3I4TA

Crystal structure of putative diphthine synthase from entamoeba histolytica
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
272
structure length
252
Chain Sequence
GSMLYIIGLGLYDEKDITVRGLEAVKSCDLVFLEHYTAILQCDVAKLEEFYGKKVIIGEADQILEPAKTKNVALLVVGDVYGATTHSDIFVRCQKMGIEVKVIHNASIMNAIGCSGLQLYRFGQTVSVCFWSEHWRPSSYYPKIKINRDNNMHTLVLLDIKVKEEPPRYMTINQCIEQLLEVEKEQHLGVYDEDTMVVGMARVACADQKIVYGKMKDLLHYDFGAPMHCLLIPAPQVDDPELDQLEYFKYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative diphthine synthase from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Structural genomics, unknown function
molecule keywords diphthine synthase
total genus 74
structure length 252
sequence length 272
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3i4tA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 3i4tA01
2OWUA 3ND1A 2HUXA 2P6KA 1PJSA 2E08A 2ZVCA 2EGLA 2EEQA 2P6LA 2P5FA 1CBFA 2EKAA 2ENIA 2E4RA 2E8RA 2EK7A 2ZVBA 2NPNA 2E8SA 2EGSA 2EK4A 1PJQA 5HW4A 2ELEA 2OWKA 1VHVA 2PB6A 2PCAA 3HH1A 2E0KA 2E8HA 2QBUA 2EH5A 2DXXA 1VE2A 2HUTA 2EGBA 3KWPA 2EN5A 4E16A 2CBFA 2ELDA 2DXWA 2EHLA 2EMUA 3I4TA 2E4NA 2OWGA 2P5CA 2DV3A 2EK3A 2E7RA 2BB3A 2DSIA 2P6IA 2OWVA 2E16A 2P9DA 2E0NA 2EJZA 2HUQA 2EL3A 2PCHA 2ED3A 2DEKA 2DXVA 1VA0A 2EL2A 2P2XA 2DSGA 2PCGA 3FFYA 2EL0A 2OWFA 3NUTA 3FQ6A 2E17A 2EK2A 1S4DA 2PB4A 1WNGA 3NDCA 1WYZA 1PJTA 2PCIA 2EJJA 2YBOA 2EH4A 2P6DA 1VCEA 1V9AA 2E8QA 2EHCA 1WDEA 2DV7A 3NEIA 2ED5A 2EH2A 2HUVA 2E15A 2EJKA 2PCMA 2DV4A 2DV5A 2E07A 2HR8A 2PB5A 2PCKA 2Z6RA 2DSHA 2EMRA 2YBQA 2EL1A
chains in the Genus database with same CATH superfamily
2OWUA 3ND1A 2HUXA 2P6KA 1PJSA 2E08A 2ZVCA 2EGLA 2EEQA 4MUYA 2P6LA 2P5FA 1CBFA 2EKAA 2ENIA 2E4RA 2E8RA 2EK7A 2ZVBA 2NPNA 3KEFA 3KELA 3KEMA 2E8SA 2EGSA 4N7BA 2EK4A 1PJQA 5HW4A 2ELEA 2OWKA 1VHVA 2PB6A 3UWMA 2PCAA 4EB3A 3HH1A 3UTDA 3SZOA 2E0KA 2E8HA 2QBUA 2EH5A 3T0GA 3UV6A 3ZGLA 2DXXA 3LMMA 3KE9A 1VE2A 2HUTA 2EGBA 3TIXB 3F7TA 3KWPA 2EN5A 4E16A 2CBFA 2ELDA 3DNFA 2DXWA 2EHLA 4MV0A 2EMUA 3I4TA 2E4NA 2OWGA 2P5CA 3SZLA 2DV3A 2EK3A 2E7RA 3T0FA 2BB3A 2DSIA 2P6IA 2OWVA 3SZUA 3UV3A 2E16A 2P9DA 2E0NA 2EJZA 4H4EA 2HUQA 2EL3A 3KE8A 2PCHA 2ED3A 2DEKA 2DXVA 1VA0A 2EL2A 2P2XA 2DSGA 2PCGA 3FFYA 4MUXA 2EL0A 2OWFA 3NUTA 3FQ6A 4H4DA 3URKA 4H4CA 2E17A 2EK2A 1S4DA 2PB4A 4MV5A 1WNGA 3NDCA 1WYZA 1PJTA 2PCIA 2EJJA 2YBOA 2EH4A 2P6DA 1VCEA 1V9AA 2E8QA 2EHCA 3UTCA 1WDEA 2DV7A 3NEIA 2ED5A 2EH2A 2HUVA 3UV7A 3ZGNA 2E15A 2EJKA 2PCMA 2DV4A 2KYYA 2DV5A 2E07A 2HR8A 2PB5A 2PCKA 2Z6RA 2DSHA 2EMRA 2YBQA 2EL1A
chains in the Genus database with same CATH topology
2OWUA 3ND1A 2HUXA 2P6KA 1PJSA 2E08A 2ZVCA 2EGLA 2EEQA 4MUYA 2P6LA 2P5FA 1CBFA 2EKAA 2ENIA 2E4RA 2E8RA 2EK7A 2ZVBA 2NPNA 3KEFA 3KELA 3KEMA 2E8SA 2EGSA 4N7BA 2EK4A 1PJQA 5HW4A 2ELEA 2OWKA 1VHVA 2PB6A 3UWMA 2PCAA 4EB3A 3HH1A 3UTDA 3SZOA 2E0KA 2E8HA 2QBUA 2EH5A 3T0GA 3UV6A 3ZGLA 2DXXA 3LMMA 3KE9A 1VE2A 2HUTA 2EGBA 3TIXB 3F7TA 3KWPA 2EN5A 4E16A 2CBFA 2ELDA 3DNFA 2DXWA 2EHLA 4MV0A 2EMUA 3I4TA 2E4NA 2OWGA 2P5CA 3SZLA 2DV3A 2EK3A 2E7RA 3T0FA 2BB3A 2DSIA 2P6IA 2OWVA 3SZUA 3UV3A 2E16A 2P9DA 2E0NA 2EJZA 4H4EA 2HUQA 2EL3A 3KE8A 2PCHA 2ED3A 2DEKA 2DXVA 1VA0A 2EL2A 2P2XA 2DSGA 2PCGA 3FFYA 4MUXA 2EL0A 2OWFA 3NUTA 3FQ6A 4H4DA 3URKA 4H4CA 2E17A 2EK2A 1S4DA 2PB4A 4MV5A 1WNGA 3NDCA 1WYZA 1PJTA 2PCIA 2EJJA 2YBOA 2EH4A 2P6DA 1VCEA 1V9AA 2E8QA 2EHCA 3UTCA 1WDEA 2DV7A 3NEIA 2ED5A 2EH2A 2HUVA 3UV7A 3ZGNA 2E15A 2EJKA 2PCMA 2DV4A 2KYYA 2DV5A 2E07A 2HR8A 2PB5A 2PCKA 2Z6RA 2DSHA 2EMRA 2YBQA 2EL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWU A;  3ND1 A;  2HUX A;  2P6K A;  1PJS A;  2E08 A;  2ZVC A;  2EGL A;  2EEQ A;  2P6L A;  2P5F A;  1CBF A;  2EKA A;  2ENI A;  2E4R A;  2E8R A;  2EK7 A;  2ZVB A;  2NPN A;  2E8S A;  2EGS A;  2EK4 A;  1PJQ A;  5HW4 A;  2ELE A;  2OWK A;  1VHV A;  2PB6 A;  2PCA A;  3HH1 A;  2E0K A;  2E8H A;  2QBU A;  2EH5 A;  2DXX A;  1VE2 A;  2HUT A;  2EGB A;  3KWP A;  2EN5 A;  4E16 A;  2CBF A;  2ELD A;  2DXW A;  2EHL A;  2EMU A;  3I4T A;  2E4N A;  2OWG A;  2P5C A;  2DV3 A;  2EK3 A;  2E7R A;  2BB3 A;  2DSI A;  2P6I A;  2OWV A;  2E16 A;  2P9D A;  2E0N A;  2EJZ A;  2HUQ A;  2EL3 A;  2PCH A;  2ED3 A;  2DEK A;  2DXV A;  1VA0 A;  2EL2 A;  2P2X A;  2DSG A;  2PCG A;  3FFY A;  2EL0 A;  2OWF A;  3NUT A;  3FQ6 A;  2E17 A;  2EK2 A;  1S4D A;  2PB4 A;  1WNG A;  3NDC A;  1WYZ A;  1PJT A;  2PCI A;  2EJJ A;  2YBO A;  2EH4 A;  2P6D A;  1VCE A;  1V9A A;  2E8Q A;  2EHC A;  1WDE A;  2DV7 A;  3NEI A;  2ED5 A;  2EH2 A;  2HUV A;  2E15 A;  2EJK A;  2PCM A;  2DV4 A;  2DV5 A;  2E07 A;  2HR8 A;  2PB5 A;  2PCK A;  2Z6R A;  2DSH A;  2EMR A;  2YBQ A;  2EL1 A; 
#chains in the Genus database with same CATH topology
 2OWU A;  3ND1 A;  2HUX A;  2P6K A;  1PJS A;  2E08 A;  2ZVC A;  2EGL A;  2EEQ A;  4MUY A;  2P6L A;  2P5F A;  1CBF A;  2EKA A;  2ENI A;  2E4R A;  2E8R A;  2EK7 A;  2ZVB A;  2NPN A;  3KEF A;  3KEL A;  3KEM A;  2E8S A;  2EGS A;  4N7B A;  2EK4 A;  1PJQ A;  5HW4 A;  2ELE A;  2OWK A;  1VHV A;  2PB6 A;  3UWM A;  2PCA A;  4EB3 A;  3HH1 A;  3UTD A;  3SZO A;  2E0K A;  2E8H A;  2QBU A;  2EH5 A;  3T0G A;  3UV6 A;  3ZGL A;  2DXX A;  3LMM A;  3KE9 A;  1VE2 A;  2HUT A;  2EGB A;  3TIX B;  3F7T A;  3KWP A;  2EN5 A;  4E16 A;  2CBF A;  2ELD A;  3DNF A;  2DXW A;  2EHL A;  4MV0 A;  2EMU A;  3I4T A;  2E4N A;  2OWG A;  2P5C A;  3SZL A;  2DV3 A;  2EK3 A;  2E7R A;  3T0F A;  2BB3 A;  2DSI A;  2P6I A;  2OWV A;  3SZU A;  3UV3 A;  2E16 A;  2P9D A;  2E0N A;  2EJZ A;  4H4E A;  2HUQ A;  2EL3 A;  3KE8 A;  2PCH A;  2ED3 A;  2DEK A;  2DXV A;  1VA0 A;  2EL2 A;  2P2X A;  2DSG A;  2PCG A;  3FFY A;  4MUX A;  2EL0 A;  2OWF A;  3NUT A;  3FQ6 A;  4H4D A;  3URK A;  4H4C A;  2E17 A;  2EK2 A;  1S4D A;  2PB4 A;  4MV5 A;  1WNG A;  3NDC A;  1WYZ A;  1PJT A;  2PCI A;  2EJJ A;  2YBO A;  2EH4 A;  2P6D A;  1VCE A;  1V9A A;  2E8Q A;  2EHC A;  3UTC A;  1WDE A;  2DV7 A;  3NEI A;  2ED5 A;  2EH2 A;  2HUV A;  3UV7 A;  3ZGN A;  2E15 A;  2EJK A;  2PCM A;  2DV4 A;  2KYY A;  2DV5 A;  2E07 A;  2HR8 A;  2PB5 A;  2PCK A;  2Z6R A;  2DSH A;  2EMR A;  2YBQ A;  2EL1 A; 
#chains in the Genus database with same CATH homology
 2OWU A;  3ND1 A;  2HUX A;  2P6K A;  1PJS A;  2E08 A;  2ZVC A;  2EGL A;  2EEQ A;  4MUY A;  2P6L A;  2P5F A;  1CBF A;  2EKA A;  2ENI A;  2E4R A;  2E8R A;  2EK7 A;  2ZVB A;  2NPN A;  3KEF A;  3KEL A;  3KEM A;  2E8S A;  2EGS A;  4N7B A;  2EK4 A;  1PJQ A;  5HW4 A;  2ELE A;  2OWK A;  1VHV A;  2PB6 A;  3UWM A;  2PCA A;  4EB3 A;  3HH1 A;  3UTD A;  3SZO A;  2E0K A;  2E8H A;  2QBU A;  2EH5 A;  3T0G A;  3UV6 A;  3ZGL A;  2DXX A;  3LMM A;  3KE9 A;  1VE2 A;  2HUT A;  2EGB A;  3TIX B;  3F7T A;  3KWP A;  2EN5 A;  4E16 A;  2CBF A;  2ELD A;  3DNF A;  2DXW A;  2EHL A;  4MV0 A;  2EMU A;  3I4T A;  2E4N A;  2OWG A;  2P5C A;  3SZL A;  2DV3 A;  2EK3 A;  2E7R A;  3T0F A;  2BB3 A;  2DSI A;  2P6I A;  2OWV A;  3SZU A;  3UV3 A;  2E16 A;  2P9D A;  2E0N A;  2EJZ A;  4H4E A;  2HUQ A;  2EL3 A;  3KE8 A;  2PCH A;  2ED3 A;  2DEK A;  2DXV A;  1VA0 A;  2EL2 A;  2P2X A;  2DSG A;  2PCG A;  3FFY A;  4MUX A;  2EL0 A;  2OWF A;  3NUT A;  3FQ6 A;  4H4D A;  3URK A;  4H4C A;  2E17 A;  2EK2 A;  1S4D A;  2PB4 A;  4MV5 A;  1WNG A;  3NDC A;  1WYZ A;  1PJT A;  2PCI A;  2EJJ A;  2YBO A;  2EH4 A;  2P6D A;  1VCE A;  1V9A A;  2E8Q A;  2EHC A;  3UTC A;  1WDE A;  2DV7 A;  3NEI A;  2ED5 A;  2EH2 A;  2HUV A;  3UV7 A;  3ZGN A;  2E15 A;  2EJK A;  2PCM A;  2DV4 A;  2KYY A;  2DV5 A;  2E07 A;  2HR8 A;  2PB5 A;  2PCK A;  2Z6R A;  2DSH A;  2EMR A;  2YBQ A;  2EL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...