3I4YA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Catechol 1,2-dioxygenase
total genus 68
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i4yA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i4yA02
3PCLA 3LMXA 2BUQA 4ILTA 3HKPA 1YKOB 2BUZB 2BUXB 3T67M 1TMXA 2AZQA 3LMXM 3MV4M 3MI5A 1YKNA 1EOBA 2XSRA 1YKMA 2XSVA 1DLMA 2BUZA 1S9AA 1YKPB 3PCHA 3I51A 4WHSD 3MFLM 4WHQB 4WHOB 1EOBB 3PCGM 4WHRA 3PCAM 3MV6M 1EO9B 4WHRF 2BUVA 3PCEM 3PCGA 3I4VA 2BUVB 5TD3A 4WHSB 3LKTM 3PCMA 2XSUA 2BUWB 4WHPA 3T67A 3PCCA 3I4YA 2BUYA 1EOCA 4WHPD 3PCIM 2PCDA 3MI1M 1YKLB 3PCBA 1YKKA 3MI5M 3LXVA 1YKKB 3O6RA 3MV4A 1DLTA 4ILVA 3PCFA 1YKNB 3LXVM 3PCDA 1YKPA 4WHOA 3N9TA 2BUUA 3PCBM 2BUMA 3PCNA 3PCFM 3HHYA 3HGIA 3HHXA 4WHQA 2BURB 4WHSA 2BOYA 2PCDM 3MI1A 3PCIA 3PCMM 3LKTA 1YKMB 2BUQB 2BUXA 4WHRB 2BV0B 3PCLM 3O32A 3PCCM 3PCKM 1EOCB 3MV6A 1YKLA 3PCAA 2BURA 1DMHA 2BUTB 4WHOD 3T63M 3T63A 3PCEA 3HJSA 1DLQA 2BUTA 2BUWA 3O5UA 3HJQA 3PCKA 3O6JA 2BV0A 3PCJM 1YKOA 3HJ8A 2BUUB 1EO9A 2BUYB 3PCJA 1EO2A 1EOAA 3MFLA 1EOAB 1EO2B 3PCHM 4WHPB 3PCNM 3TH1A 2BUMB 3PCDM
chains in the Genus database with same CATH superfamily
2J7OA 4MB7A 3ZCBB 2MR9A 3GLFA 3L25A 1XNQM 1PJIA 1ORYB 3GP1A 4NL4H 4LRTA 2BWBA 2Z8YM 2KNAA 5BPVA 4G4QA 1XC8A 5EP2A 3TE6A 3VDUA 1NV9A 4AKIA 1ZV1A 5BR8M 2WSCF 3HU2A 1D0LA 3QAUA 5L8RF 4XGIA 4L6V6 1X37A 4DV3M 1YKOB 4MGZE 3VK7A 2E5LM 2BUZB 2BUXB 5DYGA 3T67M 4DR7M 1R5LA 2AZQA 2XGNA 3GLFE 2XF3A 1IY2A 1NVMA 3C58A 3MV4M 3U61A 4LF6M 4DV0M 4NSRA 2RGHA 2XSRA 1TR8A 4NOOB 3ZC7B 5DYIA 4CGYB 2BUZA 4JI5M 4YY3M 2VIIA 1XXHB 2R4EA 2GQFA 2HCBA 1QUTA 3I51A 2KEBA 4BBAA 3MFLM 4WHSD 1WHCA 4M0WA 5KPZA 4WHQB 1IXRC 1G8PA 3TWKA 1TH2A 3UGJA 2LVAA 2QENA 4GEWA 4FWGA 2JZ1A 1PRBA 4DV5M 2XLJA 1Z5AA 3U6EA 4WHRF 3T15A 3GPXA 2BUVA 3GLHE 2I7PA 2L2DA 3PCEM 4L78A 2QZ4A 3I4VA 4LGYA 3SBJA 3WHLA 1NJGA 3HHWA 2L4FA 3A42A 2F5SA 2UUCM 1WR1B 1GJSA 2JY5A 4IBCA 2XSUA 3SYKA 2R46A 1D0KA 1WJ7A 2K47A 3DFZA 1IBLM 1YSYA 1L1ZA 2APLA 3KSJA 3KOWE 1EOCA 4IBJA 2C98A 2YFQA 4R3DA 3L27A 1SXJD 3I04M 3PCIM 5EXSA 1GL6A 3LW5F 4RNAA 4NXNM 4K0KM 1MX0A 5F3WA 5EQTA 3LQQA 2XH9A 4M9ZA 3OTOM 4MGIE 2XFTA 4B08A 1R7RA 1GL7A 2I7NA 3AKZA 3K8ZA 2D7GA 2YQZA 3PCFA 1QZEA 3FYCA 4IBGA 1K3WA 4AKGA 2KA6B 3QWLA 3PNYA 4NRVA 1OFHA 5EP4A 2CEAA 2DAGA 1WGLA 3GRUA 1Z59A 1EFUB 2CHGA 1DV0A 2CRUA 3LVVA 2B3TA 2WZJA 3HGIA 4LZZA 2KW0A 2FOIC 3GQ3A 2RRUA 3Q8GA 4LRSA 1PJQA 4WHSA 3GPYA 2LTUA 3NWLA 3PCIA 1NNUC 2QQ8A 3MHVC 3PCMM 3LKTA 4XBOA 2Y0QA 2BUQB 3RE8A 2QP9X 3FTCA 2DHYA 3K1JA 4S12A 3FKEA 3W67A 2D7EA 3O32A 1NJFA 2VDBB 4QHTA 1EOCB 1IN8A 3FE3A 2C9CA 4HEOA 3B9PA 5DFLA 2F5QA 1OAOC 5ITXE 1DMHA 3PCAA 4WHOD 3W68A 3T63M 2DWMA 3K92A 3K2LA 3PCEA 3HJSA 1G71A 4WW0A 3TPZA 2BUTA 1ZQ9A 2JA2A 3PVSA 2BUWA 3L2AA 1L1TA 2HWJA 3PCKA 3U6OA 1IBMM 3PCJM 3AOEA 2KNZA 2KZUA 1JB0F 5E26A 2D7HA 3ZQJA 1E9SA 3SHGB 4LJ8A 1V92A 3H4JA 4B7FA 1JR3E 3T1HM 3C9PA 3CTWB 4AW4A 5EJCA 1EO2A 4FW9A 1XMQM 3MFLA 1HQCA 3T6PA 2DHRA 2BUMB 4QOSA 4DUYM 4LG2A 2XSZA 1OIPA 5FSWA 3QYEA 4JXJA 4AG6A 1IN4A 4DUZM 1NHWC 1VQ1A 2Y20A 1VDLA 1G59A 3FTFA 1W5TA 4KLNA 1I94M 4ITQA 1HJPA 3EIEA 3HKPA 4WP2A 3JR4A 2OOBA 2UUAM 1JR3A 1IXSB 2L7HA 2BJVA 4DV2M 3GRVA 2KHHA 2K0BX 1J09A 3CF0A 1TH4A 3GLHB 3KOZE 2GNOA 1TMXA 3SYLA 3PCBM 2LHCA 2QHOB 3LMXM 3KDSE 3KW6A 4FCWA 3MI5A 2M5ZA 4JI0M 3VFDA 4FCVA 4IBBA 2XSVA 3GRRA 3TQSA 2OPFA 3FD9A 1Z5CA 2JY8A 2K9DA 2LVNC 3HU1A 1S9AA 3PCHA 1IN6A 1E94E 2LBCA 1N78A 1QDTA 1HNZM 1OAIA 1NV8A 1SXJE 2DAIA 1ZMVA 5FTJA 3M0EA 3WHKA 3U6DA 1AIPC 1WXQA 4IBKA 3GO8A 2BJWA 1QAQA 4OU7A 3PCGM 2R65A 2KXEA 5LMUM 4D80A 3AL0C 2CE7A 1IXSA 3VKGA 2EO2A 4KT0F 3KS4A 4FCTA 1Y8GA 3E9SA 1T6OA 3MV6M 3KOXE 1DGGA 4CHTB 2XEPA 4LZJA 2JUJA 3F92A 1L8QA 3LKTM 4P16A 3PCMA 2BUWB 1SXJA 4IBFA 1T43A 1TTEA 1W5SA 2DNAA 3I4YA 3AOGA 2EJSA 1IN5A 2BUYA 3RFWA 2EKKA 3BBZA 2NQ8C 5ITTA 3HZJA 2R0IA 3MK6A 2ZM6M 1L2DA 3KS8A 4QHSA 3PCBA 3DZDA 4R71A 2CV2A 1YKKA 3NBXX 3HWSA 3Q8XA 4QNRA 3U5ZB 2LVQD 4OX9M 3LXVA 3UZUA 3MI5M 1DLTA 2DZLA 4I5SA 4R7GA 1YKNB 4LF9M 3PCDA 3AJIB 1DO0A 2MH8A 2R45A 2ZTDA 3D8BA 3M6AA 4LJ9A 1TDHA 2BUMA 3U6QA 4F1IA 4LJ5A 2RGOA 2X49A 3GPUA 4WHQA 1NHGC 1XXHA 2X4AA 2Y21A 3FUVA 4IJFA 2BURB 3I01M 1IXZA 2FH0A 1PM5A 4GKJM 4RF0A 1IFYA 2BOYA 5IT9S 3FUWA 2KRKA 5ITUA 2VQFM 4L8RC 2JZ0A 3LCUA 4OVZA 4CJ6A 1YKMB 2O01F 1VEGA 4LY6A 4Z6YA 1L2BA 3GLGB 3HX3A 2QBYB 4WHRB 4D81A 3SAUA 1QZMA 1S3SA 4Q7JA 4FD2A 2BURA 4X66M 2BUTB 2FFJA 4Y28F 1IBKM 2F4VM 4GHAA 5EXPA 3U5ZA 1PJTA 1HR0M 3O5UA 3THGA 1DO2A 2VQEM 3T1YM 3AOEC 1YKOA 1D0MA 1OIZA 3GQ5A 2UUBM 1FNNA 1VEJA 3PCJA 4X62M 4GRIA 2BWEA 1IY0A 1QDRA 4JYAM 3SC3A 5GKNA 1J7KA 1EO2B 2G5GX 4WHPB 4JI1M 2C9OA 2ERCA 2LVPC 2R6FA 4HLQA 4KO8A 1VEKA 2RKOA 4X64M 4PD2A 1Q3BA 1GLNA 3ILKA 3L28A 4GC9A 5LMNM 1NY6A 4WURA 1UFZA 4LJAA 3CGWA 5EXXA 3U6PA 4LCBA 1IY1A 3LMXA 1SXJB 1J5EM 3J2PB 1N34M 3J27B 5KQDA 3J7BA 2BUQA 3A98B 1I4WA 1UM8A 3FUUA 2VF7A 2G8LA 3IG8A 4A3VB 2F5OA 2FNAA 3L29A 2HL7A 4IBDA 5A2QS 2DXIA 4LF4M 5ITRA 4JN6A 4DR3M 2OQ4A 1ZMUA 2OOAA 5FTMA 3SMPA 4QNMA 1GVNA 2C96A 2KZSA 5EP3A 4LFCM 1KFVA 4GHLA 5EP1A 1YKNA 2UXCM 2V1CA 4JI4M 2C5RA 1OFIA 2AHMA 5IWAM 4MGKE 4JI8M 1IM2A 1DLMA 4F2LA 3QYBA 1TDZA 2LVOC 1YKPB 2ZTCA 1PJJA 2F5NA 1QYRA 1NY5A 1JR3D 1EE8A 2DAEA 1P3QQ 3FUXA 3LCVB 4REZA 4AI6A 1MN3A 4JV5M 3EIHA 3MMPA 4L16A 4WHOB 3ZH9B 2FS1A 1DGHB 3VKHA 3FUTA 4GC5A 4GMQA 3M7GA 2EUCA 2MJ5B 1QAMA 4FVMA 4BLCA 2CV1A 4WHRA 3AFHA 2OO9A 5H37D 3SHFA 2XSZD 4LF5M 5IREB 1QVRA 2R4JA 4B3SM 2UXBM 4WHSB 5TD3A 1HNXM 4LF8M 3K9PA 4MGYE 3GPPA 3HU3A 4WHPA 4IBIA 3T67A 3PCCA 3FRHA 1CUKA 4DV7M 1V33A 4DV4M 4LJ4A 3GLGE 4DV6M 5FTLA 3JR5A 3KP1E 4TUWA 1HT1E 2XZFA 1RU3A 3SATA 4LJ6A 2PCDA 3MI1M 4UN2B 2XFSA 1XMOM 2UXDM 2CP8A 3U6LA 3U6MA 1N36M 4EIWA 1YKLB 1IN7A 2QSFX 2DAMA 5ITXA 3NBIA 1YKKB 3MV4A 1HT2E 3AV0A 3U6SA 3O6RA 3BOSA 3LXVM 1XHBA 3PXGA 1DGHA 2CUZA 4WHOA 1E9RA 3GQ4A 2CHQA 4KHPM 1MJGM 3D8LA 1KSFX 4M9SA 5C1BA 2DI0A 4ZPXA 2CHVA 3KSXA 4I4LA 4II7A 8CATA 3FTEA 1N32M 2DWZB 2P5TA 3HHYA 3J81S 2L7IA 4W5WA 1N77A 4DR2M 2DWLA 3J80S 5C18A 1K3XA 3KFUG 1QAOA 4OVZB 4MGHA 2PCDM 3MI1A 3W0LB 3B7QA 3KOYE 1NNJA 1V34A 4RKUF 1A5TA 1ZAEA 2YR0A 1LTMA 2DVWB 4L4UA 2KDLA 5KQ8A 3GLIA 1XNRM 4B3RM 2BUXA 2BV0B 3PCCM 2Z3XA 4LJ7A 3B89A 4JI2M 1GO5A 2LWXA 4KODA 3V76A 3LMMA 4PDGA 1YKLA 3MV6A 2R44A 2EKFA 3GRYA 4B3TM 4QOZC 1AUAA 1DLQA 1E32A 4G6ZA 3JAMS 3HJQA 3U60A 2Z7JA 2J5YA 4GIPA 5FTKA 4G3OA 1EIJA 5JI3E 2BV0A 3O6JA 4XK8F 1G4AE 1EO9A 3A45A 1TH3A 3TWLA 3SAWA 1K82A 2H1RA 4RF1A 2BUYB 4GH9A 5FLXS 1GKIA 4AG5A 2Z4SA 1C7YA 2K6BA 4MM3B 3FTDA 1GJTA 4PCZA 3TL4X 4D82A 4B7HA 1YUBA 1Z5BA 2WSFF 3VK8A 1EOAB 1QQWA 3CF2A 2MGWA 3C3DA 4LGMA 3SARA 3PCNM 3TH1A 4I81A 2HHHM 4IIWA 1R4GA 4HL4A 2JY6B 2KNVA 5DNYA 3PCDM 3GLIE 3PCLA 1YLAA 3SMSA 1QUSA 2V6ZM 1WGNA 4ANRA 2WSEF 1SXJC 5KO3A 4AQYM 3B7ZA 2JWSA 2CFOA 1L2CA 5ITYA 1OKSA 2G3QA 2CV0A 4ILTA 3HHZA 4CIZA 3B74A 2CWBA 4DR5M 4AKHA 3U60B 2L4EA 1VG5A 3PCFM 2O5RA 3IECA 1QANA 2F5PA 4G4OA 5EXTA 2L09A 3R8FA 2DZNB 4B7GA 4DR4M 5KPRA 2UU9M 2N35A 3PNVA 4PT5A 1KYIA 4X65M 1SG9A 3SAVA 2V1UA 3CF6E 2ZBKB 3E46A 1EOBA 2VF8A 1YKMA 3FYDA 2H5XA 2EA0A 3GLGA 2QBYA 2JY7A 2DWNA 1GABA 3U6CA 3C3EA 4JI3M 2A5YB 3KVWA 1ZMWA 4NXMM 3HY5A 1Q02A 1F4IA 2DZOB 2HKJA 1Z6TA 1EOBB 4DR1M 1G41A 1Q3CA 3PCAM 5E6JA 1EO9B 1TGUA 2HAKA 4AZFA 2J7NA 5ITQA 1R2ZA 1R2YA 1G3IA 1N75A 4LFAM 3T38A 1PGYA 4LF7M 2BUVB 2Z4RA 2DKLA 3GLFB 3PCGA 3PFIA 1NO1A 3A46A 4L15A 3J7AS 1YE9A 2Q2EB 2X8AA 3IHPA 4PDIA 4OW0A 2Y0TA 1JQJC 1LV7A 1HNWM 2R18A 3SFZA 4P17A 3BXWA 2LXEA 4GITA 4WHPD 1DGBA 1DGFA 4LFBM 1XXHE 1BVSA 5JI2E 3VDPA 4M9XA 4NSOB 1N33M 2O25A 4IBEA 3RGSA 5KPTA 1XWIA 2LHGA 2QCUA 3FRIA 2W82A 4DV1M 3MJ5A 1XB2B 2QPAA 4JI7M 3R9XB 4ILVA 3SASA 4FWDA 3UMMA 3W0FA 1Q39A 3LQRA 7CATA 2BNKA 3U61B 4NRWA 1YKPA 2ZAMA 5IZ7D 2BUUA 1H6UA 1PJSA 3PCNA 4NC6A 1MU5A 3KXEC 3HHXA 3LVWA 3B7NA 1FJGM 3DOAA 2ZAOA 1C1KA 4IJEA 1IQPA 2M60A 4M0DA 3RGPA 1NSFA 2MROB 5FTNA 3VLFB 3KP0E 3PCLM 3H4MA 1OQYA 3PCKM 4DBGB 3K9OA 1VDDA 3GLIB 4I8OA 4Z8XA 2JXNA 2JNHA 3GLHA 4B3MM 2DENA 3N9TA 3UK6A 3DA1A 1HQYE 3T63A 4BB9A 3TWMA 4MH0E 3E21A 2LH0A 4YHHM 3L26A 1D2NA 2XZUA 1T3TA 1OJLA 2L6OA 4JI6M 2C99A 3IG5A 3HJ8A 4GKKM 2BUUB 2QNJA 2FE8A 2ZANA 4G4NA 4CISA 2KRUA 1OTRA 2LNHC 4FWHA 1EOAA 2JP7A 4G4RA 3E4RA 3PCHM 1WIVA 3UJNA 1R6BX 1TF0B 2DAKA 2YNMD 2R62A 4DR6M
chains in the Genus database with same CATH topology
2J7OA 4MB7A 3ZCBB 3GLFA 3L25A 1XNQM 1PJIA 1ORYB 3GP1A 4NL4H 4LRTA 5BPVA 4G4QA 1XC8A 5EP2A 3TE6A 3VDUA 4AKIA 5BR8M 3HU2A 3QAUA 4XGIA 1X37A 4DV3M 1YKOB 4MGZE 3VK7A 2E5LM 2BUZB 2BUXB 5DYGA 3T67M 4DR7M 2AZQA 2XGNA 2XF3A 1IY2A 1NVMA 3C58A 3MV4M 3U61A 4LF6M 4DV0M 4NSRA 2RGHA 2XSRA 4NOOB 3ZC7B 5DYIA 4CGYB 2BUZA 4JI5M 4YY3M 2VIIA 1XXHB 2R4EA 2HCBA 3I51A 2KEBA 4BBAA 3MFLM 4WHSD 4M0WA 5KPZA 4WHQB 1IXRC 1G8PA 3TWKA 1TH2A 3UGJA 2QENA 4FWGA 4DV5M 2XLJA 1Z5AA 3U6EA 4WHRF 3T15A 3GPXA 2BUVA 2I7PA 3PCEM 4L78A 2QZ4A 3I4VA 4LGYA 3SBJA 3WHLA 1NJGA 3HHWA 2F5SA 3A42A 2UUCM 4IBCA 2XSUA 3SYKA 2R46A 1IBLM 2K47A 3DFZA 1YSYA 1L1ZA 3KSJA 3KOWE 1EOCA 4IBJA 2C98A 2YFQA 4R3DA 3L27A 1SXJD 3PCIM 5EXSA 1GL6A 4RNAA 4NXNM 4K0KM 1MX0A 5F3WA 5EQTA 3LQQA 2XH9A 4M9ZA 3OTOM 4MGIE 2XFTA 4B08A 1R7RA 1GL7A 2I7NA 3AKZA 3K8ZA 2D7GA 2YQZA 3PCFA 3FYCA 1K3WA 4IBGA 4AKGA 2KA6B 3QWLA 3PNYA 4NRVA 1OFHA 5EP4A 2CEAA 3GRUA 1Z59A 2CHGA 3LVVA 3HGIA 3GQ3A 4LZZA 2KW0A 2FOIC 4LRSA 4WHSA 3GPYA 3NWLA 3PCIA 1NNUC 3MHVC 3PCMM 3LKTA 4XBOA 2Y0QA 2BUQB 3RE8A 2QP9X 3FTCA 3K1JA 4S12A 3FKEA 2D7EA 3O32A 1NJFA 4QHTA 1EOCB 1IN8A 2C9CA 2F5QA 3B9PA 3PCAA 1DMHA 5ITXE 4WHOD 3T63M 2DWMA 3K92A 3K2LA 3PCEA 3HJSA 4WW0A 3TPZA 2BUTA 2BUWA 1ZQ9A 2JA2A 3PVSA 3L2AA 1L1TA 3PCKA 3U6OA 1IBMM 3PCJM 3AOEA 2KZUA 3AL0C 4B7FA 5E26A 2D7HA 1E9SA 3SHGB 4LJ8A 3T1HM 3CTWB 4AW4A 5EJCA 1EO2A 4FW9A 1XMQM 3MFLA 1HQCA 2DHRA 2BUMB 4QOSA 4DUYM 4LG2A 2XSZA 5FSWA 4JXJA 4AG6A 1IN4A 4DUZM 1NHWC 2Y20A 1G59A 3FTFA 1W5TA 4KLNA 1I94M 4ITQA 3EIEA 3HKPA 3JR4A 2UUAM 1JR3A 1IXSB 2L7HA 2BJVA 4DV2M 3GRVA 3CF0A 3GLHB 1J09A 1TH4A 3KOZE 1TMXA 3PCBM 3SYLA 3LMXM 3KDSE 3KW6A 4FCWA 3MI5A 2M5ZA 4JI0M 3VFDA 4FCVA 4IBBA 2XSVA 3GRRA 3TQSA 2OPFA 3FD9A 1Z5CA 3HU1A 1S9AA 3PCHA 1IN6A 1E94E 1N78A 1HNZM 1SXJE 5FTJA 3WHKA 3U6DA 3M0EA 1WXQA 4IBKA 3GO8A 2BJWA 1QAQA 4OU7A 3PCGM 2R65A 2KXEA 5LMUM 4D80A 2CE7A 3VKGA 3MV6M 2EO2A 3KS4A 4FCTA 3E9SA 3KOXE 1DGGA 4CHTB 2XEPA 4LZJA 1L8QA 3LKTM 4P16A 3PCMA 2BUWB 1SXJA 4IBFA 1W5SA 3I4YA 3AOGA 1IN5A 2BUYA 3RFWA 5ITTA 2NQ8C 3MK6A 2ZM6M 1L2DA 3KS8A 4QHSA 3PCBA 3DZDA 2CV2A 1YKKA 3HWSA 3Q8XA 4QNRA 3U5ZB 4OX9M 3LXVA 3MI5M 3UZUA 1DLTA 4I5SA 4R7GA 1YKNB 4LF9M 3PCDA 3AJIB 1DO0A 2R45A 4LJ9A 3M6AA 3D8BA 1TDHA 2BUMA 3U6QA 4LJ5A 2RGOA 2X49A 3GPUA 4WHQA 1NHGC 1XXHA 2X4AA 2Y21A 3FUVA 4IJFA 2BURB 1PM5A 1IXZA 4GKJM 4RF0A 2BOYA 5IT9S 3FUWA 2KRKA 5ITUA 2VQFM 4L8RC 1YKMB 4OVZA 4LY6A 4Z6YA 1L2BA 4WHRB 3GLGB 2QBYB 4D81A 3SAUA 1QZMA 1S3SA 4FD2A 2BURA 4X66M 2BUTB 2FFJA 1IBKM 2F4VM 4GHAA 5EXPA 3U5ZA 1HR0M 3O5UA 3THGA 1DO2A 2VQEM 3T1YM 3AOEC 1YKOA 3GQ5A 2UUBM 1FNNA 3PCJA 4X62M 4GRIA 1IY0A 4JYAM 3SC3A 5GKNA 1J7KA 1EO2B 2G5GX 4WHPB 4JI1M 2C9OA 2ERCA 4HLQA 4KO8A 2RKOA 4X64M 4PD2A 1Q3BA 1GLNA 3ILKA 3L28A 4GC9A 5LMNM 1NY6A 4WURA 5EXXA 4LJAA 3U6PA 4LFBM 4LCBA 1IY1A 3LMXA 1SXJB 1J5EM 3J2PB 1N34M 3J27B 5KQDA 3J7BA 2BUQA 3A98B 1I4WA 1UM8A 3FUUA 2G8LA 3IG8A 4A3VB 2F5OA 2FNAA 3L29A 2HL7A 4IBDA 5A2QS 2DXIA 4LF4M 5ITRA 4JN6A 4DR3M 2OQ4A 5FTMA 3SMPA 4QNMA 1GVNA 2C96A 2KZSA 5EP3A 4LFCM 1KFVA 4GHLA 5EP1A 1YKNA 2UXCM 2V1CA 4JI4M 2C5RA 1OFIA 2AHMA 5IWAM 4MGKE 4JI8M 1IM2A 1DLMA 1TDZA 1YKPB 1PJJA 2F5NA 1QYRA 1NY5A 1JR3D 1EE8A 3FUXA 4REZA 4AI6A 4JV5M 3EIHA 4L16A 4WHOB 3ZH9B 3VKHA 1DGHB 3FUTA 4GC5A 4GMQA 3M7GA 2EUCA 4FVMA 1QAMA 4BLCA 2CV1A 4WHRA 3AFHA 5H37D 3SHFA 2XSZD 4LF5M 5IREB 1QVRA 2R4JA 4B3SM 2UXBM 4WHSB 5TD3A 1HNXM 4LF8M 4MGYE 3GPPA 3HU3A 4WHPA 4IBIA 3T67A 3PCCA 4DV7M 4DV4M 4LJ4A 4DV6M 5FTLA 3JR5A 3KP1E 4TUWA 1HT1E 2XZFA 2PCDA 3SATA 4LJ6A 3MI1M 1YKLB 2XFSA 1XMOM 2UXDM 1N36M 3U6LA 3U6MA 4EIWA 1IN7A 5ITXA 3NBIA 1YKKB 3MV4A 1HT2E 3AV0A 3U6SA 3O6RA 3BOSA 3LXVM 1XHBA 3PXGA 1DGHA 2CUZA 4WHOA 1E9RA 3GQ4A 2CHQA 4KHPM 3N9TA 3D8LA 1KSFX 4M9SA 5C1BA 3FTEA 4ZPXA 2CHVA 3KSXA 4I4LA 4II7A 8CATA 1N32M 3PCFM 2DWZB 2P5TA 3HHYA 3J81S 2L7IA 4W5WA 1N77A 4DR2M 2DWLA 3J80S 5C18A 1K3XA 3KFUG 1QAOA 4OVZB 4MGHA 2PCDM 3MI1A 3W0LB 3KOYE 1NNJA 1ZAEA 2YR0A 4L4UA 5KQ8A 2DVWB 3GLIA 4B3RM 2BUXA 1XNRM 2BV0B 3PCCM 2Z3XA 4LJ7A 4JI2M 2LWXA 4KODA 4PDGA 3LMMA 3MV6A 1YKLA 3GRYA 4QOZC 4B3TM 1DLQA 1E32A 4G6ZA 3JAMS 3HJQA 3U60A 2Z7JA 4GIPA 5FTKA 2BV0A 3O6JA 5JI3E 1G4AE 1EO9A 3A45A 1TH3A 3TWLA 3SAWA 1K82A 2H1RA 4RF1A 2BUYB 4GH9A 5FLXS 1GKIA 4AG5A 2Z4SA 4MM3B 3FTDA 4PCZA 3TL4X 4D82A 4B7HA 1YUBA 1Z5BA 3VK8A 1EOAB 1QQWA 3CF2A 4LGMA 3SARA 3PCNM 3TH1A 4I81A 2HHHM 4IIWA 4HL4A 3PCDM 5DNYA 3PCLA 3SMSA 2V6ZM 1SXJC 5KO3A 4AQYM 1L2CA 2CFOA 5ITYA 2CV0A 4ILTA 3HHZA 4AKHA 4DR5M 3U60B 2O5RA 1QANA 2F5PA 4G4OA 5EXTA 2L09A 3R8FA 2DZNB 4B7GA 4DR4M 5KPRA 2UU9M 3PNVA 4PT5A 1KYIA 4X65M 3SAVA 2V1UA 3CF6E 2ZBKB 1EOBA 1YKMA 3FYDA 2EA0A 3GLGA 2QBYA 2DWNA 3U6CA 4JI3M 2A5YB 3KVWA 4NXMM 2DZOB 2HKJA 1Z6TA 1EOBB 4DR1M 1G41A 1Q3CA 3PCAM 5E6JA 1EO9B 1TGUA 4AZFA 2J7NA 5ITQA 1R2ZA 1R2YA 1G3IA 1N75A 4LFAM 3T38A 4LF7M 2BUVB 3PCGA 2Z4RA 3GLFB 3PFIA 3A46A 4L15A 3J7AS 1YE9A 2Q2EB 2X8AA 4PDIA 4OW0A 2Y0TA 1JQJC 1LV7A 1HNWM 2R18A 3SFZA 2LXEA 4GITA 4WHPD 1DGBA 1DGFA 5JI2E 3VDPA 4M9XA 4NSOB 1N33M 4IBEA 3RGSA 5KPTA 1XWIA 2QCUA 2W82A 4DV1M 3MJ5A 4JI7M 2QPAA 3R9XB 4ILVA 3SASA 4FWDA 3UMMA 3W0FA 1Q39A 3LQRA 7CATA 2BNKA 3U61B 4NRWA 1YKPA 2ZAMA 5IZ7D 2BUUA 1H6UA 3PCNA 1MU5A 3KXEC 3HHXA 3LVWA 1FJGM 3DOAA 2ZAOA 1C1KA 4IJEA 1IQPA 2M60A 4M0DA 3RGPA 1NSFA 5FTNA 3VLFB 3KP0E 3PCLM 3H4MA 3PCKM 3GLIB 1VDDA 4B3MM 4I8OA 4Z8XA 3GLHA 3UK6A 3DA1A 1HQYE 3T63A 4BB9A 3TWMA 4MH0E 2LH0A 4YHHM 3L26A 1D2NA 2XZUA 1T3TA 1OJLA 2L6OA 4JI6M 2C99A 3IG5A 3HJ8A 4GKKM 2BUUB 2FE8A 2ZANA 4G4NA 4CISA 2KRUA 2LNHC 1EOAA 4FWHA 4G4RA 3E4RA 3PCHM 3UJNA 1R6BX 2YNMD 2R62A 4DR6M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PCL A;  3LMX A;  2BUQ A;  4ILT A;  3HKP A;  1YKO B;  2BUZ B;  2BUX B;  3T67 M;  1TMX A;  2AZQ A;  3LMX M;  3MV4 M;  3MI5 A;  1YKN A;  1EOB A;  2XSR A;  1YKM A;  2XSV A;  1DLM A;  2BUZ A;  1S9A A;  1YKP B;  3PCH A;  3I51 A;  4WHS D;  3MFL M;  4WHQ B;  4WHO B;  1EOB B;  3PCG M;  4WHR A;  3PCA M;  3MV6 M;  1EO9 B;  4WHR F;  2BUV A;  3PCE M;  3PCG A;  3I4V A;  2BUV B;  5TD3 A;  4WHS B;  3LKT M;  3PCM A;  2XSU A;  2BUW B;  4WHP A;  3T67 A;  3PCC A;  3I4Y A;  2BUY A;  1EOC A;  4WHP D;  3PCI M;  2PCD A;  3MI1 M;  1YKL B;  3PCB A;  1YKK A;  3MI5 M;  3LXV A;  1YKK B;  3O6R A;  3MV4 A;  1DLT A;  4ILV A;  3PCF A;  1YKN B;  3LXV M;  3PCD A;  1YKP A;  4WHO A;  3N9T A;  2BUU A;  3PCB M;  2BUM A;  3PCN A;  3PCF M;  3HHY A;  3HGI A;  3HHX A;  4WHQ A;  2BUR B;  4WHS A;  2BOY A;  2PCD M;  3MI1 A;  3PCI A;  3PCM M;  3LKT A;  1YKM B;  2BUQ B;  2BUX A;  4WHR B;  2BV0 B;  3PCL M;  3O32 A;  3PCC M;  3PCK M;  1EOC B;  3MV6 A;  1YKL A;  3PCA A;  2BUR A;  1DMH A;  2BUT B;  4WHO D;  3T63 M;  3T63 A;  3PCE A;  3HJS A;  1DLQ A;  2BUT A;  2BUW A;  3O5U A;  3HJQ A;  3PCK A;  3O6J A;  2BV0 A;  3PCJ M;  1YKO A;  3HJ8 A;  2BUU B;  1EO9 A;  2BUY B;  3PCJ A;  1EO2 A;  1EOA A;  3MFL A;  1EOA B;  1EO2 B;  3PCH M;  4WHP B;  3PCN M;  3TH1 A;  2BUM B;  3PCD M; 
#chains in the Genus database with same CATH topology
 2J7O A;  4MB7 A;  3ZCB B;  2MR9 A;  3GLF A;  3L25 A;  1XNQ M;  1PJI A;  1ORY B;  3GP1 A;  4NL4 H;  4LRT A;  2BWB A;  2Z8Y M;  2KNA A;  5BPV A;  4G4Q A;  1XC8 A;  5EP2 A;  3TE6 A;  3VDU A;  1NV9 A;  4AKI A;  1ZV1 A;  5BR8 M;  2WSC F;  3HU2 A;  1D0L A;  3QAU A;  5L8R F;  4XGI A;  4L6V 6;  1X37 A;  4DV3 M;  1YKO B;  4MGZ E;  3VK7 A;  2E5L M;  2BUZ B;  2BUX B;  5DYG A;  3T67 M;  4DR7 M;  1R5L A;  2AZQ A;  2XGN A;  3GLF E;  2XF3 A;  1IY2 A;  1NVM A;  3C58 A;  3MV4 M;  3U61 A;  4LF6 M;  4DV0 M;  4NSR A;  2RGH A;  2XSR A;  1TR8 A;  4NOO B;  3ZC7 B;  5DYI A;  4CGY B;  2BUZ A;  4JI5 M;  4YY3 M;  2VII A;  1XXH B;  2R4E A;  2GQF A;  2HCB A;  1QUT A;  3I51 A;  2KEB A;  4BBA A;  3MFL M;  4WHS D;  1WHC A;  4M0W A;  5KPZ A;  4WHQ B;  1IXR C;  1G8P A;  3TWK A;  1TH2 A;  3UGJ A;  2LVA A;  2QEN A;  4GEW A;  4FWG A;  2JZ1 A;  1PRB A;  4DV5 M;  2XLJ A;  1Z5A A;  3U6E A;  4WHR F;  3T15 A;  3GPX A;  2BUV A;  3GLH E;  2I7P A;  2L2D A;  3PCE M;  4L78 A;  2QZ4 A;  3I4V A;  4LGY A;  3SBJ A;  3WHL A;  1NJG A;  3HHW A;  2L4F A;  3A42 A;  2F5S A;  2UUC M;  1WR1 B;  1GJS A;  2JY5 A;  4IBC A;  2XSU A;  3SYK A;  2R46 A;  1D0K A;  1WJ7 A;  2K47 A;  3DFZ A;  1IBL M;  1YSY A;  1L1Z A;  2APL A;  3KSJ A;  3KOW E;  1EOC A;  4IBJ A;  2C98 A;  2YFQ A;  4R3D A;  3L27 A;  1SXJ D;  3I04 M;  3PCI M;  5EXS A;  1GL6 A;  3LW5 F;  4RNA A;  4NXN M;  4K0K M;  1MX0 A;  5F3W A;  5EQT A;  3LQQ A;  2XH9 A;  4M9Z A;  3OTO M;  4MGI E;  2XFT A;  4B08 A;  1R7R A;  1GL7 A;  2I7N A;  3AKZ A;  3K8Z A;  2D7G A;  2YQZ A;  3PCF A;  1QZE A;  3FYC A;  4IBG A;  1K3W A;  4AKG A;  2KA6 B;  3QWL A;  3PNY A;  4NRV A;  1OFH A;  5EP4 A;  2CEA A;  2DAG A;  1WGL A;  3GRU A;  1Z59 A;  1EFU B;  2CHG A;  1DV0 A;  2CRU A;  3LVV A;  2B3T A;  2WZJ A;  3HGI A;  4LZZ A;  2KW0 A;  2FOI C;  3GQ3 A;  2RRU A;  3Q8G A;  4LRS A;  1PJQ A;  4WHS A;  3GPY A;  2LTU A;  3NWL A;  3PCI A;  1NNU C;  2QQ8 A;  3MHV C;  3PCM M;  3LKT A;  4XBO A;  2Y0Q A;  2BUQ B;  3RE8 A;  2QP9 X;  3FTC A;  2DHY A;  3K1J A;  4S12 A;  3FKE A;  3W67 A;  2D7E A;  3O32 A;  1NJF A;  2VDB B;  4QHT A;  1EOC B;  1IN8 A;  3FE3 A;  2C9C A;  4HEO A;  3B9P A;  5DFL A;  2F5Q A;  1OAO C;  5ITX E;  1DMH A;  3PCA A;  4WHO D;  3W68 A;  3T63 M;  2DWM A;  3K92 A;  3K2L A;  3PCE A;  3HJS A;  1G71 A;  4WW0 A;  3TPZ A;  2BUT A;  1ZQ9 A;  2JA2 A;  3PVS A;  2BUW A;  3L2A A;  1L1T A;  2HWJ A;  3PCK A;  3U6O A;  1IBM M;  3PCJ M;  3AOE A;  2KNZ A;  2KZU A;  1JB0 F;  5E26 A;  2D7H A;  3ZQJ A;  1E9S A;  3SHG B;  4LJ8 A;  1V92 A;  3H4J A;  4B7F A;  1JR3 E;  3T1H M;  3C9P A;  3CTW B;  4AW4 A;  5EJC A;  1EO2 A;  4FW9 A;  1XMQ M;  3MFL A;  1HQC A;  3T6P A;  2DHR A;  2BUM B;  4QOS A;  4DUY M;  4LG2 A;  2XSZ A;  1OIP A;  5FSW A;  3QYE A;  4JXJ A;  4AG6 A;  1IN4 A;  4DUZ M;  1NHW C;  1VQ1 A;  2Y20 A;  1VDL A;  1G59 A;  3FTF A;  1W5T A;  4KLN A;  1I94 M;  4ITQ A;  1HJP A;  3EIE A;  3HKP A;  4WP2 A;  3JR4 A;  2OOB A;  2UUA M;  1JR3 A;  1IXS B;  2L7H A;  2BJV A;  4DV2 M;  3GRV A;  2KHH A;  2K0B X;  1J09 A;  3CF0 A;  1TH4 A;  3GLH B;  3KOZ E;  2GNO A;  1TMX A;  3SYL A;  3PCB M;  2LHC A;  2QHO B;  3LMX M;  3KDS E;  3KW6 A;  4FCW A;  3MI5 A;  2M5Z A;  4JI0 M;  3VFD A;  4FCV A;  4IBB A;  2XSV A;  3GRR A;  3TQS A;  2OPF A;  3FD9 A;  1Z5C A;  2JY8 A;  2K9D A;  2LVN C;  3HU1 A;  1S9A A;  3PCH A;  1IN6 A;  1E94 E;  2LBC A;  1N78 A;  1QDT A;  1HNZ M;  1OAI A;  1NV8 A;  1SXJ E;  2DAI A;  1ZMV A;  5FTJ A;  3M0E A;  3WHK A;  3U6D A;  1AIP C;  1WXQ A;  4IBK A;  3GO8 A;  2BJW A;  1QAQ A;  4OU7 A;  3PCG M;  2R65 A;  2KXE A;  5LMU M;  4D80 A;  3AL0 C;  2CE7 A;  1IXS A;  3VKG A;  2EO2 A;  4KT0 F;  3KS4 A;  4FCT A;  1Y8G A;  3E9S A;  1T6O A;  3MV6 M;  3KOX E;  1DGG A;  4CHT B;  2XEP A;  4LZJ A;  2JUJ A;  3F92 A;  1L8Q A;  3LKT M;  4P16 A;  3PCM A;  2BUW B;  1SXJ A;  4IBF A;  1T43 A;  1TTE A;  1W5S A;  2DNA A;  3I4Y A;  3AOG A;  2EJS A;  1IN5 A;  2BUY A;  3RFW A;  2EKK A;  3BBZ A;  2NQ8 C;  5ITT A;  3HZJ A;  2R0I A;  3MK6 A;  2ZM6 M;  1L2D A;  3KS8 A;  4QHS A;  3PCB A;  3DZD A;  4R71 A;  2CV2 A;  1YKK A;  3NBX X;  3HWS A;  3Q8X A;  4QNR A;  3U5Z B;  2LVQ D;  4OX9 M;  3LXV A;  3UZU A;  3MI5 M;  1DLT A;  2DZL A;  4I5S A;  4R7G A;  1YKN B;  4LF9 M;  3PCD A;  3AJI B;  1DO0 A;  2MH8 A;  2R45 A;  2ZTD A;  3D8B A;  3M6A A;  4LJ9 A;  1TDH A;  2BUM A;  3U6Q A;  4F1I A;  4LJ5 A;  2RGO A;  2X49 A;  3GPU A;  4WHQ A;  1NHG C;  1XXH A;  2X4A A;  2Y21 A;  3FUV A;  4IJF A;  2BUR B;  3I01 M;  1IXZ A;  2FH0 A;  1PM5 A;  4GKJ M;  4RF0 A;  1IFY A;  2BOY A;  5IT9 S;  3FUW A;  2KRK A;  5ITU A;  2VQF M;  4L8R C;  2JZ0 A;  3LCU A;  4OVZ A;  4CJ6 A;  1YKM B;  2O01 F;  1VEG A;  4LY6 A;  4Z6Y A;  1L2B A;  3GLG B;  3HX3 A;  2QBY B;  4WHR B;  4D81 A;  3SAU A;  1QZM A;  1S3S A;  4Q7J A;  4FD2 A;  2BUR A;  4X66 M;  2BUT B;  2FFJ A;  4Y28 F;  1IBK M;  2F4V M;  4GHA A;  5EXP A;  3U5Z A;  1PJT A;  1HR0 M;  3O5U A;  3THG A;  1DO2 A;  2VQE M;  3T1Y M;  3AOE C;  1YKO A;  1D0M A;  1OIZ A;  3GQ5 A;  2UUB M;  1FNN A;  1VEJ A;  3PCJ A;  4X62 M;  4GRI A;  2BWE A;  1IY0 A;  1QDR A;  4JYA M;  3SC3 A;  5GKN A;  1J7K A;  1EO2 B;  2G5G X;  4WHP B;  4JI1 M;  2C9O A;  2ERC A;  2LVP C;  2R6F A;  4HLQ A;  4KO8 A;  1VEK A;  2RKO A;  4X64 M;  4PD2 A;  1Q3B A;  1GLN A;  3ILK A;  3L28 A;  4GC9 A;  5LMN M;  1NY6 A;  4WUR A;  1UFZ A;  4LJA A;  3CGW A;  5EXX A;  3U6P A;  4LCB A;  1IY1 A;  3LMX A;  1SXJ B;  1J5E M;  3J2P B;  1N34 M;  3J27 B;  5KQD A;  3J7B A;  2BUQ A;  3A98 B;  1I4W A;  1UM8 A;  3FUU A;  2VF7 A;  2G8L A;  3IG8 A;  4A3V B;  2F5O A;  2FNA A;  3L29 A;  2HL7 A;  4IBD A;  5A2Q S;  2DXI A;  4LF4 M;  5ITR A;  4JN6 A;  4DR3 M;  2OQ4 A;  1ZMU A;  2OOA A;  5FTM A;  3SMP A;  4QNM A;  1GVN A;  2C96 A;  2KZS A;  5EP3 A;  4LFC M;  1KFV A;  4GHL A;  5EP1 A;  1YKN A;  2UXC M;  2V1C A;  4JI4 M;  2C5R A;  1OFI A;  2AHM A;  5IWA M;  4MGK E;  4JI8 M;  1IM2 A;  1DLM A;  4F2L A;  3QYB A;  1TDZ A;  2LVO C;  1YKP B;  2ZTC A;  1PJJ A;  2F5N A;  1QYR A;  1NY5 A;  1JR3 D;  1EE8 A;  2DAE A;  1P3Q Q;  3FUX A;  3LCV B;  4REZ A;  4AI6 A;  1MN3 A;  4JV5 M;  3EIH A;  3MMP A;  4L16 A;  4WHO B;  3ZH9 B;  2FS1 A;  1DGH B;  3VKH A;  3FUT A;  4GC5 A;  4GMQ A;  3M7G A;  2EUC A;  2MJ5 B;  1QAM A;  4FVM A;  4BLC A;  2CV1 A;  4WHR A;  3AFH A;  2OO9 A;  5H37 D;  3SHF A;  2XSZ D;  4LF5 M;  5IRE B;  1QVR A;  2R4J A;  4B3S M;  2UXB M;  4WHS B;  5TD3 A;  1HNX M;  4LF8 M;  3K9P A;  4MGY E;  3GPP A;  3HU3 A;  4WHP A;  4IBI A;  3T67 A;  3PCC A;  3FRH A;  1CUK A;  4DV7 M;  1V33 A;  4DV4 M;  4LJ4 A;  3GLG E;  4DV6 M;  5FTL A;  3JR5 A;  3KP1 E;  4TUW A;  1HT1 E;  2XZF A;  1RU3 A;  3SAT A;  4LJ6 A;  2PCD A;  3MI1 M;  4UN2 B;  2XFS A;  1XMO M;  2UXD M;  2CP8 A;  3U6L A;  3U6M A;  1N36 M;  4EIW A;  1YKL B;  1IN7 A;  2QSF X;  2DAM A;  5ITX A;  3NBI A;  1YKK B;  3MV4 A;  1HT2 E;  3AV0 A;  3U6S A;  3O6R A;  3BOS A;  3LXV M;  1XHB A;  3PXG A;  1DGH A;  2CUZ A;  4WHO A;  1E9R A;  3GQ4 A;  2CHQ A;  4KHP M;  1MJG M;  3D8L A;  1KSF X;  4M9S A;  5C1B A;  2DI0 A;  4ZPX A;  2CHV A;  3KSX A;  4I4L A;  4II7 A;  8CAT A;  3FTE A;  1N32 M;  2DWZ B;  2P5T A;  3HHY A;  3J81 S;  2L7I A;  4W5W A;  1N77 A;  4DR2 M;  2DWL A;  3J80 S;  5C18 A;  1K3X A;  3KFU G;  1QAO A;  4OVZ B;  4MGH A;  2PCD M;  3MI1 A;  3W0L B;  3B7Q A;  3KOY E;  1NNJ A;  1V34 A;  4RKU F;  1A5T A;  1ZAE A;  2YR0 A;  1LTM A;  2DVW B;  4L4U A;  2KDL A;  5KQ8 A;  3GLI A;  1XNR M;  4B3R M;  2BUX A;  2BV0 B;  3PCC M;  2Z3X A;  4LJ7 A;  3B89 A;  4JI2 M;  1GO5 A;  2LWX A;  4KOD A;  3V76 A;  3LMM A;  4PDG A;  1YKL A;  3MV6 A;  2R44 A;  2EKF A;  3GRY A;  4B3T M;  4QOZ C;  1AUA A;  1DLQ A;  1E32 A;  4G6Z A;  3JAM S;  3HJQ A;  3U60 A;  2Z7J A;  2J5Y A;  4GIP A;  5FTK A;  4G3O A;  1EIJ A;  5JI3 E;  2BV0 A;  3O6J A;  4XK8 F;  1G4A E;  1EO9 A;  3A45 A;  1TH3 A;  3TWL A;  3SAW A;  1K82 A;  2H1R A;  4RF1 A;  2BUY B;  4GH9 A;  5FLX S;  1GKI A;  4AG5 A;  2Z4S A;  1C7Y A;  2K6B A;  4MM3 B;  3FTD A;  1GJT A;  4PCZ A;  3TL4 X;  4D82 A;  4B7H A;  1YUB A;  1Z5B A;  2WSF F;  3VK8 A;  1EOA B;  1QQW A;  3CF2 A;  2MGW A;  3C3D A;  4LGM A;  3SAR A;  3PCN M;  3TH1 A;  4I81 A;  2HHH M;  4IIW A;  1R4G A;  4HL4 A;  2JY6 B;  2KNV A;  5DNY A;  3PCD M;  3GLI E;  3PCL A;  1YLA A;  3SMS A;  1QUS A;  2V6Z M;  1WGN A;  4ANR A;  2WSE F;  1SXJ C;  5KO3 A;  4AQY M;  3B7Z A;  2JWS A;  2CFO A;  1L2C A;  5ITY A;  1OKS A;  2G3Q A;  2CV0 A;  4ILT A;  3HHZ A;  4CIZ A;  3B74 A;  2CWB A;  4DR5 M;  4AKH A;  3U60 B;  2L4E A;  1VG5 A;  3PCF M;  2O5R A;  3IEC A;  1QAN A;  2F5P A;  4G4O A;  5EXT A;  2L09 A;  3R8F A;  2DZN B;  4B7G A;  4DR4 M;  5KPR A;  2UU9 M;  2N35 A;  3PNV A;  4PT5 A;  1KYI A;  4X65 M;  1SG9 A;  3SAV A;  2V1U A;  3CF6 E;  2ZBK B;  3E46 A;  1EOB A;  2VF8 A;  1YKM A;  3FYD A;  2H5X A;  2EA0 A;  3GLG A;  2QBY A;  2JY7 A;  2DWN A;  1GAB A;  3U6C A;  3C3E A;  4JI3 M;  2A5Y B;  3KVW A;  1ZMW A;  4NXM M;  3HY5 A;  1Q02 A;  1F4I A;  2DZO B;  2HKJ A;  1Z6T A;  1EOB B;  4DR1 M;  1G41 A;  1Q3C A;  3PCA M;  5E6J A;  1EO9 B;  1TGU A;  2HAK A;  4AZF A;  2J7N A;  5ITQ A;  1R2Z A;  1R2Y A;  1G3I A;  1N75 A;  4LFA M;  3T38 A;  1PGY A;  4LF7 M;  2BUV B;  2Z4R A;  2DKL A;  3GLF B;  3PCG A;  3PFI A;  1NO1 A;  3A46 A;  4L15 A;  3J7A S;  1YE9 A;  2Q2E B;  2X8A A;  3IHP A;  4PDI A;  4OW0 A;  2Y0T A;  1JQJ C;  1LV7 A;  1HNW M;  2R18 A;  3SFZ A;  4P17 A;  3BXW A;  2LXE A;  4GIT A;  4WHP D;  1DGB A;  1DGF A;  4LFB M;  1XXH E;  1BVS A;  5JI2 E;  3VDP A;  4M9X A;  4NSO B;  1N33 M;  2O25 A;  4IBE A;  3RGS A;  5KPT A;  1XWI A;  2LHG A;  2QCU A;  3FRI A;  2W82 A;  4DV1 M;  3MJ5 A;  1XB2 B;  2QPA A;  4JI7 M;  3R9X B;  4ILV A;  3SAS A;  4FWD A;  3UMM A;  3W0F A;  1Q39 A;  3LQR A;  7CAT A;  2BNK A;  3U61 B;  4NRW A;  1YKP A;  2ZAM A;  5IZ7 D;  2BUU A;  1H6U A;  1PJS A;  3PCN A;  4NC6 A;  1MU5 A;  3KXE C;  3HHX A;  3LVW A;  3B7N A;  1FJG M;  3DOA A;  2ZAO A;  1C1K A;  4IJE A;  1IQP A;  2M60 A;  4M0D A;  3RGP A;  1NSF A;  2MRO B;  5FTN A;  3VLF B;  3KP0 E;  3PCL M;  3H4M A;  1OQY A;  3PCK M;  4DBG B;  3K9O A;  1VDD A;  3GLI B;  4I8O A;  4Z8X A;  2JXN A;  2JNH A;  3GLH A;  4B3M M;  2DEN A;  3N9T A;  3UK6 A;  3DA1 A;  1HQY E;  3T63 A;  4BB9 A;  3TWM A;  4MH0 E;  3E21 A;  2LH0 A;  4YHH M;  3L26 A;  1D2N A;  2XZU A;  1T3T A;  1OJL A;  2L6O A;  4JI6 M;  2C99 A;  3IG5 A;  3HJ8 A;  4GKK M;  2BUU B;  2QNJ A;  2FE8 A;  2ZAN A;  4G4N A;  4CIS A;  2KRU A;  1OTR A;  2LNH C;  4FWH A;  1EOA A;  2JP7 A;  4G4R A;  3E4R A;  3PCH M;  1WIV A;  3UJN A;  1R6B X;  1TF0 B;  2DAK A;  2YNM D;  2R62 A;  4DR6 M; 
#chains in the Genus database with same CATH homology
 2J7O A;  4MB7 A;  3ZCB B;  3GLF A;  3L25 A;  1XNQ M;  1PJI A;  1ORY B;  3GP1 A;  4NL4 H;  4LRT A;  5BPV A;  4G4Q A;  1XC8 A;  5EP2 A;  3TE6 A;  3VDU A;  4AKI A;  5BR8 M;  3HU2 A;  3QAU A;  4XGI A;  1X37 A;  4DV3 M;  1YKO B;  4MGZ E;  3VK7 A;  2E5L M;  2BUZ B;  2BUX B;  5DYG A;  3T67 M;  4DR7 M;  2AZQ A;  2XGN A;  2XF3 A;  1IY2 A;  1NVM A;  3C58 A;  3MV4 M;  3U61 A;  4LF6 M;  4DV0 M;  4NSR A;  2RGH A;  2XSR A;  4NOO B;  3ZC7 B;  5DYI A;  4CGY B;  2BUZ A;  4JI5 M;  4YY3 M;  2VII A;  1XXH B;  2R4E A;  2HCB A;  3I51 A;  2KEB A;  4BBA A;  3MFL M;  4WHS D;  4M0W A;  5KPZ A;  4WHQ B;  1IXR C;  1G8P A;  3TWK A;  1TH2 A;  3UGJ A;  2QEN A;  4FWG A;  4DV5 M;  2XLJ A;  1Z5A A;  3U6E A;  4WHR F;  3T15 A;  3GPX A;  2BUV A;  2I7P A;  3PCE M;  4L78 A;  2QZ4 A;  3I4V A;  4LGY A;  3SBJ A;  3WHL A;  1NJG A;  3HHW A;  2F5S A;  3A42 A;  2UUC M;  4IBC A;  2XSU A;  3SYK A;  2R46 A;  1IBL M;  2K47 A;  3DFZ A;  1YSY A;  1L1Z A;  3KSJ A;  3KOW E;  1EOC A;  4IBJ A;  2C98 A;  2YFQ A;  4R3D A;  3L27 A;  1SXJ D;  3PCI M;  5EXS A;  1GL6 A;  4RNA A;  4NXN M;  4K0K M;  1MX0 A;  5F3W A;  5EQT A;  3LQQ A;  2XH9 A;  4M9Z A;  3OTO M;  4MGI E;  2XFT A;  4B08 A;  1R7R A;  1GL7 A;  2I7N A;  3AKZ A;  3K8Z A;  2D7G A;  2YQZ A;  3PCF A;  3FYC A;  1K3W A;  4IBG A;  4AKG A;  2KA6 B;  3QWL A;  3PNY A;  4NRV A;  1OFH A;  5EP4 A;  2CEA A;  3GRU A;  1Z59 A;  2CHG A;  3LVV A;  3HGI A;  3GQ3 A;  4LZZ A;  2KW0 A;  2FOI C;  4LRS A;  4WHS A;  3GPY A;  3NWL A;  3PCI A;  1NNU C;  3MHV C;  3PCM M;  3LKT A;  4XBO A;  2Y0Q A;  2BUQ B;  3RE8 A;  2QP9 X;  3FTC A;  3K1J A;  4S12 A;  3FKE A;  2D7E A;  3O32 A;  1NJF A;  4QHT A;  1EOC B;  1IN8 A;  2C9C A;  2F5Q A;  3B9P A;  3PCA A;  1DMH A;  5ITX E;  4WHO D;  3T63 M;  2DWM A;  3K92 A;  3K2L A;  3PCE A;  3HJS A;  4WW0 A;  3TPZ A;  2BUT A;  2BUW A;  1ZQ9 A;  2JA2 A;  3PVS A;  3L2A A;  1L1T A;  3PCK A;  3U6O A;  1IBM M;  3PCJ M;  3AOE A;  2KZU A;  3AL0 C;  4B7F A;  5E26 A;  2D7H A;  1E9S A;  3SHG B;  4LJ8 A;  3T1H M;  3CTW B;  4AW4 A;  5EJC A;  1EO2 A;  4FW9 A;  1XMQ M;  3MFL A;  1HQC A;  2DHR A;  2BUM B;  4QOS A;  4DUY M;  4LG2 A;  2XSZ A;  5FSW A;  4JXJ A;  4AG6 A;  1IN4 A;  4DUZ M;  1NHW C;  2Y20 A;  1G59 A;  3FTF A;  1W5T A;  4KLN A;  1I94 M;  4ITQ A;  3EIE A;  3HKP A;  3JR4 A;  2UUA M;  1JR3 A;  1IXS B;  2L7H A;  2BJV A;  4DV2 M;  3GRV A;  3CF0 A;  3GLH B;  1J09 A;  1TH4 A;  3KOZ E;  1TMX A;  3PCB M;  3SYL A;  3LMX M;  3KDS E;  3KW6 A;  4FCW A;  3MI5 A;  2M5Z A;  4JI0 M;  3VFD A;  4FCV A;  4IBB A;  2XSV A;  3GRR A;  3TQS A;  2OPF A;  3FD9 A;  1Z5C A;  3HU1 A;  1S9A A;  3PCH A;  1IN6 A;  1E94 E;  1N78 A;  1HNZ M;  1SXJ E;  5FTJ A;  3WHK A;  3U6D A;  3M0E A;  1WXQ A;  4IBK A;  3GO8 A;  2BJW A;  1QAQ A;  4OU7 A;  3PCG M;  2R65 A;  2KXE A;  5LMU M;  4D80 A;  2CE7 A;  3VKG A;  3MV6 M;  2EO2 A;  3KS4 A;  4FCT A;  3E9S A;  3KOX E;  1DGG A;  4CHT B;  2XEP A;  4LZJ A;  1L8Q A;  3LKT M;  4P16 A;  3PCM A;  2BUW B;  1SXJ A;  4IBF A;  1W5S A;  3I4Y A;  3AOG A;  1IN5 A;  2BUY A;  3RFW A;  5ITT A;  2NQ8 C;  3MK6 A;  2ZM6 M;  1L2D A;  3KS8 A;  4QHS A;  3PCB A;  3DZD A;  2CV2 A;  1YKK A;  3HWS A;  3Q8X A;  4QNR A;  3U5Z B;  4OX9 M;  3LXV A;  3MI5 M;  3UZU A;  1DLT A;  4I5S A;  4R7G A;  1YKN B;  4LF9 M;  3PCD A;  3AJI B;  1DO0 A;  2R45 A;  4LJ9 A;  3M6A A;  3D8B A;  1TDH A;  2BUM A;  3U6Q A;  4LJ5 A;  2RGO A;  2X49 A;  3GPU A;  4WHQ A;  1NHG C;  1XXH A;  2X4A A;  2Y21 A;  3FUV A;  4IJF A;  2BUR B;  1PM5 A;  1IXZ A;  4GKJ M;  4RF0 A;  2BOY A;  5IT9 S;  3FUW A;  2KRK A;  5ITU A;  2VQF M;  4L8R C;  1YKM B;  4OVZ A;  4LY6 A;  4Z6Y A;  1L2B A;  4WHR B;  3GLG B;  2QBY B;  4D81 A;  3SAU A;  1QZM A;  1S3S A;  4FD2 A;  2BUR A;  4X66 M;  2BUT B;  2FFJ A;  1IBK M;  2F4V M;  4GHA A;  5EXP A;  3U5Z A;  1HR0 M;  3O5U A;  3THG A;  1DO2 A;  2VQE M;  3T1Y M;  3AOE C;  1YKO A;  3GQ5 A;  2UUB M;  1FNN A;  3PCJ A;  4X62 M;  4GRI A;  1IY0 A;  4JYA M;  3SC3 A;  5GKN A;  1J7K A;  1EO2 B;  2G5G X;  4WHP B;  4JI1 M;  2C9O A;  2ERC A;  4HLQ A;  4KO8 A;  2RKO A;  4X64 M;  4PD2 A;  1Q3B A;  1GLN A;  3ILK A;  3L28 A;  4GC9 A;  5LMN M;  1NY6 A;  4WUR A;  5EXX A;  4LJA A;  3U6P A;  4LFB M;  4LCB A;  1IY1 A;  3LMX A;  1SXJ B;  1J5E M;  3J2P B;  1N34 M;  3J27 B;  5KQD A;  3J7B A;  2BUQ A;  3A98 B;  1I4W A;  1UM8 A;  3FUU A;  2G8L A;  3IG8 A;  4A3V B;  2F5O A;  2FNA A;  3L29 A;  2HL7 A;  4IBD A;  5A2Q S;  2DXI A;  4LF4 M;  5ITR A;  4JN6 A;  4DR3 M;  2OQ4 A;  5FTM A;  3SMP A;  4QNM A;  1GVN A;  2C96 A;  2KZS A;  5EP3 A;  4LFC M;  1KFV A;  4GHL A;  5EP1 A;  1YKN A;  2UXC M;  2V1C A;  4JI4 M;  2C5R A;  1OFI A;  2AHM A;  5IWA M;  4MGK E;  4JI8 M;  1IM2 A;  1DLM A;  1TDZ A;  1YKP B;  1PJJ A;  2F5N A;  1QYR A;  1NY5 A;  1JR3 D;  1EE8 A;  3FUX A;  4REZ A;  4AI6 A;  4JV5 M;  3EIH A;  4L16 A;  4WHO B;  3ZH9 B;  3VKH A;  1DGH B;  3FUT A;  4GC5 A;  4GMQ A;  3M7G A;  2EUC A;  4FVM A;  1QAM A;  4BLC A;  2CV1 A;  4WHR A;  3AFH A;  5H37 D;  3SHF A;  2XSZ D;  4LF5 M;  5IRE B;  1QVR A;  2R4J A;  4B3S M;  2UXB M;  4WHS B;  5TD3 A;  1HNX M;  4LF8 M;  4MGY E;  3GPP A;  3HU3 A;  4WHP A;  4IBI A;  3T67 A;  3PCC A;  4DV7 M;  4DV4 M;  4LJ4 A;  4DV6 M;  5FTL A;  3JR5 A;  3KP1 E;  4TUW A;  1HT1 E;  2XZF A;  2PCD A;  3SAT A;  4LJ6 A;  3MI1 M;  1YKL B;  2XFS A;  1XMO M;  2UXD M;  1N36 M;  3U6L A;  3U6M A;  4EIW A;  1IN7 A;  5ITX A;  3NBI A;  1YKK B;  3MV4 A;  1HT2 E;  3AV0 A;  3U6S A;  3O6R A;  3BOS A;  3LXV M;  1XHB A;  3PXG A;  1DGH A;  2CUZ A;  4WHO A;  1E9R A;  3GQ4 A;  2CHQ A;  4KHP M;  3N9T A;  3D8L A;  1KSF X;  4M9S A;  5C1B A;  3FTE A;  4ZPX A;  2CHV A;  3KSX A;  4I4L A;  4II7 A;  8CAT A;  1N32 M;  3PCF M;  2DWZ B;  2P5T A;  3HHY A;  3J81 S;  2L7I A;  4W5W A;  1N77 A;  4DR2 M;  2DWL A;  3J80 S;  5C18 A;  1K3X A;  3KFU G;  1QAO A;  4OVZ B;  4MGH A;  2PCD M;  3MI1 A;  3W0L B;  3KOY E;  1NNJ A;  1ZAE A;  2YR0 A;  4L4U A;  5KQ8 A;  2DVW B;  3GLI A;  4B3R M;  2BUX A;  1XNR M;  2BV0 B;  3PCC M;  2Z3X A;  4LJ7 A;  4JI2 M;  2LWX A;  4KOD A;  4PDG A;  3LMM A;  3MV6 A;  1YKL A;  3GRY A;  4QOZ C;  4B3T M;  1DLQ A;  1E32 A;  4G6Z A;  3JAM S;  3HJQ A;  3U60 A;  2Z7J A;  4GIP A;  5FTK A;  2BV0 A;  3O6J A;  5JI3 E;  1G4A E;  1EO9 A;  3A45 A;  1TH3 A;  3TWL A;  3SAW A;  1K82 A;  2H1R A;  4RF1 A;  2BUY B;  4GH9 A;  5FLX S;  1GKI A;  4AG5 A;  2Z4S A;  4MM3 B;  3FTD A;  4PCZ A;  3TL4 X;  4D82 A;  4B7H A;  1YUB A;  1Z5B A;  3VK8 A;  1EOA B;  1QQW A;  3CF2 A;  4LGM A;  3SAR A;  3PCN M;  3TH1 A;  4I81 A;  2HHH M;  4IIW A;  4HL4 A;  3PCD M;  5DNY A;  3PCL A;  3SMS A;  2V6Z M;  1SXJ C;  5KO3 A;  4AQY M;  1L2C A;  2CFO A;  5ITY A;  2CV0 A;  4ILT A;  3HHZ A;  4AKH A;  4DR5 M;  3U60 B;  2O5R A;  1QAN A;  2F5P A;  4G4O A;  5EXT A;  2L09 A;  3R8F A;  2DZN B;  4B7G A;  4DR4 M;  5KPR A;  2UU9 M;  3PNV A;  4PT5 A;  1KYI A;  4X65 M;  3SAV A;  2V1U A;  3CF6 E;  2ZBK B;  1EOB A;  1YKM A;  3FYD A;  2EA0 A;  3GLG A;  2QBY A;  2DWN A;  3U6C A;  4JI3 M;  2A5Y B;  3KVW A;  4NXM M;  2DZO B;  2HKJ A;  1Z6T A;  1EOB B;  4DR1 M;  1G41 A;  1Q3C A;  3PCA M;  5E6J A;  1EO9 B;  1TGU A;  4AZF A;  2J7N A;  5ITQ A;  1R2Z A;  1R2Y A;  1G3I A;  1N75 A;  4LFA M;  3T38 A;  4LF7 M;  2BUV B;  3PCG A;  2Z4R A;  3GLF B;  3PFI A;  3A46 A;  4L15 A;  3J7A S;  1YE9 A;  2Q2E B;  2X8A A;  4PDI A;  4OW0 A;  2Y0T A;  1JQJ C;  1LV7 A;  1HNW M;  2R18 A;  3SFZ A;  2LXE A;  4GIT A;  4WHP D;  1DGB A;  1DGF A;  5JI2 E;  3VDP A;  4M9X A;  4NSO B;  1N33 M;  4IBE A;  3RGS A;  5KPT A;  1XWI A;  2QCU A;  2W82 A;  4DV1 M;  3MJ5 A;  4JI7 M;  2QPA A;  3R9X B;  4ILV A;  3SAS A;  4FWD A;  3UMM A;  3W0F A;  1Q39 A;  3LQR A;  7CAT A;  2BNK A;  3U61 B;  4NRW A;  1YKP A;  2ZAM A;  5IZ7 D;  2BUU A;  1H6U A;  3PCN A;  1MU5 A;  3KXE C;  3HHX A;  3LVW A;  1FJG M;  3DOA A;  2ZAO A;  1C1K A;  4IJE A;  1IQP A;  2M60 A;  4M0D A;  3RGP A;  1NSF A;  5FTN A;  3VLF B;  3KP0 E;  3PCL M;  3H4M A;  3PCK M;  3GLI B;  1VDD A;  4B3M M;  4I8O A;  4Z8X A;  3GLH A;  3UK6 A;  3DA1 A;  1HQY E;  3T63 A;  4BB9 A;  3TWM A;  4MH0 E;  2LH0 A;  4YHH M;  3L26 A;  1D2N A;  2XZU A;  1T3T A;  1OJL A;  2L6O A;  4JI6 M;  2C99 A;  3IG5 A;  3HJ8 A;  4GKK M;  2BUU B;  2FE8 A;  2ZAN A;  4G4N A;  4CIS A;  2KRU A;  2LNH C;  1EOA A;  4FWH A;  4G4R A;  3E4R A;  3PCH M;  3UJN A;  1R6B X;  2YNM D;  2R62 A;  4DR6 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...