3I4PA

Crystal structure of asnc family transcriptional regulator from agrobacterium tumefaciens
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
153
structure length
153
Chain Sequence
MDRLDRKILRILQEDSTLAVADLAKKVGLSTTPCWRRIQKMEEDGVIRRRVALLDPVKVNTKVTVFVSIRTASHSIEWLKRFSEVVSEFPEVVEFYRMSGDVDYLLRVVVPDIAAYDAFYKRMIAKIEIRDVSSAFAMEQIKYTTELPLDYML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of AsnC family transcriptional regulator from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str. c58
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, AsnC family
total genus 33
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01037 AsnC_trans_reg Lrp/AsnC ligand binding domain
A PF13412 HTH_24 Winged helix-turn-helix DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3i4pA01
3.30.70.920 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i4pA02
4OIPF 3GEZA 2RQPA 5L3GA 4KFCA 3J7AO 3WODF 2YX7A 1HBXG 2DAOA 4MEYF 4IJAA 1BI2A 3ISPA 4UVBA 5TJJA 3ZP5A 4HF0A 2XV4S 3B02A 1JHFA 1FLIA 5ICGA 1DPRA 1I27A 2BEOA 4UHTA 2KIFA 1H0MA 1YYVA 4OIRF 2D2WA 4EQQA 1WKMA 4XLNF 1IN7A 1FWZA 3LSTA 2FBKA 4G7ZF 1MJ9A 4IXAA 5LGNA 1QO0D 3V4GA 1HW1A 1P4XA 2EFNA 1EH6A 4L18B 5FD6A 4RB2C 1KYWA 5D6EA 2EV6A 3NQOA 1G4DA 1G3YA 5K5OA 3FMQA 3K1MA 2XAQA 5D4RA 2YX4A 2FU4A 2DLLA 1U3EM 4KIBA 2WWYA 2PG4A 1XSDA 4RS8A 4NQWA 2H94A 4D0PA 3T1BA 2A61A 4LLNA 3VEPA 4E70A 4YG2F 5ICCA 3DPTA 4DQ2A 2CYYA 4RB3C 2DFIA 2MLKA 2X0LA 5FGMA 1QPMA 4A0YA 2Q2EA 2HGCA 1D8JA 3M9AA 4P9FA 5IT9K 3TKYA 2R3SA 3WU1B 3WTTC 4ZZDA 4BHPA 3O6BB 1SFUA 3N4MA 3DFGA 5E20A 3QOPA 1ZG3A 1U5TB 2W84A 3SZPA 4RGRA 1BJAA 1T6SA 1SAXA 2IA0A 1KYZA 4G7HF 3ZMDA 2COMA 5ILSA 2OZUA 1YTYA 2EFPA 3E3VA 1BBYA 3LWFA 4KA4A 3O2PE 1E17A 1G6NA 2MC3A 1XCBA 1U5TC 4ZYGA 2H09A 1Z1DA 3ML6A 1B1BA 1HQCA 2F5DA 4LG0B 5F64A 4KIFA 5HLHA 4RGUA 1FC3A 2ZMEA 4IVNA 3F6VA 2DQRA 4M9ZA 2STWA 4GO1A 4Y17A 1O57A 3CJNA 3L2CA 5E1ZB 3G73A 3MFKA 5KVRA 4BNCA 4EJTA 4I09A 1P2FA 4HOBA 1YQAA 4IRHA 3OOPA 5BPIA 1W4MA 3TO6A 2HQNA 4Z2YA 3HUGA 4EM1A 4P5OA 4A6EA 3KP6A 2R7DA 3KP4A 3Q5FA 1ULYA 1O3TA 1SD4A 5E8IA 5ED4A 1MD0A 4YIFA 1IN5A 4ZZLA 1J2XA 2YU3A 4RAYA 1XDSA 5CYVA 4DNCA 2GWRA 1RNLA 3LA3A 1A04A 1S7AA 1UB9A 3LQRA 4HV5A 1I6XA 5L3EA 2FNPA 3WGIA 2CW0F 3FHZA 2XKOA 2P5KA 2K7LA 3HYIA 1MZBA 4OMYA 5DD8A 1I1GA 2IPQX 4RGSA 3HHGA 5JHUA 1FT9A 1Z6TA 2FNAA 2DPDA 2CVIA 1R5GA 2GA2A 4HZFA 4EM0B 2XHKA 4G94A 2H6BA 4I0BA 3FX3A 3LQQA 4HV6A 2YSRA 2XAHA 3NEUA 3KLNA 1SFXA 1KQ8A 4KN7X 5LHGA 3HOSA 3BJAA 3REOA 5CLSA 2OA4A 1D5VA 3LAJA 2L02A 1FBUA 3LFKA 3JAMK 3F8FA 4CZZA 1BN5A 1AOYA 4KT5C 4EM2A 4LJZF 5LGTA 2ZBKA 1BM9A 1TLHB 4L5IA 3KFWX 1DDNA 3LAPA 2GXBA 3GUDA 1XDUA 5LBQA 4G9YA 2PEXA 5FLXZ 2F5CA 3VFZA 1DPUA 2CSOA 2ZBCA 4KN4X 3EQLF 4HLYA 5HDKA 5HDNA 3MWMA 2OBPA 2VOPA 2Z5UA 3GW2A 4Q47A 3F8BA 1HXDA 3KP3A 4CGZA 2KJBA 1W7PD 3P9KA 1F4KA 4EV0A 1G3WA 1J59A 1S6LA 3FM5A 2HFHA 3RJPA 3WTSC 1KA8A 1LDJA 1KU3A 3I53A 2M45A 2M1BA 1OKRA 4HX8A 5DYMA 2IA2A 4ZYEA 1GXPA 4AIJA 3KZZA 2EFOA 2Y48A 4U88A 1D8KA 3BP8A 1TQIA 3PQJA 4KYWA 3BPVA 4KIGA 5D5XB 4XBFA 3HSEA 1HSJA 3BY6A 1VTNC 1IAWA 4PGGA 3BPXA 1RIOH 2IRFG 3J80K 3KEQA 2PMHA 2F5FA 2NNYA 1ZN2A 3T0YA 2H6CA 3ZN0A 3R61A 3MZYA 5D5VB 3PFIA 4AD9A 5BQTA 3FXUA 4UNOA 1MKMA 3GO5A 1K78B 1TNTA 1YIOA 2O3FA 4AIKA 5L3CA 5E18F 2H27A 3RI4A 2KJCA 2FOKA 1R7JA 4RB0A 1O3SA 3VB2A 1ONVA 4KMFA 5AONA 5D4SA 2ACJA 4PCQA 2Z9OA 4IRGA 3GZ6A 2OQGA 3VOEA 1IXSB 2K4BA 2O8XA 4HQMA 5HOOA 3CUQB 2EA4A 5E1XA 4A5MA 5E1WA 3DEUA 4WXCA 1WSUA 2K02A 5ILVA 4I98B 1G3SA 4EGZA 5IT3A 2ETHA 4N9HA 3E6MA 1S7OA 1XCVA 3TQNA 3K1NA 5JFRA 1K7AA 2MA3A 1WRJA 3GWZA 5A2QZ 1FP1D 1WQ2A 3QRFF 5DUIA 4ESBA 4P96A 1Z7UA 2PI0A 1R00A 4KNYA 3CO7C 1TBXA 2CGPA 3I71A 3FXQA 2CO5A 1XGMA 2L54A 3U2RA 4HAMA 1BI1A 2M30A 4Q4ZF 5F1RA 1PUEE 3JTGA 1J7KA 1DP7P 3ELKA 4A12A 1V4RA 1XMAA 5FFXA 2Q8KA 3IWZA 4AWXB 4BYYA 2HKXA 2IW5A 5J8CA 2VC1A 1XGSA 5H6QA 2CWEA 1YO5C 2OD5A 5F6FA 1R58A 2VBYA 2O03A 2NAZA 3V8LA 2VONA 1YFHA 3E5XA 4MTEA 4MHGA 4IHTA 4O3MA 1KU9A 3JTHA 2OAZA 1LDDA 1YW8A 1V3FA 3Q9VA 2A6EF 1IXCA 3QAHA 1YW9A 2ZMEB 4L9JA 5D8KB 2JZYA 2ISZA 3TO7A 3KP2A 4L5JA 3M8EA 2O61A 5FD5A 1FPQA 5ICFA 2BGCA 4S04A 3H92A 2MLGA 4FHTA 5DDGA 4OINF 2VT2A 3BWGA 5E8GA 4I01A 1SMYF 3ZMSA 3F72A 1RUNA 4LLGF 4CDGA 4U0WA 5BOXA 5L3FA 2FEZA 1B59A 4CO8A 2VN2A 1FBSA 5LRSA 4UVAA 3I54A 2J5OA 5A2QK 1P4AA 1IF1A 3WTWC 3WTVC 1ON1A 3CUOA 1IUYA 3RDIA 3TGNA 1FOKA 4BH9A 4LG0A 2GXGA 1IW7F 3KZYA 1USTA 2ZCWA 3ECHA 3HHHA 4LFUA 3ERED 1I5ZA 1ZAOA 3W6JB 2BV6A 1U6GA 1SD6A 1TW2A 1FP2A 1W5SA 3I5UA 3RKYA 2M87A 2P6TA 1FYLA 4NB5A 2FSWA 1OYYA 1T98A 2MD5A 2VBWA 3MAJA 4EJOA 3ZMVA 5K1YA 2X4HA 1J5YA 1JHHA 3GYHX 2HYFA 5AIPA 1QZYA 2ESHA 2A6HF 2ZKZA 5J8FA 1P4WA 2DW4A 2B0LA 2UWMA 2EV0A 3GFJA 3ZPLA 2VOOA 1XSXA 3ZMUA 2PMUA 3QP5A 1PP8F 4LLLA 4IRIA 5E17F 4YIIA 2K4JA 4PZJA 4ZYDA 4A0XA 3F6OA 2OQRA 2HOEA 1YS6A 2D1VA 1O3QA 3E5UA 4G6DA 1H9GA 5CVIA 1XGOA 4HQEA 2DO7A 5CVJA 2GIVA 2A3SA 3IKVA 2NYXA 3ECOA 2ZFWA 4YFXF 4EJVA 2QWWA 3RPUA 1O7LA 4LD5A 2V1UA 3WTYC 2ZNZA 1IZ1A 2E7XA 1KQ0A 3R60A 2G9WA 1LVAA 5AIQA 1FX7A 3DF8A 1P6RA 3O3KA 1IXRC 2XIGA 1MDMA 1L3LA 3CTAA 2P7CB 4P55A 4CICA 3GFMA 4XSZF 1LNWA 1OMIA 4MGRA 2HTSA 2Z4PA 1O7FA 1UHMA 1B9NA 1R1VA 1LEBA 2QLZA 3FMSA 3L7WA 4HW0A 2G7UA 3SHFA 3T5XA 4R8HA 4BQAA 4M6YA 3L00A 2P5VA 3IRQA 3BOQA 3H3ZA 3WE2A 2EFWA 3GLXA 2JPCA 3IL2A 4G7OF 2IA1A 3GFLA 4M74A 1UCRA 2RV8A 3HSFA 4G8XA 4L0YB 3FZVA 3KE2A 3HOTA 2NS0A 3K0LA 5FB2A 2VBZA 4N9IA 4F7ZA 2Y0MA 2P7VB 2RVCA 3MEXA 2V6CA 4WXHA 3OV8A 1K78A 2RN7A 1Z05A 3MQ0A 3EYYA 3DP7A 4WX9A 2EJRA 3HTUA 1CF7B 2DQLA 4EMSA 3P9IA 3QU3A 2PFBA 4MNUA 4LB6B 2Z3YA 1PP7U 2A68F 3SFZA 3EYIA 3ABTA 3AAFA 2MH2A 4EJUA 4U7BA 4HA8A 3V7RA 2DT5A 2VC0A 4KMUX 2Z33A 1FNNA 3CUQA 4XRFA 3L9FA 2HS5A 3H3UA 1MDMB 3MCZA 3T8TA 1RZ4A 4LK0F 1STZA 2RKHA 4BHCA 2GAUA 3GFIA 1IN4A 3BROA 1FYMA 3CUQC 5H20A 1R36A 3GVAA 1USSA 1T0FA 1R23A 2K27A 3R0JA 3R4KA 5HS8A 4RB1A 1F9NA 4G6QA 1S29A 1FBQA 2G7HA 4M9SA 2KRFA 2AS5F 3M7GA 2XASA 3K69A 4ZYHA 2W57A 1R1UA 4LK1F 3QPHA 1TNSA 5LEJA 5L3BA 3KP7A 2BE5F 2KIUA 1IN8A 1QGPA 1FZPB 2EWNA 1ZRFA 5D5UB 1WWXA 2P8TA 3T8RA 2XVCA 2F2EA 2VBXA 5FLXK 5JR3A 4EGYA 2V79A 1ZLJA 4HF1A 2JRTA 4ON0A 5TRDA 1B9MA 1K79A 2PJPA 1KU7A 3WU0A 2W85A 1U5TA 3ULQB 1AWCA 3RIRA 2A07F 1KQ9A 1ZARA 2QUFA 3TOBA 4JBAA 1H9TA 1QQIA 3RYRA 3HRUA 1HW5A 2FXAA 2EFQA 1ZRDA 1ZGJA 2DU9A 3SQNA 3E5QA 2DBBA 1ZRCA 2JSXA 2UXXA 5IT9Z 3HSRA 1IN6A 1W7PB 4FX0A 3PQKA 2Z99A 4KUMA 2LNBA 3NRVA 3IHUA 3E97A 3IKTA 2E1NA 3IWFA 4M72A 1MJBA 1K6OA 5HLIA 4EVIA 1J9IA 2IVMA 1KU2A 1W7PA 2WC2A 4H0EA 2W25A 5CVVA 2V1XA 4CHUA 3CO6C 3KETA 4MQVA 2JT1A 3FMRA 1J75A 2E1CA 2R7FA 1HW2A 3WTUC 3G3ZA 3ZMTA 1ODDA 1FYKA 2HYGD 2XAFA 2E1AA 3LA2A 5BMZA 4L9VA 4OOIA 1YS7A 2C6YA 3I64A 3DKWA 4GXOA 2EK5A 3WTXC 4HYEA 3HRMA 3RTRA 3B73A 2GQQA 1SMTA 2CQKA 1JE8A 3KLOA 5HVQC 1GHCA 1HKSA 3C3WA 2FE3A 4UV8A 3FWEA 2DPUA 3QPTA 4UXNA 2A5YB 1HSTA 2JSCA 1R1TA 2VE8A 1OPCA 5FO5A 2GA1A 3R0AA 2XRNA 1FSEA 4QLCU 2QZ8A 2EA2A 3DQVC 2WTEA 3V7SA 5JI6A 3DV8A 5LLQA 2VODA 1F1ZA 3L09A 1WI9A 5D8LB 1ON2A 2XUBA 2FMYA 2DTRA 1L0OC 4L9TA 1BC8C 2ZO4A 4ENJA 4I7HA 4ZH4F 4GYIA 1S3JA 3COAC 5ILUA 1U8RA 2QENA 3J80Z 4OIQF 2ELHA 4JQFA 1QBJA 4O5VA 3WGGA 4A2UA 2QBYB 3D5LA 1DUXC 2XROA 2HZTA 4BAYA 4IPAA 5D6FA 2L3DA 2D1HA 2ESNA 2O6GE 3F8CA 2OU2A 4ETSA 1XSVA 5HLGA 3WE3A 3ROUA 2HR3A 4WXDA 4ASNA 5DV5A 2XAJA 2PQ8A 1KGSA 2V1DA 4WCGA 3K1PA 4S05A 5DUKA 2NNNA 3EDPA 2WV0A 3FF5A 1W5TA 1CF7A 5LHHA 3WG9A 4IHSA 4M6XA 2L4MA 3M8FA 2UXNA 5CJ9A 4MQ9F 3QP6A 1BIAA 4ENMA 1RUOA 4I0AA 5DEQA 2Q0OA 2P4WA 2RDPA 4ESFA 2ADUA 2BYVE 1LDKB 3GXOA 4LB5A 5DCFA 4XSXF 1I1SA 1BIBA 1T38A 4FT8A 4JK1X 1OR7A 1Z91A 1MGTA 3KCCA 5BPDA 3Q9SA 3JSOA 3DXJF 1HKTA 1IRGA 6PAXA 1UFMA 4GYGA 2XAGA 1ZGAA 4N0BA 1ZLKA 3JW4A 1JXSA 2VT3A 2FMLA 2VXZA 2EV5A 2DJWA 3JAMZ 1TW3A 4ENKA 4UVCA 2IJLA 3MZHA 4I02A 1IRFA 5K5QA 1R22A 2HQRA 4R1HA 4UUVA 3ZQ7A 5D5WB 1ZH5A 4L9NA 2J5PA 2JPBA 2HTJA 2IT0A 4RAZA 1ZYRF 1Z9CA 1XN7A 4GCVA 5ICEA 3JSPA 3D0SA 5EEGA 2STTA 5BS6A 3BJ6A 2CG4A 3HRTA 2KIMA 4KICA 4R79A 3F22A 2LDUA 2YR2A 3U9GA 3C7JA 5HS7A 1ZHFA 3RKWA 3ZN1A 1LEAA 1SFEA 3SZTA 4AIHA 4M9XA 5DCMB 4PDKA 1O3RA 4WWCA 3I58A 2MBFA 2JTVA 2FRHA 4B8XA 1J0RA 2LF8A 2ZJ2A 4BHBA 2UZKA 3HRSA 2DK5A 1TQMA 2V9VA 3I4PA 3P9CA 3FXRA 3RYPA 3I59B 4HLXA 5DCMA 1TTYA 4WK8F 1YG2A 3E6DA 2P5LC 1BI0A 2XGXA 3BDDA 1EV7A 2BBYA 5HDGA 3S2WA 5JVTA 2FBHA 3V8KA 2DK8A 3HTSB 1PDNC 3I59A 2LKPA 3F21A 2FA5A 4B09A 2EB7A 5H6RA 1LJ9A 2F5EA 4K2EA 3W6KB 1C0WA 2AXLA 1U2WA 4HX7A 2FBIA 1T2KA 4IF4A 4OU0A 2PN6A 2FQ3A 3KEOA 1LB2A 2HWVA 3TO9A 3RPQA 5LGUA 3I0TA 3F8NA 3R6SA 3TOAA 2QQBA 1HKQA 1NHAA 1P92A 2QVOA 4ESJA 3BJOA 4UV9A 4A0ZA 3GX4X 3KP5A 4P9UA 3IC7A 2L01A 4WF2A 4A5NA 4M71A 2ZXJA 3EETA 2KKOA 3ABUA 3C18A 4Q48A 2LF7A 1GVJA 4TV7A 1Z6RA 1X3UA 1XMKA 3GZ5A 2MH9A 1Q1HA 1QNTA 2D45A 1R5HA 2YPRA 4OMZA 3HIFA 4Q5SF 4Y13A 2A69F 1E2XA 1RI7A 3N97A 4M73A 4LMYA 2ZNYA 3LA7A 1U78A 2M5WA 2RGVA 1ZG5A 2HKOA 3K2ZA 3FM3A 4U0VA 4HX4A 3GF2A 5KK1A 1OYWA 1OYIA 3VODA 4LGWA 5CVUA 5L3DA 2Y75A 1QZZA 1G3TA 3K9TA 2RNJA 3QU6A 4CXFA 2M8EA 4EJWA 4HBLA 4BXUA 1SD5A 1YLFA 2E7WA 4XLPF 4ENNA 5FFZA 1CGPA 1B4AA 1ZG1A 2ISYA 3BZ6A 1BC7C 4MEXF 3U1DA 3WTZA 2NRAC 2FF4A 4Y15A 1FSHA 1REPC 1UHWA 3ZMZA 2QM3A 3E6CC 1B6AA 1BI3A 3M1EA 2VE9A 2XKPA 2RC4A 2LSOA 3J81K 3F3XA 5DD4A 4QWQA 4PGHA 5LEKA 2PBIA 2DI3A 2L4AA 3C1DA 3V8JA 4FX4A 2GZWA 4NHJA 1SD7A 4OIOF 1JGSA 3IRRA 1EH7A 3P7NA 2CFXA 4HDUA 3RKXA 2HDCA 1ZREA 4HF2A 4A6DA 2QQAA 4YFNF 3TDZC 5K5RA 3V7CA 1MJAA 4AVPA 1S8NA 3TDUC 1FY7A 4HDVA 4U7DA 3CDHA 1LQ1A 4U0YA 4I2OA 2HEOA 5ERIA 2TDXA 2P6SA 4KDPA 4CYDA 3CLOA 3SXYA 1XB4A 2O0YA 4O6JA 2W24A 1XGNA 4RGXA 2QBYA 5LHIA 2PLYA 2OZ6A 1YW7A 2K86A 3E6BA 1EH8A 2QYOA 4MTDA 4L0ZB 1TQPA 2QQ9A 1BOAA 2IP2A 5CVRA 3J81Z 1Y0UA 5HS9A 5J6XA 3F23A 3WGHA 1D3YA 3DPLC 5LRRA 4GGGA 3EUHA 1GXQA 3F8MA 1T39A 5EEHA 1XD7A 4YFKF 1F5TA
chains in the Genus database with same CATH superfamily
3IH4A 1VC6A 2ROEA 4RZRA 1YE9A 1S9FA 3H35A 5L3GA 4KFCA 2QSFX 4DL5A 3HI9A 4R8UA 1N48A 3WODF 1H73A 4XPCA 1Q7YT 4OLOA 3E01A 4MEYF 1F5CA 2ZOGA 1Z1ZA 2FGOA 1NNDA 2I38A 4BBRJ 2QLXA 3ZP5A 4B3TF 3B02A 5EZHA 3M1VA 1JHFA 4NA1A 3FSIA 2QMWA 2WAQA 1QHHD 1N25A 2FYXA 2HQCA 5F8LA 3CJ2A 2KIFA 2FY8A 4L5EA 7FD1A 3QIDA 4OIRF 4ES1A 1UW9A 4USUA 3RKQA 1IJFB 3GV5B 2AZ3A 5B0CA 1IN7A 1KLMB 1FWZA 2DHXA 5LGNA 3SV3A 2ZVIA 1N33J 4BDYA 1HW1A 1P4XA 4JI5J 2WK4A 4OYZA 3ZTOA 1BHNA 3DCAA 4II2A 4CCKA 3S15J 3PYGA 1AHDP 3IR5B 1WJDA 1UMQA 4ZOSA 2GVZB 3DLEA 4FF4A 2ZZNA 1O51A 5GTHC 1N33F 4OI6A 2DLLA 4KIBA 2HFSA 2X1BA 1P9QC 2WVBA 2X1GA 1GXLA 3CULA 1SH2A 1GMVA 2D74B 1YK9A 4KFBA 2GHWA 1REGX 2QT7A 3VEPA 4O3QA 2GIFA 3H4BA 4QU6A 2XMMA 3DPTA 4ZHRA 3DKYA 3RBZA 2DFIA 2CQ3A 2WW8A 5FGMA 4NLWA 4L6V3 4G1QA 5A6PA 2QGUA 4ALZA 1TL7B 3VPRA 1JLFA 4J90A 4IDKB 3WU1B 3WTTC 3D9BA 3AA8A 1HIYA 1Y56A 4ZZDA 3W2AA 3TYTA 1YJWI 1SFUA 3N4MA 3FEZA 5T7LB 2OEJA 1ZG3A 2W84A 2XLIA 1AKHA 2R8HA 1ENHA 2X1CA 3J7YJ 3FDYA 2HFZA 4RW4B 4CLPA 4MIMA 4QWCA 2OZUA 3PR5B 2CV0A 2VJVA 1BBYA 1E17A 3UR3C 2M2EA 4IUFA 3K5LA 2GVDA 3FBEA 2F5VA 1LW2A 2YBVA 1HNVB 3CB4A 1MBKA 2XM3A 1Z1DA 3ML6A 3Q86A 2MQQA 4LG0B 3I55I 2MFZA 2VASA 1ZZFA 3LH2S 2M0GB 3EZOA 3FK7A 2WBMA 2DQRA 1RKTA 2J6TA 4M9ZA 4O44B 4GO1A 1RA7A 4B3OA 5T41A 2JQ7A 3B78A 4OV6A 1AB8A 3S93A 2PO4A 2HPMA 3E7LA 2MEWA 2JNJA 4EJTA 1T7PA 4B3MF 2OPPA 3BR1A 3PIOF 2K1RB 1YQAA 5J2PA 5D6GA 2HIYA 1GMWD 2M3DA 2JHEA 4DOZA 2FHKA 5KT5A 3HUGA 3M8YA 1IUJA 2KL8A 2V5HG 3ILJA 2R7DA 5ETLA 1ULYA 3BB5A 2UVUA 4DQSA 3CCEI 1SD4A 3KHRA 4F7VA 3ILLA 5ED4A 2H1KA 2C3PA 3A4TA 2JUCA 4YIFA 2LU2A 4PJMA 1RT5A 3ENQA 1G3OA 1R6YA 2GWRA 1RNLA 2R5ZA 1UB9A 2V8VA 3RU0A 2DHAA 2FZGB 4HV5A 2OTLS 2RH3A 2QSHX 3C15A 3WGIA 2JVOA 3FHZA 3Q8YA 2XKOA 3HHLC 4FVMA 2FJEB 5EGOB 4M3GA 4OMYA 2XDVA 2HQIA 3JRFA 4OJ3A 3OL9A 3NMAA 1W25A 2BOLA 2IPQX 1GMWA 1FT9A 6FDRA 3OR2B 3NGRA 2VG6B 1R5GA 3QOEA 3V6KA 4CCNA 4PAAA 1UJ5A 5J2MA 1UVNA 4WIIA 1O8BA 3AG2H 1SFKA 3LQQA 4H4OA 4BLGA 4KGZB 2XAHA 3S32A 4B4CA 4PEOA 2MGZA 4A3GJ 3CDLA 3MMAA 4B9SA 2ZWPA 4FS1A 4OI2A 5B0EA 2IC3B 2EG1A 2HHXA 3BV8A 1FDNA 2KM8B 1K9MT 2HBYB 1SEUA 3OIOA 2CPYA 4NCGB 4CLYA 3AJ1A 1GMUA 1FBUA 2KH9A 4CZZA 2RHQB 3X3UA 2DPJA 1V5VA 3M1CA 4DJBA 4ZVEA 1Y9OA 4LVNP 1KS2A 4LQ3A 3PZPA 1Z77A 1WJFA 4M3BA 1JJ2R 4AM3A 4WK1A 2FUG9 4LJZF 2NZCA 5FDLB 4Q45A 2L9VA 2ZBKA 4CLSA 4L5IA 2B9YA 2ME6A 1C4CA 5DDPC 4LIVA 2LR8A 1X1BA 1JXEA 4IRKA 3BEGB 3C6TA 4UOFA 2Y1JA 2JDJA 4HLYA 5F8HA 1PC5A 4WPAA 2RIJA 2K9MA 2F9DA 4BQNA 1D8ZA 1JKQC 5ETPA 2LTPA 3Q0WA 3GW2A 1RQ0A 3SDBA 3F8BA 3VSKA 2E1PA 5KFTA 4WFAQ 3HL2A 1A31A 5ADZA 3K4NA 3F41A 4JYAJ 2CUZA 2XMVA 4K4ZA 2NVTJ 2HZAA 3CO0P 1J59A 3TQ1A 2B7EA 3FM5A 3RJPA 3FQKA 4A69C 3GU0A 3EMTA 4I99C 4DR5J 3CMQA 1IJEB 3K70D 2JFDA 2LXIA 2MXYA 1S1XB 1HA8A 1X1PA 1HNIB 2GHVC 3G9CA 4F02A 2RKIB 5DYMA 4ZYEA 3CCMS 1GXPA 1FESA 3EUHC 3H5RA 2HWHA 3P5JA 1N78A 3KZZA 5GAHI 4K2XA 3OS2A 4U88A 1X5TA 1WORA 3BP8A 3PQJA 4KYWA 3BBCA 4K59A 1TZ0A 4BQOA 4XBFA 2DMQA 4IH6A 1J5OA 3CCJI 3BY6A 1IAWA 5HMZA 3BPXA 4F93B 1U2RA 4JI7F 2CPEA 3PNVA 3S3NA 2ZH6A 3RBEA 3ZZRA 4KQZA 1VQ8S 2EIMH 4IZZA 1YVFA 4DU8A 3RPUD 2N82B 2F40A 2PDAA 5FKOA 2PA8D 1AZSA 5GADJ 4PSXA 4M3DA 2LECA 1Z21A 1PAUB 1AFIA 3PFIA 4XO0A 3B82A 1JX4A 2ZC3A 1BW5A 3DMJA 3KYCB 2DDBA 5M3MJ 3H20A 3H5SA 2OGUA 1RJJA 1MN9A 4MH8A 1SXLA 3RCOA 3VGUA 2H27A 5JVGQ 3TEGA 5C7PA 4OZ1A 4I6AA 3UD3P 1O3SA 1EIYB 2XHCA 3EJMA 2ZITA 1OJLA 3LP1A 3ZXSA 4KMFA 3HOWJ 3TA1A 5AONA 4DV3F 5HBMB 2ACJA 2B43A 4DX8H 2Z9OA 1M0SA 4IRCA 3AFHA 5IC4B 5CYMB 1RTHB 1Z2LA 3T19A 3RB6A 4FBTA 4ZLNA 4NOHA 3CIZA 3CUQB 1ZM3A 2VFTA 5K7HA 2B8PA 1MWZA 1JKHA 2XEXA 5HP1B 2CNKB 1WC1A 1BQNA 3QO9A 4G3IA 5FROA 2IAJB 1FOXA 1GH8A 3TA2A 1RT6B 4HVZA 4KFBB 2F8EX 4CH1A 2E1RA 2UVVA 5C24A 4GKKF 2ETHA 2NXUA 2KHDA 1S7OA 1XCVA 3HT0A 1IO2A 2JL9A 2MA3A 1WRJA 1T3OA 2BKPA 2DD8S 3NGUA 3EGNA 2PIIA 2KP6A 4H4MA 4Y7NJ 2F4VF 3OFEA 5KT2A 2OPQB 1BJZA 3CO7C 2B7CB 2CGPA 3HPGA 3I71A 3FXQA 5IYCJ 1QRYA 2DVIA 5IP9J 1BI1A 2XSDC 1OIAA 4DR5F 3GFYA 1J7KA 3OFHA 4NXMF 1MN7A 2D7SA 1AKHB 2P81A 4PK4A 3W65A 4AWXB 4C0OC 2E66A 1NJWA 5DG9A 2AGPA 3BG5A 2CUFA 2AJ1A 5D78A 3CDWA 3HKZD 3R5BA 1U2FA 2PEHA 1YO5C 2VKZG 4O3SA 1BLUA 3MKLA 3LPEA 4E7SA 3OL4A 4R25A 4HRIA 3BR2A 1RK8A 2M5YA 2H1LA 2QO3A 3E5XA 1BL0A 1IQTA 3EZUA 4OHVA 2NSCA 3JTHA 2I5JA 2ZE2A 2OAZA 2XMJA 1YW8A 2WHOA 3SEZA 1XBWA 2UXDF 4OHWA 2D69A 1MLAA 2W8KA 3L2WA 3D54A 1HOMA 3TO7A 2XS5A 4TKTA 2QEXS 1FPQA 1A7GE 2WB4A 2UXBF 5HATA 3BF4A 4MFDA 2DA4A 1E6YB 1U1PA 1TMMA 1VQ8I 2R7TA 2E7VA 2MLGA 1TKTB 1SH0A 4NLXA 1WH7A 5KFWA 2UV8G 1YITS 1M1GA 5E8GA 2BY0A 1RUNA 1FJEB 3S3OA 4LLGF 4AXJA 5L3FA 4F4ZA 2MQPA 4NASA 2XI2A 3DYAB 3WZ0A 4CO8A 4UZCA 4XKVA 1HYSB 2VN2A 2R3VA 3WX4A 2ZWOA 3I54A 2F1FA 5GPAA 4E7ZA 5A2QK 1TL3A 1P4AA 2QYGA 1ZQ3P 3G86A 3SXLA 3WTWC 2V2KA 3DGPB 3ENVA 3RDIA 1DU6A 2DXDA 2GGPB 1ZETA 2JH3A 1FOKA 3FISA 1VQYA 1OSCA 5GPCA 3KZIC 2OPSA 4NDLA 2W9BA 2HURA 1N5TA 3M9NB 2ASYA 2ILYA 2HFUA 1D0ZA 2MKIA 3HHHA 2K9LA 2ACYA 1PCAA 1ZAOA 2MZ1A 2BV6A 5L8RC 1U6GA 4B9LA 1SD6A 5M2RA 2ZH4A 2U1AA 1FP2A 5ETKA 5KFCA 3I5UA 1WHXA 1VQNS 1PJ6A 2M87A 3G8TA 3V6DA 3GV7B 3LGHA 2CQ0A 2ICWG 1WSRA 2NSBA 5EN1A 2L7MP 3PIPF 2D9PA 2R2SA 1NB2A 5KFFA 5J1UA 4MAKA 3BO2A 3D6MB 2DYAA 3FFIA 4PZVA 2UXBJ 3UCGA 2OO4A 4LFBJ 1YBUA 1VISA 5LOQA 4N7TA 5I3QA 3DLHA 1FWPA 2KFNA 4DN0A 2KT2A 1MH4A 2VPWB 1NKBA 4P2FA 4CH0S 1FRMA 5AIPA 1QZYA 1DTQB 5J8FA 4DLEA 2ZKZA 1RYRA 4XQFA 2DW4A 4E2FB 3PUBA 2J9DE 3NG8A 3OSPA 3QZ7A 1HL6A 3LP2A 1XSXA 4PFOA 3C16A 3EICA 5M5YJ 1PP8F 3JQKA 5E2QA 3HHNB 2RS8A 4M94A 1I3QJ 2BX6A 2EZLA 1BR1A 2KYZA 4IKFA 5F0HA 5FJ8J 1T11A 4KE5A 1VRTA 5LJ5Y 4BEHA 4ZYDA 3RZOJ 2CNOB 2JLFA 3AD9C 4PPZA 3FXKA 5BJRA 4AE5A 1YS6A 1JLGB 4JX6A 1RABB 1J5EJ 1H9GA 5CVIA 5J1YA 4M5HA 5K9FA 1UVKA 5CVJA 3IG1A 1FX4A 3SJMA 1SANA 1ZA2B 3JSMA 1YRXA 4ZVPB 5CXTA 4WP3A 3ECOA 3QT8A 3DI6B 5MLCV 2FQ4A 1HQEB 3GJTB 2GJFA 3CCVI 5KFIA 2H8RA 3RRHA 1NZAA 1G7CB 4J9OA 2QWWA 4EATA 2UU9F 2V1UA 2JC0A 3P6YC 4ZIWA 1IZ1A 3O3LA 1U9OA 1NJZA 1RT3B 3NAUA 1FJLA 5KFMA 2J8AA 1LVAA 4ECUA 1P6RA 2K7KA 1IXRC 3FZ2A 4ES2A 2XIGA 4X0GA 3CTAA 2P7CB 2XAUA 3MGJA 4F04B 1OMIA 2HTSA 4ZP7A 1IBCB 1E6VB 3Q3SA 1R8HA 4YY3F 4IH7A 4EU0A 4KPYA 3U21A 4ED3A 1VQSA 3OUYB 3BOQA 3PFOA 4EO8A 3TEDA 3H3ZA 3S7RA 2JPCA 4M5LA 5J2NA 4G7OF 3GFLA 4YELA 1UCRA 3G6ES 3FZVA 5F0WA 3G6XA 3Q89A 3HXMA 3AB2B 3CJRB 2VBZA 2MZTA 1SL1A 3MPDA 2P7VB 2RVCA 3SSQA 3UKGA 2IMOA 3SFIA 5A8RA 2RN7A 4EEYA 2BOPA 5D4NA 2AX1A 1RTIB 3MQ0A 1TK8A 1VI0A 1IKYA 4GRIA 1U0JA 1XTZA 5JLXA 4C3JJ 2GQCA 4N8NA 4MKBA 3H42A 4WX9A 3TVYA 1XMOF 5K5MA 1S0MA 1X1DA 1CF7B 4AQYF 2DQLA 4EMSA 3QGIA 2AYBA 3M1VB 1U1RA 3K8VA 1H2TZ 2I9SA 2C2DA 4Y2IA 2RQ4A 4LB6B 3IBFB 2A68F 3EYIA 2LFBA 1TU0B 3ABTA 3JRDA 5DG8A 3BQ1A 4URSA 2M34A 1GAOA 1S6QB 2C2NA 1V9OA 4JYAF 2KDZA 3D1OA 2M88A 4LFCJ 2E2IJ 3KK2B 2GFFA 4UB6C 2RU9A 2FPHX 3H3UA 1K47A 2F3JA 2G0EA 2R7RA 2BZ2A 4X2BA 4ILMA 4E7IA 1FTCA 2IVYA 5F9LA 3GFIA 2XS7A 1R36A 2BJ3A 4JI4J 5HS8A 1FXRA 4ELUA 3DTEA 4DFKA 1F9NA 2OEMA 3H90A 4ANDA 1JLBB 2F4FA 1FBQA 2G7HA 2KRFA 4Y3OA 4LRFA 4R8UB 4ZYAA 2B7BB 4DZJA 1NLKL 2WVCA 3K69A 4MIWA 1XX5A 4ZYHA 4NMXA 1YX3A 3N9UC 3I6PA 4LK1F 4B9TA 1TNSA 5LEJA 3KMQA 4Y2MA 5IZHA 3KP7A 2KIUA 4GO7X 1UHSA 3HVTA 1ZRFA 4OV1A 4DG1B 3FZBA 2NPFA 2X85A 2MZJA 5FLXK 4EGYA 1T03A 2I5JB 1FKPA 1ZLJA 4HF1A 2A0FB 5A8KA 4MK7A 2D3UA 2WCXA 3BDEA 3A01A 4JV5J 3CXCR 2E9RX 3TRGA 1WD6A 1KU7A 3CMYA 2E29A 2Y8WA 2XZWA 1CC8A 4RWWA 2HNHA 2DKOB 3FMBA 2KIQA 2WAQD 3ZNJ1 3RIRA 1WF2A 1R0BG 5THWA 3CF5F 1KQ9A 1LOUA 4RW4A 3CCUI 3C2PA 2Z56B 3HHLA 3V2UC 4X62F 3HKZN 3NBPB 5H9EK 4JBAA 1H9TA 3TP3A 3RB3A 1CQNA 3A1YA 2C2ZB 3IR7B 3KLHA 4DV7F 4BS9A 3HRUA 1ZR2A 3AAWB 1HBNB 3CNQP 2FXAA 2EFQA 1JIHA 4PXBA 5DS9A 3RYLA 3E5QA 2VQFJ 4C2TA 2DBBA 5AJ3J 1KTVA 1TFWA 2Y9HA 1IRZA 1R43A 2ECCA 4FX0A 2R8GA 3OBIA 1Z4UA 2FB0A 1WFXA 2Z99A 3SEOA 2LNBA 2L0KA 5IPAA 2B4PA 2GW8A 3P3DA 2EPFA 3E1SA 1JGGA 3M8RA 2KTQA 1U02A 4ZLPA 3S01A 2GGPA 4DLGA 3NARA 4C30A 2HYIB 4LRBA 1IBMF 1TL1B 4OYBA 2WC2A 1C0TA 1LWEA 2X6YA 4D7MA 3NGKA 5B3SH 2QFJA 1WC5A 4I2QB 1TL5A 2W25A 2R7XA 4DQPA 2X1EA 5T7LA 4ATNA 4DR6J 3HJFA 2IHR1 4QIGA 1MBEA 5HAOA 3G71S 2H54B 4CHUA 3CO6C 4MQVA 1WGXA 4TLRA 3FMRA 3X2QH 1L5UA 1HW2A 3IC1A 4P74A 1B64A 3ZMTA 2FUG2 1FYKA 2MQMA 4G1PA 2E9TA 1ITPA 2WZ1A 2I1RA 4DGWB 2E1AA 2JX2A 3DPUA 4HKQA 3FFIB 3L2VA 1HNWJ 2YPZA 3A3NB 2C6YA 3I64A 3U27A 4CLUA 4CT9A 5DETA 1GUUA 3W5YA 4I64A 3RSNA 4Q8EA 2E1MC 5EGOA 4HYEA 4Z7CA 2RQQA 4FETA 1DTQA 3I0SA 4ZS6A 3RTRA 2PMZD 1X58A 3PACA 2GQQA 2CQKA 1JE8A 4JP0A 3KLOA 3MCOA 2APOA 4UTGA 4DR7J 1HKSA 4W97A 3AJ2A 1R9TJ 1JUMA 4A4JA 2J7KA 3W2VA 4PJJA 2H65B 1OPCA 4OWRB 2VFRA 2COLA 4I6WA 2GA1A 1R31A 1VS3A 2OTJS 1RT1A 2VLAA 3HDSA 4DFJA 5J1RA 2MGZB 5JI6A 3HOZJ 3LGNA 3L09A 2ZDPA 1RAOA 1RDRA 3K57A 1MBFA 2YXLA 3QMQA 2FMYA 4J9VA 5LMNJ 3SI8A 4NC7A 2DTRA 4HPQA 1L0OC 3GZ7A 5FLVA 4RW6A 3LAKA 3G87A 3S14J 4A93J 3QIPB 5DO2A 1RP5A 4EZ6A 3K5MA 1X9MA 2VJ5A 3QPIA 3OW2R 5L1IA 1NG7A 5ILUA 1JI8A 1YDLA 2QENA 4QPXA 1FK9A 4OIQF 2OJ3A 4O5VA 4IFVA 2KKHA 1RBOB 3KXDA 3K2AA 4B3AA 2CQDA 4Y2AA 2HZTA 1F5BA 4IPAA 5D6FA 4N47A 5J40A 2LP0A 2C3OA 4UT4A 3OVSA 2D1HA 4F50A 1SCJB 2O6GE 4RU2A 3AHPA 2MKCA 3TVKA 3F8CA 3HSGA 4ERDA 1XSVA 1HR0J 3J7YI 1EHWA 4DUZF 4ASNA 3O2IA 4J9KA 2XAJA 1NJIT 1KGSA 2V1DA 2IFXA 4S05A 4IO9F 4USIA 2NNNA 2H48B 4DPTA 5LHHA 4M6XA 3M8FA 3V81B 5CJ9A 1PGZA 3FKBA 2CWKA 1BIAA 2Z0GA 1U1NA 4I0AA 2OP5A 2YQ0A 1X3WB 4C3MA 1WZ2A 5KFHA 1MWYA 2B3TB 4NEZA 2V9WA 4CCHA 2POKA 2X1FA 1RT7A 1AFJA 2DGOA 2DY1A 4IOCF 3NS5A 4DR3J 2HZCA 2BRKA 3G82A 2HXOA 3OHBA 2FLOA 2HBQB 4B17A 3MURP 1VQMS 2GOMA 1HDDC 1T9VA 3FCVA 1LUJB 2XAGA 3SZGA 5B1BH 3LQVA 1EQMA 3JW4A 3BTLA 4OI0A 2GNKA 2BQUA 2EV5A 3SYTA 1UW4A 3MWBA 2XYGB 4ENKA 2DNGA 2X6OA 4OX8A 3TUJC 1H2VZ 3HP6A 4F67A 1R22A 2RD5C 3E51A 4UUVA 3ZQ7A 2MGQA 2HAFA 2J5PA 3ISNC 4DL7A 2VI6A 2HTJA 2V4JB 1RE1B 4NZ7A 4M3FA 1QY7A 4C8LA 4FZVA 3LP1B 5JXSA 5ICEA 4ZVUB 5DDQC 1SKWA 3RAXA 2E5ZA 2STTA 5KFNA 4BJ6C 1SKSA 3LANA 1OS5A 5TISC 5HS7A 2J7WA 2G0JA 5C42A 3TBIA 5F08A 1DZ5A 4DV1F 3OXGA 1TWHJ 2MLYA 1NJYA 5GAHU 1LEAA 1OJ4A 3SZTA 2HG4A 4KB7A 2WRMA 1DTTB 2D1CA 2UUBJ 3JS9A 3D6TB 1X4FA 3KLFB 1JUSA 1RXOB 5DZ6A 3HHDA 2LEBA 4PDKA 3C2BA 3I58A 2JTVA 2FRHA 4BHBA 3MKZA 1APLC 4I7FA 5EG0B 2J6UA 2VIHA 3T9NA 4NC8A 1W0UA 3FXRA 1X19A 3I59B 1K83J 4HLXA 3Q8UA 4C9YA 3IBCB 2CIMA 5SZTA 1RGVA 1XNRF 1VQKI 5IP7J 2OUGA 2XGXA 1S79A 2RQMA 4DR1F 3BSOA 1EQ0A 3EPIA 2NYHA 2F5GA 5IXUA 2DK8A 4II3A 4KPCA 3KLGB 2TCTA 2DA3A 1HQUB 1X4OA 3M2RA 2LKPA 3HHLB 3GYGA 5H6RA 2Z2LA 1LJ9A 2F5EA 4K2EA 2FJVA 1I94F 1AT1B 2AXLA 3FRYA 2RAEA 4EZ9A 4HX7A 3GTMJ 2FBIA 2LY9A 4J9UE 2YU9J 2M4MA 4CNYA 3FGVA 2GC8A 2VXDA 3ULHA 3PFYA 3W9IA 1LB2A 1CQMA 2HKEA 2ZE2B 3DKDA 4CYCB 4JI8F 2QV6A 2HI3A 3MM6A 1F1BB 1AU7A 2LH9A 1O5JA 1NHAA 2IYIA 3WC0A 3KP5A 4HHHA 4NL5A 3IC7A 4IRDA 1QM9A 4DUYF 4WF2A 3HHKA 3GFHA 4JBCA 4TVAB 5H9FJ 2BUNA 1S7HA 3LTOA 2ZXJA 4FYVB 2KKOA 2WADA 2XB0X 3EUAA 3ABUA 4LBPA 3C18A 2Y2ZA 4LRCA 3Q8RB 2PJRA 1IKWA 2FD2A 5FD1A 4K0KF 3DN9A 4TV7A 4WFXA 1X9SA 1Z6RA 1S12A 1X3UA 3TX8A 3K5PA 3GZ5A 1JB0C 3OS1A 2GIQA 3CSKA 3UN2A 2CUEA 2JRMA 1NO8A 2HSEB 1QZEA 2IYGA 5DGBA 1RI7A 4IFYA 2KN4A 4OYMA 1J09A 2FHMA 3Q22A 1U78A 5KFGA 1JTYA 3M30A 2IDLA 1PG5B 3IGNA 1F2GA 4NLYA 2YX1A 1AA1B 4V19K 3CESA 3ZGKA 5FLMJ 4HX4A 5KK1A 2XPUA 3VODA 3KTQA 1N6QB 1FWLA 3B4DA 2DRBA 2HZDA 3THTA 1S72I 1A9NB 5GMKa 2XULA 2MY8A 4W4MA 4WFYA 3K9TA 5LMUJ 2RNJA 4EJWA 3I0SB 4C3LA 1IBMJ 3CC4S 3IGVA 2F4VJ 3QFHA 3V6HA 2LXUA 1Q1VA 1QA6A 3ZTPA 4P71A 1ZG1A 1CBKA 1WJCA 3U1DA 1TKZB 1N8RT 2J7UA 3EDQB 4RNNA 3RUBL 1FSHA 1RT4B 5IOZA 4EWTA 3E6CC 1WWHA 4A3LJ 5EDNA 3ITHB 4C8MA 3C14B 1ITYA 2VE9A 2XKPA 1UFWA 2RC4A 1YZ7A 2LSOA 3J81K 2XC7A 4M3EA 5KFYA 4QWQA 2JEJA 4Z7YA 3KLIA 4PGHA 3MAAA 4ZKAA 3OYJA 2L4AA 3ZTQA 4LSLA 2P2CB 1S9GB 1SD7A 3S17J 3I0RA 1KNZA 3THVA 1N54B 4ICLB 1EH7A 3P7NA 1FKOB 2KG1A 2HDCA 2VG5A 1ZBTA 1XC9A 1YRNA 2RMLA 1IBKF 1HWIA 3FXMA 1Y7PA 3CIMA 5K5RA 4AVPA 3M2VA 3CW2C 4HDVA 2WV1A 1OR7C 5DDRC 3KG4A 2GMJA 4BQQA 1LQ1A 5F3ZA 4Y6IA 2KRRA 5ERIA 1FTTA 2TDXA 3ENWA 2P6SA 4KDPA 3FKJA 3D5MA 2FHOB 5B7WA 1XB4A 4Q7AA 2XB5A 1Q53A 4O6JA 3D0GE 1XWLA 2RF2B 2DOEA 3MKYB 4BACA 1W2BR 2PI4A 3DI6A 2AJ4A 2OZ6A 1QD1A 1YW7A 4DJAA 1PJ5A 4IO9Q 1V55H 3MR6A 4JI6J 1U6ZA 2ZH1A 2KVQE 4QR1A 4ETZA 1W0TA 3M9MB 4X65J 1P7IA 2HIQA 4DN9A 4DR4F 1UCNA 3TO8A 3Q0UA 1AROP 1NUEA 2O5RA 1FT8A 4MIBA 2Z1DA 4ED4A 1XD7A 2RU3A 2HS3A 4YUDA 1F5TA 4ED2A 3UCUP 3GEZA 3ICLA 5KFZA 2YTCA 3EVWA 6FD1A 3F44A 3WG7H 1RT6A 2HRUA 5BR8F 1E6VA 4HLBA 2GMLA 4IJAA 3ISPA 3K7AJ 5TJJA 4HF0A 1WJAA 2W2OP 2UXCJ 3RGIA 1FLIA 3BGRA 4OZ0A 2LLKA 5ICGA 4QWBA 1YX2A 4ED5A 3PJ9A 2AEJA 1CC7A 3TI0A 2O5DA 2XO7A 1H0MA 3S2HJ 2IY5B 4J37A 1YYVA 2XQCA 2OEKA 2QN6B 2D2WA 3MZIA 1JT0A 2YWFA 3HSJA 3B8HA 2H4YB 3PG9A 4PPDA 2V0NA 4ZLLA 3LSTA 2FBKA 3OTOJ 3T1YF 2BRLA 1QO0D 3V4GA 5IT0A 2EFNA 4ZVQB 5FD6A 4K4WA 2W4PA 2EV6A 5ITHA 3NQOA 3BPDA 3KJNB 3NGTA 2LMIA 4Z6YA 3QNWB 2V69A 4PUOA 2NOGA 3I96A 2LY1A 1C1BB 5D4RA 1NK7A 2YX4A 2FU4A 3H5NA 3QQAA 5DJBA 5KFBA 4USWA 5KG1A 1FE0A 3RBDA 4RR5A 3FCWA 3HPOA 3K7RA 1XQIA 4XK4A 1HD1A 3N5BA 4AXIA 4N8OA 1XSDA 3PO5A 1R8BA 2BJDA 1UZHA 1IV6A 3T1BA 5LFAA 1Q16B 1XJWB 4ECWA 1RAGB 4PWDB 2CYYA 3N6MA 4OZNA 4RB3C 2E1OA 2X0LA 3TOQA 4HTJA 1D8YA 1QPMA 3FBIB 5DGAA 4LF8J 3MVPA 3GE9A 3PEJA 1RLCL 4P9FA 1D1UA 5IT9K 2Z2ZA 3TKYA 4LR9A 4DF8A 1UTAA 4WK3A 5KFOA 4I2PA 3O6BB 1TKTA 3ZZYA 1PUFB 5D4LA 3K10A 1BD6A 3SZPA 4RGRA 4IOAQ 3TJAA 4B3SJ 3IMQJ 3HLUA 4XOTA 1SAXA 1NH3A 2JUGA 2NREA 1HQUA 4HTIA 1FDDA 1LWCA 4P72A 5KG4A 1V3SA 4C9DA 4K5RA 2AV5A 5KAFC 3ZQIA 4TY8A 3DLAA 4LUBA 1XCBA 2F8HA 3W6VA 4N76A 2M8HA 1U5TC 4EMDA 4DG1A 3CJSA 2VZ9A 2H09A 2H5JB 4OYPA 4DV5J 4DSJA 3CWJA 2Z16A 1HQCA 2OPSB 4EBCA 4DPUA 1JNZB 4KIFA 5HLHA 4RGUA 2COBA 2RQCA 5F0UA 5FKKA 1IBLJ 3F6VA 3HC7A 4FASD 3QBCA 3RR8A 2MC4A 4CH7A 2JVHA 1O57A 2L7ZA 4O0NA 2L5QA 3PNIA 3G73A 2CJAA 3MFKA 4DSFA 5KFPA 1R5ID 2HDDA 2QA2A 1FD2A 3FXJA 3T5LA 3I5AA 4ID5A 2JOQA 2WVDA 3CJKB 4IRHA 4ANEA 1NH7A 3UVJA 1W4MA 3IV5A 4BUPA 2HQNA 4Z2YA 2AEMA 1KQSR 3RRGA 4ZDLA 1MSFC 3HVRA 1UZCA 3Q5FA 4HH1A 2YH0A 2C3UA 4NLPA 1JK9B 1VQNI 4IFYB 2YNGB 1W1WE 3OL6A 1IN5A 2NVXJ 2HWIA 4ZZLA 3BQ2A 2KT0A 2ZJQF 2V63A 3LA3A 2Z57B 2VG6A 3KLEA 2HHHJ 1BWEA 2FNPA 2HAIA 5E3LA 3BSNA 1QTNB 3VHQA 5HK4A 4NI2A 3HYIA 1NDKA 2XY6A 1DY3A 3CCSS 3IWXA 1PBUA 2OCEA 5D77A 4RGSA 1GX5A 5JHUA 4RUCA 2BEFA 2FLNA 5FKMA 4OQJA 3D1QA 1Z6TA 2DPDA 3QYYA 5KFEA 3CCSI 3DCFA 4LMZA 1KONA 1CJVA 3R9LA 4EM0B 2XHKA 2CRGA 3F56A 4ZPVR 5E79C 2WAEA 3FX3A 5IT9U 2IM2A 2YSRA 3W5ZA 3KHLA 3CD6I 3DTKA 1P27B 1RWPB 5LHGA 4OX9F 4B1RA 4ZVTB 1S76D 3LOUA 3LMMA 2AHQA 4MKYA 1B70B 1MU2A 3J81j 3OYNA 3REOA 3LSJA 2M0CA 5F8MA 2V6AA 2Y0SN 2DH9A 2E71A 3LFKA 1JMTA 3TAMA 3LL7A 4DZPA 3CD7A 2MB0B 3RZDJ 1BN5A 1AOYA 3C6TB 4KO0B 5DM6F 3NXZA 1HHSA 3N01A 3GP9A 2KJWA 1YBTA 1YLXA 2J9CA 2BMBA 3JQJA 2ATCB 1FKOA 2RUSA 1DDNA 3FVYA 3LAPA 2RHSB 2OPTA 4PUSA 3GUDA 1AUDA 5I4MA 2DR7A 2R92J 4G9YA 1DARA 5FLXZ 4I76A 1DPUA 3VWSA 2CSOA 2W01A 2JK3A 1U0SA 2HHTA 2E5GA 2MYFA 1RHRB 2W9CA 1PSDA 2RE1A 1WHVA 1LV5A 1OSDA 2R4GA 3DRPA 4GVBB 2HMIB 1J2VA 5H2FC 4XLEA 2KJBA 3MMCB 3AKZA 2H5EA 2W4DA 2IGNA 4U6PA 4F3OA 3CCQI 4JI3F 1NPKA 2HFHA 2LY2A 3ZQLA 3GZNB 1KA8A 4JX5A 2AWZA 1IV8A 1L3KA 3DXBA 1TV6A 3J7A1 2YKNA 1FJGF 1WELA 4Q2LA 4ZJOA 4XOPA 2IA2A 2HHPA 4PYDA 4AIJA 4IFVB 2MKJA 3HCXA 5HN0A 1WTBA 1VQ6S 4H4KA 4X4SA 1TQIA 5D5XB 1K4SA 4MJKA 1JKRC 1FA0A 1S1WB 1HSJA 2DXEA 1AA7A 4OZ5A 4J7CA 2BKNA 1XR6A 5CD4A 4X64F 4ZVRB 2IJRA 2IRFG 3DMJB 5G0RB 1JLEA 2ZKTA 4LF6J 4HT7A 3J7Z5 3RG6A 3D7SB 4I4BA 4GDFA 4V2FA 1UWAA 3AQPA 4O3NA 2H6CA 3ZN0A 2V2QA 1HDPA 4QSHA 3MZYA 2FDNA 5ETNA 3UPFA 2XB2D 3NS6A 1MKMA 3PYDA 4RUBA 1V5IB 2HRYA 3MOZA 1LQ9A 3M8QA 4M63A 5HVHA 2OUMA 2O3FA 4ZVHA 2VH7A 1XNRJ 1IQZA 4KR0B 5E18F 5ETTA 2KJCA 2FOKA 1ROFA 3L3CA 5ETOA 2W7AA 4RB0A 4HI2A 3LSRA 4YB5A 2KDOA 3ADAC 2QSFA 3K8WA 3CMAS 3H2VE 4FNIA 2XNQA 3M32A 1E0EA 5L38A 3QZ8A 4CI0B 4WFBQ 2GMHA 4YEAA 3W8PA 2ASLA 2XGDA 1TWAJ 4NUBA 4PCQA 3CCJS 5I42A 3EXCX 3D5RC 1JLAA 1IXSB 2K4BA 2Y1IA 3MAHA 3CD6S 2NS1B 5B0FA 2MSYA 4FDFA 5E1XA 5IM0A 3PW4A 4A5MA 4H4MB 4WXCA 4UUSB 1VOMA 4NCBA 2HFVA 4MFEA 2CJBA 4HYKA 2XYPB 4DU7A 4J9QA 1S99A 1D9DA 1G6BA 3CZ6A 1KRPA 4U7UD 4ZCKA 3E6MA 4IKAA 4WCEQ 1K1SA 4FXWA 1NU4A 3J7ZT 3L1PA 3GWZA 1FNMA 1WQ2A 3BH7B 3GTQJ 2F48A 5FLXY 2ZJRQ 3MPYA 1WG5A 2JLGA 3FSYA 2PI0A 1VI7A 3PNTA 3TMOA 2IS6A 1R00A 1NK3P 3HJEA 2CO5A 1XGMA 3U2RA 3KLHB 2FZKB 3E2EA 2DH8A 4LVOP 5F1RA 1PUEE 1HCRA 3PSFA 3I3LA 1RZMA 4NRUA 3NCRA 5KT3A 4YDDB 4M5JA 4DPWA 1V4RA 2LYVA 2UV1A 4LF4J 5FFXA 1IUFA 3IWZA 1XNQJ 1RAIB 1G8XA 5D0HA 2HKXA 4YR3A 1Q4RA 1MBHA 2C42A 3QRPA 2YNFA 5F6FA 4P9SA 4I7FB 4EUVA 2ZBQA 1TKDA 2KI2A 5JMNA 3DRXA 3GTPJ 4IHTA 4MHGA 2H9ZA 4ZDPA 4URQU 1KU9A 1VGYA 2J76E 2K9QA 3Q0VA 1HBOB 2XBPA 3V5RA 4KGMA 4J9MA 4IQ4A 4LIWA 5KCMA 2DA7A 5HMYA 3L4BC 1NXIA 2I0XA 2ZXWH 3Q8SB 3SYZA 3M05A 4L9JA 1AW0A 1V6HA 2UP1A 3LSHA 4L5JA 3QRRA 4HNTA 3I4NJ 2LG4A 5FD5A 2KFYA 2ZJRF 4OZLA 3TP2A 2ZDOA 5JLWA 2W8LA 2C1EB 2YKOA 2BGCA 3QGPA 1U1KA 1S6PA 4RJVA 4OINF 4TY9A 1U09A 4LSNA 1LXJA 1S1TB 1EKEA 4C8KA 1DLOB 1LFUP 4KTQA 4I01A 3UVJB 1SMYF 3F72A 2WY7Q 2A6MA 1BQMA 4QIEA 3SSRA 4CDGA 4RW9B 4U0WA 5BOXA 3DRSA 2E5NA 5E41A 2P9GA 1X3ZB 3OYDA 1T02A 4WJBA 4AT1B 1FIPA 1JJ8C 1B59A 2CQPA 5K20B 3OJSA 3HJVA 1FBSA 5LRSA 3BR9A 2QA4I 2DITA 2B6AA 1IF1A 2HEKA 1W36D 5J1EB 3CUOA 1XMXA 2QA4S 3M6UA 1NAQA 3TGNA 4GFBA 3KNGA 2RUGA 4USVA 3ET6A 3GSIA 5HANA 3M8JA 4H4KC 5K8OA 4O3RA 2ZJPF 4KT6A 3F0NA 4QW8A 2CQ1A 1HPZA 1FF2A 1RSCA 5KFAA 2IM1A 4A8YA 3PW2A 3ECHA 4LFUA 4HNVA 3ERED 3UNGC 4IOBA 1I5ZA 1NKEA 3I9ZA 2IIHA 3KLGA 4CO5A 5HNFA 1Y5LB 4L3KA 5KFJA 4BBSJ 4L3NA 1OQ6A 2BABA 4HDGA 3AOAA 4RW6B 2Z2SB 1OCPA 3LA0A 2P6TA 2EBGA 3M07A 5EHHA 2OTJI 3RW6A 3M30B 1T98A 1U8SA 3T9ZA 4EJOA 1HBUB 4B9UA 1RBAA 1RAEB 3ZMVA 1G4CA 1RU1A 2FJAB 2OF7A 3OTOF 3NAHA 2X1DA 4BL0B 2DRDA 2DCEA 3GYHX 2WB1N 2R42A 3JCUC 2KT5A 1NSPA 1MMGA 4FPIA 2A6HF 1P4WA 3M4OJ 2B0LA 4A3JJ 1FVQA 3ZRGA 2VOOA 5BYQA 1ACMB 1S9HA 2KRBA 3C19A 5E17F 2K4JA 2K2PA 2KJVA 1FXDA 4PZJA 4UOCA 2EWHA 2VDIA 3TARA 2NXNB 4PJLA 4A0XA 4XIDA 2M3AA 2OLWA 4WIQA 2OQRA 3TZYA 2GO9A 2ZUAA 3HD2A 4X64J 3OL3A 4RWXA 3BM7A 2BHYA 3ILIA 2RNEA 1N0UA 1U45A 4HQEA 3DOKB 1R6VA 2E5HA 4QBUA 2CUYA 2A3SA 4LJMA 2V8PA 1N5QA 3MMCA 3KLIB 3T5HA 3K59A 3KK3B 5K8MA 3MKWB 3ZZUA 4C3KA 2IDEA 1FRXA 1ETQA 3RPUA 5CYQA 3IA0A 4TYAA 3WTYC 4ECYA 1VQPS 1DP3A 2P9EA 3ZQFA 3HDDA 5E5NA 5KG0A 1VQOS 3O5TB 4GVLA 3WU2C 1EA3A 2B8QA 4OJHA 2HWTA 5KT4A 7AT1B 5AIQA 2CQXA 1IKVB 4B9NA 1UJ8A 1M5OC 2Y0SA 3ASNH 1YHQS 3MR7A 3BC8A 2G2ZA 2DXFA 2ALYB 3UI3A 3GFMA 1Q79A 4HHJA 1SV5B 1JLEB 3MM5A 1O7FA 2VQEF 1UPPA 5LMUF 3R27A 1B9NA 2BOAA 2P8IA 2FGCA 1FRHA 2HQDA 2IGKA 4HW0A 2XC9A 2K3IA 4M6YA 5IOYA 1WNEA 4PXCA 3L00A 1B4SA 5EZGA 4YN3B 3FBBA 3G1LA 1CJTA 1I50J 1VBKA 2EFWA 4B43A 3AFGA 2EZKA 4N4OB 3IL2A 5CQEA 2CADA 1S0VA 1YJWS 2IA1A 4M74A 2HPUA 3HSFA 4L0YB 2DGXA 4AFFA 2HNZA 3UDLA 1S1UB 2NS0A 3K0LA 2PGCA 2X1AA 5FB2A 3MECA 4DL4A 2GAHC 1H8AC 2Y0MA 1I6HJ 1D9AA 3DOLB 3H0DA 4WXHA 4YIRX 1K78A 1Z05A 4X4VA 3OR1A 3EYYA 3FIWA 2HQ3A 1MNDA 1IC8A 2M52A 3VAFA 2L7KA 2EJRA 3D1NI 4K4VA 4KAIA 2HZVA 5DM6Q 3CMES 1KTQA 3BR0A 4DUTA 3BO3A 3GTJJ 2DEJA 3BGRB 1C4AA 1UVMA 1WI8A 4DSIA 2P0WA 1F2HA 1TFYA 3OYGA 4R5PA 1I94J 4NQWB 3TZZA 4ZVSB 5ETVA 2DEIA 3W8GA 4EJUA 4U7BA 4HA8A 1NSQA 3W66A 4A3EJ 2KU7A 2KXNB 1ETYA 2JA8J 3L9FA 4OX7A 3CDUA 1MDMB 1HQ2A 1UWBB 2GIZA 2XGCA 1FOYA 3MCZA 3SSSA 2V94A 1RZ4A 2IRXA 2Z8QA 1FMWA 2RKHA 3A2KA 2GAUA 1IN4A 5HJXA 2IS4A 1RWXB 3C2GA 3A3PB 3GVAA 2XI3A 2YQ1A 1T0FA 1USSA 3R0JA 5GAEJ 1NHKL 1TP4A 5K7ZA 4JI6F 4DMZA 1WC6A 3M8PB 1S29A 4M9SA 2XF6A 2R0QC 4DR2F 3M7GA 3MPUB 1RAHB 3R1LA 3IS9B 3PHTA 4D3HA 3BZQA 1OISA 1R1UA 5A8KB 3QPHA 4CYCA 1FI4A 3JR9A 2BJ7A 4PG6A 5L3BA 2TRTA 4Z2XA 2L7FP 1B8IB 3JTPA 1FZPB 4ZPCA 3C46A 2A10A 3MMBB 1WACA 1O6XA 2BV3A 1ELOA 2D5VA 3T8RA 3OSFA 3AY0A 2XVCA 5I3UA 4XICA 5JR3A 2NXEA 1I3AA 3PO3J 1IKWB 2CJKA 3DKXA 5TRDA 1SC3B 4ZITA 4A8OA 1QJHA 3QATA 3D6FB 3WU0A 1ZYQA 2BXYA 2QSGX 1FCAA 5HLFB 2A07F 2MKYA 3BO4A 2QX0A 1KVIA 4WTYA 4D9JA 2ZUGA 1QQIA 3T5KA 4XPEA 1S6PB 4DCJB 4YR0A 4U9RA 1U1QA 1NDPA 4JI2F 2L9SA 1JLCA 4M5DB 1UG2A 1ZGJA 3IRXB 2VQCA 2DU9A 1QLNA 2CZ4A 4I68A 3AG3H 2JSXA 5IT9Z 4QWAA 1IN6A 3I5BA 2VKDA 3PQKA 1U26A 2CQIA 4QZVB 1S48A 2W9AA 4JX4A 4QWEA 2FIUA 2UUTA 1X5SA 1RR7A 2BE2A 3ABLH 3JRAA 3PVXA 2I8EA 2W7OA 2IVMA 3MM8B 2HOAA 2O8KA 3ZTSA 4KV8B 1W7PA 3J80Y 1T05B 1OCRH 2DCUB 4TYBA 1EKRA 3UD4P 1Z67A 4H0EA 3DM2A 5IYBJ 5CVVA 1UA1A 4JI1J 4B02A 1SB6A 2QL9B 2VKVA 1F3VA 2ZHBA 1SH3A 3BKTA 1J75A 3NLCA 2R7FA 3W1YC 4YY3J 3CJTB 2H51B 1CS4A 2CPHA 1VLOA 4DV6J 1ZTTA 5T14A 3P96A 5D8HB 3S8SA 2LP4A 5BMZA 4L9VA 4ED7A 4DX6A 5EGYA 5KFUA 3DKWA 2K9SA 3DBRB 1XN9A 1RCOB 5C2GA 2PD1A 3DHXA 2EK5A 3KDNA 2VG7A 3OWTA 5B1AH 1OPIA 3AOCA 4OZ2A 3B73A 2XCAA 1X2MA 1SMTA 3ELHA 3NGDA 1GHCA 2DOAA 4UV8A 3CJ0A 2DPUA 1ACIA 1XR7A 1ZR4A 4UXNA 3WIVA 2ZZTA 2DGUA 1HSTA 2JSCA 2AO9A 5FO5A 2J0XA 2VUMJ 2IVFB 3T6JA 1SVMA 3R0AA 2XRNA 3HVAA 1IR2A 4ZN3A 2XWYA 1WJ5A 2EA2A 2R2RA 2E34A 5LLQA 1VC5A 1F60B 4C11B 1MU2B 2DNYA 4Y52J 2BE9B 4J9RA 4B3RJ 2GCFA 2AJ0A 4L9TA 2K3KA 5CABA 2WB1A 1RWOB 4AIDA 2BM1A 2IS2A 4YHHJ 3AXKA 5EDWA 3QYFA 1C1CA 1OCTC 2VL1A 4N5SA 2YNHB 3BR3A 3COAC 3AB4B 2V8GA 4F4YA 1WTFA 3HHEA 3SQGB 1JJ4A 2CQBA 2W1OA 2JA5J 1QBJA 1GXUA 2JEIA 2OMLA 1FJ7A 2OC6A 3WGGA 2VJUA 4A2UA 2QBYB 1OPZA 4ZK7M 4N56A 2XROA 2F9JA 1VQKS 2L3DA 2DYSH 2ESNA 3A8EA 4KGVB 2KRHA 2QLBB 1VFJA 3WE3A 1QVFR 3ROUA 2HR3A 4WXDA 5J47A 5DV5A 3MUMP 2NZ4A 4QIWN 3PW0A 3K1PA 1RWKB 4OZ3A 1RT7B 2FLPA 1W5TA 2R93J 1U0HA 2AXTC 2HVSA 5B09A 2C3YA 2HLUA 1PYSB 2E5LF 2OJED 1R27B 5KAIC 3VGVA 3QP6A 2BDPA 4ECQA 2DT7B 2ASJA 2LD5A 4FNHA 2VQGA 3VYSB 4G6TB 2RDPA 3PJXA 2L08A 4X4PA 4YDXA 3NS7B 2ADUA 2BJ1A 1LDKB 1DAXA 4ED0A 1S1UA 4LB5A 4C97A 2DMUA 1QDUB 2PC6A 2PT0A 2BZTA 2UUAJ 4XSXF 2FC9A 1I1SA 3BYPA 1BIBA 3PL8A 3GWCA 3CT9A 4RX6A 2AYGA 1T33A 3OHAA 1LW0B 2AJQA 3CJ8A 1BWVA 2R4FA 3HSDA 4NYOA 6PAXA 4LR8A 4Q2MA 5BYRA 1F36A 2V4JA 4PJNA 3UDVA 1N34F 2W9CB 3B4MA 2DIVA 1YI2S 1ZLKA 1ICEB 3VSLA 2XYHB 4WE1B 2QEXI 2ZFHA 5BR8J 2MHEA 2VXZA 3UWTA 4NLOA 4RW7B 1P9YA 3JAMZ 3HOXJ 4UVCA 1UVIA 5H9EJ 4YQWA 1R49A 4R5PB 1IRFA 5K5QA 2M70A 2C2EA 9ATCB 2X3DA 2BACA 5IWAJ 3VGSA 1ZH5A 3GTLJ 1BE4A 3DDIA 1RB0A 4LF8F 2RS2A 3PFEA 4DX7A 5U47A 2UUCF 1D0YA 1PUFA 3DEWA 2GHPA 1RYSA 3MXHP 2BJ8A 2XZTB 3NCPA 2MG4A 2ZH8A 2XRLA 1XN7A 2KVIA 2OFGX 2RDDA 3AODA 1DQAA 2ZB9A 1S49A 4PJ0C 5BS6A 3HK2A 1HLWA 3BJ6A 3MM7A 1GTHA 1FEHA 1YQHA 3HRTA 4KICA 3F22A 4NYPA 4CYUA 4TXSA 2XGQA 1ZHFA 2AZ1A 5EG0A 2CNLB 2MKSA 4AIHA 1U49A 2FX0A 3HZEA 4M9XA 3HZJA 5KFSA 5IT9Y 1O3RA 4IG0B 2MBFA 4B8XA 2W7NA 1XTAA 4DV5F 2LMDA 1IR1A 1TQLA 1Q8BA 3U1MA 2UZKA 2XNRA 1TQMA 3I4PA 3LSMA 1J27A 1V54H 1EB0A 5HVGA 3RYPA 1NDLA 4BXFA 2AT1B 1HWUA 2K40A 3CTRA 3SEQA 1IBLF 5CZXA 3MEKA 4ZN1A 2IEKA 4MFBB 4WK8F 3KJVA 3E6DA 4KC5A 3CJKA 3CCES 1VIXA 2GVZA 3DLLQ 4R0JA 4USHA 4ZIVA 1T9YA 1EV7A 4E7HA 3G4SI 4HHUA 1VQLI 2HVQA 2KISA 2FBHA 2KZVA 1K1QA 2XMTA 3HTSB 1WPKA 2GVDB 2JWNA 5HLFA 3HSZA 1PDNC 3BCBA 1Z3YA 3NGSA 1S0OA 4D5CA 3VZIA 2YNGA 4YHHF 1VQ5I 3J7AY 2DIUA 1U2WA 2W2NP 1T2KA 3FDSA 2HK3A 2NXJA 1HNXJ 3RQIA 4IF4A 3CCTA 4C98A 4G1QB 3IUOA 3KEOA 4IQMA 5HO4A 3OIQA 3C6UB 3UO0A 1YG0A 5DQHA 4XR6A 1HKQA 3QT6A 4XDDA 4LT6A 1P92A 4P75A 3RB0A 4A0ZA 3ERMA 2VD3A 2ZKUA 4P9UA 4BCAA 5KOWA 3QGHA 4MO7A 2LQ9A 2BE2B 1H88C 2VPRA 2XZDB 4RBUA 4Q48A 2LF7A 3PY8A 3LFUA 2DN0A 4K0KJ 2MY7A 1GVJA 2NCKL 1T94A 1NM2A 1XMKA 4ER8A 3H2UB 4W92B 4LSZB 1DLOA 3OT9A 4F4XA 4IG3B 2GX8A 2KO1A 2D45A 1R5HA 4OMZA 1H6KX 3HIFA 2W2MP 2R9LA 1YX5A 2A69F 1E2XA 2VFUA 3TZWA 3N97A 3R5JB 4U8YA 4WFNQ 4XKWA 3KLVA 3ZQGA 2BY3A 4WKYA 2WSFC 2BHZA 4P7TA 3K2ZA 2GJIA 1ETKA 4EYHB 3GF2A 1OYIA 4W1UA 5L3DA 3P5TL 4KRWA 2DY9A 1TKZA 2KM8C 4AD6A 4ZPTR 3OS0A 3DLBA 2MQNA 5J2QB 2LC2A 3W2WA 4CXFA 4MK9A 4BXUA 3IAS2 4WP8A 2E7WA 4XLPF 2R2UA 4DQRA 4ETXA 3MM9B 5M5XJ 3LSGA 2BKOA 2L3MA 1CJKB 1CGPA 1CJUA 4JI0J 4HH0A 4NC6A 3HVWA 3RTVA 4B47A 4DF4A 4RL1A 3JAMU 4OHZA 4YR2A 3MEEA 1S9GA 3EVMA 4Y15A 1REPC 1UHWA 4HSTA 2QM3A 4ICLA 3W9HA 1HBUA 1ZK8A 1BI3A 1FO1A 2CPIA 4ELVA 2EIKH 1Q5YA 2M0MA 3AT1B 5DD4A 2CH0A 2O67A 1LKZA 2JFKA 3OYKA 2YWKA 1M5KC 3V8JA 4FX4A 5E3AA 4OIOF 5E0OA 4S0MA 3IRRA 1DHMA 3H36A 2R7ZJ 3SQOP 5MAOA 2CQCA 4GO5X 2KFDA 4HNUA 4P2MA 3T41A 3TUZC 1KN6A 1O4XA 1ZREA 4HF2A 2KZMA 3QT7A 3ETMA 4YFNF 3ZZOA 3BGOP 4LRDA 4A48A 4HL9A 4U7DA 2ZBIA 3LALA 2ADBA 2C28A 1R0CB 1RKJA 2A2CA 2R5YA 3T1HJ 2L48A 4M1KA 1NSAA 2X6XA 1OCCH 4BJ5C 1JKPC 3CLOA 2LBFB 3SXYA 1TL4A 5GMDA 3K4CA 1GTEA 2O0YA 2BW2A 1VK3A 5DDOC 2QL7B 4J9SA 1XMBA 4IEJA 1URNA 2W24A 1I51B 3K2YA 1U6FA 1DQ9A 5KG5A 5LHIA 2DO0A 1HFEL 4KHMA 1VF9A 2EEYA 1TQPA 2QRRA 2W48A 5CVRA 2IP2A 2GM4A 4OX9J 4RU9A 1Y0UA 3FJ2A 3NKYA 3WGHA 1YJUA 4F36A 1D3YA 4GGGA 4C8ZA 2JVGA 3JREA 5EEHA 4XN0A 3ZQQA 1U47A 3TJ9A 4QYZK 4A3KJ 3TAPA 4WZQA 4F52A 4CO0A 2CPDA 4ZHRB 3BCAA 2RQPA 2HFOA 5GTIC 4XLFA 2X7IA 3TEHB 1TT5B 3S1RJ 3GSDA 1EARA 1WG4A 2UU9J 1S6OA 1NRKA 3IFEA 1WC4A 3IAM9 3TNVA 1RKWA 2ZH3A 4A8SA 1YJTA 4MKVA 2J0SD 4OIXA 1BI2A 4ZMMA 3O8HA 4UVBA 2VPXB 4DX5A 1ZS6A 2DR6A 2CJJA 4L72B 1RACB 4CA0A 2AW0A 1N4LA 1RA6A 3W3SA 2R2TA 3E0JB 1S1XA 4A3MJ 4C2MA 3L7UA 1N34J 3MTKA 4OJGA 2HHSA 4O4RA 4I56A 4A3BJ 2QQ8A 2XF5A 2GIRA 1EX8A 4XLNF 1GNKA 4RNMA 2L9RA 3HX9A 1PJRA 3KPHA 1MJ9A 4IXAA 4UUXA 1RTJB 5FIIA 3KHGA 1EH6A 4L18B 2HHUA 1KYWA 4NE9C 2J0WA 4FXVA 2UXDJ 1K0TA 1FRIA 2ZOFA 2XHWA 4PRFA 1G4DA 4OHYA 1X4PA 3FMQA 3GCWP 1T0FC 1TAUA 3K1MA 1LK5A 2KQRA 1LFWA 2DNMA 5DM7F 5IQ6A 2EKNA 4DR6F 1U3EM 2WWYA 3BN4A 2PG4A 1OYDA 5AXMA 2DMTA 5F41A 4RS8A 3MM5B 1Y8QB 4NQWA 2H94A 1HBOA 4D0PA 2EFGA 3JXOA 4LOCA 2A61A 4LLNA 3RBXA 3CC2S 4KJZA 1UMJA 4YG2F 5ICCA 2UUBF 1A5JA 4P6QA 4DBQA 1W2IA 3AOBA 3KEYA 3C2HA 2CDQA 1N5YB 3DOMA 4M5NA 5L9NA 2BW3A 3HO1A 5GAGI 1QAIA 2DA2A 1ZKGA 1GFWB 1CJTB 2Q2EA 4DIQA 2RREA 1WF0A 3PO2J 2HGCA 1D8JA 3M9AA 4XRMA 1XC5A 3QRQA 2R3SA 1P7JA 2HLTA 1S4EA 2HHWA 4BHPA 2X6WA 4LSNB 3DFGA 1S1TA 2V4JC 4K4UA 3MI7X 4BC9A 1U5TB 5HROA 2D3OR 1T9WA 2HHHF 4K4XA 3IP4B 1BJAA 3FBFA 5GAEU 3BTCA 3FXOA 4ZDNA 1KYZA 3ZMDA 1WEXA 3QSYB 2COMA 5ILSA 2YS9A 2HBRB 1UJ4A 1XEZA 2DFEA 4M8LA 4NRTA 4KHPJ 3LWFA 4KA4A 3IRWP 2MC3A 1XK8A 4K8RA 3OR2A 3RQ4A 4ZYGA 3BR8A 3A02A 2UUAF 3BBFA 4EFAC 1DURA 4FYYB 5LM7E 3HEFA 2IA6A 5F64A 2ATLA 4ECSA 4BXXJ 2HHQA 1XMOJ 3OYMA 1ZAVA 2RSQA 2ZMEA 3QYBA 4NLGA 2NR0A 3NRBA 5EWGA 2STWA 5F8IA 4Q0BB 4Y17A 3JTNA 2R8IA 3MEDB 2HVDA 3L2CA 5E1ZB 4DR3F 3HM9A 2VQLA 1KD1T 1RWWB 2E5JA 4RAFA 2DGVA 5IY5H 4BNCA 2RNGA 4CCMA 2GOXB 4ZP9A 4WXWA 4QPQA 4I09A 1P2FA 4HOBA 3WHBA 2BXZA 2CW7A 4J19A 2H1YA 3VALA 2DA5A 4EM1A 5LXYA 3IRXA 3KP6A 3K4KA 2R7SA 3D2WA 1PBAA 5E8IA 2IRUA 2W9BB 1MD0A 1J2XA 4RAYA 5CYVA 1Q0NA 4AUXA 4DNCA 1A04A 3M4XA 2YVSA 1I6XA 2B63J 5EEAA 2DNNA 4OJ1A 5I3UB 2V1NA 5F0CA 3JSBA 3O44A 2P5KA 2LCWA 2K7LA 2EQRA 4KV8A 5BXIA 5DD8A 2NXNA 3SDEB 1R89A 1MMDA 3R7SB 3MAQA 1K61A 2QCOA 4JP8A 1H7XA 4I1TA 3J7AN 1S4FA 4I6ZA 4AL6A 3N0VA 2DR8A 2N7CA 2DYRH 1HNIA 2QJ3A 2B9EA 3AJDA 4I0BA 4TU8A 4FF2A 4BWMA 4HV6A 1R4MB 2IMWP 2DK2A 3J81U 3KLNA 4EEFG 1Z7LA 2Z2MA 1KQ8A 4KN7X 3RW7A 3HOSA 4M5DA 1RISA 2RJZA 4B3OB 2CNNB 3BJAA 5FRNA 1HF0A 2H3EB 2YNIA 2DFHA 3SFUA 1H7WA 2OA4A 3KNAA 1S0NA 1PO6A 3LAJA 2DXIA 2XY7A 2L02A 1S1VA 3F8FA 1D0EA 1QVTA 4BC7A 4PQUB 4G1IA 1XERA 4BEHB 3W3CA 2GZOA 4DL3A 4L75A 5J2PB 4KT5C 3N05A 4X65F 1SC6A 1A35A 1AZSB 1N56A 1JLGA 4ZPAA 1PIEA 4FYWB 3S1QJ 5LGTA 4CCLA 1OCOH 3KFWX 4HACB 3NL0A 2E44A 4DXLA 3FNNA 3IXQA 1DQ8A 1L3SA 1XDUA 5CQGA 1SV5A 4CTAB 2LKZA 4WWSA 1LEOA 4X6AJ 2FC8A 1K73T 3VFZA 3PDNA 2ZBCA 4JI8J 4NA3A 3R2CJ 3EQLF 4XONA 3O1LA 4ANCA 4RNHA 4M5IA 3SIPB 3MWMA 1Z0XA 2OBPA 2VOPA 1Q8KA 3NWSA 3IP0A 2Z5UA 3EWGA 1B0TA 3TUIC 2FJBB 2Y1LB 4U95A 1HXDA 3DRRA 1PAEX 4B44A 3DU6A 4CGZA 4KH0B 4XDCA 1K44A 5GVQA 2OSQA 2EW9A 1G3WA 5CAAA 4ES3A 4M5GA 1F5AA 1U1OA 5GAGJ 3LAMA 3WTSC 3K0JA 4WTOB 1LDJA 3EDRB 2M45A 2VIXA 5L1KA 3PW5A 4BHQA 5G0RA 4O23A 3O6QA 3SV4A 2GJ2A 3R1HA 4LFCF 3PM9A 2JA6J 2EFOA 2Y48A 3WHCA 4CNZA 4FS2A 3DU5A 3CEDA 2FOWA 4P7VA 3BPVA 4KIGA 2HU9A 1X8DA 4DR4J 2Q6CA 4DPOA 2Q1LA 1MIJA 3OD2A 1NZ8A 1VTNC 4PGGA 1RIOH 5EJCA 1SQGA 4ZLJA 3J80K 3KEQA 2RQKA 2F5FA 2NNYA 3M8WA 5KAKA 4EBEA 1ZN2A 4QW9A 1D3WA 4TNOA 3VAKA 2CA9A 3BGLA 3DLEB 3R61A 5B0BA 5B0GA 4DL0C 1RRJA 3TR5A 4LIUA 1JJCB 5J1NA 5HQMA 2CW8A 5M5WJ 4F0KA 3LNQA 4AD9A 5BQTA 3FXUA 3PSIA 4ZPDA 2F4IA 4UNOA 3MR2A 1T8IA 3DLKA 1DJ0A 3QT5A 3GO5A 2FY1A 1KSPA 4QOTA 2RDJA 1TNTA 1VQLS 4A8FA 4AIKA 2C2KB 5K8PA 4UQGA 3OL8A 2FZCB 2JA2A 3RI4A 3U02A 1DRZA 1R7JA 5AXLA 1MMNA 3G6EI 1VQMI 3AG4H 3GB0A 3HT3A 4LRAA 2BA9A 3VB2A 3M8PA 3AA9A 3OYEA 3OYBA 4FBUA 3F9KA 4UUSA 1S7IA 4ITVA 4X4TA 5D4SA 4ECTA 2CJYB 4IDKA 1R71A 4IRGA 1X4DA 3GZ6A 4ZTFA 4YB7A 3VOEA 2Z58B 4C6AA 2LA6A 4HQMA 2O8XA 4OYXA 5HOOA 2V2ZA 3LWMA 3PYEA 1B8IA 4ZJZA 2XGPA 2M7AA 4RW7A 3T1HF 3DEUA 1KWMA 1IVZA 4ED8A 2K02A 5ILVA 2AYEA 1NK6A 4Y2CA 3L9ZA 2HS0A 4S0HB 1SKUB 2MPUA 1G3SA 5B5EC 3OYAA 2JWTA 3GYXB 1S59A 1PYVA 4N9HA 1T95A 2ZFUA 3K1NA 1J5OB 1R4NB 2OIHA 2V4RA 5A2QZ 3BTJA 1LW2B 3QRFF 5DUIA 2LEPA 4KNYA 1KFDA 3DYAA 2FHJD 5CPRB 2ME0A 1TBXA 3M6XA 4GMKA 3GIRA 1ZGWA 3NWRA 4Q4ZF 2VJ4A 5AXKA 1FJGJ 3ELKA 1LFBA 3WX8A 5HROB 3PHEA 1TL7A 4A12A 3VF0B 4FXDA 1EKSA 4CP5A 2Q8KA 1JLFB 4QPTA 4CLWA 3LSIA 3HFVA 3KJQB 4FTHA 5IT4A 5EUHA 4BYYA 3W61A 1T03B 4XKBA 1Y11A 2CQNA 2IW5A 5DG7A 4B9VA 4CT8A 2ZH2A 4X66F 5J8CA 1Q81T 2OD5A 2XF7A 1NJXA 4WE1A 4D1QA 1TMJA 3K4MA 2CJXB 4CCOA 1LFPA 1YFHA 2I2YA 2DDAA 2B9XA 1TKXA 2HNDA 1LDDA 1V3FA 2NUHA 3M7VA 3Q24A 1S10A 3Q9VA 4XLAA 3NBPA 3AG1H 3KJVB 2A6EF 3CC4I 1WUUA 1D9FA 1VJWA 2HVZA 3C66A 3QAHA 1RT5B 3MUVP 1QTMA 2ZMEB 4XRSA 2LVWA 5D8KB 3K4LA 2R5ZB 1JKHB 1JLBA 3OTEA 2KHMA 3KP2A 3M8EA 4RW9A 3QO9B 1WH5A 1N75A 3BLYA 5DRKA 2WSCC 5ICFA 3THPA 1XIQA 1LVKA 3CJTA 4S04A 1D1AA 3CC2I 1CS4B 2OH2A 2M8GX 2LXFA 4CM0A 3IAS9 4IO1A 2DNLA 3LSKA 3UD5A 1Q82T 3R3TA 3SCJE 3GILA 1U8BA 3BR5A 4Q44A 1URRA 3HKZA 3EGVA 2FEZA 1C0UA 4H4OB 4CM2A 1A36A 1TL1A 2C2OB 1VRTB 9ANTA 2LREA 2OPPB 5D4PA 1KOHA 3ZQCA 2AJ2A 1LWEB 3A01B 1OQ3A 5L46A 2QLJB 3SCLE 3OLBA 3VAJA 5GADU 2L2OA 3WTVC 1ON1A 1U25A 1IUYA 4N4NB 1Y3JA 4U96A 4BKXA 4EGLA 4P10A 4BH9A 2QSWA 4K50A 1NTCA 2DFFA 2M2BA 4IH5A 1HI0P 4PFPA 3RZAA 3GCXP 2B9SA 2ZCWA 1HQEA 1JUPA 4PG4A 2A2DA 2KMUA 3DNCA 2XWXA 1QAXA 2B9WA 3QWUA 5I3PA 1NPPA 2G4BA 1UVLA 3S1MJ 1ZM4A 1LE8B 2BQRA 3RKYA 1X4CA 5JJBA 1H38A 3TANA 3HG9A 4NB5A 3MN2A 3PJWA 2FSWA 3D4JA 4PXEA 1UL3A 2V8DA 2MD5A 4NZ0A 3OSGA 2VBWA 2CRLA 1X1AA 1HHTP 3RB4A 2V68A 1YJNI 3CJ3A 4DCOB 2L9NA 3POTB 5KG2A 4A3DJ 2X4HA 1J5YA 1JHHA 1QE1B 1DGRM 4RBTA 2I6WA 2MD0A 2CQHA 2Q3PA 2AYMA 4YP3A 1H89C 2UWMA 2EV0A 1S5ZA 3NAIA 5BNGA 2CDRB 2PMUA 4LLLA 4YIIA 3MEGB 4DHVA 3KUEA 2RKIA 5M2PA 2EK1A 1S57A 2CMPA 5KG3A 1M5VC 4E7LA 2P9CA 1TL3B 3MFIA 4P52A 3M3YJ 2ILZA 5FDLA 2VB6A 2D1VA 5GP9A 1KVJA 3JTOA 5KFVA 3E5UA 4G6DA 2G0IA 5CYQB 4KHPF 4MMOA 2W4SA 4V19X 1DBDA 2DO7A 4OYIA 3D3CJ 2V6EA 2NOJB 1X4AA 4AYBA 1FK9B 3IKVA 3D68A 4QYRA 3UN3A 5RUBA 3G8SA 1T9TA 1OLTA 4YFXF 4V1Ak 4N77A 4EJVA 1OCZH 2HGLA 1SVLA 3VZHA 3J7YU 4PXDA 1O7LA 4LD5A 1L3UA 4XN3A 2EK6A 2ZNZA 5IV4A 5IOLA 4XTTA 1KQ0A 3NY0A 4HT5A 3R60A 2DTZA 2PMWA 3H5AA 4WU3A 5DLFA 1RT1B 1FX7A 4Y3CA 1S6QA 4UOGA 1R3NA 1X4EA 3QYEA 2VKRA 4LF5J 4XIUA 2B0GA 4PG8A 3KK1A 1P8GA 4CIOA 3HOYJ 2LBFA 2BANA 5E3CA 4XSZF 1LNWA 4AL7A 4MGRA 2NPIA 3VCDA 5GADI 3HM5A 4C7QA 2O1PA 1R1VA 1LEBA 1RTHA 1TELA 3P5BP 4DUZJ