVAA 3CUQA 1DPUA 4S04A 2QQBA 3Q5FA 2ZMEB 3U1DA 3RYPA 2P7VB 2RDPA 3I53A 4HDVA 2QBYB 1KQ9A 3J80K 1IXCA 5D5UB 1T6SA 3HTUA 2UZKA 2MLGA 3HYIA 2LDUA 1XMAA 4D0PA 2PEXA 5JFRA 5HDNA 4A12A 5K5RA 1TTYA 3WTVC 1WWXA 2ZBKA 3L09A 4I01A 2H09A 1Z6TA 2H6CA 1IAWA 2FF4A 3WG9A 4GCVA 5ERIA 2OU2A 4B09A 5JR3A 1R36A 5LLQA 1SD7A 2HYFA 3QU6A 3M9AA 5HLGA 2HEOA 4M72A 1BJAA 5D8LB 5IT3A 4EM2A 4RGRA 1ZAOA 4XLNF 1T0FA 3ZMUA 4UV9A 1U5TC 3E6BA 2WV0A 2QENA 1ZYRF 2DPDA 3OV8A 3T8TA 5EEGA 2LKPA 2YX7A 2ZKZA 4OOIA 3P7NA 1FLIA 3HRUA 4ETSA 2YPRA 1R1TA 5E20A 3HHGA 2O0YA 2XRNA 4LMYA 1RUOA 4KMFA 5BS6A 2KJCA 1GXPA 2RV8A 4FX4A 4LG0A 3P9KA 1Z91A 1JHFA 2GIVA 3MCZA 1LVAA 1EV7A 2RNJA 5CVRA 1O3SA 1ZG5A 2DAOA 2JPCA 4XSXF 4HF2A 3V7SA 4LLLA 5KVRA 2M8EA 2AS5F 4YIFA 4UXNA 3ZMVA 5E18F 3CJNA 3HRMA 1IW7F 3TDUC 2E1AA 2XASA 1G3TA 4BQAA 1FSEA 3F23A 2VOPA 1OYIA 1BBYA 3GFIA 4ON0A 4OIPF 1STZA 3I5UA 4EJVA 1SFUA 3ISPA 2UXXA 1DUXC 3GF2A 2ADUA 5D5XB 2H94A 2L4AA 2Z4PA 2CWEA 1O3TA 2F5DA 4LGWA 3G3ZA 1BIAA 3C3WA 1DPRA 1WI9A 3F3XA 2BYVE 5BOXA 4ZZLA 3O2PE 5IT9Z 4RB0A 1XSDA 3FHZA 5HLIA 4Y15A 3O6BB 1O7LA 2NNNA 1UFMA 3GUDA 2Z3YA 2DPUA 3E6MA 2JPBA 4IF4A 3KCCA 1J75A 1HW5A 2VT3A 2XVCA 4WXDA 3R0JA 3V8JA 1QPMA 1Z05A 2L4MA 5HDKA 2VONA 2FU4A 2PMUA 1FNNA 5ICEA 1MJAA 2LF7A 3PQKA 1BI0A 1YIOA 1KQ0A 3I71A 1HQCA 4IXAA 3LA7A 1ZREA 4RB3C 3PQJA 3I59A 5IT9K 1GVJA 4IJAA 3RPQA 3DF8A 1YLFA 1U5TB 3P9CA 2VBZA 2QWWA 2O6GE 3TKYA 3EYYA 2EJRA 5A2QZ 1QNTA 2DQLA 4AIHA 1O57A 5TJJA 2HTSA 3GYHX 3LA2A 3WU1B 5BPDA 2RVCA 2LF8A 3E3VA 2WC2A 2E1NA 3J81K 3RIRA 4IRGA 2FMYA 5FFZA 3I64A 5HS7A 2STTA 1IXSB 2P5KA 2UXNA 2FRHA 2TDXA 3BPXA 4EJUA 3VFZA 1TQMA 2VC1A 3NRVA 1T38A 5BQTA 3T8RA 2FQ3A 2K7LA 1V4RA 3TO6A 4L9NA 4U0VA 1B6AA 2LSOA 3R61A 1EH6A 1TNTA 1FT9A 2HQNA 2P7CB 3B02A 3L00A 3HSFA 3GO5A 2A5YB 1IXRC 2HZTA 1XDSA 2DQRA 4Y13A 1FX7A 4KDPA 1WQ2A 3WTUC 3I59B 2VOOA 3COAC 1BC7C 2ZXJA 3NQOA 4WF2A 2JTVA 4EMSA 2A69F 2R7DA 4MEYF 1HKTA 2JSXA 5FB2A 1K78B 3EYIA 3M7GA 3CO7C 4HDUA 1FYMA 2D1VA 1CGPA 2V1UA 1ZGAA 2JT1A 4AVPA 4KT5C 1R5HA 4FX0A 4NB5A 3K1PA 3WU0A 1KYZA 1LDDA 1AWCA 1YYVA 1TW3A 2FXAA 1XCBA 3KP3A 2G7HA 3I4PA 1LDKB 1G3YA 2J5PA 3MZHA 2PN6A 4EJWA 4A5NA 1LB2A 1PP8F 3HRTA 5HS8A 2EFPA 1OKRA 1YQAA 2BBYA 1XD7A 4GGGA 4LK1F 3RKXA 2FOKA 1XB4A 1Y0UA 2P8TA 2PMHA 5H20A 1P4XA 2F5FA 3IRQA 4PGHA 1P6RA 4WXHA 5LGTA 2QM3A 5J8CA 1F5TA 2EFOA 5FO5A 1MDMB 3FF5A 4WXCA 1BN5A 4P96A 3BDDA 4IPAA 2CYYA 2DW4A 4UVCA 4CDGA 3IKTA 3B73A 1LEAA 1F1ZA 3CTAA 3FXUA 2GQQA 1S7AA 3WTZA 1YFHA 1F9NA 2R3SA 3IL2A 4ZYEA 4EJTA 3DV8A 2ZNZA 2CW0F 4HBLA 3HOTA 1JGSA 2RC4A 3H92A 4R79A 2PLYA 3IWFA 4HV5A 3F21A 3BP8A 2CSOA 3I54A 5LHGA 4LG0B 2EK5A 2GA1A 4PZJA 2OZUA 2ISZA 4KICA 1BI1A 3IHUA 2Q8KA 3HUGA 3J7AO 4K2EA 1MJ9A 2W85A 3L7WA 4U7DA 4L9VA 4IVNA 2UWMA 5D6FA 4ESBA 2QUFA 4HLXA 4S05A 2ISYA 2VBWA 4L0YB 3K9TA 3V7RA 1G4DA 1EH7A 1SMTA 1BM9A 1B1BA 3T1BA 1P4WA 4CO8A 5D4RA 3RJPA 4YFNF 3CO6C 1FOKA 4M9SA 1KU3A 1I6XA 4FHTA 5ILUA 2DLLA 5CJ9A 2XGXA 3TQNA 2E7XA 1FYLA 2PI0A 4EM0B 1YW7A 3CLOA 4I0AA 1OPCA 3DPTA 5DV5A 2B0LA 2V1DA 3JTGA 4GYGA 5F64A 4LD5A 1FP1D 2EB7A 4WCGA 3IRRA 4G94A 1B9MA 1KU9A 2GWRA 5DUKA 4F7ZA 2FBKA 3K69A 2A07F 1FBQA 4B8XA 4I2OA 3U2RA 3WTXC 3KZZA 4M9XA 5JI6A 2M1BA 4O6JA 1KU2A 2HS5A 3H3ZA 5D8KB 4HX8A 1IF1A 1EH8A 2DT5A 3ZMSA 2IVMA 2MBFA 2X4HA 3WTWC 4GYIA 3JW4A 3J80Z 3F8BA 1TQIA 4HQEA 5LBQA 4QLCU 3IKVA 2IP2A 1S7OA 4IHTA 1KYWA 1U6GA 2RGVA 5DEQA 2W84A 3IWZA 4N9HA 2FEZA 2IA0A 2ZO4A 4EM1A 1XGOA 4Q48A 1H9GA 2FNAA 2VN2A 2P6SA 4HF0A 4L0ZB 1W7PA 5EEHA 2KJBA 1BOAA 2O03A 5ILSA 2ESHA 5DD4A 3TGNA 4BHPA 2XIGA 4YG2F 4G8XA 2Q0OA 3WTTC 3E5QA 3Q9SA 2ZBCA 3DFGA 3LWFA 2Q2EA 3LQQA 1IUYA 2RQPA 3F8FA 2K02A 3DP7A 1UB9A 4KNYA 2ZFWA 1ON1A 4RGXA 2DFIA 1ZRFA 4O3MA 1Q1HA 3EDPA 3NEUA 3GVAA 5H6QA 3WODF 1R22A 2OD5A 1SAXA 1IRGA 1WKMA 4HQMA 3QOPA 3Q9VA 3KP6A 2ZJ2A 4LFUA 5LEKA 3GXOA 2JZYA 4LB6B 1USTA 3TO7A 2HGCA 5D6EA 3FMSA 1T39A 3IC7A 1G3WA 4CXFA 1IN5A 1FC3A 2QBYA 2CO5A 1AOYA 3M8EA 1O3QA 1REPC 2HDCA 1ZH5A 1FP2A 3ZP5A 3RKYA 2XKPA 4WWCA 1XDUA 3F22A 1USSA 4KFCA 3ZMZA 2ACJA 3KP7A 2RN7A 2XROA 2O61A 3RKWA 4R1HA 4DQ2A 2YR2A 5DCMA 3FX3A 4KIFA 2ELHA 3BZ6A 2EFNA 3GZ5A 4N0BA 3BWGA 2QYOA 2G9WA 4OIOF 3S2WA 1ZARA 4I7HA 1R1UA 2O8XA 4OIRF 1WSUA 1G6NA 2ZMEA 2KIFA 4A6DA 4AD9A 2L3DA 3ABTA 1CF7A 5F1RA 3E5UA 4AIJA 1XGMA 5AIPA 5DD8A 5DYMA 3TDZC 4LB5A 4HX7A 1XMKA 1CF7B 3FM3A 1DDNA 4RAZA 4G7OF 2GA2A 1K7AA 2QQ9A 2MLKA 3D0SA 1KQ8A 5TRDA 2ZNYA 3GFJA 2H27A 1U3EM 3FMQA 4M6YA 3LAJA 2EWNA 2FNPA 1P4AA 3GZ6A 2OAZA 3KP2A 1KA8A 4KN4X 4U0YA 3LFKA 3RPUA 3CUQB 3L9FA 1FPQA 1YS6A 2C6YA 1FSHA 1DP7P 1QQIA 5AIQA 5F6FA 3FM5A 1RIOH 2M5WA 4JK1X 4KA4A 2A6EF 2KIUA 2XAHA 1ZLKA 3R6SA 4FT8A 2VODA 3F72A 2DU9A 1TNSA 3LQRA 5HS9A 1HW1A 4MHGA 1WRJA 2ETHA 4LLNA 2BE5F 1ZG1A 1GXQA 3JSOA 4EGZA 3BJ6A 3K1NA 4JQFA 5J8FA 5K1YA 4QWQA 3TOAA 1P2FA 2VBYA 4OMYA 4RGSA 2HKXA 1PUEE 1ODDA 1I1GA 1HW2A 2CGPA 1ZLJA 1KGSA 3QPHA 3PFIA 1JHHA 2E7WA 4HF1A 2K4JA 1I5ZA 4ZYGA 1YW9A 3JAMK 4KN7X 3N4MA 4MTDA 1D3YA 1IZ1A 4UVBA 2L54A 4GXOA 4BYYA 1MGTA 4KIGA 1IN4A 4MGRA 2Y0MA 2GXBA 1XGNA 2Y75A 4Y17A 5LEJA 1BC8C 2P5VA 5LRRA 4U0WA 3FWEA 2Z33A 4M9ZA 3ZMTA 3KFWX 3T5XA 5L3EA 5CVIA 5E1WA 3ULQB 2KIMA 2NNYA 4PCQA 3ELKA 3I0TA 3MWMA 2YSRA 5L3BA 1S6LA 4L9JA 1O3RA 1MDMA
chains in the Genus database with same CATH superfamily
3CCES 4K4UA 1NXIA 1CVJA 2IA6A 2UV8G 3F6OA 3J7ZT 2XEXA 1IV8A 2M8DB 3RZOJ 1NJIT 3KHRA 2OUGA 2CQIA 5GAHJ 2Y8WA 4AYBD 1IWGA 2XG8A 1CQMA 1R23A 3BKTA 3BPDA 5KK1A 1EF4A 2D7SA 4KUMA 4B3OB 4A8MP 5JHFA 2VJIA 4ALZA 3C6TA 1FTRA 2M45A 1BR1A 3ZQQA 2RDIA 3WC0A 4ELVA 1LJ9A 1EZZB 3RAXA 2ROPA 2B51A 2EC0A 1U1LA 3CDHA 5BPIA 2RIJA 5CVVA 3GR1A 1VQ8S 2CZ4A 1W25A 4G1QA 3BTJA 3IV5A 3LFUA 1X5PA 3MR7A 4U95A 5A8WB 2M7AA 2IM2A 1FKOA 1CS4B 2DA5A 1DURA 4ASNA 1SD5A 1OR7A 2B4VA 4MLOA 4G6DA 4CYDA 1X2NA 4DN0A 1YI2I 3FBEA 2HS0A 4ENKA 2V4RA 4OX6A 1QZZA 4GFBA 4OYZA 2CXEA 1UHWA 3IG1B 4G7HF 5HP1B 2WY7Q 4Q0BB 2FE3A 2QL9B 5C2GA 2XMWA 4ZVSB 1IRFA 2GXGA 4K7QA 4CLFA 1XSVA 2NRAC 4HACB 3BGOP 5KOXA 1BE4A 2XGEA 2WW4A 3H5SA 3BPSP 3TO8A 1VIXA 4YFXF 4HNTA 2MGZB 2Q1LA 3I0SA 2B9EA 2UUCJ 1SFOJ 3IXQA 3OV7A 1VQMI 1EARA 1RT5B 1R00A 1MWZA 2GAHC 2ATCB 3KETA 1DTTA 2BE2B 1UELB 4IRKA 3CF5F 5HANA 2VD3A 2WONA 3R7SB 3SXYA 1RT5A 3O2IA 1TBXA 2RAEA 2VQLA 3AOBA 3KG4A 3ERMA 3LANA 5TGTA 1O0PA 3I5CA 5F9NA 2R9LA 3PIPQ 2D2WA 3E5XA 1RT2A 4P9FA 1VFJA 3HSRA 5LGNA 1JXEA 3OFFA 1SC4B 1FE0A 1YBAA 4DYRA 2W2OP 3SEQA 1LDJA 1T9XA 1G2HA 1YO5C 3KE2A 4ZPTR 5A0YA 4YFUA 2G13A 3T1HF 1A04A 5GTHC 3C6TB 1XTZA 4DV6J 3DXJF 4X0GA 1ETXA 2BHZA 4J00A 3DMJA 4ICLA 2YNHA 4XPEA 4HA8A 2BV6A 2VKRA 1NZ8A 1HNIB 1MMAA 1F2GA 3K0LA 5H6RA 3FEZA 3HD2A 3TX0A 2DTRA 1IKWA 2HTJA 4OU0A 4LFAF 5A8WA 4OHWA 2IVFB 3FCHA 1M5PC 2VPRA 3TOBA 4CCNA 2COMA 3R3TA 3J7YJ 3U9GA 1IQZA 2PIIA 2A68F 2Y1RI 5IYCJ 3CGIA 1WC3A 2IFXA 3MTKA 3FDSA 1Y5LB 4M63A 1EP4A 3AKZA 5DDGA 4RW4B 2Y2ZA 4IOAQ 2KM8B 2NVUB 1QBJA 3ZQGA 4UHTA 3QO9B 3ILOA 1Y0HA 4HKQA 3P8BB 2D45A 5CLSA 4P10A 1MIJA 4M73A 1D0ZA 2X6YA 2VE9A 3ULHA 3A1YG 1YE9A 3ZXWA 2WADA 4IOBA 5J1YA 4EGYA 2DK8A 2CS3A 4XKBA 1IKYB 1E3PA 1XNQJ 3H3UA 4M3BA 4H54A 4MIAA 5EG0A 4ID8A 2TRTA 3IWNC 4I7FA 2XGPA 2V94A 4DUZJ 1A6IA 2QEXS 1VQ9S 4QQBA 3UKGA 3GJRB 2YX4A 3GYGA 4ID5B 2LFVA 4X1EA 4MTEA 1FOWA 5ILVA 3OYAA 3GTJJ 8RUCA 2OPRB 2M7BA 1VRUB 2VT2A 1FZPB 1HL6A 4J9MA 4EVIA 1CJVA 4BDPA 4QPOA 1Q7LB 4CYUA 2DR8A 4OX7A 5F8MA 4L5IA 2BW2A 3DBRB 2E1CA 2N4DA 1Y10A 1PUFA 2VE8A 2FJBB 2CQPA 4OINF 1UEKA 4ED4A 2DR5A 1VQ7I 1Q82T 4P5OA 5GAHU 3M8YA 1HQUA 2MKYA 1HR0J 1XC5A 4ENMA 4W1UA 2P9GA 3KOAA 4JI4F 2DBBA 4ZH4F 1U0HB 5CVUA 1FKPA 2QCOA 1Z0XA 3OYMA 4YIIA 1ULRA 1YDLA 2AGPA 3KLFB 1WC4A 2UU9J 2L5QA 4A3GJ 1Z2LA 3GJSB 4XIDA 4JI5F 4UY85 3KLEB 1HYSA 2F5EA 3GZ7A 3WX8A 2HZDA 2OCCH 4DV1J 2MSYA 1EKEA 3C8YA 4Q8FA 1FBUA 3SDEB 4PR6A 4NI2A 4ZC3A 3H5YA 1SJ1A 4ZVHA 3TP3A 1UVNA 2K9NA 1TKZB 2UUCF 2GCFA 2OPRA 3ZQ7A 1P7JA 2DIUA 5A2QK 2XAJA 4M3EA 3BPVA 1T3OA 4QSHA 4HNUA 4BHCA 2H4YB 1QY7A 5LRSA 3CDWA 4WIQA 5L3DA 4PKDB 2YNFA 3PG9A 3C7JA 2EZIA 2IA1A 1J0RA 3GW2A 2W00A 4WFXA 1ETKA 1T11A 3BJOA 2OPPA 3OBIA 2M5YA 1HDPA 2N4CA 2DR9A 5IV4A 2KHMA 4LF1A 3FCVA 2OQGA 2NXJA 4JOMA 1W7PB 2PQ8A 4YP3A 3M30B 4ZN1A 5C24B 3P5JA 2HHHF 1FDDA 2PMWA 2PEHA 3BF4A 4IRIA 2G0CA 1UW4A 1N5YB 3DLBA 2NVTJ 2DA1A 3K4MA 2EFGA 3E51A 2Y9ZA 1TQPA 3Q8RB 5KG3A 1S1WA 2D69A 1ZQ3P 2A5WA 4H4MB 4XKCA 2KL8A 5HODA 2STWA 4Y3OA 3W6KB 2JNJA 2DRAA 4B9MA 1ON2A 4W98A 1WHVA 4K5SA 2XMJA 4IHSA 5KNLA 2HK2A 3SHFA 1X1BA 2CPZA 4FYVB 1PO6A 3HRSA 3HUGB 3GTKJ 3OOPA 4XRSA 1LFWA 5ETLA 2JVOA 4M5DB 3VOEA 5J2QA 3C1DA 4I2PA 3NARA 4JYKA 5B0FA 5J40A 2E9ZA 1ZG3A 1RDRA 3D6MB 3HVTA 2W25A 1GXLA 2UXBF 3GCXP 4YR3A 1LW2A 1J9IA 4A8OA 2M87A 1JLFB 1JKPC 1XJWB 1T02A 3DOKB 1U2CA 1JXSA 2FDNA 4X65J 3HF5A 5A0YB 2OJED 3QP5A 1K6OA 5KFNA 2MKSA 2DN0A 4X2BA 4I69A 1D0XA 3LP2B 2YBVA 3JSMB 3R6LB 3W60A 4AU7A 5DDRC 1A31A 4RB1A 5JXSA 1RR7A 3I55S 2EEYA 4ZYDA 3G6ES 4ECUA 4ANDA 1N77A 2Z0GA 4YB7A 2ADBA 2ZVSA 2QF7A 4BWMA 5FLXK 4UOFA 4MFBA 3N79A 2ILYA 4D5FA 1WC5A 1IO2A 1U2WA 1IRXA 4CLSA 2BEOA 1WEXA 4A0XA 3JQMA 1NHAA 4F04B 4CZCA 1E6VB 2V8PA 1G4CA 5JHUA 2IIHA 2L01A 1F5AA 2W24A 5H9EJ 1HSJA 4WFNQ 1U8WA 1HBOA 3T0YA 2N3LA 5KFXA 2EC2A 1Q1VA 4CQ1A 4F52A 4U7BA 3VB2A 1U1KA 3DDNA 5J1NA 1HXDA 2XAFA 3AG4H 4O0IA 1IBLJ 1UWBB 3CCUS 2IVYA 1TL7A 2XTJP 3BO2A 4FP9A 4NLXA 2FVSA 4DSEA 1KNZA 2B6AB 3LGNA 4BACA 4P2XA 4ZZDA 4H4OA 4CTAB 1AYEA 1HW8A 1S1UB 2G7UA 2PJRA 4EGLA 2PBIA 3H0DA 3D4JA 4LF7F 3L7UA 3V8KA 5K8PA 4A3KJ 2CQ7A 3GG0A 2RQCA 2MH2A 4EEYA 1D5VA 4PJNA 5AXNA 2ZBRA 1K79A 1LE8B 4YR0A 4G12A 2K8GA 2ZE2A 3L95X 2HQRA 5DLGA 2RKHA 3L2CA 2RRAA 2M2BA 2H3EB 1FVSA 3VR1A 4OYAA 1TWGJ 3FK4A 2KG1A 3K1MA 3K7AJ 1QGPA 1U9NA 2OTLS 3F56A 4BNCA 4I68A 3R60A 1LQ1A 3PJ9A 1JLGB 1S8NA 3AG2H 3JCUC 4WZQA 3GTMJ 1RETA 5HVGA 5CCLA 4F4ZA 4BJTA 1ITYA 4B3OA 2WTFA 3ERED 1EKSA 4JI3J 3SCKE 2IM0A 3EPIA 3CCLS 1K6YA 1NMEB 1QZYA 3BEGB 2U2FA 1HW9A 4K4YA 4D9JA 3G2BA 4NEYA 3ISZA 4CGZA 4X64F 4TU8A 4MYUA 2R7VA 4TY9A 2XWYA 5J3LA 4CLLA 2HR3A 1JUPA 2WAQD 5FFXA 3M9MB 4KB7A 1XNRF 5JVTA 1CJTB 2OD6A 4A69C 2ZSIB 3W6JB 4ZJOA 4QYZJ 3FISA 4LSLB 2R7ZJ 1I1SA 5CXTA 2CQ4A 1LW0B 4TN2A 5C4JJ 2V69A 1FWZA 3HOUJ 1CG2A 2OPSB 1Q53A 1P7IA 1TZLA 2G2ZA 3BQ1A 1J2XA 5IWAF 4WK1A 4HV6A 2MQ8A 2RQQA 1IR0A 4IQMA 1NK8A 3IAS2 2RREA 4PG4A 2ZD1B 5KFLA 3E6CC 3D1HA 5DM6Q 2WVBA 4NQWA 3L1PA 3FZBA 4BC7A 2AO9A 2WK4A 4DV0J 1PBUA 2GFFA 1TL1A 3MM9A 3JTOA 2UVUA 4CRJA 4AXIA 4LF9F 1RTZA 1URNA 4DUZF 3KLIB 4MEXF 3R8YA 1BC6A 1SH2A 4B3MF 1HKSA 3EGWB 3CB4A 4G7ZF 3A12A 1NKCA 3FXQA 1TQLA 5AE1A 3DEWA 2OTJS 3FMRA 1SCJB 3C46A 3QIPA 1MMLA 2VG5B 3CUQA 3CCEI 1DPUA 4S04A 2HURA 2ZWPA 2QQBA 1OCZH 3OSNA 1URRA 2ZMEB 5F27A 4GO5X 4NA2A 2RDPA 3I53A 1F9EB 4MKVA 4P2MA 2UV1A 4HT5A 2MLYA 4AD6A 3PW5A 2PMZA 5ETTA 5F8LA 1LWXA 5IM0A 3R1HA 4QR2A 1T6SA 2B5JA 1CBKA 2LDUA 5E3NA 1B8IB 2PJRB 2AT1B 1XTAA 2CJKA 3KEYA 2FYXA 1TTYA 3CCQS 5IOLA 3WTVC 4GKKF 3H2UB 5EWGA 5GAHI 2B6AA 4JI1J 2R4FA 3L09A 1N48A 4I01A 3HHEA 2H09A 1Z6TA 2H6CA 1HBMA 5IT4A 2ZJPQ 5ERIA 4F7VA 2J8AA 5HP1A 5JR3A 5LLQA 1GH8A 1MMNA 1C0UA 1FWPA 2DCUB 3TUZC 2V50A 1WF2A 2CPFA 2CUFA 3BSCA 5IT3A 3J7YU 2QV6A 1VC5A 2B43A 4RGRA 1ZAOA 2RRNA 4RUAA 4K4TA 1T0FA 3ZMUA 1IDZA 5FKKA 2CQHA 1ITPA 3IS9A 4PSXA 1U5TC 2MQMA 4BGDA 1Q79A 2XI2A 2V68A 2QENA 2QKMB 2X1GA 4CO0A 1MNEA 1SVDA 2DPDA 3OV8A 5EHHA 3M32B 2ZKZA 2KZZA 4LF7J 2CAJA 4EATA 4DPOA 2YPRA 4ZHRA 5F8GA 2X1CA 2GGPA 2FZKB 4F26A 1HD0A 4XM3A 1NJXA 4DR6F 1TKTB 2LMIA 2KG0A 2XRNA 1EKRA 2HQDA 4B9VA 4ECSA 1RUOA 4PYAA 1S4EA 1T9WA 5BS6A 2W1OA 3LSKA 2KJCA 1TT5B 2EBIA 1AUDA 3QNWB 1TUWA 3RW6A 2EKYA 3MEDB 2L7KA 1JHFA 2QMXA 3CLQA 3CJKA 3LO3A 3S17J 2M34A 1LVAA 1DJ0A 3CMES 4V19J 3KLFA 1EV7A 2Z8QA 5CVRA 3MXHP 2DAOA 2JPCA 1WI3A 3V7SA 3DTKA 4RBOA 3JAMY 2QMWA 3HRMA 1TZ0A 5DO2A 1NH7A 4H4MA 5DLFA 1U49A 3CJTA 4K0KF 4BQAA 4QW9A 2MTLA 3JRAA 1S57A 3UE2A 5E3MA 4URSA 4NL5A 3TA1A 2C2EA 2IBDA 5EDWA 5F41A 4OIPF 1STZA 3PEHA 4EJVA 1HBOB 2OSRA 4AL7A 4PPDA 4C0OC 2ADUA 2H94A 2L4AA 2Z4PA 3PJWA 2AIRB 1WKLA 2JEIA 2XGDA 3FNNA 1I94J 3HB9A 2JA2A 5E3RA 1MMGA 1FOYA 1Y4ZB 2IDLA 4LGWA 4FPRA 2GJIA 3C3WA 1KFSA 1S79A 4XIUA 1KQSR 4F3OA 4RDUA 3O2PE 2M8GX 3D2WA 3POTB 4JI2F 1XSDA 3F9KA 2VJUA 2HFUA 3CESA 3KG1A 1M5KC 1WSRA 1WEZA 2JPBA 3TARA 2XSJA 4M3DA 3KCCA 3THTA 1NK0A 3ZCOA 2XVCA 3X1LB 3RBXA 1QPMA 2RE1A 4M94A 2L4MA 3QWUA 1FNNA 2IPOB 2DGQA 3GP9A 3PO4A 1MJAA 3OYLA 3PQKA 1BI0A 2R8HA 3K5NA 3GQCA 2RS8A 4J9UE 1FJGF 3U7JA 2HDDA 4V19X 3CCSS 3C2BA 1GVJA 5EGOB 5K5MA 3RPQA 2HHQA 2LQBA 2EINH 1MMDA 3LSGA 2POKA 3HVWA 4RW6B 1MBKA 5K7ZA 4AIHA 2H5JB 2HHVA 1O57A 2MD0A 2GIZA 5IOYA 3SSRA 5JVHQ 4PXCA 4UF4A 1JGGA 5B09A 3IH3A 1ENHA 3FQKA 2GW8A 5KFZA 1QUVA 3VGUA 5KT7A 2F4MB 4HDGA 4OYIA 1ZZNA 4X66J 1EA3A 4P72A 4DF8A 2A10A 3W3SA 3H90A 3MF5A 4K4XA 4OYXA 5J4VA 4A46A 1FFWB 4IRGA 2MABA 2FMYA 4IG0A 3ADAC 1UCNA 2DKOB 5FFZA 2ZXWH 3DXBA 2STTA 3UDLA 1HA1A 3SMZA 1X4FA 3W2AA 2HQ5A 1Z21A 5B1BH 3CUNA 2XY5A 1OQ6A 5SUHA 3PYDA 3JREA 1T38A 3QRQA 1RWNB 3T8RA 2C42A 1S1VB 2AZ1A 2VU5A 4FZVA 1HWJA 3G86A 2Z56B 2EBEA 4L72B 3TO6A 4L9NA 3GE9A 5GMKa 1RE1B 1B6AA 1JJ4A 2GBYA 2DNPA 2LMDA 2LSOA 2UUTA 1H0HB 1FT9A 4G1IA 1LWCA 4XMYA 2HQNA 1Q8KA 4A8KA 2P7CB 3L00A 3GPAA 2ZH6A 1ACIA 3ZGKA 4L76A 1IXRC 2VG6B 2LOOA 4Y13A 1WQ2A 2DMNA 4J9OA 3COAC 3IG1A 4IO1A 5HQMA 3G6EI 2R7DA 4MEYF 4A3FJ 3FKIJ 5FB2A 3M7GA 4USKA 3CP2A 4O44A 3KPHA 3K4NA 1X4HA 2AYMA 2LXIA 1ZGAA 4XKWA 2YNHB 4Q7AA 1VHIA 1N5TA 4C8YA 1R5HA 3K1PA 1VRUA 3WU0A 3MECA 1LDDA 2GIQA 4Z7CA 2FGCA 1TW3A 4DJBA 1I39A 2V2VA 2XLIA 3KP3A 2QT7A 1R0BG 3I4PA 1FMWA 2MKIA 2DFHA 1G3YA 2W4CA 1FO1A 3FUYA 4EJWA 1WI6A 2IJRA 3A02A 1W5CC 5HS8A 2NVXJ 3H0GJ 5EYRA 2VQCA 3M6UA 4GGGA 4LK1F 1F9FA 2COLA 5KTQA 2P8TA 4J9SA 4EBEA 4WYWA 1FWLA 1SIZA 3K6GA 3PO5A 2F5FA 1VMBA 2DR7A 4WXHA 5LGTA 5J8CA 2EFOA 5FO5A 1X4CA 1IBLF 1KRPA 4C8LA 4QWAA 3RGIA 2Y31A 3GIKA 4UT4A 1UAAA 4AL6A 3BDDA 4XPCA 4MKAA 2CYYA 4LFCJ 2EILH 2FJ1A 3HX9A 4CDGA 2G0JA 1S7AA 5KFDA 1PYSB 2CQNA 4U7UD 2EKNA 2O01C 1F9NA 2H8WA 2R3SA 3IL2A 2R7OA 4ER8A 2F63A 3V4IA 1VC6A 3G8SA 2SXLA 2ZNZA 3Q83A 3LP1B 1WKKA 1JGSA 4P74A 5C25A 1HNVA 3F21A 2CSOA 2HKEA 3S7RA 4ENOA 3NG8A 2EK5A 4NE9C 1JXLA 2CDQA 3VWBA 1S6QA 2GA1A 4PZJA 3HG9A 4I0WA 3SSQA 2CFOA 1IDYA 3CJ3A 4LVOP 2F3JA 1R4NB 3QPSA 1HQEB 2RAQA 3PV8A 2HNZB 3A3PB 3CJ5A 2XMVA 4UB6C 3VSLA 2OAUA 3U27A 2CQQA 4AQYF 3UW1A 2ISZA 4KICA 3K4KA 1HMVA 4K2EA 1MWYA 4ICLB 2FLPA 1V5VA 4G1QB 4KY3A 1UPMB 4JV1A 3MZIA 4LOCA 2UWMA 2J7WA 1J09A 1RLDA 4F3MA 4S05A 2VBWA 4ZPAA 2L9VA 3TAPA 1I3OB 3CJQB 2NXCA 3BG6A 1Y00A 2KYXA 4ANCA 1EH7A 1B1BA 2KXNB 1P4WA 3TZWA 2R92J 3BGFA 3RQ4A 1FOKA 1UWBA 4M9SA 4JI1F 2JC0A 4OJHA 5F1JA 3X3UA 2HGNA 4ETXA 2YWHA 3BG7A 4XONA 1V5IB 1YJUA 1AA7A 4RAFA 1FK9A 2OI2A 2E7XA 1AU7A 1YBTA 3NAIA 2ZUAA 1YRTA 5DS7A 4ZCLA 3OSFA 3HOXJ 2HVDA 3HSDA 2XLKA 4KHRA 2B0LA 2DMTA 3ILLA 5LSOA 2V1DA 3JTGA 5GTIC 4DEZA 1QJHA 5F8JA 5F64A 1FP1D 4IDKB 3KXDA 2RUSA 4WCGA 3DBHB 4F02A 2K7JA 3SZGA 4DPWA 4Q2MA 3D5SC 1R0AA 2V1NA 1X9SA 1X9MA 2GWRA 4JV5J 2K7KA 3PIOF 4P7TA 3K69A 3R5BA 2XRLA 5M5YJ 3HI9A 1FBQA 4B8XA 2XHCA 3S15J 1AB8A 1X0PA 3U2RA 2YKOA 4M9XA 3CDLA 4DLGA 4PXDA 4PG8A 2Q66A 2N8GA 4O6JA 2BE7D 1Y1VJ 3OW2R 2J6SA 4NLTA 2AMCB 4PJMA 2YWEA 5D8KB 1NB7A 1X4AA 2PD1A 3TUPA 3ZXSA 4HVZA 2FHKA 3BN7A 2IYGA 2DO0A 3E7LA 3IM8A 5C5JA 2X4HA 3WTWC 2MEWA 4CT9A 2XF7A 1FEXA 4A8FA 4NLUA 3JQKA 4HQEA 4M5KA 1HNXF 3RCOA 4ILMA 3TNVA 1F36A 3ELHA 5A8KB 4HTIA 1S7OA 2BKNA 4ZN3A 1VQSA 1U6GA 3IAM9 3ONQA 3DYAB 4M95A 3HSZA 2QA4G 3IR7B 1XNRJ 2Z1DA 2FEZA 1P1TA 2IA0A 4EM1A 4BDYA 3MM8B 5D0EA 3I9ZA 2VN2A 1W7PA 4Y52J 1MN9A 2W8LA 5E7OB 5EEHA 4YUDA 1U8SA 2KJBA 4OJ3A 5ILSA 2DIVA 2AJ1A 3OTCA 1JLAB 2HNDA 3L7PA 4DV3J 4F92B 2E5LJ 2E44A 4R5PA 5KFKA 1A9NB 4QIFA 1UVMA 3E5QA 4HYKA 7FD1A 3Q9SA 1MLAA 2WAQA 3DFGA 1J5EJ 4L3KA 3TJ8A 3OMYA 4DSKA 5KFEA 4EK2A 2K02A 3DP7A 1DRZA 2B7BB 2ZFWA 1ON1A 1OIAA 3MM7A 3PUBA 3M2VA 3THVA 1OLTA 3CCRS 4RW8B 3ENQA 4G6VB 4CCHA 1UL3A 1GQEA 3QPLA 1SUQB 2MHEA 4F2RA 2JHEA 5I3QA 3EDPA 3NEUA 4CNYA 5E33A 1R22A 1SAXA 6FD1A 3GFZA 2KZMA 4A8XA 4YRVA 3JQJA 4XRSG 4IH6A 3QOPA 2LECA 1U2FA 1GX6A 2ZJ2A 4J37A 4LFUA 1Q78A 4C30A 2DT7B 2ATLA 1ERDA 1PCAA 5KFGA 4NXNJ 5LEKA 3PR4A 3QZ7A 4OL8A 3VYRB 1LKZA 2JZYA 1P8GA 2BW3A 4JX6A 4JB8B 2NOGA 4RLFA 2XMTA 1USTA 4NZ0A 1REVB 5EX0A 2XM3A 1V3RA 5D6EA 1IUJA 3TBIA 2MQPA 1HARA 1T39A 4FF4A 1WSVA 1G3WA 3QYEA 3FRZA 3BM7A 2JDJA 4OLPA 3CD7A 5I3UA 2E19A 1MH3A 3M8EA 2F9DA 2IBOA 1REPC 3CF5Q 3M4XA 4DDFA 2XF6A 1FP2A 4N4OB 3MD2A 3RKYA 2GHVC 1D1BA 3I32A 4WWCA 3F22A 3ZMZA 2K9SA 3ITHB 2YQ1A 4J90A 2RN7A 3EZ5A 5AJ3F 2O61A 3RKWA 2JA7J 3P96A 2AW0A 4OHZA 4DCPB 4H4OB 5CD4A 3U1NA 4DQ2A 5HQLA 5KFSA 2YR2A 3PXGa 4QIWD 4KIFA 1I94F 3BZ6A 3F73A 3TR5A 1VLYA 3H5NA 3LF0A 1T08B 2G9WA 2QJ3A 2LP0A 3L2QA 1RHMB 3Q0WA 1RHJB 4OI1A 4OI3A 1DARA 4U6PA 4UZBA 3OOUA 2W7PA 2UUAF 2IAJB 2UXBJ 4XQFA 5KOWA 2IM1A 2KZVA 4AD9A 2DEIA 3I0RA 2W9CB 1SAUA 3LW5C 4AIJA 2AX1A 4RAGA 2DPJA 3DCFA 4ANJA 4QIEA 1HHQA 2C1EB 3QLHB 5IP9J 3KYDB 5AIPA 3V42A 3EZOA 4BHQA 5CYMA 4HX7A 5K7HA 1CF7B 5HROB 3KK1B 2X1FA 1DDNA 4C8KA 1VDHA 1U6FA 4EU0A 1WVRA 2APOA 1KWMA 2NXEA 5D0GA 3HBLA 1FKAF 2A18A 3OJSA 3MM8A 2PMZD 1JLEB 1KQ8A 4IO9Q 2UUBF 3LPEA 1S5ZA 3L2UA 1NKEA 1P4AA 3GZ6A 3KLHB 2OSQA 3QJJA 3DU5A 1QLNA 2JFKA 4U0YA 1KLMB 1NK7A 2AXTC 2ZMEC 3S2DJ 3C6UA 4X4NA 3GYXB 4HRIA 2VJJA 1DBDA 1QQIA 2CADA 5GPAA 2F8MA 1N78A 1EETA 4E7HA 2M5WA 3BR3A 2A6EF 4RNNA 8AT1B 2XMAA 1A6LA 3RB3A 1ZLKA 2Y30A 3R6SA 3ISNC 1ZELA 3LOUA 2VI6A 3CNQP 4RO0A 4TU9A 2BDPA 2E2HJ 2J0XA 5DQGA 4DR1F 2I8EA 2HNZA 5LD2C 1VOMA 4OI6A 1PJ6A 1VQMS 4MHGA 5F0UA 3ET6A 3OXGA 1G1XA 1MBGA 2R8GA 4NXMF 2Y0SD 3D5MA 1OYDA 3BJ6A 3FXJA 2EPIA 4YHHJ 2BM1A 4LF9J 2HQCA 3HT3A 5J8FA 3VTIA 3PJXA 3EZUA 5LFAA 3HPHA 2E5LF 3C3LA 2VBYA 3T5HA 4CM2A 2KO1A 5DDOC 2C2MB 4NLVA 3K2AA 1I1GA 1ZLJA 1KGSA 2KT2A 2OPPB 2KFZA 3Q2TC 4XDCA 2E34A 1I5ZA 4DX7A 3JAMK 2D3OR 3ZR8X 5M2PA 5ETPA 2XO7A 4BLGA 4RLEA 3N4MA 3LSPA 4XK8C 1D3YA 1VQPI 2HQGA 2L54A 1NZAA 4MGRA 2Y0MA 3H7HB 2Y75A 1E6VA 1RT3A 4Y17A 1BC8C 3E8OA 1RXOB 2B9WA 4BBRJ 4UTGA 3FWEA 5FRMA 1X1PA 4ZA1A 1QE1B 1IV6A 5HJYA 1HI0P 2AJ2A 4G6TB 1QM9A 5E1WA 5HMZA 3B54A 3FVYA 1Y1WJ 4IYQA 3ULQB 1W36D 4B3SF 3G1OA 4N77A 2HWTA 1U09A 2X6WA 2ECBA 1NBEB 2MGQA 3N6NA 4OX9F 1R8AA 4I6AA 1NH8A 3H9GA 3I0TA 1AKHA 2YSRA 2BQUA 2O5DA 4L9JA 2QL7B 2OZ6A 1HA8A 3DLEB 1PKUA 3FRYA 4UOCA 3G71S 3CQZJ 2F5VA 2L48A 2DNOA 4L5JA 2GLOA 2E29A 2GO9A 3AODA 2FVPA 5FKMA 1ZA2B 4L73A 1FJCA 1R58A 3FMWA 2MD5A 1N32F 3DQVC 4HSTA 2UUWA 2MG4A 2D74B 2J7KA 4F3QA 1AFJA 1IUFA 5H9FJ 4PQUB 5J6XA 3KX2A 3MOJB 1P9QC 1RHUB 1MNDA 1T98A 1E17A 4DU8A 2BRKA 1UFLA 2NYHA 3J81Z 4V2GA 3EYZA 1L3SA 1IR2A 4XSZF 3KEOA 5ETQA 2IPQX 2C3UA 3CO0P 1HHTP 4OWRB 3PRVA 5ETKA 2QLFB 3N97A 1UJ8A 1X5TA 5AXLA 5B08A 2IHR1 2JLFA 4OZ5A 2HAFA 3QT8A 3KJNB 4FTHA 4USUA 5DCFA 4MJKA 2X51A 1FRLA 2NAZA 2FVQA 3DKWA 3CW2C 4HL9A 1VS3A 2XV4S 3O5TB 4A2UA 4UB8C 4XOPA 2DHHA 3QWPA 4O3NA 2NCKL 2EVZA 3UCGA 4M5LA 4B02A 3Q8VA 1QO0D 1UVIA 3JS9A 4DLEA 4DR1J 1WC0A 3P49B 4V19K 3Q8UA 1KQFB 5LGUA 1DLOB 4AUXA 1BIBA 4DUTA 1S0MA 3HKZN 1NDPA 3J7AN 4WK8F 4JI6F 2CFXA 2QSFA 4A48A 2DK5A 3MN2A 2KHCA 3M6WA 1K0VA 3WIVA 1WOOA 4R0EA 1LE8A 2EV6A 3GMGA 1RUNA 1NH3A 2YU9J 1PC5A 4I56A 3W63A 4RW6A 2V2ZA 3GTYX 4DV2J 4BH9A 1HIYA 3ZZRA 4R8HA 3H36A 2V1XA 4K4ZA 2L9SA 2V9VA 2XMKA 1RTIA 4BE0A 1VLOA 1D8YA 4HW0A 4KR0B 3KNAA 1BOBA 4FF1A 5D4PA 5L46A 5ETRA 3BTIA 2B4OA 4PGGA 2F1FA 3O3KA 1GMUA 4RB2C 1O4XA 5I3PA 3OYCA 2EZHA 2VQGA 2WV1A 1HWUA 4F50A 2HYGD 3AJ2A 2DYRH 2ZITA 1DLOA 5DDQC 5KG5A 4I4BA 4ENJA 4UUVA 2DT9A 2OGUA 4DPUA 5EDNA 4LJZF 4C0HA 1Y6IA 3CEDA 4IUFA 5C3EJ 1RBAA 4DXLA 3GFYA 3QBCA 5D6GA 4ESFA 2RJZA 3ZN0A 3O6QA 1VQ4S 3WGGA 3DEEA 2X1EA 4ECTA 4IRDA 4Y2KA 4JYAJ 2X6XA 3MCNA 4KRWA 4IRHA 4CH1A 4ZP8A 1TAQA 2GS8A 1ETOA 2PFBA 1RBOB 4XO0A 3TYTA 2BMBA 5KT3A 3BC8A 3V6JA 1VQOI 1SJ3P 1G3OA 1SFXA 1YX2A 1K9MT 3VYTB 4ZYHA 3MWBA 2X0LA 5CAAA 3R5CA 2WHOA 5G0RB 2D9OA 1H89C 4XRFA 3M8JA 3FKJA 2A6HF 2ZC3A 3Q24A 1BQMB 3NS6A 3CCMI 1MROB 3N6MA 2FSWA 3PHTA 1FYKA 2DH8A 4QWBA 3CIMA 3LL7A 2UXCJ 3BN4A 1KLMA 5IY5H 2NZ4A 3BB5A 1XQIA 2WWYA 4KIBA 2LVWA 2ZJRQ 4M3GA 5DQHA 3QPTA 4C3IJ 2MFZA 4PDKA 1RNLA 2O67A 5FD6A 3V81A 3T1YJ 3DLHA 1BJZA 3ESWB 2BQ3A 1MD0A 2V34A 8ATCB 1U8RA 3CMAS 1RACB 1GTHA 3E97A 2ASLA 3KK1A 4C11B 4WU2A 2ZH2A 4HT7A 5CYMB 2ELKA 3AXMA 3OUYA 1EQMA 2CWXA 1XBWA 4C4WA 1W5SA 3P6YC 1N36F 2IT0A 2DO7A 3EQLF 4B3XA 5EWFA 3JSYA 1Z2ZA 3OIPA 3NNAA 3T5JA 1ZBTA 2IAJA 4ZVUB 4EFAC 1B0TA 2NS8A 2FHJA 1UMQA 1N33J 2G4BA 4L3NA 1KS2A 3WG7H 3M07A 1VQNI 1U47A 1GTEA 4U87A 2B63J 2HS3A 1YZ6A 5LL6d 3SQGB 1SQEA 4KKOB 5T7LB 2DVIA 5F3TA 2FJEB 2OTLI 1PIEA 4PUOA 3BR0A 5AXMA 1S6UA 2NVQJ 4ESJA 1FFSB 2QSWA 3TRGA 4JBAA 4O5VA 3TJ9A 2CQ0A 3VCDA 4O4RA 1WG5A 2FMLA 3DRXA 5HMYA 3BR5A 4PEOA 2VICA 1TLHB 1PUFB 2DTJA 3BBFA 2KZGA 1F5BA 2XSFA 4DNCA 3PUFA 3LA3A 3TQEA 2HIYA 2Z9OA 1P92A 2HWHA 1UEUA 2QVOA 2PC6A 1Z7UA 3LOCA 4HEA2 4TV7A 2QZ8A 4RS8A 3BTLA 2PA3A 2QA4I 3W9IA 3HT0A 2ZVIA 2RMLA 2O8KA 1BW5A 3GWZA 4ZJLA 4FXWA 2CV2A 2EG2A 2ASDA 4ED8A 1FESA 4DMZA 3AQOA 4HH0A 2VUMJ 3MEGA 2XB5A 3RPUD 2YNIA 4NLSA 4KPCA 4A6EA 1SUQA 1J59A 5KAFC 3OL9A 5KFIA 4JV5F 1SL0A 3KLNA 2EFWA 2QIFA 3SV4A 4MQ9F 3MUTP 2QKLB 4WIIA 1PILA 3MM5B 3EUNA 2OEKA 1SB6A 2YUSA 1UHMA 4EEFG 3NS7B 3QU3A 5GAEJ 4IHWA 2WB1D 1GT8A 4NWBA 2ZB9A 4L18B 2AEJA 1QAIA 2MC4A 1RT4B 2W4PA 1KLNA 3TVZA 1XN7A 2Z99A 1B4AA 1S29A 1LEBA 4K4SA 4ZTFA 1X19A 4UOGA 3D9BA 2B4UA 4LF8F 5A8RA 4R0JA 2L02A 2R4GA 2FQQB 2OPQA 2CPEA 3LWLA 2HQAA 1XSXA 2Y8YA 3K0JA 4NC7A 1K83J 3QT5A 4B9SA 3A4TA 1XEZA 3KTQA 3BCAA 4UUWA 5KHDA 3RQIA 1ZHFA 1HBNA 1YK9A 1SKWA 1NHUA 3HVAA 3DNCA 1X5SA 3EUAA 1SQFA 3JXOA 1UAWA 1FD8A 3MM5A 1CLFA 1RWOB 1UW9A 3KMSA 3IN5A 2BXJA 3VODA 2O3FA 2AF6A 3PYFA 3RDIA 2DGTA 4KQZA 5LXYA 3M8FA 2DMPA 2ZZMA 3WTYC 1D8JA 1Y5IB 2DTZA 5LHHA 3N9UC 3RAQA 2E7VA 4NCAA 1T05B 2JVRA 4CNZA 2BY3A 5IQQA 3OYKA 3TO9A 5BYQA 4HX4A 1IKVA 2LDIA 2OCEA 4L9TA 1U5TA 2L08A 3DOLA 3AHPA 4YMEA 7FDRA 3HSEA 4WX9A 3KEQA 1Z9CA 2IEKA 1VFCA 1IBMJ 9ATCB 4LIWA 3FDYA 1TK5A 3BSOA 4WWSA 1SFEA 3OS2A 2Y3YA 2HU9A 5DZ7A 1JLBA 2QQAA 3G73A 5E17F 2L7FP 3TW0A 2FQ4A 3IP4B 1JKHA 2JFDA 1D9FA 3GCWP 5SZTA 3LALA 5ED4A 1I27A 1Y9OA 2CPDA 3KP5A 4ZMMA 3W1YC 2YU3A 2L2OA 3J81U 1SC6A 4NLRA 1U78A 4QTRA 2YPYA 1KEKA 3QIDA 3SYZA 2HLTA 3CC4I 2R2UA 1ULYA 2NXUA 4DFPA 2OBPA 4Z7YA 3DM2A 1LNQA 1WJFA 2K4BA 4U88A 2EA4A 1B59A 3BSNA 2E60A 4I76A 1BXNA 3GCMA 1KKHA 2HFZA 2GIFA 3N05A 1WHUA 4M5GA 3LH2S 3E6DA 2CDRB 5GAEI 4OFZA 1SV5B 4RW8A 2VBXA 4HNVA 4CCJA 2DGXA 3MVPA 4Z2XA 3HHLB 3GIJA 3DLGB 1YQHA 1QSSA 2YH0A 4G3IA 2LD5A 4QOTA 5KCMA 2ESNA 3HHHA 3L9ZA 2HNYA 1K78A 2IGOA 2R7UA 1X4BA 2DEJA 4ED0A 3HDSA 2YNIB 2X7IA 4Y28C 5E41A 4MK9A 3IR5B 2LRDA 4ZIWA 3ZZOA 2GQCA 2VB6A 2JX2A 3PW2A 1L0OC 3ROUA 2FBHA 5B0DA 2XNQA 5E8IA 3I4NJ 3DOKA 3RR8A 3BBCA 4CI0B 1YW8A 5KFPA 2ERRA 5K8NA 5HLHA 2PI5A 2CJYB 2IMWP 5F08A 2LYCA 3IGVA 4KGZB 2J6UA 5JMNA 5CPRB 4I2PB 2JSCA 4X84A 4Y0FA 3I4MJ 1WJBA 2MLZA 1S0NA 2DCEA 3BR2A 1PP7U 5DCMB 4HI2A 3WIUA 3KHLA 1XR5A 4M71A 5KG7A 1U1MA 3K4LA 1U8BA 4I98B 1H8AC 1D1UA 2DY1A 3KJFB 4BCAA 4FKXA 4UUXA 4NLQA 3VV2B 4XNFA 3HXLA 4X4VA 1MJBA 2E9TA 5ICCA 2EA2A 3MEXA 1U48A 4UVAA 3K70C 3FBNB 3Q0VA 5KFOA 4C2MA 1NSPA 3Q5FA 1QRYA 1R9TJ 3RYPA 1RHKB 3OR2C 4USHA 3OR2A 2ZZTA 2YKNB 1KQ9A 2DH7A 1UA0A 3J80K 3PKYA 2RUGA 1JUSA 5D5UB 2M2EA 5FDLB 3H5XA 4CO2A 3HTUA 2OLWA 5GMEA 2ZM6J 2AQFA 2UZKA 3PNVA 4KBIA 5HMXA 2MLGA 3HYIA 1XMAA 4TQSA 2LA6A 5HDNA 2NSCA 1PVEA 5K5RA 1RISA 4KHMA 1OR7C 3KLGB 4BJ6C 4GMKA 2ZOGA 2R8JA 2VFUA 4ZPVR 1IAWA 1OCTC 2WW8A 1GDTA 4GCVA 3IM9A 3S32A 5GPCA 1ZM4A 4ZVRB 4B09A 3NMRA 1W2BR 3SQOP 5F8NA 3PVXA 3M9AA 5G4DA 3CMQA 4CCLA 4F25A 1NNDA 2CQXA 1RWPB 5D8LB 3KK2A 2MY8A 4YDXA 4QW8A 2P81A 5I4MA 3CJTB 2XZWA 1N32J 5BNGA 1JLQB 1VQKS 3FFIB 4DOZA 1TV6A 3M9NB 2I6WA 1WH5A 2XMUA 5EEGA 2LKPA 1RT6B 1HNWF 1BQMA 4OOIA 3SI8A 3P7NA 2ZFHA 1HQUB 4ED1A 1K73T 1HQ2A 3HMJG 4NCGA 1F9HA 1NSQA 2L9NA 3HM5A 1HMVB 1R6VA 1V3SA 4EWTA 3MCOA 3WC2A 2O0YA 3M2RB 1UG0A 1SIWB 5E3AA 2JJ7A 3G6XA 4LMYA 2Q3PA 3ZC4A 2L7ZA 1GXPA 3J80Y 4FX4A 1CC8A 3UWTA 4ZJZA 2PA8D 4ZVEA 4HI1A 4B48A 3ENAA 4B9TA 1RPWA 4RZRA 2KFNA 4IL6C 2RNJA 3CCJI 4XSXF 2LXUA 1E6YA 3G8TA 2ZBPA 2DFFA 1VNDA 1A5JA 3MMYB 4ECWA 2ZHAA 2M8EA 2AS5F 5CYJA 3VYSB 4UXNA 2FC9A 3S1NJ 5E18F 4TLRA 1FRMA 1CQTA 1IW7F 4IR9A 2VFVA 3IS9B 5HLFA 1G3TA 1FSEA 4DGWB 2ZZNA 3MUVP 1H38A 1H2VZ 3W66A 4C3LA 4JI6J 2VOPA 4DSIA 1OYIA 3TI0A 1BBYA 1U6ZA 3M2VB 2NXNB 2J5AA 1SFUA 2YKMA 2WVEA 3BS9A 2IGNA 2UXXA 2IY5B 2Q6CA 2HHUA 3GF2A 3EPZA 3DRYA 2XBPA 5K7FA 4C2TA 2FD2A 3ZQFA 2F9JA 4BBYA 3ZZZA 2M9HA 2XMMA 2F8EX 1E3HA 3G3ZA 1DPRA 3GIIA 4BXXJ 1VQ4I 3F3XA 4WFAQ 2R7WA 1S7IA 5BOXA 1PYTA 1RT6A 5IT9Z 2DH9A 3AT1B 4F4KA 4RB0A 3CC2I 3OY9A 2RKIA 1VQPS 5HLIA 4XN0A 3O6BB 3S1RJ 2DPUA 2Z3YA 1H73A 3QGIA 3ENWA 2ZOFA 4F8RA 1BUXA 1TMJA 1J75A 1FHTA 1T56A 1T94A 1U0SA 3FJ2A 1RTDA 1HNIA 1XMOJ 3RU0A 4JOUA 4CLTA 4QPQA 2FU4A 5BR8J 1FVQA 2HVEA 3MAAB 2M0GB 2LF7A 1GAOA 2NS7A 1B72B 4DCJB 1KQ0A 3I71A 4IXAA 3FMBA 3LA7A 4RB3C 2DXIA 1OQ3A 3PQJA 4ZDNA 5IT9K 4KGVB 1TKXA 4N4NB 4DR7J 3G8QA 1U5TB 2VBZA 3L2RA 2QWWA 2HVIA 4MFEA 1MBFA 1R4MB 2O6GE 3TKYA 4C97A 2YVSA 2Y1LB 2EJRA 1T05A 4BQQA 4YY3F 3PY8A 4B3MJ 1QNTA 1MU2B 3KHGA 1I3AA 4NCBA 1NRKA 2BE9B 2H8RA 3NEKA 3LA2A 2YWFA 3PIPF 4AVZA 2ZJRF 1RWVB 3R5DA 4FISA 2XC7A 2L9DA 2RVCA 3TP2A 2E1NA 1FJ7A 4J9VA 2QA1A 3ILJA 4PWUA 1NK4A 3PKMA 3IC1A 4HLBA 1UEVA 4RUBA 1FDAA 3I64A 5HS7A 1HR0F 1MBEA 5D3GA 1G59A 5JVGF 3K5LA 1MW7A 2LCWA 1S72I 4LR7A 1YRNA 1IXSB 2P5KA 4OYPA 2UXNA 3ZZPA 4JI0J 2ZKUA 4ZPWR 3BPXA 2J9DA 5DZ6A 1TQMA 2DXEA 3UVJB 5GAEU 2NREA 2F4VJ 1Q5VA 2ELJA 1NPPA 3BZQA 4Y4RA 1RLCL 1CPZA 1V4RA 5GAGI 3QWLA 1DY3A 1SPBP 1SL1A 5IP6A 3UD4P 2OV7A 1LWEB 2W1BA 3M8PB 4R25A 3MEGB 3RBDA 3R61A 4ZS6A 1EH6A 1YHQI 5LT5A 1KD1T 1V5GA 4G65A 4CA0A 4AC0A 3HSFA 2A5YB 5D3GB 2J6TA 1XDSA 4ZVGA 2ECCA 4C9YA 2Q43A 3VAMA 3JSRA 1OY6A 3I59B 2ASJA 3NCQA 1BC7C 2JWTA 4DPTA 3NQOA 4WF2A 1O5JA 4EMSA 4F0KA 2A69F 1HKTA 1LKXA 3A2KA 3BR9A 3KJVB 1TWCJ 1K78B 5KG2A 1G2EA 2LTPA 2D1VA 2ZE2B 1U1OA 3DLGA 2WCXA 2RRBA 4O3OA 2V1UA 2QLBB 1OCOH 3C2HA 2K3FA 1POGA 3LWMA 2JT1A 4Q43A 1MU2A 4DV5J 4NB5A 2KISA 3L7OA 3MTJA 3CDEA 1YRNB 2RS2A 3BG3A 1YYVA 3PW0A 4BEHA 3FBFA 3TVKA 3MGJA 1BL0A 1QD1A 3Q23A 2PO4A 1N33F 2G7HA 2C3PA 3VAJA 1R8PA 3PEJA 4HTJA 3JRDA 1UVKA 1T0TV 1Q81T 1PP8F 1ZPVA 2PFDA 2A2CA 2CKWA 2QTWA 3RYLA 1YQAA 3PSFA 1WJEA 3BGLA 3KYLA 2ZM6F 2Q1ZB 1XD7A 1Y0UA 2FOKA 5GP9A 3CDAA 4DQQA 4PJJA 5H20A 1EJ9A 2H54B 1P4XA 3C15A 3IRQA 4O44B 4HSRA 1Y3KA 4O3QA 3OIOA 3VAHA 2W7AA 4WXCA 1VQLS 3K2YA 4ETZA 3W5XA 1QAJA 4DU7A 2M9KA 4WXWA 3U1KA 4UVCA 3NCRA 2A0FB 4UZCA 3B73A 1LEAA 1F1ZA 3TAQA 3FXUA 2GQQA 1JKQC 5HATA 4CWBA 4DR2F 2DGSA 3A3OB 4A47A 2GVZA 2EZLA 3NAHA 3ITHA 2R5YA 5F8HA 2CW0F 3MEEA 2XSJC 2QLWA 3BSAA 4JI7F 2KT5A 2PLYA 2YH1A 2AYGA 3OYFA 3IWFA 5L39A 3BP8A 5LHGA 4IFYA 2ZDPA 1U1RA 5D0RA 5EWEA 5C4XJ 4AM3A 1H7XA 1I5OB 4NQWB 4K4VA 1UA1A 1C1CA 1T9YA 2OZUA 3U02A 5F0HA 3ZTRA 4CO4A 4FE4A 3HUGA 4QJVA 1REVA 4E7LA 4YQWA 3O8WA 2W85A 3KJQB 3SJMA 4FQGA 1GT0C 4ESBA 1N5QA 5B0GA 3OTEA 4HLXA 2ISYA 3C16B 3G4SS 2K85A 3K9TA 1EAYC 3V7RA 1G4DA 1SMTA 1BM9A 4C7QA 2ACYA 2IC3A 4RU2A 2VDIA 3I0RB 3RJPA 4ED3A 3CO6C 4FHTA 2HBRB 3VVTA 2CJAA 1DQ8A 1SJFA 4I67A 3DXSX 2RVJA 5K8MA 3TQNA 4H4KC 2PI0A 2R2TA 3TA2A 4C3MA 4A3IJ 4IKFA 5FROA 1RZMA 1OPCA 2GHWA 4NXNF 3DPTA 4KGKA 5DV5A 4Y3CA 5B66C 2V4JA 4N56A 2CUYA 2VXDA 3IBWA 4WFYA 3DI6A 3T9ZA 1UWAA 4GYGA 3RKQA 2YWWA 3V5RA 1UPPA 1Z3XA 2EB7A 1A0OB 1Q8BA 1RAEB 4LIRA 4O3SA 1NCLA 1TT0A 1ZM2A 2YS9A 1TV6B 4ITVA 2HGMA 1KU9A 1M0SA 5DUKA 2O7OA 1TL3B 4YEAA 3SV3A 3IRXB 4ECRA 2KLOA 5M3FJ 3HZEA 2QSFX 2VA3A 4NLPA 4DF4A 2M4KA 1DTQA 2DCLA 2KFYA 2Z2YB 4LG3A 1XC9A 2M1BA 4IH7A 2HQ3A 5GAGJ 1OWXA 3CCUI 1RAFB 3ENVA 2R7RA 2P0WA 2DT5A 3HPGA 5LSRA 1H2UX 3ZMSA 2MBFA 5IZHA 5E0OA 2J0QD 1FRJA 2RF2A 1KVKA 1H2TZ 4F36A 3A0BC 3HEFA 3M2UA 3BKUA 1EB0A 3TL4X 1RBLA 2EG1A 4Z6YA 4KO0A 5HLTA 4Y65A 1X31C 5LXRA 1VYAA 3MFIA 1YKWA 1NPKA 2EI5A 3S01A 2ZO4A 4P2SA 3AFGA 2OIHA 3AH6A 2HOTA 4L0ZB 3N5FA 1FIAA 2E5IA 1R0AB 1X4PA 1ZETA 3D6FB 3FSYA 1S6OA 3SIPB 1PJ7A 3POTA 1DAXA 1WI8A 2DA6A 2E71A 1WF0A 4B3RJ 2OPSA 4NA1A 1UZCA 2CG8A 3HO1A 3CVKA 4BHPA 2C3MA 4YG2F 2VA2A 1UFKA 3CCVS 2LKZA 4EZ9A 3NBPA 1S4FA 2UU9F 5C44J 1IUYA 2DYSH 4MKYA 4IOAF 4ZDLA 1KSPA 2WB4A 3UDVA 3HM9A 1R5ID 3VQTA 1TP4A 4J5OA 3KJVA 4IO9F 2ID3A 4RGXA 3IRXA 2L9WA 2XPWA 4DZDA 3EDRB 1Q1HA 4C98A 4OZLA 4WTYA 1EP4B 1RK8A 5T41A 1S59A 3GVAA 5H6QA 2E66A 1BY9A 1ZAXA 4CT8A 4RNOA 2OO4A 1QVTA 3H4DA 2DNRA 4IOCF 1S1XB 2CPJA 3E1SA 3H20A 3JYTB 4ECYA 1Z4UA 2CRLA 3IC7A 4WK3A 3I5AA 1LXNA 1T9TA 4KH1B 3ISND 1N5YA 2QBYA 2HHTA 5A2QU 1IM6A 4DG1A 1N36J 2U1AA 3NRBA 4XLCA 4N8OA 2HDCA 2BVZA 4A8SA 3VGVA 1QTNB 3NLCA 3FGVA 6AT1B 1XDUA 4KFCA 2B9YA 9RUBA 3CCSI 2HDWA 1XNQF 3DGPB 4LUBA 4A4JA 1S99A 2KRCA 3L3CA 4R1HA 4IHXA 3BZKA 5D4OA 3LP0B 1YJNS 3FXKA 2B8QA 2R7SA 1TL7B 1U4BA 5FRNA 4BE2A 1NSKL 4X62F 2XSDC 1AA1B 3GZ5A 2BANB 1S77D 2V8DA 5KT5A 4DSFA 3VGSA 2CPIA 2W01A 3LAMA 2KYZA 4OIOF 4RMNA 1ZYQA 2XS2A 3S2WA 1TVRA 3IFEA 3C2PA 1ETYA 4RW9A 3VHQA 1R1UA 4OIRF 5J1UA 5LMNJ 2KM8C 3PFOA 4IFYB 2X9DA 5DM6F 2ZMEA 4F0MA 4FXVA 5H2FC 2KIFA 5A8KA 4E2FB 4YB1P 4EYIB 4V1Ak 3QYBA 3MEEB 3ABTA 5F1RA 3E5UA 1AFIA 4LSNB 2GVZB 3LTOA 4QBUA 3MPYA 3DOMA 4LB5A 1YJ7A 1WG1A 5HNFA 1Y3JA 3V6HA 2FVCA 3FCWA 3I55I 2XZDB 4G7OF 2GA2A 3IRWP 4MK8A 3PX0A 3RRGA 4DW6A 2H65B 2CJJA 1QU3A 2Z16A 2QQ9A 4ZCKA 5TRDA 3TAMB 2HRUA 2MHNA 5BR8F 3OXFA 2EWNA 2FNPA 4PJLA 3KG0A 4UW2A 1KA8A 4KN4X 2MZ1A 2HXIA 3OSPA 3CUQB 1HNVB 1VCTA 5C25B 3L9FA 1REGX 2C6YA 1DP7P 5AIQA 3NNCA 4D5CA 4X65F 1PSDA 3ZNUA 3ILIA 3TZYA 3A13A 4PK4A 3HK2A 4FASD 3BR8A 1LWCB 1DFDA 4II3A 1SVLA 4FT8A 3KLIA 2A6OA 2VODA 2E5GA 2GMLA 3GBGA 1UHSA 2RH3A 3EDQB 4LSLA 3F72A 2NQPA 1TNSA 5FLMJ 3FK6A 2Y1IA 5IQ6A 1AW0A 3LQRA 4ZKAA 3TOQA 5DGAA 1TVRB 4ILLA 2BE5F 3WHIA 3RBEA 3JSOA 4N47A 1FERA 3GLJA 4JQFA 2CIMA 4QWQA 4RGSA 1NJZA 2HKXA 1ODDA 2BJDA 5J1RA 2NUUG 3QPHA 5A8RB 2QGFB 2H5EA 4HF1A 4Y2IA 4ZYGA 4RKUC 4RLQA 1TC3C 1JKRC 4PWWA 1X5OA 3DHWC 1S76D 3HPOA 4FVCA 4PJ0C 2WVDA 2PMZN 4AE5A 1MGTA 3LSIA 2GXBA 4KFBA 3OYBA 4BUPA 1UFWA 2ZC2A 5LEJA 3T9NA 2P5VA 2HSEB 1HQEA 2KT0A 3W2WA 3NGRA 2HGLA 3PYEA 4KGXB 1HYSB 3ZMTA 5EZHA 5KG4A 4TYBA 4USMA 2LDYA 1APSA 3DMJB 2ADCA 3BR6A 2LY2A 1SC1B 1RTHA 1AKHB 3M6XA 3HZJA 2K40A 1BA5A 2G1DA 3O8GA 5CQGA 3PL8A 2AQ4A 4NNJA 4BQOA 1FT8A 4ZITA 3ZO7A 2GC8A 1A35A 1A36A 1MDMA 2HWVA 1IRZA 3D6HB 5FD5A 3HDDA 4JV2A 3UN2A 3K59A 1FTCA 3JTHA 5IFMA 4LQ3A 4PUSA 2FC8A 2VFSA 4JI5J 3ICLA 3HHLD 2EIJH 5ICGA 2XB2D 2JA8J 1OYWA 2L7MP 1RT3B 3ZRGA 3HOSA 3F8NA 4ZP6A 2OH2A 4OJ1A 2DPIA 2RSQA 2QMUB 2XY6A 3I0SB 2XDVA 3DCAA 1Q86T 4G9YA 5HLFB 1SI9A 4Q47A 2D41A 2DY9A 3AJ1A 3CC7I 3S16J 3ZZUA 3UPFA 3OD2A 3GTLJ 3DLJA 1R89A 3OUYB 2K9LA 4HACA 5F3ZA 3HTSB 3OYEA 5AT1B 4LMZA 3KP4A 2OTJI 3K4BA 1SVOA 2DA7A 2VFTA 5TISC 2JN6A 2VFRA 3ABUA 4MIWA 5MAOA 4IEJA 4DQSA 3PTWA 5A2QY 4KISA 2XWXA 1RHQB 4DSLA 3BJAA 1HCRA 4OQJA 2AU0A 3M1VA 1IG7A 2AHQA 5K5QA 3FQLA 1OMIA 4PPZA 3OIQA 4WPAA 1R43A 2LQ8A 2ID6A 3HIFA 5C7PA 1SD6A 1MROA 1UZHA 4KIAA 5HDGA 3C18A 1WDDA 2EFQA 3QAEA 3GLLA 4JI0F 2Y1JA 1SMYF 3B4DA 4LFBF 5L8RC 4ED7A 1KN6A 1SQGA 4CM0A 5J2NB 1HBXG 2IW5A 3D0HE 3W7BA 4LITA 2JRTA 1JB0C 2VKDA 3JB9k 2I2YA 4RUCA 4WE1A 4CHUA 1LW2B 3BQYA 2K3PA 3JSPA 3M1EA 3S6EA 4X4RA 1YX3A 2VF3A 4DFKA 2R8KA 4AUKA 2KRRA 1IN6A 3HCXA 1C4CA 2M3AA 2Y9YA 2BXZA 2M7SA 3NOGA 3D54A 3UQSA 2EV0A 3JRIA 3T19A 2M8HA 3KZYA 4WKRA 1W4MA 2QYGA 3W9HA 5MLCV 2P5LC 4ZVPB 5FGMA 1F6TA 5DM7Q 3KLGA 2ZH1A 2AD9A 3S3MA 1JXVA 3RG6A 5KFAA 2R93J 3E0JB 4HR2A 3NY0A 3OHAA 2IMOA 1U0JA 2LNBA 1YRUA 3HKWA 2FD5A 2GIRA 1NTCA 3UFCX 2K3KA 5M5WJ 2WONB 5AONA 2W2QP 1FJEB 3NWSA 3AOAA 5GAGU 2X3DA 2YKNA 2QFJA 2ALZA 1RT7B 1RHRB 3N6LA 2XNRA 2VJ4A 3QSYB 4ANEA 3BO3A 1W1WE 2KIQA 2XHKA 3H0PA 1RP5A 1XMOF 1HWKA 1Q5YA 4P6QA 1XR7A 2HKOA 2LKSA 3BOQA 2XI3A 3LSRA 1HWLA 1WKJA 2XS5A 4NC8A 1D9DA 3R5JB 2X48A 2KMUA 2DXDA 4Q2LA 3FFIA 1GHCA 2I5JB 3MMAA 2DGVA 5CD4H 1W7PD 2EPFA 1KOHA 1WJ5A 2B8PA 3SZTA 1TKZA 2B9XA 3LQVA 3CCTA 2IBKA 4YHHF 1B64A 2KVQE 2E5ZA 1CS4A 4ZVQB 4MNUA 3EUKL 1PG5B 3AXKA 3LA0A 2QYCA 3W3CA 4HLYA 4FYYB 4P55A 4TY8A 3MQ0A 2G1HA 2ZJQF 1F5CA 5B7WA 3R1LA 1U1NA 2BW3B 2GGPB 5FLXZ 3D5LA 4IH5A 1OY9A 3QP6A 5FJ8J 3UN5A 3I56S 2OQRA 3AL0B 3M32A 3U21A 2CV0A 3CCYA 1H98A 2VASA 4DR3J 3I96A 2V26A 1N0UA 2YWGA 5K14B 4ZIVA 2ME0A 4NMXA 4IX7A 2W9BA 3GZNB 3I9V2 2BOLA 3SXLA 3EUHA 1JJHA 5T14A 3KNGA 1V3ZA 2BVMA 2FJAB 2VPZB 4CCMA 2MKHA 3PHEA 1FXDA 2H9ZA 4CLKA 1YS7A 4JP8A 2XGCA 2X1BA 2H4WB 4E7SA 2BJEA 1S9EA 2P4WA 4WFZA 5E3QA 2KPMA 2DD8S 4F55A 5KG0A 1O8BA 4NYZA 1FNMA 1UJ6A 1C4AA 4QWDA 4FNIA 3SQNA 4X4QA 3H8YA 4BHBA 1QSLA 1J5OB 5HOOA 3EGZA 3QT6A 4K2JA 1T03B 4LLGF 4Q45A 1MSWD 3MDFA 2JVHA 2IDEA 3HL2A 2HHSA 5HK4A 5EUHA 2DI3A 2HVHA 2YQ0A 4UQTA 2XULA 2ZC4A 3UN3A 5IWAJ 2EXUA 4MH8A 4RGUA 1D1CA 1M1KT 3VDXA 3RYRA 1N5SA 5EN1A 1ETVA 2V67A 2HYJA 1RAAB 1Y56A 2DNZA 3UR3C 2B56A 3I31A 3CC4S 3TVYA 5D5VB 2KKHA 2PT0A 1D0EA 2HOEA 1HNZF 2OUMA 2Z5UA 3H2VE 5FJ4A 1TWHJ 1O7FA 3K89A 3CWJA 5E1XA 2RDJA 2DOFA 5D15A 3VEPA 2G0IA 1QE1A 3Q3SA 1YJ9S 4OIQF 4KHPF 3S1QJ 2IGKA 3KUHA 3EETA 4X4UA 1MSFC 2F4FA 1C0UB 1YX5A 3ECHA 2AJ4A 1YTYA 4NXMJ 1YG2A 1ZPWX 3HOVJ 1OJLA 1XPXA 1HBMB 3ZPLA 1JT6A 2D5VA 3AB4B 3MCMA 3S3NA 1AT1B 1NJYA 4EQQA 3MFKA 2E2IJ 1HI1A 2F65A 1WHXA 2E1PA 3B6AA 5KG1A 2W2NP 4B47A 5CVJA 1G7CB 1RA7A 3A8EA 1C0WA 2PJPA 4QPXA 4GKJJ 1L3UA 4RW9B 4USVA 3DRPA 4RNMA 4F2SA 3FXLA 3TANA 2DA3A 4GO1A 4C48A 2NXNA 2N82B 4E70A 3SFIA 4DR5F 2AX0A 1ZRDA 2JWNA 1X60A 2A3SA 2OC6A 4MKBA 3UDEA 4OYWA 5C2CA 1R5GA 3EPGA 4IG3B 2MZRA 2UXDJ 4DS4A 3QIPB 4OAZA 4ATNA 3GFMA 2IGMA 3M6VA 1VGYA 2V4JC 1PBAA 4DV1F 3MZYA 2PEBA 2DNGA 5DUIA 4EV0A 4NLGA 1C1BA 3I58A 4DWIA 5FD1A 3OR1A 1IBCB 3JSBA 4TYAA 2JLGA 5DRKA 3WE3A 1GXTA 2MC3A 3H25A 3KWMA 3O44A 3MZ8A 4RU9A 4DSJA 2DHSA 1YJRA 4KV8B 2V8VA 1VTNC 1XMQJ 1L3LA 5EX3A 3CF2A 3BJYA 3GSDA 5AE2A 2MQNA 2VXZA 4BKXA 1HKQA 4P9SA 1TR0A 2ZH4A 1JNZB 3T6BA 3N4WA 1ETWA 4LRFA 3SCIE 3R5AA 1S1XA 2KHDA 1RC9A 4WJBA 1CULA 1QUPA 2E1MB 3F8CA 3DPUA 2EZKA 1WTFA 2F2EA 2QG9B 1X1DA 4ZP9A 3H42A 4CUGA 3HP6A 1G3SA 2JEJA 2PSZA 2VIXA 4IHVA 1FTZA 3H5AA 1RT4A 4O3RA 3N28A 5KFHA 3KK2B 2FUG2 3MM6A 4C8MA 4UY8T 1SD4A 2FA5A 3PDNA 5AJ3J 2VQEF 1XR6A 1JK9B 2CA9A 5L1LA 4HH1A 3QPIA 1CJKA 2K3IA 3DHXA 1DQUA 2XSJB 3AQPA 4BAYA 3H1CA 3ZQIA 4F4AA 2MB0B 5L3CA 4F67A 2HQFA 1LQ9A 4KPYA 1SBRA 2A6MA 2NS0A 3W9JA 1P1LA 3RB4A 4UQGA 3D1QA 4JI8J 4CYCA 2RF2B 4PG7A 1WWHA 3S93A 4KJZA 5F8IA 5DM7F 4A3EJ 3Q8PB 1RI7A 3K2ZA 1OYYA 2JSPA 2V2QA 2AEMA 1B7YB 5FDLA 1SKUB 3W8GA 3EXYA 2HHHJ 3AAFA 2JMWA 5E3LA 4R8UA 2GA7A 3TW7A 1BR2A 4HYEA 4XDDA 1W5TA 2AXLA 4FE7A 3SDEA 1U26A 4NA3A 3CXCR 4KGMA 2HRTA 4QPTA 5ITHA 1KHVA 4WFBQ 2DNHA 3I4HX 3HKZD 4WZMA 3A01A 1NLKL 3WGHA 4YS2A 2K9QA 2ZBQA 5EF6A 2XQCA 1APLC 2GM4A 1GNKA 1ZS6A 2COBA 1PJ5A 2UUBJ 2IS1A 1LWFB 1TWFJ 4QYRA 4CDIA 3X2QH 4CTAA 3DLAA 2ZCWA 3G6VA 4M6XA 3D1OA 2WAEA 5DQIA 1FXLA 5L3FA 5DG9A 1TUGB 5JLXA 3RTRA 1GVDA 4A3CJ 2MZTA 1HF0A 1BI2A 2NYXA 1B0VA 1DU0A 4DX6A 4Q44A 5EEAA 4ZYAA 3JTPA 1ONVA 2O66A 2DITA 3VAGA 1RT7A 1SKSA 3IH2A 4KYWA 1FCAA 4N76A 3DRRB 3CDIA 2Y0BB 5IT9U 3K8WA 1J27A 4CLYA 1FBSA 2VC0A 3IWLA 2HW3A 2VL1A 3DDKA 1OQYA 2GJ2A 4M5JA 4F4WA 1W7WA 5F9LA 2C2OB 3NGUA 2IRFG 4E7KA 5D8HB 2OMLA 3C19A 1CC7A 3TX8A 1XCVA 4DS5A 1YVFA 1B3TA 5FKOA 4DYQA 3KHHA 4I6WA 1RGVA 4IOCQ 3DGVA 3WDOA 1AZSA 3PX6A 3JRCA 2XGQA 3M7VA 1BD6A 4D7MA 3CO9A 3U1DA 2P7VB 2HVSA 4GKKJ 1TP7A 2VHGA 3D6TB 3MKWB 1OSDA 3HJVA 5LMNF 5M3MJ 3NGTA 3MPVA 5ETVA 3DLLQ 4KTQA 3JRHA 5K8OA 4GRIA 5JFRA 4A12A 2WBRA 4OYOA 1RTIB 4GKJF 3BG5A 4M1KA 1M1EB 4GO7X 4XR6A 1LPQA 4OZ2A 3GV7B 3GMEA 2OU2A 3FEYB 5D77A 4PZVA 1LK7A 1R36A 5CKTA 2J76E 5F0FA 2F6CA 1MN7A 4HHHA 4M8LA 4U8YA 3QU6A 2QRRA 1QA6A 2QC3A 1WCMJ 4M72A 1NU4A 2VPLA 4MIMA 4EM2A 2CNNB 2WZ1A 3GWCA 2DYAA 1MG7A 4XLNF 4GC6A 4KYZA 3OR1B 4UV9A 1HLVA 4F4XA 1RB0A 1LFPA 5IT9Y 4DIQA 2KL4A 4OI0A 3RAMA 3E6BA 3W8PA 3DOMB 1WC6A 2MMYA 1M5VC 3T8TA 4TXSA 5CYQA 3PW4A 2HPMA 1PJRA 2OFGX 2DISA 1FLIA 3AB2B 3LMMA 3V4MA 3IMQJ 3DDIA 4AYBN 5E20A 2OFHX 2DK2A 3BGRB 3EVOA 3QFWA 2MSSA 1WHWA 2OJ3A 4RR5A 3MURP 3K57A 2BKPA 2DB1A 2ZJPF 4KMFA 4LRAA 1HFEL 3SDGA 4NI2B 3GTPJ 4JUZA 1PAEX 2HWIA 1S97A 1Z91A 2X1DA 3K17A 2GIVA 3CIZA 4XN3A 1TK8A 2LBFA 2AJ0A 3M05A 2MGZA 1I50J 4J9LA 2VV5A 3HGGA 1RU2A 4HF2A 3LSMA 5HVFA 3VZHA 1FEHA 1D1AA 5KVRA 3K5MA 3BDPA 4YIFA 4BEHB 2UXCF 3I56I 4DQRA 5L38A 4O4GA 3FKBA 1RAGB 1S9EB 2E1AA 4RX6A 3QOEA 1RKIA 2XASA 2I0XA 3F23A 3KIOA 3DTEA 1FNOA 1HPZB 3DLKA 3GFIA 4OV1A 5DG7A 3CTRA 3I5UA 4WYLA 2UXDF 3T41A 1Q1KA 4M5NA 4JI2J 3EGNA 1OFCX 3GSIA 1ZAVA 4B9LA 2CWEA 4OV6A 2JEGA 2QX0A 3PM1A 2BA9A 2BM0A 1GUUA 1WDTA 1V54H 2ZKTA 2P8IA 4LR9A 2WVCA 1YIJI 4YEJA 5KFTA 4ZZLA 3PACA 1RRJA 3UI3A 4XICA