3I4YA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 68
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i4yA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i4yA02
3MI1M 2BUQB 3T67M 3LMXA 3MV6A 3HJQA 2BUMA 1DLTA 3PCEA 3MFLM 3LXVM 3HKPA 4WHSD 2BUQA 4WHOB 1DLQA 2BV0A 4WHOA 3PCNM 2BUYB 3PCDM 3PCGM 5TD3A 2BURA 1EO2A 1DLMA 2BUVA 4ILTA 3LXVA 1YKOB 3HGIA 3O6RA 3PCEM 3PCDA 3PCGA 2BUXA 2BUMB 3I51A 3PCCA 1YKKB 3PCBA 3O5UA 4ILVA 3LKTA 3PCLA 3PCIM 1EOCA 2XSVA 3HJ8A 2BUTA 1EO9A 1YKNB 3O6JA 3LKTM 2BUVB 3PCHA 3MV4A 3HHYA 1YKLA 4WHQB 1S9AA 2XSRA 1TMXA 2BOYA 2BUUA 2PCDA 1YKMB 1EOBA 1EOAA 3PCMM 1YKPB 1YKOA 4WHPB 3I4VA 3PCFA 2BUTB 3MI1A 1EOAB 3N9TA 3MV6M 4WHSB 3PCKA 3TH1A 3I4YA 1YKKA 4WHRF 2BUZB 1EOBB 3HHXA 3PCIA 3PCLM 1DMHA 3PCKM 2XSUA 2BUWA 4WHOD 4WHRA 3T63M 4WHQA 3PCNA 3HJSA 1YKLB 3MI5M 4WHPA 1EO2B 1YKNA 3PCAA 3PCJA 1YKMA 3O32A 3T63A 1YKPA 2BUYA 3PCHM 2BUWB 4WHRB 2BUUB 3MV4M 1EOCB 3MI5A 2BV0B 2PCDM 3PCMA 3LMXM 3PCCM 3PCBM 2BUZA 2BUXB 4WHPD 3T67A 2AZQA 3MFLA 2BURB 1EO9B 3PCAM 3PCJM 4WHSA 3PCFM
chains in the Genus database with same CATH superfamily
3U61B 3GPYA 5GKNA 4R3DA 2APLA 3SYLA 4CIZA 3MI1M 3KSXA 1ZV1A 3FTCA 1TR8A 4GRIA 3NBXX 3L29A 4WURA 3LCUA 3B74A 2OOAA 1NNJA 2VIIA 4JI5M 2HAKA 4MGZE 4WW0A 2FH0A 3LXVM 1H6UA 3E4RA 2OPFA 1NJGA 3IG5A 3ZH9B 3A98B 4PT5A 3LVVA 5JI2E 2CRUA 2BV0A 3PCNM 5IT9S 2V1CA 3GRRA 1R2YA 1W5SA 3B89A 2LVOC 1TH4A 3KOXE 2AHMA 1V34A 4JI8M 5KPTA 1YKOB 2QCUA 3GLIA 4IBGA 2JXNA 3FTFA 2A5YB 3VLFB 3O6RA 1GL7A 3SMPA 7CATA 1SXJE 4FWDA 4KHPM 3PCGA 1R6BX 4REZA 2P5TA 3H4JA 4FCWA 1GVNA 1QQWA 4L6V6 5EJCA 3CF6E 2LHGA 3SARA 4MB7A 2QQ8A 3IECA 4GITA 3A45A 1P3QQ 3GRUA 1MX0A 1HJPA 5ITXE 4F1IA 3VK8A 2L7IA 2R18A 3I51A 4L4UA 3GLIB 4JI1M 2VQEM 3AV0A 3PCBA 3WHLA 3LQRA 1F4IA 2XH9A 1WXQA 3QAUA 2R62A 1W5TA 3BOSA 4FCTA 2EA0A 3T1HM 3KS8A 2F5QA 2DHYA 3LW5F 1EE8A 4LJ6A 4ITQA 2F4VM 3TWKA 1FNNA 3DFZA 3HJ8A 3KSJA 2HHHM 5FTLA 1YKNB 5FTJA 1A5TA 2ZBKB 2R4EA 3I04M 4BLCA 1PGYA 3KFUG 1YE9A 3U60A 4II7A 5KO3A 1YKLA 5A2QS 4LF8M 3D8LA 4DR4M 1DO0A 2XSRA 2BOYA 5FTNA 1CUKA 1OIPA 1Z5AA 1AUAA 3HWSA 2Z8YM 2J7NA 4JXJA 3NWLA 1NVMA 1XNRM 1YKMB 2YNMD 2UUCM 4R7GA 2NQ8C 1QZEA 4DV4M 3PCFA 4M0DA 3L26A 3L27A 1IBKM 4M9SA 2DZOB 5DYGA 3MI1A 3MHVC 1QAQA 2DAIA 3SAVA 5KPZA 1EOBB 4CGYB 4LJAA 1EOAB 2Y0TA 3JR4A 1XMOM 1TTEA 1QANA 2HL7A 2KHHA 3A42A 4IBIA 1UFZA 1T6OA 1DO2A 2XEPA 4WHRF 3IG8A 3GQ5A 3FTEA 2O5RA 3AOEA 3KS4A 3B7QA 2DENA 3FD9A 3HHXA 1TH2A 2BWEA 4RKUF 3UK6A 2JA2A 2R6FA 3EIEA 4X64M 1N78A 2ZANA 1IN8A 3J7BA 5IREB 3PCKM 2EKKA 2VQFM 5FLXS 3PCNA 3HJSA 4AG5A 2LTUA 1N32M 2QNJA 3MI5M 2RGOA 2I7NA 4L15A 3K92A 4BB9A 2KNVA 4Z6YA 3CTWB 1XNQM 2JY6B 3UMMA 3O32A 3PCAA 5JI3E 3E9SA 1YKPA 1L2BA 3PCHM 1NHGC 3FRIA 3V76A 3BBZA 2BUUB 3MV4M 1EOCB 2BV0B 1IY2A 1G59A 4NXMM 2PCDM 3DA1A 2Y21A 3NBIA 3LMXM 3AOGA 2I7PA 2O01F 2JNHA 2RKOA 5KPRA 3PCBM 3FE3A 3FUWA 3KXEC 4WHPD 1IBLM 4LF5M 3FKEA 3L25A 1IBMM 1OIZA 3U6LA 5EP1A 2K9DA 4NSOB 3U6CA 1QZMA 4G4QA 1AIPC 4BBAA 3WHKA 5EQTA 2KNAA 4LF7M 3I01M 4LCBA 2BUQB 2MROB 3ILKA 3SBJA 2C9OA 4LZZA 2BJWA 1E94E 2R4JA 1DLTA 2WSCF 3SAWA 4GIPA 2MJ5B 2KA6B 3HKPA 4WHOB 4CJ6A 1XXHE 2XSZD 3M6AA 3VDPA 5EP4A 3J80S 2KZSA 3CF0A 1Q39A 3VKHA 3U6QA 2R0IA 2DAMA 4IBCA 3PCGM 4MGKE 5TD3A 2XZUA 1DLMA 5IWAM 4DR1M 2K47A 3C3EA 1QUTA 4MGYE 5EXTA 5L8RF 5ITXA 3U5ZA 2YFQA 2X4AA 3U6MA 3PCEM 3M7GA 4IBDA 3U6SA 3PCDA 1NHWC 3HY5A 5BPVA 4HL4A 3KOYE 1N33M 2BUXA 3RGPA 3CF2A 1HQYE 4DR2M 2CFOA 3PCCA 1NV9A 1QUSA 4Q7JA 4ILVA 4OX9M 3PNVA 2D7EA 3KP0E 3HHWA 3UJNA 1PJIA 3GQ4A 1EOCA 4OW0A 4AZFA 1L2DA 3QYBA 1I94M 4DR6M 2BUTA 2EJSA 4FD2A 3GLGA 3LKTM 3TQSA 4LRSA 1GLNA 1D2NA 2X49A 3PNYA 2JY8A 2BUVB 1ORYB 3PCHA 3MV4A 2CE7A 3VDUA 4L8RC 4WHQB 2ZAOA 1PJSA 1S9AA 3SFZA 2UUBM 4NOOB 1XWIA 4MGIE 2BUUA 1N75A 2DHRA 4M0WA 2PCDA 2FOIC 4YY3M 2LVQD 2YR0A 3DZDA 1YKOA 1YKPB 3L2AA 2CUZA 2DWLA 2WSEF 1FJGM 1C7YA 2L2DA 1TDHA 2OO9A 2VF7A 3FYDA 1D0KA 2X8AA 4RF1A 3GPPA 3TE6A 1OQYA 3EIHA 3N9TA 1NJFA 5EXSA 3T1YM 2DXIA 2ERCA 4WHSB 2GNOA 3HHZA 3PCKA 1V33A 2CHGA 4FWGA 1GABA 5H37D 4D80A 1DGGA 3I4YA 1G3IA 3T15A 1YKKA 2UXBM 4DV6M 4JI0M 2BUZB 4QHSA 4D81A 4LF6M 5EXXA 2ZTDA 1NY5A 4DV3M 3GPXA 4FCVA 2KEBA 1I4WA 1DMHA 2BWBA 4I8OA 5DNYA 1MU5A 3W0FA 2XSZA 3FYCA 4I81A 4CHTB 4XBOA 2DZNB 4AG6A 1XC8A 2BUWA 2BUWB 4LRTA 2XSUA 4JN6A 3FUUA 2JZ0A 2RRUA 1IN6A 2DAEA 4R71A 1YLAA 2LH0A 4GC5A 1YKNA 2HCBA 3PCJA 1G8PA 4NRVA 2EO2A 2DAKA 3GQ3A 1DGHA 4MH0E 3AOEC 1IFYA 3B7NA 1J7KA 1VDDA 1VQ1A 5E6JA 2KW0A 2G5GX 2QZ4A 3K2LA 3MMPA 3UGJA 2KRKA 2UUAM 4QOZC 5F3WA 3SHFA 4GKJM 2MH8A 3SHGB 1WGLA 3J81S 1GO5A 3PVSA 3PCCM 2DWMA 3LVWA 5EP3A 3RGSA 4NRWA 4LZJA 5EP2A 4A3VB 1Z5BA 2R65A 3HU2A 2ZAMA 4B7HA 3ZCBB 3U6PA 4W5WA 3ZC7B 3C3DA 5EXPA 1XB2B 3R8FA 4I5SA 1L1ZA 1GJSA 3AJIB 1VEGA 5ITQA 2CWBA 4IJEA 1LV7A 3MK6A 1R5LA 3MV6A 1ZMUA 4XK8F 4X62M 4K0KM 1WIVA 3HZJA 1ZMVA 1QAMA 4F2LA 2BUMA 3FUXA 3JR5A 3MFLM 2XZFA 4LFCM 2BUQA 3W68A 1IY0A 2C9CA 1KFVA 1G4AE 4OU7A 1VDLA 4MGHA 1VEKA 4GH9A 4QNMA 1NY6A 2EKFA 4B3RM 1HR0M 1OAIA 3PCDM 4B08A 2BUVA 4ILTA 3SMSA 3B9PA 1WR1B 3SYKA 4YHHM 2ZM6M 1SG9A 2CHQA 2E5LM 2CV1A 2QBYA 2V1UA 1Z59A 3TPZA 3C9PA 1IN4A 2B3TA 3GLGE 1PRBA 3MJ5A 4LFBM 2RGHA 1G41A 1NSFA 2LVAA 3KOZE 4IBEA 4RF0A 8CATA 4DV0M 2LVNC 1TDZA 2G3QA 1QAOA 2CV0A 4B3TM 3LMMA 3KDSE 1Z6TA 2Y0QA 1JR3D 4AQYM 4LJ4A 4AKIA 2BUMB 2LXEA 1R4GA 2M5ZA 4DBGB 3SASA 1IM2A 2JP7A 1ZAEA 5DFLA 5IZ7D 4GHLA 4JI6M 5ITYA 3LKTA 3O5UA 2Q2EB 4JI3M 3U61A 1HT1E 1OFIA 1HNZM 2OOBA 1OKSA 3FRHA 2F5OA 4UN2B 1S3SA 4NL4H 4G4RA 4ZPXA 3M0EA 3O6JA 1Y8GA 4KT0F 5FSWA 1JR3A 3GLFA 4OVZB 4GEWA 4QOSA 3ZQJA 3FUVA 3K9PA 3L28A 4LJ7A 3RFWA 1LTMA 2CEAA 2KZUA 2M60A 4PDIA 4IBJA 4EIWA 4B3SM 1UM8A 3F92A 3BXWA 2MR9A 3VK7A 1K3XA 1EOAA 1VG5A 2C98A 1QVRA 3TWMA 3GPUA 2N35A 5FTMA 3GLFB 2K6BA 4DUZM 2F5SA 5ITRA 2QSFX 5C1BA 2UXDM 1IQPA 3H4MA 3R9XB 3MV6M 2LVPC 1T43A 1T3TA 1SXJC 2YQZA 1OFHA 3TH1A 1HNWM 4IIWA 2BJVA 2VF8A 1HQCA 4PD2A 1D0LA 2CP8A 3HU3A 1Z5CA 4IBFA 3J7AS 4AKGA 3PCIA 3PCLM 2F5PA 4WHSD 4LJ8A 2CHVA 2LNHC 4L78A 5DYIA 2DI0A 4WHRA 1JB0F 1YSYA 4B7GA 4WHQA 1IXSA 1QDTA 2Z7JA 4Z8XA 2H5XA 3K8ZA 4DV1M 4ANRA 3T38A 1XHBA 4WHPA 2LBCA 1IY1A 3T63A 2XFSA 3GLHE 1OAOC 2KXEA 3KP1E 3SC3A 2C5RA 1DGBA 2Y20A 1HNXM 3VKGA 4WHRB 1IXRC 1PM5A 2QPAA 1PJJA 2XGNA 2C99A 3PCMA 1YUBA 1Q02A 2QP9X 5LMUM 2MGWA 4KLNA 4X66M 3GRYA 3HU1A 4JI7M 2KRUA 1ZQ9A 4IBKA 1X37A 1J09A 4KODA 1XMQM 2F5NA 2BUXB 3CGWA 2LWXA 2QBYB 1NNUC 1IXZA 4QHTA 3AFHA 1EO9B 3PCAM 2UU9M 4LFAM 1OTRA 2JWSA 1R2ZA 3KOWE 1GL6A 2FFJA 3OTOM 2QHOB 4GMQA 4LJ5A 5C18A 3LMXA 3HX3A 3T67M 1NO1A 2JY5A 3AKZA 3KVWA 1WHCA 4DV5M 3HJQA 1GKIA 3PCEA 4Y28F 4DV7M 2G8LA 1V92A 3DOAA 1EFUB 2XLJA 1XXHA 1DLQA 2D7HA 4WHOA 1GJTA 2WSFF 1DGHB 4NSRA 3U6OA 5E26A 2UXCM 1E32A 4PCZA 4KO8A 2BUYB 1PJQA 4HLQA 1TH3A 1WJ7A 2QENA 2BURA 1EO2A 2BNKA 4IJFA 5LMNM 3LXVA 4B3MM 4WP2A 5BR8M 3U6DA 1IN7A 3A46A 3TL4X 4AI6A 2XFTA 4FWHA 3HGIA 3E46A 3QWLA 2R44A 2JZ1A 1QDRA 4NC6A 1SXJB 3B7ZA 3K1JA 4P17A 3QYEA 4DV2M 4GHAA 2XF3A 4D82A 4MM3B 3TWLA 4CISA 2FNAA 4NXNM 2FE8A 1MN3A 2L4EA 2J7OA 4GKKM 1JR3E 3GLFE 1YKKB 1JQJC 3E21A 4QNRA 4RNAA 2CV2A 2R45A 1KYIA 3PCLA 3GLHB 3PCIM 2XSVA 4JV5M 1Q3BA 5ITTA 2R46A 1HT2E 1C1KA 1EO9A 2Z3XA 1RU3A 4XGIA 1L2CA 3AL0C 2L7HA 4M9ZA 2FS1A 1PJTA 2V6ZM 1L8QA 4LGMA 3THGA 3GLIE 4G6ZA 1K82A 4DR3M 4DR7M 1IXSB 3HHYA 3RE8A 1J5EM 1OJLA 3KW6A 3Q8GA 4LJ9A 5FTKA 2JUJA 1EIJA 1TMXA 1TGUA 1D0MA 3SATA 1R7RA 2HKJA 1ZMWA 4JI4M 1QYRA 3GP1A 1NV8A 3FUTA 3SAUA 1EOBA 1VEJA 4LGYA 3PCMM 3J27B 4FVMA 2L09A 2LHCA 4M9XA 4WHPB 4LY6A 3I4VA 1E9RA 2BUTB 2DZLA 4P16A 2WZJA 4B7FA 1E9SA 4PDGA 2C96A 3LQQA 4DR5M 1IN5A 2L6OA 1N77A 4LF4M 3FTDA 4FW9A 1WGNA 4AW4A 2OQ4A 4LG2A 4TUWA 4S12A 2KDLA 4HEOA 2ZTCA 3PFIA 5ITUA 4G4NA 2Z4RA 3GO8A 1DGFA 2KNZA 2W82A 4G3OA 3VFDA 3GLGB 1N36M 3D8BA 3J2PB 2DKLA 4WHOD 4LF9M 3T63M 4GC9A 1MJGM 2EUCA 3K9OA 3GRVA 2D7GA 1SXJD 3UZUA 3W0LB 3U5ZB 3C58A 4AKHA 1YKLB 3GLHA 1N34M 3U60B 1G71A 4DUYM 4OVZA 5KQ8A 1EO2B 5KQDA 1YKMA 4JYAM 4JI2M 2K0BX 2Z4SA 2BUYA 3JAMS 1TF0B 1XXHB 2DWNA 3MI5A 2GQFA 1L1TA 1KSFX 3W67A 2O25A 1SXJA 2DAGA 2JY7A 2DVWB 3PXGA 3Q8XA 4X65M 2BUZA 1Q3CA 1K3WA 3PCFM 2HWJA 2L4FA 3T67A 4L16A 2VDBB 4IBBA 1DV0A 2AZQA 3MFLA 4G4OA 2BURB 3PCJM 2H1RA 3LCVB 4WHSA 1BVSA 4I4LA 3U6EA 2DWZB 2DNAA 3IHPA 2J5YA 3T6PA
chains in the Genus database with same CATH topology
3U61B 3GPYA 5GKNA 4R3DA 3SYLA 3MI1M 3KSXA 3FTCA 4GRIA 3L29A 4WURA 1NNJA 2VIIA 4JI5M 4MGZE 4WW0A 3LXVM 1H6UA 3E4RA 2OPFA 1NJGA 3IG5A 3ZH9B 3A98B 4PT5A 3LVVA 5JI2E 2BV0A 3PCNM 5IT9S 2V1CA 3GRRA 1R2YA 1W5SA 1TH4A 3KOXE 2AHMA 4JI8M 5KPTA 1YKOB 2QCUA 4IBGA 3FTFA 2A5YB 3VLFB 3O6RA 1GL7A 3SMPA 7CATA 1SXJE 4FWDA 4KHPM 3PCGA 1R6BX 4REZA 2P5TA 4FCWA 5EJCA 1GVNA 1QQWA 3CF6E 3SARA 4MB7A 4GITA 3A45A 3GRUA 1MX0A 4JV5M 5ITXE 3VK8A 4JI1M 2L7IA 2R18A 3I51A 4L4UA 3GLIB 2VQEM 3AV0A 3PCBA 3WHLA 3LQRA 2XH9A 1WXQA 3QAUA 2R62A 1W5TA 3BOSA 4FCTA 2EA0A 3T1HM 3KS8A 2F5QA 1EE8A 4LJ6A 4ITQA 2F4VM 3TWKA 1FNNA 3DFZA 3HJ8A 3KSJA 2HHHM 5FTLA 1YKNB 5FTJA 2ZBKB 2R4EA 4BLCA 3KFUG 1YE9A 3U60A 4II7A 5KO3A 1YKLA 5A2QS 4LF8M 3D8LA 4DR4M 1DO0A 2XSRA 2BOYA 5FTNA 1Z5AA 3HWSA 2J7NA 4JXJA 3NWLA 1NVMA 1XNRM 1YKMB 2YNMD 2UUCM 4R7GA 2NQ8C 4DV4M 3PCFA 4M0DA 3L26A 3L27A 1IBKM 4M9SA 2DZOB 5DYGA 3MI1A 3MHVC 1QAQA 3SAVA 1EOAB 5KPZA 4CGYB 4LJAA 2Y0TA 3JR4A 1XMOM 1QANA 2HL7A 3A42A 4IBIA 1DO2A 2XEPA 4WHRF 3IG8A 3GQ5A 3FTEA 2O5RA 3AOEA 3KS4A 3GLIA 3UK6A 3FD9A 3HHXA 1TH2A 4X64M 1EOBB 1N78A 2JA2A 3EIEA 2ZANA 1IN8A 3J7BA 5IREB 3PCKM 2VQFM 5FLXS 3PCNA 3HJSA 4AG5A 1N32M 3MI5M 2RGOA 2I7NA 4L15A 3K92A 4BB9A 4Z6YA 3CTWB 1XNQM 3UMMA 3PCAA 3O32A 5JI3E 3E9SA 1YKPA 1L2BA 3PCHM 1NHGC 2BUUB 3MV4M 1EOCB 2BV0B 1IY2A 1G59A 4NXMM 2PCDM 3DA1A 2Y21A 3NBIA 3LMXM 3AOGA 2I7PA 3PCBM 5KPRA 2RKOA 3FUWA 3KXEC 4WHPD 1IBLM 4LF5M 3FKEA 3L25A 1IBMM 3U6LA 5EP1A 4NSOB 3U6CA 1QZMA 4G4QA 4BBAA 3WHKA 5EQTA 4LF7M 4LCBA 2BUQB 3ILKA 3SBJA 2C9OA 4LZZA 2BJWA 1E94E 2R4JA 1DLTA 3SAWA 4GIPA 2KA6B 3HKPA 4WHOB 2XSZD 3M6AA 3VDPA 5EP4A 3J80S 2KZSA 3CF0A 1Q39A 3VKHA 3U6QA 4IBCA 3PCGM 4MGKE 5TD3A 2XZUA 1DLMA 5IWAM 4DR1M 2K47A 4MGYE 5EXTA 3U5ZA 5ITXA 2YFQA 2X4AA 3U6MA 3PCEM 3M7GA 4IBDA 3U6SA 3PCDA 1NHWC 5BPVA 4HL4A 3KOYE 1N33M 2BUXA 3RGPA 3CF2A 1HQYE 4DR2M 2CFOA 3PCCA 4ILVA 4OX9M 3PNVA 2D7EA 3KP0E 3HHWA 3UJNA 1PJIA 3GQ4A 1EOCA 4OW0A 4AZFA 1L2DA 1I94M 4DR6M 2BUTA 4FD2A 3GLGA 3LKTM 3TQSA 4LRSA 1GLNA 1D2NA 2X49A 3PNYA 2BUVB 3PCHA 1ORYB 3MV4A 2CE7A 3VDUA 4L8RC 4WHQB 2ZAOA 1S9AA 3SFZA 2UUBM 4NOOB 1XWIA 4MGIE 2BUUA 1N75A 2DHRA 4M0WA 2PCDA 2FOIC 4YY3M 2YR0A 3DZDA 1YKOA 1YKPB 3L2AA 2CUZA 2DWLA 1FJGM 4RF1A 1TDHA 3FYDA 3GPPA 2X8AA 3TE6A 3EIHA 3N9TA 1NJFA 5EXSA 3T1YM 2DXIA 2ERCA 4WHSB 3PCKA 3HHZA 2CHGA 4FWGA 5H37D 4D80A 1DGGA 3I4YA 1G3IA 3T15A 1YKKA 2UXBM 4DV6M 4JI0M 2BUZB 4QHSA 4D81A 4LF6M 5EXXA 1NY5A 4DV3M 3GPXA 4FCVA 2KEBA 1I4WA 1DMHA 4I8OA 5DNYA 1MU5A 3W0FA 2XSZA 3FYCA 4I81A 4CHTB 4XBOA 2DZNB 4AG6A 1XC8A 2BUWA 2BUWB 4LRTA 2XSUA 4JN6A 3FUUA 1IN6A 2LH0A 4GC5A 1YKNA 2HCBA 3PCJA 1G8PA 4NRVA 2EO2A 3GQ3A 1DGHA 4MH0E 3AOEC 1J7KA 1VDDA 5E6JA 2KW0A 2G5GX 2QZ4A 3K2LA 3UGJA 2UUAM 2KRKA 4GKJM 4QOZC 5F3WA 3SHFA 3SHGB 3J81S 3PVSA 3PCCM 2DWMA 3LVWA 5EP3A 3RGSA 4NRWA 4LZJA 5EP2A 4A3VB 1Z5BA 2R65A 3HU2A 4B7HA 3ZCBB 3U6PA 4W5WA 3ZC7B 5EXPA 3R8FA 4I5SA 1L1ZA 3AJIB 5ITQA 4IJEA 1LV7A 3MK6A 3MV6A 4X62M 4K0KM 2BUMA 1QAMA 3FUXA 3JR5A 3MFLM 2XZFA 4LFCM 2BUQA 1IY0A 2C9CA 1KFVA 1G4AE 4OU7A 4MGHA 4GH9A 4QNMA 1NY6A 3PCDM 4B3RM 1HR0M 4B08A 2BUVA 4ILTA 3SMSA 3B9PA 3SYKA 4YHHM 2ZM6M 2CV1A 2QBYA 2CHQA 2E5LM 2V1UA 1Z59A 3TPZA 4LFBM 1IN4A 3MJ5A 2RGHA 1G41A 1NSFA 3KOZE 4IBEA 4RF0A 8CATA 4DV0M 1TDZA 2CV0A 4B3TM 1QAOA 3LMMA 3KDSE 1Z6TA 2Y0QA 1JR3D 4AQYM 4LJ4A 4AKIA 2BUMB 2LXEA 2M5ZA 3SASA 1IM2A 5IZ7D 1ZAEA 3O5UA 4GHLA 3LKTA 4JI6M 5ITYA 2Q2EB 4JI3M 3U61A 1HT1E 1OFIA 1HNZM 2F5OA 1S3SA 4NL4H 4G4RA 4ZPXA 3M0EA 3O6JA 5FSWA 1JR3A 3GLFA 4OVZB 4QOSA 3FUVA 3L28A 4LJ7A 3RFWA 2CEAA 2KZUA 2M60A 4PDIA 4EIWA 4B3SM 1UM8A 3VK7A 1K3XA 1EOAA 2C98A 1QVRA 3TWMA 3GPUA 3GLFB 5FTMA 4DUZM 2F5SA 5ITRA 5C1BA 2UXDM 1IQPA 3H4MA 3R9XB 3MV6M 1T3TA 1SXJC 2YQZA 1OFHA 3TH1A 1HNWM 4IIWA 2BJVA 1HQCA 4PD2A 3HU3A 1Z5CA 4IBFA 3J7AS 4AKGA 3PCIA 3PCLM 2F5PA 4WHSD 4LJ8A 2CHVA 2LNHC 4L78A 5DYIA 4WHRA 1YSYA 4B7GA 4WHQA 2Z7JA 4Z8XA 3K8ZA 4DV1M 3T38A 1XHBA 4WHPA 1IY1A 3T63A 2XFSA 3KP1E 2KXEA 1HNXM 3SC3A 3VKGA 2C5RA 1DGBA 2Y20A 4WHRB 1IXRC 1PM5A 2QPAA 1PJJA 2XGNA 2C99A 3PCMA 1YUBA 2QP9X 5LMUM 4X66M 4KLNA 3GRYA 3HU1A 4JI7M 2KRUA 1ZQ9A 4IBKA 1X37A 1J09A 4KODA 1XMQM 2F5NA 2BUXB 2QBYB 2LWXA 1NNUC 1IXZA 4QHTA 3AFHA 1EO9B 3PCAM 2UU9M 4LFAM 1R2ZA 3KOWE 1GL6A 2FFJA 3OTOM 4GMQA 4LJ5A 5C18A 3LMXA 3T67M 4DV5M 3AKZA 3KVWA 3HJQA 1GKIA 3PCEA 4DV7M 2G8LA 3DOAA 2XLJA 1XXHA 1DLQA 2D7HA 4WHOA 4NSRA 1DGHB 3U6OA 5E26A 2UXCM 1E32A 4PCZA 4KO8A 2BUYB 4HLQA 1TH3A 2QENA 2BURA 1EO2A 2BNKA 4IJFA 5LMNM 3LXVA 4B3MM 5BR8M 3U6DA 1IN7A 3A46A 3TL4X 4AI6A 2XFTA 4FWHA 3HGIA 3QWLA 1SXJB 3K1JA 4DV2M 4GHAA 2XF3A 4D82A 4MM3B 3TWLA 4CISA 2FNAA 4NXNM 2FE8A 2J7OA 4GKKM 1YKKB 1JQJC 4QNRA 4RNAA 2CV2A 2R45A 1KYIA 3PCLA 3GLHB 3PCIM 2XSVA 1Q3BA 5ITTA 2R46A 1HT2E 1C1KA 1EO9A 2Z3XA 4XGIA 1L2CA 3AL0C 2L7HA 4M9ZA 3THGA 4LGMA 2V6ZM 1L8QA 1K82A 4G6ZA 4DR3M 4DR7M 1IXSB 3HHYA 3RE8A 1J5EM 1OJLA 3KW6A 4LJ9A 5FTKA 1TMXA 1TGUA 3SATA 1R7RA 2HKJA 4JI4M 1QYRA 3GP1A 3SAUA 3FUTA 1EOBA 3PCMM 4LGYA 3J27B 4FVMA 2L09A 4M9XA 4WHPB 4LY6A 3I4VA 1E9RA 2BUTB 4P16A 4B7FA 1E9SA 4PDGA 2C96A 3LQQA 4DR5M 1IN5A 2L6OA 1N77A 4LF4M 3FTDA 4FW9A 4AW4A 2OQ4A 4LG2A 4TUWA 4S12A 3PFIA 5ITUA 4G4NA 2Z4RA 3GO8A 1DGFA 2W82A 3VFDA 3GLGB 1N36M 3D8BA 3J2PB 4WHOD 4LF9M 3T63M 4GC9A 2EUCA 3GRVA 2D7GA 1SXJD 3UZUA 3W0LB 3U5ZB 3C58A 4AKHA 1YKLB 3GLHA 1N34M 3U60B 4DUYM 4OVZA 5KQ8A 1EO2B 5KQDA 1YKMA 4JYAM 4JI2M 2Z4SA 2BUYA 3JAMS 1XXHB 2DWNA 3MI5A 1L1TA 1KSFX 1SXJA 2DVWB 3PXGA 3Q8XA 4X65M 2BUZA 1Q3CA 1K3WA 3PCFM 3T67A 4L16A 4IBBA 2AZQA 3MFLA 4G4OA 2BURB 3PCJM 2H1RA 4WHSA 4I4LA 3U6EA 2DWZB 2ZAMA 4IBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MI1 M;  2BUQ B;  3T67 M;  3LMX A;  3MV6 A;  3HJQ A;  2BUM A;  1DLT A;  3PCE A;  3MFL M;  3LXV M;  3HKP A;  4WHS D;  2BUQ A;  4WHO B;  1DLQ A;  2BV0 A;  4WHO A;  3PCN M;  2BUY B;  3PCD M;  3PCG M;  5TD3 A;  2BUR A;  1EO2 A;  1DLM A;  2BUV A;  4ILT A;  3LXV A;  1YKO B;  3HGI A;  3O6R A;  3PCE M;  3PCD A;  3PCG A;  2BUX A;  2BUM B;  3I51 A;  3PCC A;  1YKK B;  3PCB A;  3O5U A;  4ILV A;  3LKT A;  3PCL A;  3PCI M;  1EOC A;  2XSV A;  3HJ8 A;  2BUT A;  1EO9 A;  1YKN B;  3O6J A;  3LKT M;  2BUV B;  3PCH A;  3MV4 A;  3HHY A;  1YKL A;  4WHQ B;  1S9A A;  2XSR A;  1TMX A;  2BOY A;  2BUU A;  2PCD A;  1YKM B;  1EOB A;  1EOA A;  3PCM M;  1YKP B;  1YKO A;  4WHP B;  3I4V A;  3PCF A;  2BUT B;  3MI1 A;  1EOA B;  3N9T A;  3MV6 M;  4WHS B;  3PCK A;  3TH1 A;  3I4Y A;  1YKK A;  4WHR F;  2BUZ B;  1EOB B;  3HHX A;  3PCI A;  3PCL M;  1DMH A;  3PCK M;  2XSU A;  2BUW A;  4WHO D;  4WHR A;  3T63 M;  4WHQ A;  3PCN A;  3HJS A;  1YKL B;  3MI5 M;  4WHP A;  1EO2 B;  1YKN A;  3PCA A;  3PCJ A;  1YKM A;  3O32 A;  3T63 A;  1YKP A;  2BUY A;  3PCH M;  2BUW B;  4WHR B;  2BUU B;  3MV4 M;  1EOC B;  3MI5 A;  2BV0 B;  2PCD M;  3PCM A;  3LMX M;  3PCC M;  3PCB M;  2BUZ A;  2BUX B;  4WHP D;  3T67 A;  2AZQ A;  3MFL A;  2BUR B;  1EO9 B;  3PCA M;  3PCJ M;  4WHS A;  3PCF M; 
#chains in the Genus database with same CATH topology
 3U61 B;  3GPY A;  5GKN A;  4R3D A;  2APL A;  3SYL A;  4CIZ A;  3MI1 M;  3KSX A;  1ZV1 A;  3FTC A;  1TR8 A;  4GRI A;  3NBX X;  3L29 A;  4WUR A;  3LCU A;  3B74 A;  2OOA A;  1NNJ A;  2VII A;  4JI5 M;  2HAK A;  4MGZ E;  4WW0 A;  2FH0 A;  3LXV M;  1H6U A;  3E4R A;  2OPF A;  1NJG A;  3IG5 A;  3ZH9 B;  3A98 B;  4PT5 A;  3LVV A;  5JI2 E;  2CRU A;  2BV0 A;  3PCN M;  5IT9 S;  2V1C A;  3GRR A;  1R2Y A;  1W5S A;  3B89 A;  2LVO C;  1TH4 A;  3KOX E;  2AHM A;  1V34 A;  4JI8 M;  5KPT A;  1YKO B;  2QCU A;  3GLI A;  4IBG A;  2JXN A;  3FTF A;  2A5Y B;  3VLF B;  3O6R A;  1GL7 A;  3SMP A;  7CAT A;  1SXJ E;  4FWD A;  4KHP M;  3PCG A;  1R6B X;  4REZ A;  2P5T A;  3H4J A;  4FCW A;  1GVN A;  1QQW A;  4L6V 6;  5EJC A;  3CF6 E;  2LHG A;  3SAR A;  4MB7 A;  2QQ8 A;  3IEC A;  4GIT A;  3A45 A;  1P3Q Q;  3GRU A;  1MX0 A;  1HJP A;  5ITX E;  4F1I A;  3VK8 A;  2L7I A;  2R18 A;  3I51 A;  4L4U A;  3GLI B;  4JI1 M;  2VQE M;  3AV0 A;  3PCB A;  3WHL A;  3LQR A;  1F4I A;  2XH9 A;  1WXQ A;  3QAU A;  2R62 A;  1W5T A;  3BOS A;  4FCT A;  2EA0 A;  3T1H M;  3KS8 A;  2F5Q A;  2DHY A;  3LW5 F;  1EE8 A;  4LJ6 A;  4ITQ A;  2F4V M;  3TWK A;  1FNN A;  3DFZ A;  3HJ8 A;  3KSJ A;  2HHH M;  5FTL A;  1YKN B;  5FTJ A;  1A5T A;  2ZBK B;  2R4E A;  3I04 M;  4BLC A;  1PGY A;  3KFU G;  1YE9 A;  3U60 A;  4II7 A;  5KO3 A;  1YKL A;  5A2Q S;  4LF8 M;  3D8L A;  4DR4 M;  1DO0 A;  2XSR A;  2BOY A;  5FTN A;  1CUK A;  1OIP A;  1Z5A A;  1AUA A;  3HWS A;  2Z8Y M;  2J7N A;  4JXJ A;  3NWL A;  1NVM A;  1XNR M;  1YKM B;  2YNM D;  2UUC M;  4R7G A;  2NQ8 C;  1QZE A;  4DV4 M;  3PCF A;  4M0D A;  3L26 A;  3L27 A;  1IBK M;  4M9S A;  2DZO B;  5DYG A;  3MI1 A;  3MHV C;  1QAQ A;  2DAI A;  3SAV A;  5KPZ A;  1EOB B;  4CGY B;  4LJA A;  1EOA B;  2Y0T A;  3JR4 A;  1XMO M;  1TTE A;  1QAN A;  2HL7 A;  2KHH A;  3A42 A;  4IBI A;  1UFZ A;  1T6O A;  1DO2 A;  2XEP A;  4WHR F;  3IG8 A;  3GQ5 A;  3FTE A;  2O5R A;  3AOE A;  3KS4 A;  3B7Q A;  2DEN A;  3FD9 A;  3HHX A;  1TH2 A;  2BWE A;  4RKU F;  3UK6 A;  2JA2 A;  2R6F A;  3EIE A;  4X64 M;  1N78 A;  2ZAN A;  1IN8 A;  3J7B A;  5IRE B;  3PCK M;  2EKK A;  2VQF M;  5FLX S;  3PCN A;  3HJS A;  4AG5 A;  2LTU A;  1N32 M;  2QNJ A;  3MI5 M;  2RGO A;  2I7N A;  4L15 A;  3K92 A;  4BB9 A;  2KNV A;  4Z6Y A;  3CTW B;  1XNQ M;  2JY6 B;  3UMM A;  3O32 A;  3PCA A;  5JI3 E;  3E9S A;  1YKP A;  1L2B A;  3PCH M;  1NHG C;  3FRI A;  3V76 A;  3BBZ A;  2BUU B;  3MV4 M;  1EOC B;  2BV0 B;  1IY2 A;  1G59 A;  4NXM M;  2PCD M;  3DA1 A;  2Y21 A;  3NBI A;  3LMX M;  3AOG A;  2I7P A;  2O01 F;  2JNH A;  2RKO A;  5KPR A;  3PCB M;  3FE3 A;  3FUW A;  3KXE C;  4WHP D;  1IBL M;  4LF5 M;  3FKE A;  3L25 A;  1IBM M;  1OIZ A;  3U6L A;  5EP1 A;  2K9D A;  4NSO B;  3U6C A;  1QZM A;  4G4Q A;  1AIP C;  4BBA A;  3WHK A;  5EQT A;  2KNA A;  4LF7 M;  3I01 M;  4LCB A;  2BUQ B;  2MRO B;  3ILK A;  3SBJ A;  2C9O A;  4LZZ A;  2BJW A;  1E94 E;  2R4J A;  1DLT A;  2WSC F;  3SAW A;  4GIP A;  2MJ5 B;  2KA6 B;  3HKP A;  4WHO B;  4CJ6 A;  1XXH E;  2XSZ D;  3M6A A;  3VDP A;  5EP4 A;  3J80 S;  2KZS A;  3CF0 A;  1Q39 A;  3VKH A;  3U6Q A;  2R0I A;  2DAM A;  4IBC A;  3PCG M;  4MGK E;  5TD3 A;  2XZU A;  1DLM A;  5IWA M;  4DR1 M;  2K47 A;  3C3E A;  1QUT A;  4MGY E;  5EXT A;  5L8R F;  5ITX A;  3U5Z A;  2YFQ A;  2X4A A;  3U6M A;  3PCE M;  3M7G A;  4IBD A;  3U6S A;  3PCD A;  1NHW C;  3HY5 A;  5BPV A;  4HL4 A;  3KOY E;  1N33 M;  2BUX A;  3RGP A;  3CF2 A;  1HQY E;  4DR2 M;  2CFO A;  3PCC A;  1NV9 A;  1QUS A;  4Q7J A;  4ILV A;  4OX9 M;  3PNV A;  2D7E A;  3KP0 E;  3HHW A;  3UJN A;  1PJI A;  3GQ4 A;  1EOC A;  4OW0 A;  4AZF A;  1L2D A;  3QYB A;  1I94 M;  4DR6 M;  2BUT A;  2EJS A;  4FD2 A;  3GLG A;  3LKT M;  3TQS A;  4LRS A;  1GLN A;  1D2N A;  2X49 A;  3PNY A;  2JY8 A;  2BUV B;  1ORY B;  3PCH A;  3MV4 A;  2CE7 A;  3VDU A;  4L8R C;  4WHQ B;  2ZAO A;  1PJS A;  1S9A A;  3SFZ A;  2UUB M;  4NOO B;  1XWI A;  4MGI E;  2BUU A;  1N75 A;  2DHR A;  4M0W A;  2PCD A;  2FOI C;  4YY3 M;  2LVQ D;  2YR0 A;  3DZD A;  1YKO A;  1YKP B;  3L2A A;  2CUZ A;  2DWL A;  2WSE F;  1FJG M;  1C7Y A;  2L2D A;  1TDH A;  2OO9 A;  2VF7 A;  3FYD A;  1D0K A;  2X8A A;  4RF1 A;  3GPP A;  3TE6 A;  1OQY A;  3EIH A;  3N9T A;  1NJF A;  5EXS A;  3T1Y M;  2DXI A;  2ERC A;  4WHS B;  2GNO A;  3HHZ A;  3PCK A;  1V33 A;  2CHG A;  4FWG A;  1GAB A;  5H37 D;  4D80 A;  1DGG A;  3I4Y A;  1G3I A;  3T15 A;  1YKK A;  2UXB M;  4DV6 M;  4JI0 M;  2BUZ B;  4QHS A;  4D81 A;  4LF6 M;  5EXX A;  2ZTD A;  1NY5 A;  4DV3 M;  3GPX A;  4FCV A;  2KEB A;  1I4W A;  1DMH A;  2BWB A;  4I8O A;  5DNY A;  1MU5 A;  3W0F A;  2XSZ A;  3FYC A;  4I81 A;  4CHT B;  4XBO A;  2DZN B;  4AG6 A;  1XC8 A;  2BUW A;  2BUW B;  4LRT A;  2XSU A;  4JN6 A;  3FUU A;  2JZ0 A;  2RRU A;  1IN6 A;  2DAE A;  4R71 A;  1YLA A;  2LH0 A;  4GC5 A;  1YKN A;  2HCB A;  3PCJ A;  1G8P A;  4NRV A;  2EO2 A;  2DAK A;  3GQ3 A;  1DGH A;  4MH0 E;  3AOE C;  1IFY A;  3B7N A;  1J7K A;  1VDD A;  1VQ1 A;  5E6J A;  2KW0 A;  2G5G X;  2QZ4 A;  3K2L A;  3MMP A;  3UGJ A;  2KRK A;  2UUA M;  4QOZ C;  5F3W A;  3SHF A;  4GKJ M;  2MH8 A;  3SHG B;  1WGL A;  3J81 S;  1GO5 A;  3PVS A;  3PCC M;  2DWM A;  3LVW A;  5EP3 A;  3RGS A;  4NRW A;  4LZJ A;  5EP2 A;  4A3V B;  1Z5B A;  2R65 A;  3HU2 A;  2ZAM A;  4B7H A;  3ZCB B;  3U6P A;  4W5W A;  3ZC7 B;  3C3D A;  5EXP A;  1XB2 B;  3R8F A;  4I5S A;  1L1Z A;  1GJS A;  3AJI B;  1VEG A;  5ITQ A;  2CWB A;  4IJE A;  1LV7 A;  3MK6 A;  1R5L A;  3MV6 A;  1ZMU A;  4XK8 F;  4X62 M;  4K0K M;  1WIV A;  3HZJ A;  1ZMV A;  1QAM A;  4F2L A;  2BUM A;  3FUX A;  3JR5 A;  3MFL M;  2XZF A;  4LFC M;  2BUQ A;  3W68 A;  1IY0 A;  2C9C A;  1KFV A;  1G4A E;  4OU7 A;  1VDL A;  4MGH A;  1VEK A;  4GH9 A;  4QNM A;  1NY6 A;  2EKF A;  4B3R M;  1HR0 M;  1OAI A;  3PCD M;  4B08 A;  2BUV A;  4ILT A;  3SMS A;  3B9P A;  1WR1 B;  3SYK A;  4YHH M;  2ZM6 M;  1SG9 A;  2CHQ A;  2E5L M;  2CV1 A;  2QBY A;  2V1U A;  1Z59 A;  3TPZ A;  3C9P A;  1IN4 A;  2B3T A;  3GLG E;  1PRB A;  3MJ5 A;  4LFB M;  2RGH A;  1G41 A;  1NSF A;  2LVA A;  3KOZ E;  4IBE A;  4RF0 A;  8CAT A;  4DV0 M;  2LVN C;  1TDZ A;  2G3Q A;  1QAO A;  2CV0 A;  4B3T M;  3LMM A;  3KDS E;  1Z6T A;  2Y0Q A;  1JR3 D;  4AQY M;  4LJ4 A;  4AKI A;  2BUM B;  2LXE A;  1R4G A;  2M5Z A;  4DBG B;  3SAS A;  1IM2 A;  2JP7 A;  1ZAE A;  5DFL A;  5IZ7 D;  4GHL A;  4JI6 M;  5ITY A;  3LKT A;  3O5U A;  2Q2E B;  4JI3 M;  3U61 A;  1HT1 E;  1OFI A;  1HNZ M;  2OOB A;  1OKS A;  3FRH A;  2F5O A;  4UN2 B;  1S3S A;  4NL4 H;  4G4R A;  4ZPX A;  3M0E A;  3O6J A;  1Y8G A;  4KT0 F;  5FSW A;  1JR3 A;  3GLF A;  4OVZ B;  4GEW A;  4QOS A;  3ZQJ A;  3FUV A;  3K9P A;  3L28 A;  4LJ7 A;  3RFW A;  1LTM A;  2CEA A;  2KZU A;  2M60 A;  4PDI A;  4IBJ A;  4EIW A;  4B3S M;  1UM8 A;  3F92 A;  3BXW A;  2MR9 A;  3VK7 A;  1K3X A;  1EOA A;  1VG5 A;  2C98 A;  1QVR A;  3TWM A;  3GPU A;  2N35 A;  5FTM A;  3GLF B;  2K6B A;  4DUZ M;  2F5S A;  5ITR A;  2QSF X;  5C1B A;  2UXD M;  1IQP A;  3H4M A;  3R9X B;  3MV6 M;  2LVP C;  1T43 A;  1T3T A;  1SXJ C;  2YQZ A;  1OFH A;  3TH1 A;  1HNW M;  4IIW A;  2BJV A;  2VF8 A;  1HQC A;  4PD2 A;  1D0L A;  2CP8 A;  3HU3 A;  1Z5C A;  4IBF A;  3J7A S;  4AKG A;  3PCI A;  3PCL M;  2F5P A;  4WHS D;  4LJ8 A;  2CHV A;  2LNH C;  4L78 A;  5DYI A;  2DI0 A;  4WHR A;  1JB0 F;  1YSY A;  4B7G A;  4WHQ A;  1IXS A;  1QDT A;  2Z7J A;  4Z8X A;  2H5X A;  3K8Z A;  4DV1 M;  4ANR A;  3T38 A;  1XHB A;  4WHP A;  2LBC A;  1IY1 A;  3T63 A;  2XFS A;  3GLH E;  1OAO C;  2KXE A;  3KP1 E;  3SC3 A;  2C5R A;  1DGB A;  2Y20 A;  1HNX M;  3VKG A;  4WHR B;  1IXR C;  1PM5 A;  2QPA A;  1PJJ A;  2XGN A;  2C99 A;  3PCM A;  1YUB A;  1Q02 A;  2QP9 X;  5LMU M;  2MGW A;  4KLN A;  4X66 M;  3GRY A;  3HU1 A;  4JI7 M;  2KRU A;  1ZQ9 A;  4IBK A;  1X37 A;  1J09 A;  4KOD A;  1XMQ M;  2F5N A;  2BUX B;  3CGW A;  2LWX A;  2QBY B;  1NNU C;  1IXZ A;  4QHT A;  3AFH A;  1EO9 B;  3PCA M;  2UU9 M;  4LFA M;  1OTR A;  2JWS A;  1R2Z A;  3KOW E;  1GL6 A;  2FFJ A;  3OTO M;  2QHO B;  4GMQ A;  4LJ5 A;  5C18 A;  3LMX A;  3HX3 A;  3T67 M;  1NO1 A;  2JY5 A;  3AKZ A;  3KVW A;  1WHC A;  4DV5 M;  3HJQ A;  1GKI A;  3PCE A;  4Y28 F;  4DV7 M;  2G8L A;  1V92 A;  3DOA A;  1EFU B;  2XLJ A;  1XXH A;  1DLQ A;  2D7H A;  4WHO A;  1GJT A;  2WSF F;  1DGH B;  4NSR A;  3U6O A;  5E26 A;  2UXC M;  1E32 A;  4PCZ A;  4KO8 A;  2BUY B;  1PJQ A;  4HLQ A;  1TH3 A;  1WJ7 A;  2QEN A;  2BUR A;  1EO2 A;  2BNK A;  4IJF A;  5LMN M;  3LXV A;  4B3M M;  4WP2 A;  5BR8 M;  3U6D A;  1IN7 A;  3A46 A;  3TL4 X;  4AI6 A;  2XFT A;  4FWH A;  3HGI A;  3E46 A;  3QWL A;  2R44 A;  2JZ1 A;  1QDR A;  4NC6 A;  1SXJ B;  3B7Z A;  3K1J A;  4P17 A;  3QYE A;  4DV2 M;  4GHA A;  2XF3 A;  4D82 A;  4MM3 B;  3TWL A;  4CIS A;  2FNA A;  4NXN M;  2FE8 A;  1MN3 A;  2L4E A;  2J7O A;  4GKK M;  1JR3 E;  3GLF E;  1YKK B;  1JQJ C;  3E21 A;  4QNR A;  4RNA A;  2CV2 A;  2R45 A;  1KYI A;  3PCL A;  3GLH B;  3PCI M;  2XSV A;  4JV5 M;  1Q3B A;  5ITT A;  2R46 A;  1HT2 E;  1C1K A;  1EO9 A;  2Z3X A;  1RU3 A;  4XGI A;  1L2C A;  3AL0 C;  2L7H A;  4M9Z A;  2FS1 A;  1PJT A;  2V6Z M;  1L8Q A;  4LGM A;  3THG A;  3GLI E;  4G6Z A;  1K82 A;  4DR3 M;  4DR7 M;  1IXS B;  3HHY A;  3RE8 A;  1J5E M;  1OJL A;  3KW6 A;  3Q8G A;  4LJ9 A;  5FTK A;  2JUJ A;  1EIJ A;  1TMX A;  1TGU A;  1D0M A;  3SAT A;  1R7R A;  2HKJ A;  1ZMW A;  4JI4 M;  1QYR A;  3GP1 A;  1NV8 A;  3FUT A;  3SAU A;  1EOB A;  1VEJ A;  4LGY A;  3PCM M;  3J27 B;  4FVM A;  2L09 A;  2LHC A;  4M9X A;  4WHP B;  4LY6 A;  3I4V A;  1E9R A;  2BUT B;  2DZL A;  4P16 A;  2WZJ A;  4B7F A;  1E9S A;  4PDG A;  2C96 A;  3LQQ A;  4DR5 M;  1IN5 A;  2L6O A;  1N77 A;  4LF4 M;  3FTD A;  4FW9 A;  1WGN A;  4AW4 A;  2OQ4 A;  4LG2 A;  4TUW A;  4S12 A;  2KDL A;  4HEO A;  2ZTC A;  3PFI A;  5ITU A;  4G4N A;  2Z4R A;  3GO8 A;  1DGF A;  2KNZ A;  2W82 A;  4G3O A;  3VFD A;  3GLG B;  1N36 M;  3D8B A;  3J2P B;  2DKL A;  4WHO D;  4LF9 M;  3T63 M;  4GC9 A;  1MJG M;  2EUC A;  3K9O A;  3GRV A;  2D7G A;  1SXJ D;  3UZU A;  3W0L B;  3U5Z B;  3C58 A;  4AKH A;  1YKL B;  3GLH A;  1N34 M;  3U60 B;  1G71 A;  4DUY M;  4OVZ A;  5KQ8 A;  1EO2 B;  5KQD A;  1YKM A;  4JYA M;  4JI2 M;  2K0B X;  2Z4S A;  2BUY A;  3JAM S;  1TF0 B;  1XXH B;  2DWN A;  3MI5 A;  2GQF A;  1L1T A;  1KSF X;  3W67 A;  2O25 A;  1SXJ A;  2DAG A;  2JY7 A;  2DVW B;  3PXG A;  3Q8X A;  4X65 M;  2BUZ A;  1Q3C A;  1K3W A;  3PCF M;  2HWJ A;  2L4F A;  3T67 A;  4L16 A;  2VDB B;  4IBB A;  1DV0 A;  2AZQ A;  3MFL A;  4G4O A;  2BUR B;  3PCJ M;  2H1R A;  3LCV B;  4WHS A;  1BVS A;  4I4L A;  3U6E A;  2DWZ B;  2DNA A;  3IHP A;  2J5Y A;  3T6P A; 
#chains in the Genus database with same CATH homology
 3U61 B;  3GPY A;  5GKN A;  4R3D A;  3SYL A;  3MI1 M;  3KSX A;  3FTC A;  4GRI A;  3L29 A;  4WUR A;  1NNJ A;  2VII A;  4JI5 M;  4MGZ E;  4WW0 A;  3LXV M;  1H6U A;  3E4R A;  2OPF A;  1NJG A;  3IG5 A;  3ZH9 B;  3A98 B;  4PT5 A;  3LVV A;  5JI2 E;  2BV0 A;  3PCN M;  5IT9 S;  2V1C A;  3GRR A;  1R2Y A;  1W5S A;  1TH4 A;  3KOX E;  2AHM A;  4JI8 M;  5KPT A;  1YKO B;  2QCU A;  4IBG A;  3FTF A;  2A5Y B;  3VLF B;  3O6R A;  1GL7 A;  3SMP A;  7CAT A;  1SXJ E;  4FWD A;  4KHP M;  3PCG A;  1R6B X;  4REZ A;  2P5T A;  4FCW A;  5EJC A;  1GVN A;  1QQW A;  3CF6 E;  3SAR A;  4MB7 A;  4GIT A;  3A45 A;  3GRU A;  1MX0 A;  4JV5 M;  5ITX E;  3VK8 A;  4JI1 M;  2L7I A;  2R18 A;  3I51 A;  4L4U A;  3GLI B;  2VQE M;  3AV0 A;  3PCB A;  3WHL A;  3LQR A;  2XH9 A;  1WXQ A;  3QAU A;  2R62 A;  1W5T A;  3BOS A;  4FCT A;  2EA0 A;  3T1H M;  3KS8 A;  2F5Q A;  1EE8 A;  4LJ6 A;  4ITQ A;  2F4V M;  3TWK A;  1FNN A;  3DFZ A;  3HJ8 A;  3KSJ A;  2HHH M;  5FTL A;  1YKN B;  5FTJ A;  2ZBK B;  2R4E A;  4BLC A;  3KFU G;  1YE9 A;  3U60 A;  4II7 A;  5KO3 A;  1YKL A;  5A2Q S;  4LF8 M;  3D8L A;  4DR4 M;  1DO0 A;  2XSR A;  2BOY A;  5FTN A;  1Z5A A;  3HWS A;  2J7N A;  4JXJ A;  3NWL A;  1NVM A;  1XNR M;  1YKM B;  2YNM D;  2UUC M;  4R7G A;  2NQ8 C;  4DV4 M;  3PCF A;  4M0D A;  3L26 A;  3L27 A;  1IBK M;  4M9S A;  2DZO B;  5DYG A;  3MI1 A;  3MHV C;  1QAQ A;  3SAV A;  1EOA B;  5KPZ A;  4CGY B;  4LJA A;  2Y0T A;  3JR4 A;  1XMO M;  1QAN A;  2HL7 A;  3A42 A;  4IBI A;  1DO2 A;  2XEP A;  4WHR F;  3IG8 A;  3GQ5 A;  3FTE A;  2O5R A;  3AOE A;  3KS4 A;  3GLI A;  3UK6 A;  3FD9 A;  3HHX A;  1TH2 A;  4X64 M;  1EOB B;  1N78 A;  2JA2 A;  3EIE A;  2ZAN A;  1IN8 A;  3J7B A;  5IRE B;  3PCK M;  2VQF M;  5FLX S;  3PCN A;  3HJS A;  4AG5 A;  1N32 M;  3MI5 M;  2RGO A;  2I7N A;  4L15 A;  3K92 A;  4BB9 A;  4Z6Y A;  3CTW B;  1XNQ M;  3UMM A;  3PCA A;  3O32 A;  5JI3 E;  3E9S A;  1YKP A;  1L2B A;  3PCH M;  1NHG C;  2BUU B;  3MV4 M;  1EOC B;  2BV0 B;  1IY2 A;  1G59 A;  4NXM M;  2PCD M;  3DA1 A;  2Y21 A;  3NBI A;  3LMX M;  3AOG A;  2I7P A;  3PCB M;  5KPR A;  2RKO A;  3FUW A;  3KXE C;  4WHP D;  1IBL M;  4LF5 M;  3FKE A;  3L25 A;  1IBM M;  3U6L A;  5EP1 A;  4NSO B;  3U6C A;  1QZM A;  4G4Q A;  4BBA A;  3WHK A;  5EQT A;  4LF7 M;  4LCB A;  2BUQ B;  3ILK A;  3SBJ A;  2C9O A;  4LZZ A;  2BJW A;  1E94 E;  2R4J A;  1DLT A;  3SAW A;  4GIP A;  2KA6 B;  3HKP A;  4WHO B;  2XSZ D;  3M6A A;  3VDP A;  5EP4 A;  3J80 S;  2KZS A;  3CF0 A;  1Q39 A;  3VKH A;  3U6Q A;  4IBC A;  3PCG M;  4MGK E;  5TD3 A;  2XZU A;  1DLM A;  5IWA M;  4DR1 M;  2K47 A;  4MGY E;  5EXT A;  3U5Z A;  5ITX A;  2YFQ A;  2X4A A;  3U6M A;  3PCE M;  3M7G A;  4IBD A;  3U6S A;  3PCD A;  1NHW C;  5BPV A;  4HL4 A;  3KOY E;  1N33 M;  2BUX A;  3RGP A;  3CF2 A;  1HQY E;  4DR2 M;  2CFO A;  3PCC A;  4ILV A;  4OX9 M;  3PNV A;  2D7E A;  3KP0 E;  3HHW A;  3UJN A;  1PJI A;  3GQ4 A;  1EOC A;  4OW0 A;  4AZF A;  1L2D A;  1I94 M;  4DR6 M;  2BUT A;  4FD2 A;  3GLG A;  3LKT M;  3TQS A;  4LRS A;  1GLN A;  1D2N A;  2X49 A;  3PNY A;  2BUV B;  3PCH A;  1ORY B;  3MV4 A;  2CE7 A;  3VDU A;  4L8R C;  4WHQ B;  2ZAO A;  1S9A A;  3SFZ A;  2UUB M;  4NOO B;  1XWI A;  4MGI E;  2BUU A;  1N75 A;  2DHR A;  4M0W A;  2PCD A;  2FOI C;  4YY3 M;  2YR0 A;  3DZD A;  1YKO A;  1YKP B;  3L2A A;  2CUZ A;  2DWL A;  1FJG M;  4RF1 A;  1TDH A;  3FYD A;  3GPP A;  2X8A A;  3TE6 A;  3EIH A;  3N9T A;  1NJF A;  5EXS A;  3T1Y M;  2DXI A;  2ERC A;  4WHS B;  3PCK A;  3HHZ A;  2CHG A;  4FWG A;  5H37 D;  4D80 A;  1DGG A;  3I4Y A;  1G3I A;  3T15 A;  1YKK A;  2UXB M;  4DV6 M;  4JI0 M;  2BUZ B;  4QHS A;  4D81 A;  4LF6 M;  5EXX A;  1NY5 A;  4DV3 M;  3GPX A;  4FCV A;  2KEB A;  1I4W A;  1DMH A;  4I8O A;  5DNY A;  1MU5 A;  3W0F A;  2XSZ A;  3FYC A;  4I81 A;  4CHT B;  4XBO A;  2DZN B;  4AG6 A;  1XC8 A;  2BUW A;  2BUW B;  4LRT A;  2XSU A;  4JN6 A;  3FUU A;  1IN6 A;  2LH0 A;  4GC5 A;  1YKN A;  2HCB A;  3PCJ A;  1G8P A;  4NRV A;  2EO2 A;  3GQ3 A;  1DGH A;  4MH0 E;  3AOE C;  1J7K A;  1VDD A;  5E6J A;  2KW0 A;  2G5G X;  2QZ4 A;  3K2L A;  3UGJ A;  2UUA M;  2KRK A;  4GKJ M;  4QOZ C;  5F3W A;  3SHF A;  3SHG B;  3J81 S;  3PVS A;  3PCC M;  2DWM A;  3LVW A;  5EP3 A;  3RGS A;  4NRW A;  4LZJ A;  5EP2 A;  4A3V B;  1Z5B A;  2R65 A;  3HU2 A;  4B7H A;  3ZCB B;  3U6P A;  4W5W A;  3ZC7 B;  5EXP A;  3R8F A;  4I5S A;  1L1Z A;  3AJI B;  5ITQ A;  4IJE A;  1LV7 A;  3MK6 A;  3MV6 A;  4X62 M;  4K0K M;  2BUM A;  1QAM A;  3FUX A;  3JR5 A;  3MFL M;  2XZF A;  4LFC M;  2BUQ A;  1IY0 A;  2C9C A;  1KFV A;  1G4A E;  4OU7 A;  4MGH A;  4GH9 A;  4QNM A;  1NY6 A;  3PCD M;  4B3R M;  1HR0 M;  4B08 A;  2BUV A;  4ILT A;  3SMS A;  3B9P A;  3SYK A;  4YHH M;  2ZM6 M;  2CV1 A;  2QBY A;  2CHQ A;  2E5L M;  2V1U A;  1Z59 A;  3TPZ A;  4LFB M;  1IN4 A;  3MJ5 A;  2RGH A;  1G41 A;  1NSF A;  3KOZ E;  4IBE A;  4RF0 A;  8CAT A;  4DV0 M;  1TDZ A;  2CV0 A;  4B3T M;  1QAO A;  3LMM A;  3KDS E;  1Z6T A;  2Y0Q A;  1JR3 D;  4AQY M;  4LJ4 A;  4AKI A;  2BUM B;  2LXE A;  2M5Z A;  3SAS A;  1IM2 A;  5IZ7 D;  1ZAE A;  3O5U A;  4GHL A;  3LKT A;  4JI6 M;  5ITY A;  2Q2E B;  4JI3 M;  3U61 A;  1HT1 E;  1OFI A;  1HNZ M;  2F5O A;  1S3S A;  4NL4 H;  4G4R A;  4ZPX A;  3M0E A;  3O6J A;  5FSW A;  1JR3 A;  3GLF A;  4OVZ B;  4QOS A;  3FUV A;  3L28 A;  4LJ7 A;  3RFW A;  2CEA A;  2KZU A;  2M60 A;  4PDI A;  4EIW A;  4B3S M;  1UM8 A;  3VK7 A;  1K3X A;  1EOA A;  2C98 A;  1QVR A;  3TWM A;  3GPU A;  3GLF B;  5FTM A;  4DUZ M;  2F5S A;  5ITR A;  5C1B A;  2UXD M;  1IQP A;  3H4M A;  3R9X B;  3MV6 M;  1T3T A;  1SXJ C;  2YQZ A;  1OFH A;  3TH1 A;  1HNW M;  4IIW A;  2BJV A;  1HQC A;  4PD2 A;  3HU3 A;  1Z5C A;  4IBF A;  3J7A S;  4AKG A;  3PCI A;  3PCL M;  2F5P A;  4WHS D;  4LJ8 A;  2CHV A;  2LNH C;  4L78 A;  5DYI A;  4WHR A;  1YSY A;  4B7G A;  4WHQ A;  2Z7J A;  4Z8X A;  3K8Z A;  4DV1 M;  3T38 A;  1XHB A;  4WHP A;  1IY1 A;  3T63 A;  2XFS A;  3KP1 E;  2KXE A;  1HNX M;  3SC3 A;  3VKG A;  2C5R A;  1DGB A;  2Y20 A;  4WHR B;  1IXR C;  1PM5 A;  2QPA A;  1PJJ A;  2XGN A;  2C99 A;  3PCM A;  1YUB A;  2QP9 X;  5LMU M;  4X66 M;  4KLN A;  3GRY A;  3HU1 A;  4JI7 M;  2KRU A;  1ZQ9 A;  4IBK A;  1X37 A;  1J09 A;  4KOD A;  1XMQ M;  2F5N A;  2BUX B;  2QBY B;  2LWX A;  1NNU C;  1IXZ A;  4QHT A;  3AFH A;  1EO9 B;  3PCA M;  2UU9 M;  4LFA M;  1R2Z A;  3KOW E;  1GL6 A;  2FFJ A;  3OTO M;  4GMQ A;  4LJ5 A;  5C18 A;  3LMX A;  3T67 M;  4DV5 M;  3AKZ A;  3KVW A;  3HJQ A;  1GKI A;  3PCE A;  4DV7 M;  2G8L A;  3DOA A;  2XLJ A;  1XXH A;  1DLQ A;  2D7H A;  4WHO A;  4NSR A;  1DGH B;  3U6O A;  5E26 A;  2UXC M;  1E32 A;  4PCZ A;  4KO8 A;  2BUY B;  4HLQ A;  1TH3 A;  2QEN A;  2BUR A;  1EO2 A;  2BNK A;  4IJF A;  5LMN M;  3LXV A;  4B3M M;  5BR8 M;  3U6D A;  1IN7 A;  3A46 A;  3TL4 X;  4AI6 A;  2XFT A;  4FWH A;  3HGI A;  3QWL A;  1SXJ B;  3K1J A;  4DV2 M;  4GHA A;  2XF3 A;  4D82 A;  4MM3 B;  3TWL A;  4CIS A;  2FNA A;  4NXN M;  2FE8 A;  2J7O A;  4GKK M;  1YKK B;  1JQJ C;  4QNR A;  4RNA A;  2CV2 A;  2R45 A;  1KYI A;  3PCL A;  3GLH B;  3PCI M;  2XSV A;  1Q3B A;  5ITT A;  2R46 A;  1HT2 E;  1C1K A;  1EO9 A;  2Z3X A;  4XGI A;  1L2C A;  3AL0 C;  2L7H A;  4M9Z A;  3THG A;  4LGM A;  2V6Z M;  1L8Q A;  1K82 A;  4G6Z A;  4DR3 M;  4DR7 M;  1IXS B;  3HHY A;  3RE8 A;  1J5E M;  1OJL A;  3KW6 A;  4LJ9 A;  5FTK A;  1TMX A;  1TGU A;  3SAT A;  1R7R A;  2HKJ A;  4JI4 M;  1QYR A;  3GP1 A;  3SAU A;  3FUT A;  1EOB A;  3PCM M;  4LGY A;  3J27 B;  4FVM A;  2L09 A;  4M9X A;  4WHP B;  4LY6 A;  3I4V A;  1E9R A;  2BUT B;  4P16 A;  4B7F A;  1E9S A;  4PDG A;  2C96 A;  3LQQ A;  4DR5 M;  1IN5 A;  2L6O A;  1N77 A;  4LF4 M;  3FTD A;  4FW9 A;  4AW4 A;  2OQ4 A;  4LG2 A;  4TUW A;  4S12 A;  3PFI A;  5ITU A;  4G4N A;  2Z4R A;  3GO8 A;  1DGF A;  2W82 A;  3VFD A;  3GLG B;  1N36 M;  3D8B A;  3J2P B;  4WHO D;  4LF9 M;  3T63 M;  4GC9 A;  2EUC A;  3GRV A;  2D7G A;  1SXJ D;  3UZU A;  3W0L B;  3U5Z B;  3C58 A;  4AKH A;  1YKL B;  3GLH A;  1N34 M;  3U60 B;  4DUY M;  4OVZ A;  5KQ8 A;  1EO2 B;  5KQD A;  1YKM A;  4JYA M;  4JI2 M;  2Z4S A;  2BUY A;  3JAM S;  1XXH B;  2DWN A;  3MI5 A;  1L1T A;  1KSF X;  1SXJ A;  2DVW B;  3PXG A;  3Q8X A;  4X65 M;  2BUZ A;  1Q3C A;  1K3W A;  3PCF M;  3T67 A;  4L16 A;  4IBB A;  2AZQ A;  3MFL A;  4G4O A;  2BUR B;  3PCJ M;  2H1R A;  4WHS A;  4I4L A;  3U6E A;  2DWZ B;  2ZAM A;  4IBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...