3I4TA

Crystal structure of putative diphthine synthase from entamoeba histolytica
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
272
structure length
252
Chain Sequence
GSMLYIIGLGLYDEKDITVRGLEAVKSCDLVFLEHYTAILQCDVAKLEEFYGKKVIIGEADQILEPAKTKNVALLVVGDVYGATTHSDIFVRCQKMGIEVKVIHNASIMNAIGCSGLQLYRFGQTVSVCFWSEHWRPSSYYPKIKINRDNNMHTLVLLDIKVKEEPPRYMTINQCIEQLLEVEKEQHLGVYDEDTMVVGMARVACADQKIVYGKMKDLLHYDFGAPMHCLLIPAPQVDDPELDQLEYFKYKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative diphthine synthase from Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
molecule tags Structural genomics, unknown function
molecule keywords diphthine synthase
total genus 74
structure length 252
sequence length 272
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00590 TP_methylase Tetrapyrrole (Corrin/Porphyrin) Methylases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.10 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 3i4tA02
3.40.1010.10 Alpha Beta 3-Layer(aba) Sandwich Cobalt-precorrin-4 Transmethylase; domain 1 Cobalt-precorrin-4 Transmethylase; Domain 1 3i4tA01
2E8QA 2EH5A 2DSIA 2E4NA 3KWPA 2P6DA 2EKAA 2EK4A 1WYZA 2EGBA 1VE2A 2EL0A 1VHVA 2DV3A 2YBQA 5HW4A 2EK3A 3HH1A 3ND1A 2ED3A 2E8SA 4E16A 2Z6RA 2E0KA 1CBFA 2EMUA 1V9AA 2P5FA 3I4TA 2E08A 2HUVA 2CBFA 2EJZA 2EH4A 2EL1A 2ZVCA 2EGSA 2PB5A 2OWUA 2QBUA 2DV7A 2PCMA 2P5CA 2E8HA 2OWVA 2PB4A 1PJSA 2DXVA 2EMRA 2DXXA 2PCHA 2E16A 3FFYA 1WDEA 2EK2A 2P6IA 1VA0A 2E8RA 2DXWA 2E17A 2P2XA 2EJJA 2HUQA 2P6LA 2DSGA 2E15A 2NPNA 2DEKA 2EGLA 1S4DA 2OWKA 2EN5A 2ZVBA 2OWFA 1PJQA 2EHCA 2E7RA 1WNGA 2EJKA 2ED5A 2EK7A 2YBOA 2DSHA 2BB3A 3FQ6A 2E4RA 2PCIA 2E0NA 2P6KA 2ELDA 2EHLA 2DV4A 2EH2A 2HUXA 2PCAA 2EEQA 2ELEA 2HR8A 3NUTA 2PCKA 1PJTA 3NEIA 2ENIA 2OWGA 2EL3A 2E07A 2DV5A 1VCEA 2EL2A 2PCGA 2HUTA 3NDCA 2P9DA 2PB6A
chains in the Genus database with same CATH superfamily
4MV0A 2E8QA 2EH5A 2DSIA 2E4NA 3KWPA 3KE9A 2P6DA 2EKAA 2EK4A 1WYZA 2EGBA 3DNFA 1VE2A 2EL0A 1VHVA 2DV3A 2YBQA 5HW4A 2EK3A 4H4DA 3HH1A 3ND1A 2ED3A 4MUYA 2E8SA 4E16A 2KYYA 4H4CA 2Z6RA 2E0KA 1CBFA 2EMUA 3ZGNA 1V9AA 2P5FA 3I4TA 3SZOA 2E08A 3T0GA 2HUVA 2CBFA 2EJZA 2EH4A 2EL1A 2ZVCA 2EGSA 2PB5A 3KEMA 2OWUA 2QBUA 2DV7A 2PCMA 2P5CA 2E8HA 2OWVA 2PB4A 1PJSA 4H4EA 3KEFA 2DXVA 3KE8A 2EMRA 2DXXA 2PCHA 3URKA 2E16A 3TIXB 3FFYA 1WDEA 3UTDA 2EK2A 2P6IA 1VA0A 2E8RA 2DXWA 2E17A 2P2XA 2EJJA 2HUQA 4EB3A 2P6LA 2DSGA 2E15A 2NPNA 3SZLA 2DEKA 2EGLA 4N7BA 1S4DA 2OWKA 2EN5A 2ZVBA 3UWMA 3SZUA 2OWFA 1PJQA 3UV3A 2EHCA 2E7RA 1WNGA 2EJKA 2ED5A 2EK7A 3UTCA 2YBOA 2DSHA 2BB3A 3FQ6A 3KELA 3UV6A 3UV7A 2E4RA 4MUXA 3T0FA 2PCIA 2E0NA 2P6KA 4MV5A 2ELDA 3F7TA 2EHLA 2DV4A 2EH2A 2HUXA 3LMMA 2PCAA 2EEQA 2ELEA 2HR8A 3NUTA 2PCKA 1PJTA 3NEIA 2ENIA 2OWGA 2EL3A 2E07A 2DV5A 3ZGLA 1VCEA 2EL2A 2PCGA 2HUTA 3NDCA 2P9DA 2PB6A
chains in the Genus database with same CATH topology
4MV0A 2E8QA 2EH5A 2DSIA 2E4NA 3KWPA 3KE9A 2P6DA 2EKAA 2EK4A 1WYZA 2EGBA 3DNFA 1VE2A 2EL0A 1VHVA 2DV3A 2YBQA 5HW4A 2EK3A 4H4DA 3HH1A 3ND1A 2ED3A 4MUYA 2E8SA 4E16A 2KYYA 4H4CA 2Z6RA 2E0KA 1CBFA 2EMUA 3ZGNA 1V9AA 2P5FA 3I4TA 3SZOA 2E08A 3T0GA 2HUVA 2CBFA 2EJZA 2EH4A 2EL1A 2ZVCA 2EGSA 2PB5A 3KEMA 2OWUA 2QBUA 2DV7A 2PCMA 2P5CA 2E8HA 2OWVA 2PB4A 1PJSA 4H4EA 3KEFA 2DXVA 3KE8A 2EMRA 2DXXA 2PCHA 3URKA 2E16A 3TIXB 3FFYA 1WDEA 3UTDA 2EK2A 2P6IA 1VA0A 2E8RA 2DXWA 2E17A 2P2XA 2EJJA 2HUQA 4EB3A 2P6LA 2DSGA 2E15A 2NPNA 3SZLA 2DEKA 2EGLA 4N7BA 1S4DA 2OWKA 2EN5A 2ZVBA 3UWMA 3SZUA 2OWFA 1PJQA 3UV3A 2EHCA 2E7RA 1WNGA 2EJKA 2ED5A 2EK7A 3UTCA 2YBOA 2DSHA 2BB3A 3FQ6A 3KELA 3UV6A 3UV7A 2E4RA 4MUXA 3T0FA 2PCIA 2E0NA 2P6KA 4MV5A 2ELDA 3F7TA 2EHLA 2DV4A 2EH2A 2HUXA 3LMMA 2PCAA 2EEQA 2ELEA 2HR8A 3NUTA 2PCKA 1PJTA 3NEIA 2ENIA 2OWGA 2EL3A 2E07A 2DV5A 3ZGLA 1VCEA 2EL2A 2PCGA 2HUTA 3NDCA 2P9DA 2PB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8Q A;  2EH5 A;  2DSI A;  2E4N A;  3KWP A;  2P6D A;  2EKA A;  2EK4 A;  1WYZ A;  2EGB A;  1VE2 A;  2EL0 A;  1VHV A;  2DV3 A;  2YBQ A;  5HW4 A;  2EK3 A;  3HH1 A;  3ND1 A;  2ED3 A;  2E8S A;  4E16 A;  2Z6R A;  2E0K A;  1CBF A;  2EMU A;  1V9A A;  2P5F A;  3I4T A;  2E08 A;  2HUV A;  2CBF A;  2EJZ A;  2EH4 A;  2EL1 A;  2ZVC A;  2EGS A;  2PB5 A;  2OWU A;  2QBU A;  2DV7 A;  2PCM A;  2P5C A;  2E8H A;  2OWV A;  2PB4 A;  1PJS A;  2DXV A;  2EMR A;  2DXX A;  2PCH A;  2E16 A;  3FFY A;  1WDE A;  2EK2 A;  2P6I A;  1VA0 A;  2E8R A;  2DXW A;  2E17 A;  2P2X A;  2EJJ A;  2HUQ A;  2P6L A;  2DSG A;  2E15 A;  2NPN A;  2DEK A;  2EGL A;  1S4D A;  2OWK A;  2EN5 A;  2ZVB A;  2OWF A;  1PJQ A;  2EHC A;  2E7R A;  1WNG A;  2EJK A;  2ED5 A;  2EK7 A;  2YBO A;  2DSH A;  2BB3 A;  3FQ6 A;  2E4R A;  2PCI A;  2E0N A;  2P6K A;  2ELD A;  2EHL A;  2DV4 A;  2EH2 A;  2HUX A;  2PCA A;  2EEQ A;  2ELE A;  2HR8 A;  3NUT A;  2PCK A;  1PJT A;  3NEI A;  2ENI A;  2OWG A;  2EL3 A;  2E07 A;  2DV5 A;  1VCE A;  2EL2 A;  2PCG A;  2HUT A;  3NDC A;  2P9D A;  2PB6 A; 
#chains in the Genus database with same CATH topology
 4MV0 A;  2E8Q A;  2EH5 A;  2DSI A;  2E4N A;  3KWP A;  3KE9 A;  2P6D A;  2EKA A;  2EK4 A;  1WYZ A;  2EGB A;  3DNF A;  1VE2 A;  2EL0 A;  1VHV A;  2DV3 A;  2YBQ A;  5HW4 A;  2EK3 A;  4H4D A;  3HH1 A;  3ND1 A;  2ED3 A;  4MUY A;  2E8S A;  4E16 A;  2KYY A;  4H4C A;  2Z6R A;  2E0K A;  1CBF A;  2EMU A;  3ZGN A;  1V9A A;  2P5F A;  3I4T A;  3SZO A;  2E08 A;  3T0G A;  2HUV A;  2CBF A;  2EJZ A;  2EH4 A;  2EL1 A;  2ZVC A;  2EGS A;  2PB5 A;  3KEM A;  2OWU A;  2QBU A;  2DV7 A;  2PCM A;  2P5C A;  2E8H A;  2OWV A;  2PB4 A;  1PJS A;  4H4E A;  3KEF A;  2DXV A;  3KE8 A;  2EMR A;  2DXX A;  2PCH A;  3URK A;  2E16 A;  3TIX B;  3FFY A;  1WDE A;  3UTD A;  2EK2 A;  2P6I A;  1VA0 A;  2E8R A;  2DXW A;  2E17 A;  2P2X A;  2EJJ A;  2HUQ A;  4EB3 A;  2P6L A;  2DSG A;  2E15 A;  2NPN A;  3SZL A;  2DEK A;  2EGL A;  4N7B A;  1S4D A;  2OWK A;  2EN5 A;  2ZVB A;  3UWM A;  3SZU A;  2OWF A;  1PJQ A;  3UV3 A;  2EHC A;  2E7R A;  1WNG A;  2EJK A;  2ED5 A;  2EK7 A;  3UTC A;  2YBO A;  2DSH A;  2BB3 A;  3FQ6 A;  3KEL A;  3UV6 A;  3UV7 A;  2E4R A;  4MUX A;  3T0F A;  2PCI A;  2E0N A;  2P6K A;  4MV5 A;  2ELD A;  3F7T A;  2EHL A;  2DV4 A;  2EH2 A;  2HUX A;  3LMM A;  2PCA A;  2EEQ A;  2ELE A;  2HR8 A;  3NUT A;  2PCK A;  1PJT A;  3NEI A;  2ENI A;  2OWG A;  2EL3 A;  2E07 A;  2DV5 A;  3ZGL A;  1VCE A;  2EL2 A;  2PCG A;  2HUT A;  3NDC A;  2P9D A;  2PB6 A; 
#chains in the Genus database with same CATH homology
 4MV0 A;  2E8Q A;  2EH5 A;  2DSI A;  2E4N A;  3KWP A;  3KE9 A;  2P6D A;  2EKA A;  2EK4 A;  1WYZ A;  2EGB A;  3DNF A;  1VE2 A;  2EL0 A;  1VHV A;  2DV3 A;  2YBQ A;  5HW4 A;  2EK3 A;  4H4D A;  3HH1 A;  3ND1 A;  2ED3 A;  4MUY A;  2E8S A;  4E16 A;  2KYY A;  4H4C A;  2Z6R A;  2E0K A;  1CBF A;  2EMU A;  3ZGN A;  1V9A A;  2P5F A;  3I4T A;  3SZO A;  2E08 A;  3T0G A;  2HUV A;  2CBF A;  2EJZ A;  2EH4 A;  2EL1 A;  2ZVC A;  2EGS A;  2PB5 A;  3KEM A;  2OWU A;  2QBU A;  2DV7 A;  2PCM A;  2P5C A;  2E8H A;  2OWV A;  2PB4 A;  1PJS A;  4H4E A;  3KEF A;  2DXV A;  3KE8 A;  2EMR A;  2DXX A;  2PCH A;  3URK A;  2E16 A;  3TIX B;  3FFY A;  1WDE A;  3UTD A;  2EK2 A;  2P6I A;  1VA0 A;  2E8R A;  2DXW A;  2E17 A;  2P2X A;  2EJJ A;  2HUQ A;  4EB3 A;  2P6L A;  2DSG A;  2E15 A;  2NPN A;  3SZL A;  2DEK A;  2EGL A;  4N7B A;  1S4D A;  2OWK A;  2EN5 A;  2ZVB A;  3UWM A;  3SZU A;  2OWF A;  1PJQ A;  3UV3 A;  2EHC A;  2E7R A;  1WNG A;  2EJK A;  2ED5 A;  2EK7 A;  3UTC A;  2YBO A;  2DSH A;  2BB3 A;  3FQ6 A;  3KEL A;  3UV6 A;  3UV7 A;  2E4R A;  4MUX A;  3T0F A;  2PCI A;  2E0N A;  2P6K A;  4MV5 A;  2ELD A;  3F7T A;  2EHL A;  2DV4 A;  2EH2 A;  2HUX A;  3LMM A;  2PCA A;  2EEQ A;  2ELE A;  2HR8 A;  3NUT A;  2PCK A;  1PJT A;  3NEI A;  2ENI A;  2OWG A;  2EL3 A;  2E07 A;  2DV5 A;  3ZGL A;  1VCE A;  2EL2 A;  2PCG A;  2HUT A;  3NDC A;  2P9D A;  2PB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...