3I4YA

Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
256
structure length
256
Chain Sequence
ATADTSPERLAAIAKDALGALNDVILKHGVTYPEYRVFKQWLIDVGEGGEWPLFLDVFIEHSVEEVLARSRKGTMGSIEGPYYIENSPELPSKCTLPMREEDEKITPLVFSGQVTDLDGNGLAGAKVELWHADNDGYYSQFAPHLPEWNLRGTIIADEEGRYEITTIQPAPYQIPTDGPTGQFIEAQNGHPWRPAHLHLIVSAPGKESVTTQLYFKGGEWIDSDVASATKPELILDPKTGDDGKNYVTYNFVLDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catechol 1,2-dioxygenase
publication title Catechol 1,2-dioxygenase from the Gram-positive Rhodococcus opacus 1CP: Quantitative structure/activity relationship and the crystal structures of native enzyme and catechols adducts.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 68
structure length 256
sequence length 256
ec nomenclature ec 1.13.11.1: Catechol 1,2-dioxygenase.
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00775 Dioxygenase_C Dioxygenase
A PF04444 Dioxygenase_N Catechol dioxygenase N terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.580 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3i4yA01
2.60.130.10 Mainly Beta Sandwich Protocatechuate 3,4-Dioxygenase, subunit A Aromatic compound dioxygenase 3i4yA02
1YKOB 4WHQB 3MV4A 1EO9B 2XSUA 2BUTA 3O6JA 3MV6M 2BUZB 2BUYA 4ILVA 3O5UA 3PCHM 3T63A 2BUMA 1YKKA 4WHOD 1EOBB 1YKPB 2PCDM 2BUXB 2BUUA 1TMXA 3PCCM 1YKNB 3HJ8A 3T63M 1YKLA 1YKMA 3MI5A 3LKTA 4WHRB 3HKPA 4WHPA 3PCKM 1EO2A 3O6RA 3HJQA 3PCNA 3PCMM 3I4VA 3PCFM 2AZQA 3I51A 3HHYA 4WHPD 1DLTA 3T67M 5TD3A 3PCBM 3PCIA 3PCJM 4WHOA 3PCAA 1YKOA 2BURB 3PCEA 4WHQA 4WHSA 1EO9A 3LMXA 3MV4M 2BUZA 1EOCB 3I4YA 4WHSD 1EOBA 1YKPA 2BV0B 2BUWB 3HHXA 2BUVB 2BUXA 4WHRF 1DLMA 3LXVA 3PCDA 1YKNA 3PCLA 3O32A 4WHRA 3MI5M 3LKTM 3PCDM 1DMHA 3PCGA 2BUQB 3PCNM 3MFLA 1S9AA 3MI1A 1EOAB 2BOYA 2XSRA 4WHOB 4ILTA 3MV6A 2BURA 2BUTB 3PCHA 3PCIM 3PCAM 3PCEM 2BUYB 3LMXM 1EOCA 2XSVA 2PCDA 1YKKB 3PCCA 2BV0A 2BUWA 2BUUB 2BUVA 3N9TA 3LXVM 1YKLB 1YKMB 3PCKA 4WHPB 3PCLM 3PCMA 1DLQA 1EO2B 3PCFA 3TH1A 2BUQA 3T67A 3PCGM 3HGIA 3PCBA 3PCJA 1EOAA 3MFLM 3HJSA 3MI1M 2BUMB 4WHSB
chains in the Genus database with same CATH superfamily
1WJ7A 4IBKA 2XFTA 5A2QS 5JI2E 3AOGA 5KPTA 3O6JA 4LF4M 3LCUA 2BUZB 2DHYA 3OTOM 2BJWA 4MGIE 3T63A 5FTNA 1SXJE 2CHGA 4GRIA 3U61A 4M0WA 2O5RA 4DUYM 1JR3D 3J2PB 2BUUA 5BR8M 3MK6A 4XGIA 1SXJA 2A5YB 1VQ1A 2DKLA 3J27B 2OOBA 2EO2A 3A46A 4G4QA 5DYIA 3T63M 3PVSA 4EIWA 1WIVA 5F3WA 4LFBM 1V92A 4I5SA 3FYDA 2J7OA 4NL4H 5BPVA 3PCKM 1UM8A 3LVVA 5FTJA 3SHFA 1DGHB 2L2DA 1AUAA 5LMUM 2LNHC 3W68A 1HNZM 2XEPA 1GJTA 2FE8A 4YHHM 3JR4A 1PM5A 3SASA 3SYLA 2HL7A 2KNVA 4S12A 1TDZA 1IY2A 1ZMWA 1GKIA 2M60A 2DENA 4DBGB 4GH9A 1DLTA 2K6BA 1PJTA 3FKEA 5FTKA 1QUTA 2UXDM 1L1ZA 1QUSA 3UGJA 3PCAA 2JZ1A 2WSFF 3THGA 3MV4M 2XFSA 1NNJA 3VDUA 1LTMA 5JI3E 4GKJM 4IBJA 1TTEA 3QYEA 3M7GA 4DV7M 3H4MA 1JB0F 1L1TA 4WHSD 1YKPA 2BV0B 3WHLA 1G71A 2LHCA 4DR5M 2XZUA 2L4FA 1DLMA 4WHRF 2GNOA 2BWEA 2BNKA 5EXTA 1G8PA 4IBDA 1H6UA 1Z5BA 1KFVA 2GQFA 3FUXA 4LY6A 4JV5M 1YKNA 2QCUA 3PCLA 3WHKA 2RGOA 5GKNA 4IBFA 1XMOM 4AW4A 3GRUA 3U6SA 4WHRA 1W5TA 1WR1B 1N75A 3DZDA 3W67A 1OIPA 4L8RC 2V1UA 2DZLA 1XNRM 3U5ZA 2CV0A 1DMHA 4DR2M 3FD9A 4FCVA 2R4JA 3D8LA 4I8OA 1HR0M 2CWBA 4LZZA 3SARA 1RU3A 3MV4A 4REZA 1KSFX 2QBYB 1T3TA 2XSRA 3K9PA 1Q02A 2ZANA 2XLJA 4ILTA 2LVAA 3J80S 2BURA 2KNAA 1E32A 4DV5M 3PCHA 3VK7A 1QYRA 2R46A 3IHPA 3PCIM 2EKKA 3A98B 3T1YM 1L2DA 2BUYB 3PCEM 3AKZA 2CEAA 4GHLA 2D7GA 2JNHA 4RNAA 4B7HA 3KS4A 2UXCM 1IQPA 2H5XA 1NY6A 3L25A 1DV0A 2CV2A 1QDTA 2XSZD 4LF7M 4MB7A 3LMMA 4LRTA 3N9TA 5C18A 4JI5M 2Y0TA 1YKLB 2V6ZM 1XXHE 4OVZB 4TUWA 5IT9S 4AKGA 3B7QA 1P3QQ 2DHRA 3HZJA 4WHPB 5ITYA 1DO0A 2CHVA 3GLFB 1C7YA 2HHHM 1SXJC 1FNNA 2B3TA 1Z6TA 1XXHA 2EUCA 2KNZA 1Q39A 2OPFA 2BUQA 3T67A 1T6OA 2L09A 3AOEC 4IIWA 3FTDA 3PCGM 4AKHA 3SHGB 2RGHA 1L8QA 3VDPA 1JR3E 3EIHA 3PCJA 3MFLM 1OKSA 3Q8GA 1ZV1A 3TPZA 2Q2EB 1YKOB 1EO9B 2KRUA 2BUTA 1IN8A 1WXQA 1JR3A 3HU1A 5FLXS 3MV6M 1IN7A 4B3MM 2JY7A 2M5ZA 3GLHE 1GLNA 2FFJA 1MJGM 3SAWA 2UUBM 2LBCA 2JA2A 3HHWA 4I4LA 3U6QA 2BUXB 2F5PA 4LJ8A 3KOZE 3GLHA 1PJSA 3PXGA 3KSXA 4AZFA 4G4NA 1SG9A 1VDLA 1R7RA 4BLCA 2ZAMA 5ITUA 3SYKA 2R65A 3W0FA 5H37D 2CV1A 3IG8A 1C1KA 2L7HA 7CATA 4LF5M 2JY8A 4WP2A 3SC3A 3KW6A 2VF7A 3GQ3A 1E9SA 1NJGA 3L27A 3HJQA 3PCNA 1IXRC 3NBXX 3PCMM 2J5YA 5FSWA 2JP7A 3LCVB 2KDLA 3LQQA 4LZJA 4OU7A 2C9CA 2XZFA 2AZQA 2RRUA 1A5TA 5EP2A 4G3OA 4QNRA 1YUBA 4WHPD 1S3SA 3FE3A 1E9RA 2YFQA 3LW5F 4F1IA 1UFZA 3JAMS 4JYAM 3PCBM 2DAIA 2KXEA 3JR5A 4WHSA 1I4WA 4MGZE 3FYCA 2UUAM 1Y8GA 1N78A 3LMXA 2G8LA 1QZEA 2QNJA 3A45A 2BUZA 3GPYA 4R71A 1Z5CA 1EOCB 4NRVA 1Z5AA 2CE7A 2LXEA 4L15A 1TDHA 3GPPA 1TF0B 4OW0A 1T43A 2G3QA 4GMQA 3SMSA 4XK8F 2BUVB 1V33A 2JXNA 3I01M 1N34M 3LXVA 2EJSA 4NSRA 2R18A 3IECA 3FTEA 1GJSA 1OTRA 1DGBA 2VDBB 4LFAM 1HJPA 1VEJA 2QZ4A 3CGWA 4GC5A 4DV0M 3O32A 1XB2B 2MGWA 1G41A 1J7KA 4AG6A 1EE8A 4HL4A 4NC6A 1DGHA 4PCZA 1V34A 1PGYA 4Y28F 3Q8XA 1S9AA 1K3XA 3RFWA 2LVOC 3B7NA 3MMPA 2X4AA 3B74A 4G6ZA 4NOOB 1EOAB 2DZOB 4GITA 4CIZA 4WHOB 3U60B 1D0LA 2Y21A 3M0EA 3NWLA 3PFIA 4GEWA 3SBJA 3DFZA 3GLIB 3TQSA 2QSFX 1PRBA 2XSZA 1IM2A 5DNYA 4QNMA 2C96A 3PCAM 3HU2A 3PNVA 4KT0F 4CJ6A 2DWMA 4GIPA 3AL0C 2PCDA 1N33M 4PDGA 3U6LA 3U6MA 4K0KM 1YKKB 2FOIC 2UU9M 4R3DA 3FUWA 5KPZA 3PCCA 2BV0A 5EQTA 1QAMA 3KVWA 4L16A 4LJ7A 4F2LA 5ITQA 2DZNB 1IY0A 1AIPC 1NO1A 2LVPC 2Z7JA 3T6PA 4QOSA 3HY5A 4G4OA 5KQDA 1L2BA 3FUUA 1EO2B 1YKMB 2CP8A 3C9PA 4X65M 1IN5A 3CTWB 2XH9A 3PCLM 4WHSB 3SMPA 1PJQA 1OFIA 1OIZA 3CF2A 2ERCA 2KZUA 3MHVC 4R7GA 2R62A 1IFYA 4ITQA 3UK6A 2K9DA 2R45A 3K92A 3CF0A 3SAVA 4MH0E 3FUTA 1N32M 3ZQJA 3R9XB 3NBIA 4HEOA 3UMMA 4KLNA 2WZJA 3T38A 2QBYA 1LV7A 1QAQA 4KODA 3W0LB 4B3SM 2VQEM 4P16A 4WHQB 2JWSA 2QHOB 2YNMD 2LVQD 1J5EM 2QQ8A 2XSUA 2DAKA 4M0DA 3BXWA 2KZSA 1IBKM 3KS8A 3BBZA 2BUYA 4B3TM 4OX9M 3O5UA 3AFHA 2L6OA 2C98A 4FW9A 1FJGM 3FRIA 3LQRA 1NY5A 3GQ4A 2Y0QA 4KHPM 2OOAA 3KP0E 2F5NA 1DGGA 4HLQA 1EOBB 4WHOD 5EXSA 5ITTA 2QP9X 5IZ7D 3E9SA 1G4AE 2ZTDA 1TMXA 1ORYB 2W82A 1EIJA 2F5QA 5EP4A 1QDRA 3GLFE 3VK8A 2HAKA 4B7FA 1GO5A 3HJ8A 2OQ4A 4RKUF 1YKLA 1XC8A 4OVZA 1GABA 4IJEA 3TE6A 3MI5A 3UZUA 2Z3XA 3LKTA 4WHPA 3HKPA 3KP1E 3FTCA 1IXSB 3GP1A 3K1JA 4IBBA 4QHSA 4QHTA 3D8BA 2LH0A 4RF1A 3TWKA 3GLFA 4W5WA 1GVNA 3QWLA 2R0IA 3I51A 2CRUA 3VKGA 5EXXA 1HNWM 1ZMVA 3U6CA 1R4GA 4DV6M 3TWLA 4DV2M 4B3RM 2Y20A 1VEKA 4JXJA 3T67M 2I7PA 4MM3B 5KPRA 1IXZA 2LHGA 3PCJM 1PJJA 4PT5A 4JI8M 1YKOA 2RKOA 4LFCM 3ZC7B 1EO9A 2XF3A 2C5RA 3L26A 3TWMA 4GC9A 2NQ8C 1WGNA 1YSYA 2ZM6M 4FWGA 2ZAOA 3I4YA 1QAOA 4LGYA 4PD2A 5IWAM 2EA0A 3GRVA 1OAIA 4GKKM 3R8FA 2EKFA 2YR0A 3HHXA 2BUWB 3HWSA 2BUXA 2R4EA 4LRSA 1K82A 1X37A 4JI2M 3KFUG 1F4IA 3PCDA 3J7AS 2LTUA 4MGKE 5EXPA 1G3IA 2G5GX 3ZH9B 2L7IA 3U6PA 3LVWA 4M9XA 4IBGA 3ILKA 8CATA 3FRHA 1VG5A 1W5SA 2WSEF 5KQ8A 2Z4SA 2DWLA 3PCDM 2APLA 4LF9M 2DNAA 2O25A 1TH2A 2D7HA 3J81S 3PCNM 3KXEC 3GLGB 3SATA 3MI1A 3L28A 1NVMA 1HNXM 2J7NA 4JI4M 1N77A 4DV1M 3CF6E 2BOYA 4D80A 2XGNA 2HKJA 1K3WA 2QENA 5DYGA 4DR1M 1IN4A 1YE9A 3L29A 4DR4M 2MJ5B 5ITRA 3SAUA 3PNYA 4FCWA 4JI3M 1R5LA 1IN6A 4QOZC 2DAMA 4XBOA 3GO8A 3LMXM 2K0BX 1EOCA 2XSVA 3C3DA 4LJ5A 3U61B 1OAOC 1D0KA 3GQ5A 2BUVA 2BUUB 3U6EA 5E26A 1E94E 1SXJB 5EP3A 1Q3BA 1XHBA 3H4JA 1IBLM 5FTLA 3LXVM 1WGLA 1WHCA 2VF8A 5E6JA 2VIIA 3PCKA 4II7A 4M9ZA 4Q7JA 2BWBA 1R2YA 1QZMA 3PCFA 3UJNA 4LCBA 1I94M 1XWIA 1XMQM 3EIEA 1DO2A 1HQYE 3KSJA 1DLQA 4IBCA 1GL7A 1ZAEA 3B7ZA 2JY5A 1YLAA 4AI6A 3AOEA 1L2CA 2UXBM 3FTFA 4CISA 2K47A 3GLIE 4BB9A 3HGIA 1EOAA 1HT2E 3GRYA 3HJSA 3BOSA 5LMNM 1TH4A 2C99A 1HT1E 1IY1A 3DA1A 1R6BX 3E4RA 2BUMB 4WHOA 3U60A 4LG2A 2KW0A 4JI1M 4BBAA 1D0MA 2Z4RA 1QVRA 2F5SA 1TR8A 3GLIA 1HQCA 1NSFA 4L78A 2N35A 3GRRA 4NSOB 4PDIA 4X62M 4AQYM 1NNUC 3AJIB 1MN3A 4ILVA 2LVNC 2C9OA 2BUMA 1XNQM 2I7NA 2MH8A 1YKKA 4RF0A 3PCHM 1CUKA 1YKPB 2DXIA 2PCDM 2UUCM 4JI7M 3I04M 3PCCM 5IREB 3ZCBB 4DR3M 1QANA 3M6AA 1VDDA 4MGHA 3E21A 4ANRA 4DR6M 1YKNB 1G59A 1YKMA 2FH0A 5EJCA 4LJ4A 2DAGA 4Z8XA 4WHRB 2DI0A 3U6DA 4LJ9A 3KOWE 3SFZA 1EO2A 1SXJD 3O6RA 2F5OA 2FS1A 3I4VA 3GPUA 3U5ZB 4YY3M 3PCFM 1QQWA 2V1CA 1DGFA 2R44A 2H1RA 2O01F 3L2AA 4FVMA 3HHYA 4DUZM 2DAEA 1ZQ9A 2JUJA 1R2ZA 2KRKA 4D81A 2MROB 2F4VM 4FWHA 4AKIA 5TD3A 3K8ZA 3PCIA 2YQZA 2BURB 3PCEA 4WHQA 3HHZA 4L6V6 3RGSA 4CGYB 2DVWB 1NHGC 3J7BA 3KDSE 3K2LA 3E46A 4FCTA 4CHTB 5ITXE 3IG5A 2Z8YM 1EOBA 4DV4M 1NV9A 2CHQA 4FWDA 1ZMUA 4KO8A 1JQJC 4P17A 2HCBA 5KO3A 2VQFM 5ITXA 4X66M 3V76A 2LWXA 2CUZA 3VLFB 2AHMA 3U6OA 1NJFA 5FTMA 3TL4X 4B08A 4UN2B 3HU3A 3QAUA 3MI5M 1IXSA 3AV0A 3MJ5A 3LKTM 1XXHB 4AG5A 4ZPXA 4LJ6A 4DV3M 4IBIA 3HX3A 2L4EA 1BVSA 3KOXE 3PCGA 1NV8A 3GPXA 1OFHA 2QPAA 2BUQB 3MFLA 3DOAA 4FD2A 4IJFA 3A42A 2HWJA 1MU5A 4GHAA 2JZ0A 2KA6B 2X49A 5EP1A 5C1BA 4G4RA 1KYIA 4NXMM 1N36M 4MGYE 3MV6A 2CFOA 2OO9A 4WURA 1VEGA 1PJIA 5DFLA 2BUTB 1IBMM 4D82A 2ZTCA 4LF8M 3VKHA 3FUVA 4LJAA 4M9SA 1J09A 2X8AA 3RE8A 4B7GA 1NHWC 3B89A 3VFDA 4NRWA 2MR9A 3C3EA 2FNAA 3GLHB 3K9OA 2BUWA 1Q3CA 2DWNA 2E5LM 2ZBKB 1OJLA 2D7EA 1EFUB 2DWZB 2BJVA 3T1HM 1TGUA 4LGMA 3RGPA 2KEBA 2KHHA 1D2NA 2P5TA 4X64M 4LF6M 4JI0M 1OQYA 2JY6B 4JN6A 2R6FA 3QYBA 4I81A 3F92A 4JI6M 3PCMA 3GLGE 3KOYE 5L8RF 3TH1A 3T15A 4A3VB 4Z6YA 4L4UA 4IBEA 4DR7M 1Z59A 4NXNM 3GLGA 1GL6A 4WW0A 3PCBA 1MX0A 1TH3A 3MI1M 2WSCF 3B9PA 3C58A
chains in the Genus database with same CATH topology
4IBKA 2XFTA 5A2QS 5JI2E 3AOGA 5KPTA 3O6JA 4LF4M 2BUZB 3OTOM 2BJWA 4MGIE 3T63A 5FTNA 1SXJE 2CHGA 4GRIA 3U61A 4M0WA 2O5RA 4DUYM 1JR3D 3J2PB 2BUUA 5BR8M 3MK6A 4XGIA 1SXJA 2A5YB 3J27B 2EO2A 3A46A 4G4QA 5DYIA 3T63M 3PVSA 4EIWA 5F3WA 4LFBM 4I5SA 3FYDA 2J7OA 4NL4H 5BPVA 3PCKM 1UM8A 3LVVA 5FTJA 3SHFA 1DGHB 5LMUM 2LNHC 1HNZM 2XEPA 2FE8A 4YHHM 3JR4A 1PM5A 3SASA 3SYLA 2HL7A 4S12A 1TDZA 1IY2A 1GKIA 2M60A 1DLTA 4GH9A 5FTKA 3FKEA 2UXDM 1L1ZA 3UGJA 3PCAA 3THGA 3MV4M 2XFSA 3VDUA 5JI3E 4GKJM 4IBJA 3M7GA 4DV7M 3H4MA 4WHSD 1L1TA 1YKPA 2BV0B 3WHLA 2XZUA 4DR5M 4WHRF 1DLMA 2BNKA 5EXTA 1G8PA 4IBDA 1H6UA 1Z5BA 1KFVA 3FUXA 4LY6A 4JV5M 1YKNA 2QCUA 3PCLA 3WHKA 2RGOA 5GKNA 4IBFA 1XMOM 4AW4A 3GRUA 3U6SA 4WHRA 1W5TA 1N75A 3DZDA 4L8RC 2V1UA 1XNRM 3U5ZA 2CV0A 1DMHA 4DR2M 3FD9A 4FCVA 2R4JA 3D8LA 4I8OA 1HR0M 4LZZA 3SARA 4REZA 1KSFX 2QBYB 1T3TA 2XSRA 2ZANA 2XLJA 4ILTA 3J80S 2BURA 4DV5M 1E32A 3PCHA 3VK7A 1QYRA 2R46A 3PCIM 3PCEM 3A98B 3T1YM 2BUYB 1L2DA 3AKZA 2CEAA 4GHLA 2D7GA 4RNAA 4B7HA 3KS4A 2UXCM 1IQPA 1NY6A 3L25A 2CV2A 2XSZD 4LF7M 4MB7A 3LMMA 4LRTA 3N9TA 5C18A 4JI5M 2Y0TA 1YKLB 2V6ZM 4OVZB 4TUWA 5IT9S 4AKGA 2DHRA 4WHPB 5ITYA 1DO0A 2CHVA 3GLFB 2HHHM 1SXJC 1FNNA 1Z6TA 1XXHA 2EUCA 1Q39A 2OPFA 2BUQA 3T67A 2L09A 3AOEC 4IIWA 3FTDA 3PCGM 4AKHA 3SHGB 2RGHA 1L8QA 3VDPA 3EIHA 3PCJA 3MFLM 3TPZA 2Q2EB 1YKOB 1EO9B 2KRUA 2BUTA 1IN8A 1WXQA 1JR3A 3HU1A 5FLXS 3MV6M 1IN7A 4B3MM 2M5ZA 1GLNA 2FFJA 3SAWA 2UUBM 2JA2A 3HHWA 4I4LA 3U6QA 2BUXB 2F5PA 4LJ8A 3KOZE 3GLHA 3PXGA 4AZFA 3KSXA 4G4NA 1R7RA 4BLCA 2ZAMA 5ITUA 3SYKA 2R65A 3W0FA 5H37D 2CV1A 3IG8A 1C1KA 2L7HA 7CATA 4LF5M 3SC3A 3KW6A 3GQ3A 1E9SA 1NJGA 3L27A 3HJQA 3PCNA 1IXRC 3PCMM 5FSWA 1NNJA 4OU7A 4LZJA 3LQQA 2C9CA 2XZFA 2AZQA 5EP2A 4QNRA 1YUBA 4WHPD 1S3SA 1E9RA 2YFQA 3JAMS 4JYAM 3PCBM 3JR5A 2KXEA 4WHSA 1I4WA 4MGZE 3FYCA 2UUAM 1N78A 3LMXA 2G8LA 3A45A 2BUZA 3GPYA 1EOCB 1Z5CA 4NRVA 1Z5AA 2CE7A 2LXEA 4L15A 1TDHA 3GPPA 4OW0A 4GMQA 3SMSA 2BUVB 1N34M 3LXVA 4NSRA 2R18A 3FTEA 1DGBA 4LFAM 2QZ4A 4GC5A 4DV0M 3O32A 1G41A 1J7KA 4AG6A 1EE8A 4HL4A 1DGHA 4PCZA 3Q8XA 1S9AA 1K3XA 3RFWA 2X4AA 4G6ZA 4NOOB 1EOAB 2DZOB 4GITA 4WHOB 3U60B 2Y21A 3M0EA 3NWLA 3PFIA 3SBJA 3DFZA 3GLIB 3TQSA 2XSZA 1IM2A 5DNYA 4QNMA 2C96A 3PCAM 3HU2A 3PNVA 2DWMA 4GIPA 3AL0C 2PCDA 1N33M 4PDGA 3U6LA 3U6MA 4K0KM 1YKKB 2FOIC 2UU9M 4R3DA 3FUWA 5KPZA 3PCCA 2BV0A 5EQTA 1QAMA 3KVWA 4L16A 4LJ7A 5ITQA 2DZNB 1IY0A 2Z7JA 4QOSA 4G4OA 5KQDA 1L2BA 3FUUA 1YKMB 4X65M 1IN5A 3CTWB 2XH9A 3PCLM 4WHSB 3SMPA 1OFIA 3CF2A 3MHVC 2ERCA 2KZUA 4R7GA 1EO2B 2R62A 3PCFA 4ITQA 3UK6A 2R45A 3K92A 3CF0A 3SAVA 4MH0E 3FUTA 1N32M 3R9XB 3NBIA 3UMMA 4KLNA 3T38A 2QBYA 1QAQA 1LV7A 4KODA 3W0LB 4B3SM 2VQEM 4P16A 4WHQB 2YNMD 1J5EM 2XSUA 1IBKM 4M0DA 3KS8A 2KZSA 2BUYA 4B3TM 4OX9M 3O5UA 3AFHA 2L6OA 2C98A 4FW9A 1FJGM 3PCHM 3LQRA 1NY5A 3GQ4A 2Y0QA 4KHPM 3KP0E 2F5NA 1DGGA 4HLQA 1EOBB 4WHOD 5EXSA 5ITTA 2QP9X 5IZ7D 3E9SA 1G4AE 1TMXA 1ORYB 2W82A 2F5QA 5EP4A 3VK8A 4B7FA 3HJ8A 2OQ4A 1YKLA 1XC8A 4OVZA 4IJEA 3TE6A 3MI5A 3UZUA 2Z3XA 3LKTA 4WHPA 3HKPA 3KP1E 3FTCA 1IXSB 3GP1A 3K1JA 4IBBA 4QHSA 4QHTA 3D8BA 2LH0A 4RF1A 3TWKA 3GLFA 4W5WA 1GVNA 3QWLA 3I51A 3VKGA 5EXXA 1HNWM 3U6CA 4DV6M 3TWLA 4DV2M 4B3RM 2Y20A 4JXJA 3T67M 2I7PA 4MM3B 5KPRA 1IXZA 3PCJM 1PJJA 4PT5A 4JI8M 1YKOA 2RKOA 4LFCM 3ZC7B 1EO9A 2XF3A 2C5RA 3L26A 3TWMA 4GC9A 2NQ8C 1YSYA 2ZM6M 4FWGA 2ZAOA 3I4YA 1QAOA 4LGYA 4PD2A 5IWAM 2EA0A 3GRVA 4GKKM 3R8FA 2YR0A 3HHXA 2BUWB 3HWSA 2BUXA 2R4EA 4LRSA 1K82A 1X37A 4JI2M 3KFUG 3PCDA 3J7AS 4MGKE 5EXPA 1G3IA 2G5GX 3ZH9B 2L7IA 3U6PA 3LVWA 4M9XA 4IBGA 3ILKA 8CATA 1W5SA 5KQ8A 2Z4SA 2DWLA 3PCDM 4LF9M 1TH2A 2D7HA 3J81S 3PCNM 3KXEC 3GLGB 3SATA 3MI1A 3L28A 1NVMA 1HNXM 2J7NA 4JI4M 1N77A 4DV1M 3CF6E 2BOYA 4D80A 2XGNA 2HKJA 1K3WA 2QENA 5DYGA 4DR1M 1IN4A 1YE9A 3L29A 4DR4M 5ITRA 3SAUA 3PNYA 4FCWA 4JI3M 1IN6A 4QOZC 4XBOA 3GO8A 3LMXM 1EOCA 2XSVA 4LJ5A 3U61B 3GQ5A 2BUVA 2BUUB 3U6EA 5E26A 1E94E 1SXJB 5EP3A 1Q3BA 1XHBA 1IBLM 5FTLA 3LXVM 5E6JA 2VIIA 3PCKA 4II7A 4M9ZA 1R2YA 1QZMA 3UJNA 4LCBA 1I94M 1XWIA 1XMQM 3EIEA 3KSJA 1DO2A 1HQYE 1DLQA 4IBCA 1GL7A 1ZAEA 4AI6A 3AOEA 1L2CA 2UXBM 3FTFA 4CISA 2K47A 4BB9A 3HGIA 1EOAA 1HT2E 3GRYA 3HJSA 3BOSA 5LMNM 1TH4A 1HT1E 3E4RA 2C99A 1IY1A 3DA1A 1R6BX 2BUMB 4WHOA 3U60A 4LG2A 2KW0A 4JI1M 4BBAA 3MV4A 2Z4RA 1QVRA 2F5SA 3GLIA 1HQCA 1NSFA 4L78A 3GRRA 4AQYM 4NSOB 4PDIA 4X62M 1NNUC 3AJIB 4ILVA 2C9OA 2BUMA 1XNQM 2I7NA 1YKKA 4RF0A 1YKPB 2DXIA 2PCDM 2UUCM 4JI7M 3PCCM 5IREB 3ZCBB 4DR3M 1QANA 3M6AA 1VDDA 4MGHA 4DR6M 1YKNB 1G59A 1YKMA 5EJCA 4LJ4A 4Z8XA 4WHRB 3U6DA 4LJ9A 3KOWE 3SFZA 1EO2A 1SXJD 3O6RA 2F5OA 3GPUA 3I4VA 3U5ZB 4YY3M 3PCFM 1QQWA 2V1CA 1DGFA 3L2AA 2H1RA 4FVMA 3HHYA 1R2ZA 4DUZM 1ZQ9A 2KRKA 4D81A 2F4VM 4FWHA 4AKIA 5TD3A 3K8ZA 3PCIA 2YQZA 2BURB 3PCEA 4WHQA 3HHZA 3RGSA 4CGYB 2DVWB 1NHGC 3J7BA 3KDSE 3K2LA 4FCTA 4CHTB 5ITXE 3IG5A 1EOBA 4DV4M 4FWDA 2CHQA 4KO8A 1JQJC 2HCBA 5KO3A 2VQFM 5ITXA 4X66M 2LWXA 2CUZA 3VLFB 2AHMA 3U6OA 1NJFA 5FTMA 3TL4X 4B08A 3HU3A 3QAUA 3MI5M 3AV0A 3MJ5A 3LKTM 1XXHB 4AG5A 4ZPXA 4LJ6A 4DV3M 4IBIA 3KOXE 3PCGA 2BUQB 3GPXA 1OFHA 2QPAA 3MFLA 3DOAA 4FD2A 4IJFA 3A42A 1MU5A 4GHAA 5C1BA 2KA6B 2X49A 5EP1A 4G4RA 1KYIA 4NXMM 1N36M 4MGYE 3MV6A 2CFOA 4WURA 1PJIA 2BUTB 1IBMM 4D82A 4LF8M 3VKHA 3FUVA 4LJAA 4M9SA 1J09A 2X8AA 3RE8A 4B7GA 1NHWC 3VFDA 4NRWA 2FNAA 3GLHB 2BUWA 1Q3CA 2DWNA 2E5LM 2ZBKB 1OJLA 2D7EA 2DWZB 2BJVA 3T1HM 1TGUA 4LGMA 3RGPA 2KEBA 1D2NA 2P5TA 4X64M 4LF6M 4JI0M 4JN6A 4I81A 4JI6M 3PCMA 3KOYE 3TH1A 3T15A 4A3VB 4Z6YA 4L4UA 4IBEA 4DR7M 1Z59A 4NXNM 3GLGA 1GL6A 4WW0A 3PCBA 1MX0A 1TH3A 3MI1M 3B9PA 3C58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKO B;  4WHQ B;  3MV4 A;  1EO9 B;  2XSU A;  2BUT A;  3O6J A;  3MV6 M;  2BUZ B;  2BUY A;  4ILV A;  3O5U A;  3PCH M;  3T63 A;  2BUM A;  1YKK A;  4WHO D;  1EOB B;  1YKP B;  2PCD M;  2BUX B;  2BUU A;  1TMX A;  3PCC M;  1YKN B;  3HJ8 A;  3T63 M;  1YKL A;  1YKM A;  3MI5 A;  3LKT A;  4WHR B;  3HKP A;  4WHP A;  3PCK M;  1EO2 A;  3O6R A;  3HJQ A;  3PCN A;  3PCM M;  3I4V A;  3PCF M;  2AZQ A;  3I51 A;  3HHY A;  4WHP D;  1DLT A;  3T67 M;  5TD3 A;  3PCB M;  3PCI A;  3PCJ M;  4WHO A;  3PCA A;  1YKO A;  2BUR B;  3PCE A;  4WHQ A;  4WHS A;  1EO9 A;  3LMX A;  3MV4 M;  2BUZ A;  1EOC B;  3I4Y A;  4WHS D;  1EOB A;  1YKP A;  2BV0 B;  2BUW B;  3HHX A;  2BUV B;  2BUX A;  4WHR F;  1DLM A;  3LXV A;  3PCD A;  1YKN A;  3PCL A;  3O32 A;  4WHR A;  3MI5 M;  3LKT M;  3PCD M;  1DMH A;  3PCG A;  2BUQ B;  3PCN M;  3MFL A;  1S9A A;  3MI1 A;  1EOA B;  2BOY A;  2XSR A;  4WHO B;  4ILT A;  3MV6 A;  2BUR A;  2BUT B;  3PCH A;  3PCI M;  3PCA M;  3PCE M;  2BUY B;  3LMX M;  1EOC A;  2XSV A;  2PCD A;  1YKK B;  3PCC A;  2BV0 A;  2BUW A;  2BUU B;  2BUV A;  3N9T A;  3LXV M;  1YKL B;  1YKM B;  3PCK A;  4WHP B;  3PCL M;  3PCM A;  1DLQ A;  1EO2 B;  3PCF A;  3TH1 A;  2BUQ A;  3T67 A;  3PCG M;  3HGI A;  3PCB A;  3PCJ A;  1EOA A;  3MFL M;  3HJS A;  3MI1 M;  2BUM B;  4WHS B; 
#chains in the Genus database with same CATH topology
 1WJ7 A;  4IBK A;  2XFT A;  5A2Q S;  5JI2 E;  3AOG A;  5KPT A;  3O6J A;  4LF4 M;  3LCU A;  2BUZ B;  2DHY A;  3OTO M;  2BJW A;  4MGI E;  3T63 A;  5FTN A;  1SXJ E;  2CHG A;  4GRI A;  3U61 A;  4M0W A;  2O5R A;  4DUY M;  1JR3 D;  3J2P B;  2BUU A;  5BR8 M;  3MK6 A;  4XGI A;  1SXJ A;  2A5Y B;  1VQ1 A;  2DKL A;  3J27 B;  2OOB A;  2EO2 A;  3A46 A;  4G4Q A;  5DYI A;  3T63 M;  3PVS A;  4EIW A;  1WIV A;  5F3W A;  4LFB M;  1V92 A;  4I5S A;  3FYD A;  2J7O A;  4NL4 H;  5BPV A;  3PCK M;  1UM8 A;  3LVV A;  5FTJ A;  3SHF A;  1DGH B;  2L2D A;  1AUA A;  5LMU M;  2LNH C;  3W68 A;  1HNZ M;  2XEP A;  1GJT A;  2FE8 A;  4YHH M;  3JR4 A;  1PM5 A;  3SAS A;  3SYL A;  2HL7 A;  2KNV A;  4S12 A;  1TDZ A;  1IY2 A;  1ZMW A;  1GKI A;  2M60 A;  2DEN A;  4DBG B;  4GH9 A;  1DLT A;  2K6B A;  1PJT A;  3FKE A;  5FTK A;  1QUT A;  2UXD M;  1L1Z A;  1QUS A;  3UGJ A;  3PCA A;  2JZ1 A;  2WSF F;  3THG A;  3MV4 M;  2XFS A;  1NNJ A;  3VDU A;  1LTM A;  5JI3 E;  4GKJ M;  4IBJ A;  1TTE A;  3QYE A;  3M7G A;  4DV7 M;  3H4M A;  1JB0 F;  1L1T A;  4WHS D;  1YKP A;  2BV0 B;  3WHL A;  1G71 A;  2LHC A;  4DR5 M;  2XZU A;  2L4F A;  1DLM A;  4WHR F;  2GNO A;  2BWE A;  2BNK A;  5EXT A;  1G8P A;  4IBD A;  1H6U A;  1Z5B A;  1KFV A;  2GQF A;  3FUX A;  4LY6 A;  4JV5 M;  1YKN A;  2QCU A;  3PCL A;  3WHK A;  2RGO A;  5GKN A;  4IBF A;  1XMO M;  4AW4 A;  3GRU A;  3U6S A;  4WHR A;  1W5T A;  1WR1 B;  1N75 A;  3DZD A;  3W67 A;  1OIP A;  4L8R C;  2V1U A;  2DZL A;  1XNR M;  3U5Z A;  2CV0 A;  1DMH A;  4DR2 M;  3FD9 A;  4FCV A;  2R4J A;  3D8L A;  4I8O A;  1HR0 M;  2CWB A;  4LZZ A;  3SAR A;  1RU3 A;  3MV4 A;  4REZ A;  1KSF X;  2QBY B;  1T3T A;  2XSR A;  3K9P A;  1Q02 A;  2ZAN A;  2XLJ A;  4ILT A;  2LVA A;  3J80 S;  2BUR A;  2KNA A;  1E32 A;  4DV5 M;  3PCH A;  3VK7 A;  1QYR A;  2R46 A;  3IHP A;  3PCI M;  2EKK A;  3A98 B;  3T1Y M;  1L2D A;  2BUY B;  3PCE M;  3AKZ A;  2CEA A;  4GHL A;  2D7G A;  2JNH A;  4RNA A;  4B7H A;  3KS4 A;  2UXC M;  1IQP A;  2H5X A;  1NY6 A;  3L25 A;  1DV0 A;  2CV2 A;  1QDT A;  2XSZ D;  4LF7 M;  4MB7 A;  3LMM A;  4LRT A;  3N9T A;  5C18 A;  4JI5 M;  2Y0T A;  1YKL B;  2V6Z M;  1XXH E;  4OVZ B;  4TUW A;  5IT9 S;  4AKG A;  3B7Q A;  1P3Q Q;  2DHR A;  3HZJ A;  4WHP B;  5ITY A;  1DO0 A;  2CHV A;  3GLF B;  1C7Y A;  2HHH M;  1SXJ C;  1FNN A;  2B3T A;  1Z6T A;  1XXH A;  2EUC A;  2KNZ A;  1Q39 A;  2OPF A;  2BUQ A;  3T67 A;  1T6O A;  2L09 A;  3AOE C;  4IIW A;  3FTD A;  3PCG M;  4AKH A;  3SHG B;  2RGH A;  1L8Q A;  3VDP A;  1JR3 E;  3EIH A;  3PCJ A;  3MFL M;  1OKS A;  3Q8G A;  1ZV1 A;  3TPZ A;  2Q2E B;  1YKO B;  1EO9 B;  2KRU A;  2BUT A;  1IN8 A;  1WXQ A;  1JR3 A;  3HU1 A;  5FLX S;  3MV6 M;  1IN7 A;  4B3M M;  2JY7 A;  2M5Z A;  3GLH E;  1GLN A;  2FFJ A;  1MJG M;  3SAW A;  2UUB M;  2LBC A;  2JA2 A;  3HHW A;  4I4L A;  3U6Q A;  2BUX B;  2F5P A;  4LJ8 A;  3KOZ E;  3GLH A;  1PJS A;  3PXG A;  3KSX A;  4AZF A;  4G4N A;  1SG9 A;  1VDL A;  1R7R A;  4BLC A;  2ZAM A;  5ITU A;  3SYK A;  2R65 A;  3W0F A;  5H37 D;  2CV1 A;  3IG8 A;  1C1K A;  2L7H A;  7CAT A;  4LF5 M;  2JY8 A;  4WP2 A;  3SC3 A;  3KW6 A;  2VF7 A;  3GQ3 A;  1E9S A;  1NJG A;  3L27 A;  3HJQ A;  3PCN A;  1IXR C;  3NBX X;  3PCM M;  2J5Y A;  5FSW A;  2JP7 A;  3LCV B;  2KDL A;  3LQQ A;  4LZJ A;  4OU7 A;  2C9C A;  2XZF A;  2AZQ A;  2RRU A;  1A5T A;  5EP2 A;  4G3O A;  4QNR A;  1YUB A;  4WHP D;  1S3S A;  3FE3 A;  1E9R A;  2YFQ A;  3LW5 F;  4F1I A;  1UFZ A;  3JAM S;  4JYA M;  3PCB M;  2DAI A;  2KXE A;  3JR5 A;  4WHS A;  1I4W A;  4MGZ E;  3FYC A;  2UUA M;  1Y8G A;  1N78 A;  3LMX A;  2G8L A;  1QZE A;  2QNJ A;  3A45 A;  2BUZ A;  3GPY A;  4R71 A;  1Z5C A;  1EOC B;  4NRV A;  1Z5A A;  2CE7 A;  2LXE A;  4L15 A;  1TDH A;  3GPP A;  1TF0 B;  4OW0 A;  1T43 A;  2G3Q A;  4GMQ A;  3SMS A;  4XK8 F;  2BUV B;  1V33 A;  2JXN A;  3I01 M;  1N34 M;  3LXV A;  2EJS A;  4NSR A;  2R18 A;  3IEC A;  3FTE A;  1GJS A;  1OTR A;  1DGB A;  2VDB B;  4LFA M;  1HJP A;  1VEJ A;  2QZ4 A;  3CGW A;  4GC5 A;  4DV0 M;  3O32 A;  1XB2 B;  2MGW A;  1G41 A;  1J7K A;  4AG6 A;  1EE8 A;  4HL4 A;  4NC6 A;  1DGH A;  4PCZ A;  1V34 A;  1PGY A;  4Y28 F;  3Q8X A;  1S9A A;  1K3X A;  3RFW A;  2LVO C;  3B7N A;  3MMP A;  2X4A A;  3B74 A;  4G6Z A;  4NOO B;  1EOA B;  2DZO B;  4GIT A;  4CIZ A;  4WHO B;  3U60 B;  1D0L A;  2Y21 A;  3M0E A;  3NWL A;  3PFI A;  4GEW A;  3SBJ A;  3DFZ A;  3GLI B;  3TQS A;  2QSF X;  1PRB A;  2XSZ A;  1IM2 A;  5DNY A;  4QNM A;  2C96 A;  3PCA M;  3HU2 A;  3PNV A;  4KT0 F;  4CJ6 A;  2DWM A;  4GIP A;  3AL0 C;  2PCD A;  1N33 M;  4PDG A;  3U6L A;  3U6M A;  4K0K M;  1YKK B;  2FOI C;  2UU9 M;  4R3D A;  3FUW A;  5KPZ A;  3PCC A;  2BV0 A;  5EQT A;  1QAM A;  3KVW A;  4L16 A;  4LJ7 A;  4F2L A;  5ITQ A;  2DZN B;  1IY0 A;  1AIP C;  1NO1 A;  2LVP C;  2Z7J A;  3T6P A;  4QOS A;  3HY5 A;  4G4O A;  5KQD A;  1L2B A;  3FUU A;  1EO2 B;  1YKM B;  2CP8 A;  3C9P A;  4X65 M;  1IN5 A;  3CTW B;  2XH9 A;  3PCL M;  4WHS B;  3SMP A;  1PJQ A;  1OFI A;  1OIZ A;  3CF2 A;  2ERC A;  2KZU A;  3MHV C;  4R7G A;  2R62 A;  1IFY A;  4ITQ A;  3UK6 A;  2K9D A;  2R45 A;  3K92 A;  3CF0 A;  3SAV A;  4MH0 E;  3FUT A;  1N32 M;  3ZQJ A;  3R9X B;  3NBI A;  4HEO A;  3UMM A;  4KLN A;  2WZJ A;  3T38 A;  2QBY A;  1LV7 A;  1QAQ A;  4KOD A;  3W0L B;  4B3S M;  2VQE M;  4P16 A;  4WHQ B;  2JWS A;  2QHO B;  2YNM D;  2LVQ D;  1J5E M;  2QQ8 A;  2XSU A;  2DAK A;  4M0D A;  3BXW A;  2KZS A;  1IBK M;  3KS8 A;  3BBZ A;  2BUY A;  4B3T M;  4OX9 M;  3O5U A;  3AFH A;  2L6O A;  2C98 A;  4FW9 A;  1FJG M;  3FRI A;  3LQR A;  1NY5 A;  3GQ4 A;  2Y0Q A;  4KHP M;  2OOA A;  3KP0 E;  2F5N A;  1DGG A;  4HLQ A;  1EOB B;  4WHO D;  5EXS A;  5ITT A;  2QP9 X;  5IZ7 D;  3E9S A;  1G4A E;  2ZTD A;  1TMX A;  1ORY B;  2W82 A;  1EIJ A;  2F5Q A;  5EP4 A;  1QDR A;  3GLF E;  3VK8 A;  2HAK A;  4B7F A;  1GO5 A;  3HJ8 A;  2OQ4 A;  4RKU F;  1YKL A;  1XC8 A;  4OVZ A;  1GAB A;  4IJE A;  3TE6 A;  3MI5 A;  3UZU A;  2Z3X A;  3LKT A;  4WHP A;  3HKP A;  3KP1 E;  3FTC A;  1IXS B;  3GP1 A;  3K1J A;  4IBB A;  4QHS A;  4QHT A;  3D8B A;  2LH0 A;  4RF1 A;  3TWK A;  3GLF A;  4W5W A;  1GVN A;  3QWL A;  2R0I A;  3I51 A;  2CRU A;  3VKG A;  5EXX A;  1HNW M;  1ZMV A;  3U6C A;  1R4G A;  4DV6 M;  3TWL A;  4DV2 M;  4B3R M;  2Y20 A;  1VEK A;  4JXJ A;  3T67 M;  2I7P A;  4MM3 B;  5KPR A;  1IXZ A;  2LHG A;  3PCJ M;  1PJJ A;  4PT5 A;  4JI8 M;  1YKO A;  2RKO A;  4LFC M;  3ZC7 B;  1EO9 A;  2XF3 A;  2C5R A;  3L26 A;  3TWM A;  4GC9 A;  2NQ8 C;  1WGN A;  1YSY A;  2ZM6 M;  4FWG A;  2ZAO A;  3I4Y A;  1QAO A;  4LGY A;  4PD2 A;  5IWA M;  2EA0 A;  3GRV A;  1OAI A;  4GKK M;  3R8F A;  2EKF A;  2YR0 A;  3HHX A;  2BUW B;  3HWS A;  2BUX A;  2R4E A;  4LRS A;  1K82 A;  1X37 A;  4JI2 M;  3KFU G;  1F4I A;  3PCD A;  3J7A S;  2LTU A;  4MGK E;  5EXP A;  1G3I A;  2G5G X;  3ZH9 B;  2L7I A;  3U6P A;  3LVW A;  4M9X A;  4IBG A;  3ILK A;  8CAT A;  3FRH A;  1VG5 A;  1W5S A;  2WSE F;  5KQ8 A;  2Z4S A;  2DWL A;  3PCD M;  2APL A;  4LF9 M;  2DNA A;  2O25 A;  1TH2 A;  2D7H A;  3J81 S;  3PCN M;  3KXE C;  3GLG B;  3SAT A;  3MI1 A;  3L28 A;  1NVM A;  1HNX M;  2J7N A;  4JI4 M;  1N77 A;  4DV1 M;  3CF6 E;  2BOY A;  4D80 A;  2XGN A;  2HKJ A;  1K3W A;  2QEN A;  5DYG A;  4DR1 M;  1IN4 A;  1YE9 A;  3L29 A;  4DR4 M;  2MJ5 B;  5ITR A;  3SAU A;  3PNY A;  4FCW A;  4JI3 M;  1R5L A;  1IN6 A;  4QOZ C;  2DAM A;  4XBO A;  3GO8 A;  3LMX M;  2K0B X;  1EOC A;  2XSV A;  3C3D A;  4LJ5 A;  3U61 B;  1OAO C;  1D0K A;  3GQ5 A;  2BUV A;  2BUU B;  3U6E A;  5E26 A;  1E94 E;  1SXJ B;  5EP3 A;  1Q3B A;  1XHB A;  3H4J A;  1IBL M;  5FTL A;  3LXV M;  1WGL A;  1WHC A;  2VF8 A;  5E6J A;  2VII A;  3PCK A;  4II7 A;  4M9Z A;  4Q7J A;  2BWB A;  1R2Y A;  1QZM A;  3PCF A;  3UJN A;  4LCB A;  1I94 M;  1XWI A;  1XMQ M;  3EIE A;  1DO2 A;  1HQY E;  3KSJ A;  1DLQ A;  4IBC A;  1GL7 A;  1ZAE A;  3B7Z A;  2JY5 A;  1YLA A;  4AI6 A;  3AOE A;  1L2C A;  2UXB M;  3FTF A;  4CIS A;  2K47 A;  3GLI E;  4BB9 A;  3HGI A;  1EOA A;  1HT2 E;  3GRY A;  3HJS A;  3BOS A;  5LMN M;  1TH4 A;  2C99 A;  1HT1 E;  1IY1 A;  3DA1 A;  1R6B X;  3E4R A;  2BUM B;  4WHO A;  3U60 A;  4LG2 A;  2KW0 A;  4JI1 M;  4BBA A;  1D0M A;  2Z4R A;  1QVR A;  2F5S A;  1TR8 A;  3GLI A;  1HQC A;  1NSF A;  4L78 A;  2N35 A;  3GRR A;  4NSO B;  4PDI A;  4X62 M;  4AQY M;  1NNU C;  3AJI B;  1MN3 A;  4ILV A;  2LVN C;  2C9O A;  2BUM A;  1XNQ M;  2I7N A;  2MH8 A;  1YKK A;  4RF0 A;  3PCH M;  1CUK A;  1YKP B;  2DXI A;  2PCD M;  2UUC M;  4JI7 M;  3I04 M;  3PCC M;  5IRE B;  3ZCB B;  4DR3 M;  1QAN A;  3M6A A;  1VDD A;  4MGH A;  3E21 A;  4ANR A;  4DR6 M;  1YKN B;  1G59 A;  1YKM A;  2FH0 A;  5EJC A;  4LJ4 A;  2DAG A;  4Z8X A;  4WHR B;  2DI0 A;  3U6D A;  4LJ9 A;  3KOW E;  3SFZ A;  1EO2 A;  1SXJ D;  3O6R A;  2F5O A;  2FS1 A;  3I4V A;  3GPU A;  3U5Z B;  4YY3 M;  3PCF M;  1QQW A;  2V1C A;  1DGF A;  2R44 A;  2H1R A;  2O01 F;  3L2A A;  4FVM A;  3HHY A;  4DUZ M;  2DAE A;  1ZQ9 A;  2JUJ A;  1R2Z A;  2KRK A;  4D81 A;  2MRO B;  2F4V M;  4FWH A;  4AKI A;  5TD3 A;  3K8Z A;  3PCI A;  2YQZ A;  2BUR B;  3PCE A;  4WHQ A;  3HHZ A;  4L6V 6;  3RGS A;  4CGY B;  2DVW B;  1NHG C;  3J7B A;  3KDS E;  3K2L A;  3E46 A;  4FCT A;  4CHT B;  5ITX E;  3IG5 A;  2Z8Y M;  1EOB A;  4DV4 M;  1NV9 A;  2CHQ A;  4FWD A;  1ZMU A;  4KO8 A;  1JQJ C;  4P17 A;  2HCB A;  5KO3 A;  2VQF M;  5ITX A;  4X66 M;  3V76 A;  2LWX A;  2CUZ A;  3VLF B;  2AHM A;  3U6O A;  1NJF A;  5FTM A;  3TL4 X;  4B08 A;  4UN2 B;  3HU3 A;  3QAU A;  3MI5 M;  1IXS A;  3AV0 A;  3MJ5 A;  3LKT M;  1XXH B;  4AG5 A;  4ZPX A;  4LJ6 A;  4DV3 M;  4IBI A;  3HX3 A;  2L4E A;  1BVS A;  3KOX E;  3PCG A;  1NV8 A;  3GPX A;  1OFH A;  2QPA A;  2BUQ B;  3MFL A;  3DOA A;  4FD2 A;  4IJF A;  3A42 A;  2HWJ A;  1MU5 A;  4GHA A;  2JZ0 A;  2KA6 B;  2X49 A;  5EP1 A;  5C1B A;  4G4R A;  1KYI A;  4NXM M;  1N36 M;  4MGY E;  3MV6 A;  2CFO A;  2OO9 A;  4WUR A;  1VEG A;  1PJI A;  5DFL A;  2BUT B;  1IBM M;  4D82 A;  2ZTC A;  4LF8 M;  3VKH A;  3FUV A;  4LJA A;  4M9S A;  1J09 A;  2X8A A;  3RE8 A;  4B7G A;  1NHW C;  3B89 A;  3VFD A;  4NRW A;  2MR9 A;  3C3E A;  2FNA A;  3GLH B;  3K9O A;  2BUW A;  1Q3C A;  2DWN A;  2E5L M;  2ZBK B;  1OJL A;  2D7E A;  1EFU B;  2DWZ B;  2BJV A;  3T1H M;  1TGU A;  4LGM A;  3RGP A;  2KEB A;  2KHH A;  1D2N A;  2P5T A;  4X64 M;  4LF6 M;  4JI0 M;  1OQY A;  2JY6 B;  4JN6 A;  2R6F A;  3QYB A;  4I81 A;  3F92 A;  4JI6 M;  3PCM A;  3GLG E;  3KOY E;  5L8R F;  3TH1 A;  3T15 A;  4A3V B;  4Z6Y A;  4L4U A;  4IBE A;  4DR7 M;  1Z59 A;  4NXN M;  3GLG A;  1GL6 A;  4WW0 A;  3PCB A;  1MX0 A;  1TH3 A;  3MI1 M;  2WSC F;  3B9P A;  3C58 A; 
#chains in the Genus database with same CATH homology
 4IBK A;  2XFT A;  5A2Q S;  5JI2 E;  3AOG A;  5KPT A;  3O6J A;  4LF4 M;  2BUZ B;  3OTO M;  2BJW A;  4MGI E;  3T63 A;  5FTN A;  1SXJ E;  2CHG A;  4GRI A;  3U61 A;  4M0W A;  2O5R A;  4DUY M;  1JR3 D;  3J2P B;  2BUU A;  5BR8 M;  3MK6 A;  4XGI A;  1SXJ A;  2A5Y B;  3J27 B;  2EO2 A;  3A46 A;  4G4Q A;  5DYI A;  3T63 M;  3PVS A;  4EIW A;  5F3W A;  4LFB M;  4I5S A;  3FYD A;  2J7O A;  4NL4 H;  5BPV A;  3PCK M;  1UM8 A;  3LVV A;  5FTJ A;  3SHF A;  1DGH B;  5LMU M;  2LNH C;  1HNZ M;  2XEP A;  2FE8 A;  4YHH M;  3JR4 A;  1PM5 A;  3SAS A;  3SYL A;  2HL7 A;  4S12 A;  1TDZ A;  1IY2 A;  1GKI A;  2M60 A;  1DLT A;  4GH9 A;  5FTK A;  3FKE A;  2UXD M;  1L1Z A;  3UGJ A;  3PCA A;  3THG A;  3MV4 M;  2XFS A;  3VDU A;  5JI3 E;  4GKJ M;  4IBJ A;  3M7G A;  4DV7 M;  3H4M A;  4WHS D;  1L1T A;  1YKP A;  2BV0 B;  3WHL A;  2XZU A;  4DR5 M;  4WHR F;  1DLM A;  2BNK A;  5EXT A;  1G8P A;  4IBD A;  1H6U A;  1Z5B A;  1KFV A;  3FUX A;  4LY6 A;  4JV5 M;  1YKN A;  2QCU A;  3PCL A;  3WHK A;  2RGO A;  5GKN A;  4IBF A;  1XMO M;  4AW4 A;  3GRU A;  3U6S A;  4WHR A;  1W5T A;  1N75 A;  3DZD A;  4L8R C;  2V1U A;  1XNR M;  3U5Z A;  2CV0 A;  1DMH A;  4DR2 M;  3FD9 A;  4FCV A;  2R4J A;  3D8L A;  4I8O A;  1HR0 M;  4LZZ A;  3SAR A;  4REZ A;  1KSF X;  2QBY B;  1T3T A;  2XSR A;  2ZAN A;  2XLJ A;  4ILT A;  3J80 S;  2BUR A;  4DV5 M;  1E32 A;  3PCH A;  3VK7 A;  1QYR A;  2R46 A;  3PCI M;  3PCE M;  3A98 B;  3T1Y M;  2BUY B;  1L2D A;  3AKZ A;  2CEA A;  4GHL A;  2D7G A;  4RNA A;  4B7H A;  3KS4 A;  2UXC M;  1IQP A;  1NY6 A;  3L25 A;  2CV2 A;  2XSZ D;  4LF7 M;  4MB7 A;  3LMM A;  4LRT A;  3N9T A;  5C18 A;  4JI5 M;  2Y0T A;  1YKL B;  2V6Z M;  4OVZ B;  4TUW A;  5IT9 S;  4AKG A;  2DHR A;  4WHP B;  5ITY A;  1DO0 A;  2CHV A;  3GLF B;  2HHH M;  1SXJ C;  1FNN A;  1Z6T A;  1XXH A;  2EUC A;  1Q39 A;  2OPF A;  2BUQ A;  3T67 A;  2L09 A;  3AOE C;  4IIW A;  3FTD A;  3PCG M;  4AKH A;  3SHG B;  2RGH A;  1L8Q A;  3VDP A;  3EIH A;  3PCJ A;  3MFL M;  3TPZ A;  2Q2E B;  1YKO B;  1EO9 B;  2KRU A;  2BUT A;  1IN8 A;  1WXQ A;  1JR3 A;  3HU1 A;  5FLX S;  3MV6 M;  1IN7 A;  4B3M M;  2M5Z A;  1GLN A;  2FFJ A;  3SAW A;  2UUB M;  2JA2 A;  3HHW A;  4I4L A;  3U6Q A;  2BUX B;  2F5P A;  4LJ8 A;  3KOZ E;  3GLH A;  3PXG A;  4AZF A;  3KSX A;  4G4N A;  1R7R A;  4BLC A;  2ZAM A;  5ITU A;  3SYK A;  2R65 A;  3W0F A;  5H37 D;  2CV1 A;  3IG8 A;  1C1K A;  2L7H A;  7CAT A;  4LF5 M;  3SC3 A;  3KW6 A;  3GQ3 A;  1E9S A;  1NJG A;  3L27 A;  3HJQ A;  3PCN A;  1IXR C;  3PCM M;  5FSW A;  1NNJ A;  4OU7 A;  4LZJ A;  3LQQ A;  2C9C A;  2XZF A;  2AZQ A;  5EP2 A;  4QNR A;  1YUB A;  4WHP D;  1S3S A;  1E9R A;  2YFQ A;  3JAM S;  4JYA M;  3PCB M;  3JR5 A;  2KXE A;  4WHS A;  1I4W A;  4MGZ E;  3FYC A;  2UUA M;  1N78 A;  3LMX A;  2G8L A;  3A45 A;  2BUZ A;  3GPY A;  1EOC B;  1Z5C A;  4NRV A;  1Z5A A;  2CE7 A;  2LXE A;  4L15 A;  1TDH A;  3GPP A;  4OW0 A;  4GMQ A;  3SMS A;  2BUV B;  1N34 M;  3LXV A;  4NSR A;  2R18 A;  3FTE A;  1DGB A;  4LFA M;  2QZ4 A;  4GC5 A;  4DV0 M;  3O32 A;  1G41 A;  1J7K A;  4AG6 A;  1EE8 A;  4HL4 A;  1DGH A;  4PCZ A;  3Q8X A;  1S9A A;  1K3X A;  3RFW A;  2X4A A;  4G6Z A;  4NOO B;  1EOA B;  2DZO B;  4GIT A;  4WHO B;  3U60 B;  2Y21 A;  3M0E A;  3NWL A;  3PFI A;  3SBJ A;  3DFZ A;  3GLI B;  3TQS A;  2XSZ A;  1IM2 A;  5DNY A;  4QNM A;  2C96 A;  3PCA M;  3HU2 A;  3PNV A;  2DWM A;  4GIP A;  3AL0 C;  2PCD A;  1N33 M;  4PDG A;  3U6L A;  3U6M A;  4K0K M;  1YKK B;  2FOI C;  2UU9 M;  4R3D A;  3FUW A;  5KPZ A;  3PCC A;  2BV0 A;  5EQT A;  1QAM A;  3KVW A;  4L16 A;  4LJ7 A;  5ITQ A;  2DZN B;  1IY0 A;  2Z7J A;  4QOS A;  4G4O A;  5KQD A;  1L2B A;  3FUU A;  1YKM B;  4X65 M;  1IN5 A;  3CTW B;  2XH9 A;  3PCL M;  4WHS B;  3SMP A;  1OFI A;  3CF2 A;  3MHV C;  2ERC A;  2KZU A;  4R7G A;  1EO2 B;  2R62 A;  3PCF A;  4ITQ A;  3UK6 A;  2R45 A;  3K92 A;  3CF0 A;  3SAV A;  4MH0 E;  3FUT A;  1N32 M;  3R9X B;  3NBI A;  3UMM A;  4KLN A;  3T38 A;  2QBY A;  1QAQ A;  1LV7 A;  4KOD A;  3W0L B;  4B3S M;  2VQE M;  4P16 A;  4WHQ B;  2YNM D;  1J5E M;  2XSU A;  1IBK M;  4M0D A;  3KS8 A;  2KZS A;  2BUY A;  4B3T M;  4OX9 M;  3O5U A;  3AFH A;  2L6O A;  2C98 A;  4FW9 A;  1FJG M;  3PCH M;  3LQR A;  1NY5 A;  3GQ4 A;  2Y0Q A;  4KHP M;  3KP0 E;  2F5N A;  1DGG A;  4HLQ A;  1EOB B;  4WHO D;  5EXS A;  5ITT A;  2QP9 X;  5IZ7 D;  3E9S A;  1G4A E;  1TMX A;  1ORY B;  2W82 A;  2F5Q A;  5EP4 A;  3VK8 A;  4B7F A;  3HJ8 A;  2OQ4 A;  1YKL A;  1XC8 A;  4OVZ A;  4IJE A;  3TE6 A;  3MI5 A;  3UZU A;  2Z3X A;  3LKT A;  4WHP A;  3HKP A;  3KP1 E;  3FTC A;  1IXS B;  3GP1 A;  3K1J A;  4IBB A;  4QHS A;  4QHT A;  3D8B A;  2LH0 A;  4RF1 A;  3TWK A;  3GLF A;  4W5W A;  1GVN A;  3QWL A;  3I51 A;  3VKG A;  5EXX A;  1HNW M;  3U6C A;  4DV6 M;  3TWL A;  4DV2 M;  4B3R M;  2Y20 A;  4JXJ A;  3T67 M;  2I7P A;  4MM3 B;  5KPR A;  1IXZ A;  3PCJ M;  1PJJ A;  4PT5 A;  4JI8 M;  1YKO A;  2RKO A;  4LFC M;  3ZC7 B;  1EO9 A;  2XF3 A;  2C5R A;  3L26 A;  3TWM A;  4GC9 A;  2NQ8 C;  1YSY A;  2ZM6 M;  4FWG A;  2ZAO A;  3I4Y A;  1QAO A;  4LGY A;  4PD2 A;  5IWA M;  2EA0 A;  3GRV A;  4GKK M;  3R8F A;  2YR0 A;  3HHX A;  2BUW B;  3HWS A;  2BUX A;  2R4E A;  4LRS A;  1K82 A;  1X37 A;  4JI2 M;  3KFU G;  3PCD A;  3J7A S;  4MGK E;  5EXP A;  1G3I A;  2G5G X;  3ZH9 B;  2L7I A;  3U6P A;  3LVW A;  4M9X A;  4IBG A;  3ILK A;  8CAT A;  1W5S A;  5KQ8 A;  2Z4S A;  2DWL A;  3PCD M;  4LF9 M;  1TH2 A;  2D7H A;  3J81 S;  3PCN M;  3KXE C;  3GLG B;  3SAT A;  3MI1 A;  3L28 A;  1NVM A;  1HNX M;  2J7N A;  4JI4 M;  1N77 A;  4DV1 M;  3CF6 E;  2BOY A;  4D80 A;  2XGN A;  2HKJ A;  1K3W A;  2QEN A;  5DYG A;  4DR1 M;  1IN4 A;  1YE9 A;  3L29 A;  4DR4 M;  5ITR A;  3SAU A;  3PNY A;  4FCW A;  4JI3 M;  1IN6 A;  4QOZ C;  4XBO A;  3GO8 A;  3LMX M;  1EOC A;  2XSV A;  4LJ5 A;  3U61 B;  3GQ5 A;  2BUV A;  2BUU B;  3U6E A;  5E26 A;  1E94 E;  1SXJ B;  5EP3 A;  1Q3B A;  1XHB A;  1IBL M;  5FTL A;  3LXV M;  5E6J A;  2VII A;  3PCK A;  4II7 A;  4M9Z A;  1R2Y A;  1QZM A;  3UJN A;  4LCB A;  1I94 M;  1XWI A;  1XMQ M;  3EIE A;  3KSJ A;  1DO2 A;  1HQY E;  1DLQ A;  4IBC A;  1GL7 A;  1ZAE A;  4AI6 A;  3AOE A;  1L2C A;  2UXB M;  3FTF A;  4CIS A;  2K47 A;  4BB9 A;  3HGI A;  1EOA A;  1HT2 E;  3GRY A;  3HJS A;  3BOS A;  5LMN M;  1TH4 A;  1HT1 E;  3E4R A;  2C99 A;  1IY1 A;  3DA1 A;  1R6B X;  2BUM B;  4WHO A;  3U60 A;  4LG2 A;  2KW0 A;  4JI1 M;  4BBA A;  3MV4 A;  2Z4R A;  1QVR A;  2F5S A;  3GLI A;  1HQC A;  1NSF A;  4L78 A;  3GRR A;  4AQY M;  4NSO B;  4PDI A;  4X62 M;  1NNU C;  3AJI B;  4ILV A;  2C9O A;  2BUM A;  1XNQ M;  2I7N A;  1YKK A;  4RF0 A;  1YKP B;  2DXI A;  2PCD M;  2UUC M;  4JI7 M;  3PCC M;  5IRE B;  3ZCB B;  4DR3 M;  1QAN A;  3M6A A;  1VDD A;  4MGH A;  4DR6 M;  1YKN B;  1G59 A;  1YKM A;  5EJC A;  4LJ4 A;  4Z8X A;  4WHR B;  3U6D A;  4LJ9 A;  3KOW E;  3SFZ A;  1EO2 A;  1SXJ D;  3O6R A;  2F5O A;  3GPU A;  3I4V A;  3U5Z B;  4YY3 M;  3PCF M;  1QQW A;  2V1C A;  1DGF A;  3L2A A;  2H1R A;  4FVM A;  3HHY A;  1R2Z A;  4DUZ M;  1ZQ9 A;  2KRK A;  4D81 A;  2F4V M;  4FWH A;  4AKI A;  5TD3 A;  3K8Z A;  3PCI A;  2YQZ A;  2BUR B;  3PCE A;  4WHQ A;  3HHZ A;  3RGS A;  4CGY B;  2DVW B;  1NHG C;  3J7B A;  3KDS E;  3K2L A;  4FCT A;  4CHT B;  5ITX E;  3IG5 A;  1EOB A;  4DV4 M;  4FWD A;  2CHQ A;  4KO8 A;  1JQJ C;  2HCB A;  5KO3 A;  2VQF M;  5ITX A;  4X66 M;  2LWX A;  2CUZ A;  3VLF B;  2AHM A;  3U6O A;  1NJF A;  5FTM A;  3TL4 X;  4B08 A;  3HU3 A;  3QAU A;  3MI5 M;  3AV0 A;  3MJ5 A;  3LKT M;  1XXH B;  4AG5 A;  4ZPX A;  4LJ6 A;  4DV3 M;  4IBI A;  3KOX E;  3PCG A;  2BUQ B;  3GPX A;  1OFH A;  2QPA A;  3MFL A;  3DOA A;  4FD2 A;  4IJF A;  3A42 A;  1MU5 A;  4GHA A;  5C1B A;  2KA6 B;  2X49 A;  5EP1 A;  4G4R A;  1KYI A;  4NXM M;  1N36 M;  4MGY E;  3MV6 A;  2CFO A;  4WUR A;  1PJI A;  2BUT B;  1IBM M;  4D82 A;  4LF8 M;  3VKH A;  3FUV A;  4LJA A;  4M9S A;  1J09 A;  2X8A A;  3RE8 A;  4B7G A;  1NHW C;  3VFD A;  4NRW A;  2FNA A;  3GLH B;  2BUW A;  1Q3C A;  2DWN A;  2E5L M;  2ZBK B;  1OJL A;  2D7E A;  2DWZ B;  2BJV A;  3T1H M;  1TGU A;  4LGM A;  3RGP A;  2KEB A;  1D2N A;  2P5T A;  4X64 M;  4LF6 M;  4JI0 M;  4JN6 A;  4I81 A;  4JI6 M;  3PCM A;  3KOY E;  3TH1 A;  3T15 A;  4A3V B;  4Z6Y A;  4L4U A;  4IBE A;  4DR7 M;  1Z59 A;  4NXN M;  3GLG A;  1GL6 A;  4WW0 A;  3PCB A;  1MX0 A;  1TH3 A;  3MI1 M;  3B9P A;  3C58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...