3I56F

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
119
structure length
119
Chain Sequence
PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome/antibiotic
total genus 29
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3i56F00
2LBWA 1CN7A 3LWPC 3JAMM 3CCEF 3JCMM 2QA4F 3HAXD 3CCLF 1KD1H 1YI2F 3CD6F 2OZBA 1W42A 2JNBA 3OW2F 1KC8H 3CC7F 2QEXF 1VQ6F 1X52A 1X7OA 1YITF 1W3EX 4C4WC 5IT9M 2QI2A 5DCVA 3RA6A 3MCAB 3RA5A 1GZ0A 1M90H 3ON1A 2CZWA 3LWRC 1GO1A 2KG4A 3CG6A 3NVKE 1QVFF 4BW0B 1Q86H 3N4ZA 3FFMA 5FJ4C 1NJIH 3LFOA 1RA4A 1ZWZA 1VQMF 1W40A 4X3MA 1KQSF 1Q82H 3J81M 2OTJF 2VGNA 3I56F 1VQNF 5G4VC 5GANK 5GAPK 3J7AR 1E7KA 5FLXM 3G71F 1VQ7F 3CCSF 1N8RH 2HVYD 3V7EA 5G4UC 3CCJF 2OTLF 3CCVF 1YJWF 1M1KH 2LBXA 1YHQF 1GO0A 3PAFA 1S72F 1H7MA 3CPWF 1IPAA 1Q81H 2FC3A 3AGKA 1CK2A 1K73H 5GINC 3CXCF 2VGMA 2OHWA 3OBYA 3CCMF 1SDSA 1W2BF 3G6EF 3N4YA 1YJ9F 3LWQC 1VQPF 2AIFA 3VMFB 3WXMB 5GIOC 1DT9A 3J80M 1YIJF 1PXWA 3CMEF 4TZZA 3CCQF 4LCKA 5EWRA 1YJNF 3LWOC 3CC2F 3E1YA 5A2QM 3IR9A 3OBWA 1Q7YH 1VQ8F 3CC4F 3PLAC 2BO1A 2WALA 1JJ2F 1RLGA 3NMUC 3CCRF 1QVGF 2I6DA 3HJWC 1K9MH 1XBIA 3V7QA 2KTUA 5GIPC 3G4SF 4BY9D 1T0KB 3VI6A 3NK7A 1NMUB 3E20B 4NUTA 1K8AH 1VQKF 3NK6A 3CPQA 3NVIB 1VQ5F 2ALEA 1X7PA 5EO3A 4X3LA 1VQLF 3GYQA 3SIVA 3SIUA 3O85A 3CCUF 1VQOF 1VQ9F 3LWVC 1W41A 1VQ4F 3CMAF 3I55F 2KTVA
chains in the Genus database with same CATH superfamily
2IAFA 3LMEA 2LBWA 3CYPB 3JAMM 3JCMM 2QA4F 5CA0A 3F6MA 3F0FA 1YI2F 3P0ZA 1W5FA 4O4JA 4KWEA 3N2KB 2HX0A 3JVHA 3ZP4A 1TVKA 3S0YA 5JVDA 5ITZA 3MCQA 3KHNA 4IHJB 3MDOA 5J2UA 4E6EA 2CWJA 2ZODA 3KJJA 4C4WC 4RHAA 5KX5B 5MN6A 4LNUB 1GX1A 4X1YA 5LP6C 5CA0B 3VCZA 5KMGA 3LWRC 2UYKA 2KG4A 3NVKE 4O4JB 3RYHA 4B45A 1TVKB 3K14A 3VOBA 5JVDB 5ITZB 5JCOC 5CA1A 1VQMF 4X3MA 3JARA 5J2UB 2H8EA 3ELCA 1VHAA 3TD4A 3R0PA 2PMPA 3J7AR 4ERHA 5FLXM 3G71F 3C9RA 3M84A 4X1YB 2VAMA 3CCVF 3F0GA 1YJWF 1RQ7A 4O2BA 4EB6A 5KMGB 3L7QA 1IPAA 4BVRA 1Q81H 2RHJA 3RYHB 4C8GA 5GINC 4DXDA 1JN1A 2VGMA 3S02A 3CCMF 1FNJA 3BYQA 1W2BF 4BVQA 5CA1B 5CB4A 1IV1A 3JARB 1W57A 3J80M 3TD5A 3B6NA 2ZVYA 3QTYA 5EZYA 3D00A 3CMEF 4LCKA 5B8FA 3CC2F 5A2QM 3OBWA 3C9UA 3WJPA 4YJ3A 1PF5A 3CC4F 2BO1A 4O2BB 4EB6B 4ZK7A 1ODEA 1DBFA 3VIUA 1K9MH 2K1SA 5EYPA 3CB2A 3ERNA 3FD5A 4ZOLA 5CB4B 5IJ0A 1T0KB 4NUTA 1KNJA 3VYUC 5EZYB 2VXYA 3NVIB 1VQ5F 1FSZA 1X7PA 4YJ3B 4X3LA 5LYJA 1IV2A 3KIZA 4TUYA 1CLIA 2PHNA 3CMAF 5EIBC 2KTVA 3JAKA 5EYPB 2AMTA 3HAXD 2H6LA 4ZOLB 5IJ0B 3F0EA 3CD6F 2H8CA 1W42A 2AIZP 1J7HA 1VQ6F 3S0HA 1X7OA 3WGLA 2UYNA 4BT2A 5IYZA 5LYJB 1U40A 3ZO8A 2Z01A 2QI2A 2UZHA 4TUYB 1W5EA 2L26A 3JAKB 3FBAA 3VOAA 3RYIA 4ZHYB 1M90H 3ON1A 2CZWA 5BMVA 1GO1A 2Q1YA 3CG6A 1W581 2GVIA 2DYYA 4U39A 3WGNA 2CSLA 2Z1EA 3F0DA 1XRGA 5HY0A 1Q82H 3J81M 2UYNB 1YGYA 1H48A 1JFFA 2DT4A 4YJ2A 5IYZB 1VQNF 2ZOVA 4NWOB 3WGKA 3VYSC 5GAPK 1QD9A 3VTIC 5MN5A 3CCJF 4O2AA 2OTLF 2CVLA 3RYIB 5J2TA 1YHQF 1GO0A 5BMVB 1Z5VA 2HRYA 1H7MA 3E22A 5JQGA 3MBMA 3S0WA 3AGKA 1JY8A 1IV3A 3ESJA 3S06A 1SDSA 3UT5A 4O4IA 3N4YA 1YJ9F 3LWQC 2AIFA 4I50A 4X1KA 3I3FA 2BTUA 2IG8A 4YJ2B 1JFFB 1DT9A 1PXWA 4F6RA 5EWRA 3LWOC 5HXUA 3E1YA 3C9TA 1VQ8F 3IEWA 2VAPA 3PLAC 5J2TB 1QU9A 3E22B 3RE3A 5JQGB 1W59A 5GONA 1XBIA 1SZQA 3UT5B 3GTZA 4O4IB 5GIPC 3G4SF 3WGMA 3RYFA 4I50B 4X1KB 2CW4A 4F6RB 3NK6A 4EI7A 3ZP7A 2RHOA 1Q8RA 3D54A 2ALEA 1VQLF 4O4HA 3CCUF 1VQOF 2BTQB 1W41A 1W5BA 2IQQA 2R6R1 3IEQA 4ZHWA 1NQ3A 3TD3A 1OAPA 1XV2A 2EWCA 2UYJA 5GONB 4B5CA 3LWPC 2UYPA 1COMA 2W8BC 3HKEA 3CCLF 1KD1H 5EAZA 2OZBA 3RYFB 4BT4A 2ZAUA 1X25A 1TUBA 4C8EA 5EIBD 3VO8A 4O4LA 2QEXF 3K0TA 2RHHA 3HKCA 4G4XA 1U3PA 4O4HB 3MQWA 1U3LA 5LXTA 1W3EX 3LDTA 2FGYA 5C8YA 3IMPA 4C8IA 2HS4A 3QHDA 1OFUA 3MCAB 5MN4A 2RB9A 4FFBA 5FNVA 3HKEB 1UI9A 2N48A 2R751 1QVFF 1TUBB 3JATA 1Q86H 1RQ2A 5FJ4C 1NJIH 3LFOA 1RA4A 4TV9A 3HKCB 5LP6A 3S03A 2MQEA 2Z1UA 3I56F 3CYQA 5LXTB 5AVMA 5G4VC 5C8YB 5GANK 3V7EA 1N8RH 2HVYD 2F9ZC 4TV8A 4X20A 4FFBB 1M1KH 5HWEA 2LBXA 5FNVB 3PAFA 5LA6A 1UFYA 2VAWA 5JCOA 2KGWA 5HY1A 1CK2A 2GZLA 3P4EA 3V3TA 3JATB 3FPIA 3JAWA 3ZOPA 3JASA 3U0OA 3VMFB 5LP6B 3WXMB 3HWUA 1YIJF 4TZZA 2HP0A 1VK3A 5IJ9A 1JD1A 4HNAA 4X20B 4TV8B 2NMUA 5HP8A 4C81A 2WALA 5LA6B 1JJ2F 3NMUC 2ZVZA 2I6DA 2LBTA 4EI8A 5EB1B 3HJWC 3JAWB 2CHSA 3HKBA 5LOVA 4BVSA 5HXZA 4G4ZA 3RYCA 2I6RA 4BY9D 3VI6A 5HY4A 4BT6A 1NMUB 3OONA 3JASB 4ZHQA 3WJQA 4RQOA 1SA0A 3HKDA 4BT5A 3WPXA 1U43A 2Q1XA 2HP0B 2GLZA 5IJ9B 4HNAB 3SIUA 4I55A 3O85A 3M1XA 1VQ9F 4O2AB 2RHLA 3LWVC 1KNKA 4NQ3A 1VQ4F 5JH7A 1CN7A 3HKBB 5LOVB 3CCEF 3QUWA 3RYCB 4R40B 4ZHQB 2JNBA 3OW2F 3C9SA 3K12A 3IKFA 1KC8H 2YXZA 1SA0B 3HKDB 2P6YA 4C82A 3KE1A 3CC7F 4I4TA 1X52A 1QAHA 1RLUA 1YQNA 1W5AA 4I55B 2Z1FA 1YITF 4PWTA 3Q8HA 5IT9M 2HP3A 2HRUA 3M4SA 1VQVA 3RA6A 3C8LA 5DCVA 3WPWA 5JH7B 3RA5A 1GZ0A 2LCAA 3HTNA 4ZI7A 3I7TA 4BW0B 3P10A 3D01A 3DC2A 1XHOA 1IV4A 1T0AA 4BVTA 3N4ZA 4I4TB 3FFMA 2Z1TA 3FD6A 1ZWZA 1W40A 1KQSF 2HS3A 2OTJF 3WJRA 2VGNA 1FFXA 4X1IA 1R1MA 3JALA 4EI9A 4G88A 4B62A 2OTMA 2G9IA 1E7KA 1VQ7F 5G4UC 3VYTC 3CCSF 3WGJA 3T80A 4G4YA 4G4WA 3KJKA 4M8IA 1S72F 4ZI7B 3CPWF 2FC3A 5EB0A 4DRXA 4WBNA 1K73H 2BTOA 4B46A 3CXCF 2OHWA 3OBYA 3K2XA 3G6EF 4O4LB 1W55A 1VQPF 3N2GA 2QTPA 1FFXB 5HY2A 5GIOC 4X1IB 3JALB 3CCQF 1YJNF 3IR9A 1Q7YH 4BT7A 2YYEA 4U3JA 2B33A 1RLGA 3CCRF 1FNKA 4WBNB 4DRXB 1QVGF 4IIJA 3V7QA 3V4DA 1ONIA 2CHTA 2KTUA 3NK7A 3DDNA 3LYBA 3E20B 3N2GB 3EORA 1K8AH 2V9YA 3IKEA 4G4VA 3N2KA 4TV9B 4ZHVA 1VQKF 4XCQA 3CPQA 2ZF8A 3GHZA 5EO3A 3SIVA 3GYQA 4IHJA 5HP7A 4BT3A 4U3JB 1Z5WA 2HQSC 1H47A 3I55F 5KX5A 1VH8A 4LNUA 2HS0A 4IIJB
chains in the Genus database with same CATH topology
2LBWA 1CN7A 3LWPC 3JAMM 3CCEF 3JCMM 2QA4F 3HAXD 3CCLF 1KD1H 1YI2F 3CD6F 2OZBA 1W42A 2JNBA 3OW2F 1KC8H 3CC7F 2QEXF 1VQ6F 1X52A 1X7OA 1YITF 1W3EX 4C4WC 5IT9M 2FGYA 2QI2A 5DCVA 3RA6A 3MCAB 3RA5A 1GZ0A 1M90H 3ON1A 2CZWA 3LWRC 1GO1A 2KG4A 3CG6A 3NVKE 1QVFF 4BW0B 1Q86H 4BVTA 3N4ZA 3FFMA 5FJ4C 1NJIH 3LFOA 1RA4A 1ZWZA 1VQMF 1W40A 4X3MA 5HY0A 1Q82H 3J81M 1KQSF 2OTJF 2VGNA 3I56F 1VQNF 4EI9A 5G4VC 5GANK 5GAPK 3J7AR 1E7KA 5FLXM 3G71F 1VQ7F 3CCSF 1N8RH 2HVYD 3V7EA 5G4UC 3CCJF 2F9ZC 2OTLF 3CCVF 1YJWF 1M1KH 5HWEA 2LBXA 1YHQF 1GO0A 3PAFA 1S72F 1H7MA 3CPWF 1IPAA 4BVRA 1Q81H 5HY1A 2FC3A 3AGKA 1CK2A 3V3TA 1K73H 5GINC 3CXCF 2VGMA 2OHWA 3OBYA 3CCMF 1SDSA 1W2BF 4BVQA 3G6EF 3N4YA 1YJ9F 3LWQC 1VQPF 2AIFA 3VMFB 3WXMB 5HY2A 5GIOC 1DT9A 3J80M 1YIJF 1PXWA 3CMEF 4TZZA 3D00A 3CCQF 4LCKA 5EWRA 1YJNF 3LWOC 5HXUA 3E1YA 5A2QM 3CC2F 3IR9A 3OBWA 1Q7YH 1VQ8F 3CC4F 3PLAC 2BO1A 2WALA 1JJ2F 1RLGA 3NMUC 3CCRF 1QVGF 2I6DA 4EI8A 3HJWC 1K9MH 1XBIA 3V7QA 4BVSA 5HXZA 2KTUA 5GIPC 3G4SF 4BY9D 1T0KB 3VI6A 3NK7A 5HY4A 1NMUB 3E20B 4NUTA 1K8AH 1VQKF 3NK6A 4EI7A 4XCQA 3CPQA 2GLZA 3NVIB 1VQ5F 2ALEA 1X7PA 5EO3A 4X3LA 1VQLF 3GYQA 3SIVA 3SIUA 3O85A 3CCUF 1VQOF 1VQ9F 3LWVC 1W41A 4NQ3A 1VQ4F 3CMAF 3I55F 2KTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LBW A;  1CN7 A;  3LWP C;  3JAM M;  3CCE F;  3JCM M;  2QA4 F;  3HAX D;  3CCL F;  1KD1 H;  1YI2 F;  3CD6 F;  2OZB A;  1W42 A;  2JNB A;  3OW2 F;  1KC8 H;  3CC7 F;  2QEX F;  1VQ6 F;  1X52 A;  1X7O A;  1YIT F;  1W3E X;  4C4W C;  5IT9 M;  2QI2 A;  5DCV A;  3RA6 A;  3MCA B;  3RA5 A;  1GZ0 A;  1M90 H;  3ON1 A;  2CZW A;  3LWR C;  1GO1 A;  2KG4 A;  3CG6 A;  3NVK E;  1QVF F;  4BW0 B;  1Q86 H;  3N4Z A;  3FFM A;  5FJ4 C;  1NJI H;  3LFO A;  1RA4 A;  1ZWZ A;  1VQM F;  1W40 A;  4X3M A;  1KQS F;  1Q82 H;  3J81 M;  2OTJ F;  2VGN A;  3I56 F;  1VQN F;  5G4V C;  5GAN K;  5GAP K;  3J7A R;  1E7K A;  5FLX M;  3G71 F;  1VQ7 F;  3CCS F;  1N8R H;  2HVY D;  3V7E A;  5G4U C;  3CCJ F;  2OTL F;  3CCV F;  1YJW F;  1M1K H;  2LBX A;  1YHQ F;  1GO0 A;  3PAF A;  1S72 F;  1H7M A;  3CPW F;  1IPA A;  1Q81 H;  2FC3 A;  3AGK A;  1CK2 A;  1K73 H;  5GIN C;  3CXC F;  2VGM A;  2OHW A;  3OBY A;  3CCM F;  1SDS A;  1W2B F;  3G6E F;  3N4Y A;  1YJ9 F;  3LWQ C;  1VQP F;  2AIF A;  3VMF B;  3WXM B;  5GIO C;  1DT9 A;  3J80 M;  1YIJ F;  1PXW A;  3CME F;  4TZZ A;  3CCQ F;  4LCK A;  5EWR A;  1YJN F;  3LWO C;  3CC2 F;  3E1Y A;  5A2Q M;  3IR9 A;  3OBW A;  1Q7Y H;  1VQ8 F;  3CC4 F;  3PLA C;  2BO1 A;  2WAL A;  1JJ2 F;  1RLG A;  3NMU C;  3CCR F;  1QVG F;  2I6D A;  3HJW C;  1K9M H;  1XBI A;  3V7Q A;  2KTU A;  5GIP C;  3G4S F;  4BY9 D;  1T0K B;  3VI6 A;  3NK7 A;  1NMU B;  3E20 B;  4NUT A;  1K8A H;  1VQK F;  3NK6 A;  3CPQ A;  3NVI B;  1VQ5 F;  2ALE A;  1X7P A;  5EO3 A;  4X3L A;  1VQL F;  3GYQ A;  3SIV A;  3SIU A;  3O85 A;  3CCU F;  1VQO F;  1VQ9 F;  3LWV C;  1W41 A;  1VQ4 F;  3CMA F;  3I55 F;  2KTV A; 
#chains in the Genus database with same CATH topology
 2IAF A;  3LME A;  2LBW A;  3CYP B;  3JAM M;  3JCM M;  2QA4 F;  5CA0 A;  3F6M A;  3F0F A;  1YI2 F;  3P0Z A;  1W5F A;  4O4J A;  4KWE A;  3N2K B;  2HX0 A;  3JVH A;  3ZP4 A;  1TVK A;  3S0Y A;  5JVD A;  5ITZ A;  3MCQ A;  3KHN A;  4IHJ B;  3MDO A;  5J2U A;  4E6E A;  2CWJ A;  2ZOD A;  3KJJ A;  4C4W C;  4RHA A;  5KX5 B;  5MN6 A;  4LNU B;  1GX1 A;  4X1Y A;  5LP6 C;  5CA0 B;  3VCZ A;  5KMG A;  3LWR C;  2UYK A;  2KG4 A;  3NVK E;  4O4J B;  3RYH A;  4B45 A;  1TVK B;  3K14 A;  3VOB A;  5JVD B;  5ITZ B;  5JCO C;  5CA1 A;  1VQM F;  4X3M A;  3JAR A;  5J2U B;  2H8E A;  3ELC A;  1VHA A;  3TD4 A;  3R0P A;  2PMP A;  3J7A R;  4ERH A;  5FLX M;  3G71 F;  3C9R A;  3M84 A;  4X1Y B;  2VAM A;  3CCV F;  3F0G A;  1YJW F;  1RQ7 A;  4O2B A;  4EB6 A;  5KMG B;  3L7Q A;  1IPA A;  4BVR A;  1Q81 H;  2RHJ A;  3RYH B;  4C8G A;  5GIN C;  4DXD A;  1JN1 A;  2VGM A;  3S02 A;  3CCM F;  1FNJ A;  3BYQ A;  1W2B F;  4BVQ A;  5CA1 B;  5CB4 A;  1IV1 A;  3JAR B;  1W57 A;  3J80 M;  3TD5 A;  3B6N A;  2ZVY A;  3QTY A;  5EZY A;  3D00 A;  3CME F;  4LCK A;  5B8F A;  3CC2 F;  5A2Q M;  3OBW A;  3C9U A;  3WJP A;  4YJ3 A;  1PF5 A;  3CC4 F;  2BO1 A;  4O2B B;  4EB6 B;  4ZK7 A;  1ODE A;  1DBF A;  3VIU A;  1K9M H;  2K1S A;  5EYP A;  3CB2 A;  3ERN A;  3FD5 A;  4ZOL A;  5CB4 B;  5IJ0 A;  1T0K B;  4NUT A;  1KNJ A;  3VYU C;  5EZY B;  2VXY A;  3NVI B;  1VQ5 F;  1FSZ A;  1X7P A;  4YJ3 B;  4X3L A;  5LYJ A;  1IV2 A;  3KIZ A;  4TUY A;  1CLI A;  2PHN A;  3CMA F;  5EIB C;  2KTV A;  3JAK A;  5EYP B;  2AMT A;  3HAX D;  2H6L A;  4ZOL B;  5IJ0 B;  3F0E A;  3CD6 F;  2H8C A;  1W42 A;  2AIZ P;  1J7H A;  1VQ6 F;  3S0H A;  1X7O A;  3WGL A;  2UYN A;  4BT2 A;  5IYZ A;  5LYJ B;  1U40 A;  3ZO8 A;  2Z01 A;  2QI2 A;  2UZH A;  4TUY B;  1W5E A;  2L26 A;  3JAK B;  3FBA A;  3VOA A;  3RYI A;  4ZHY B;  1M90 H;  3ON1 A;  2CZW A;  5BMV A;  1GO1 A;  2Q1Y A;  3CG6 A;  1W58 1;  2GVI A;  2DYY A;  4U39 A;  3WGN A;  2CSL A;  2Z1E A;  3F0D A;  1XRG A;  5HY0 A;  1Q82 H;  3J81 M;  2UYN B;  1YGY A;  1H48 A;  1JFF A;  2DT4 A;  4YJ2 A;  5IYZ B;  1VQN F;  2ZOV A;  4NWO B;  3WGK A;  3VYS C;  5GAP K;  1QD9 A;  3VTI C;  5MN5 A;  3CCJ F;  4O2A A;  2OTL F;  2CVL A;  3RYI B;  5J2T A;  1YHQ F;  1GO0 A;  5BMV B;  1Z5V A;  2HRY A;  1H7M A;  3E22 A;  5JQG A;  3MBM A;  3S0W A;  3AGK A;  1JY8 A;  1IV3 A;  3ESJ A;  3S06 A;  1SDS A;  3UT5 A;  4O4I A;  3N4Y A;  1YJ9 F;  3LWQ C;  2AIF A;  4I50 A;  4X1K A;  3I3F A;  2BTU A;  2IG8 A;  4YJ2 B;  1JFF B;  1DT9 A;  1PXW A;  4F6R A;  5EWR A;  3LWO C;  5HXU A;  3E1Y A;  3C9T A;  1VQ8 F;  3IEW A;  2VAP A;  3PLA C;  5J2T B;  1QU9 A;  3E22 B;  3RE3 A;  5JQG B;  1W59 A;  5GON A;  1XBI A;  1SZQ A;  3UT5 B;  3GTZ A;  4O4I B;  5GIP C;  3G4S F;  3WGM A;  3RYF A;  4I50 B;  4X1K B;  2CW4 A;  4F6R B;  3NK6 A;  4EI7 A;  3ZP7 A;  2RHO A;  1Q8R A;  3D54 A;  2ALE A;  1VQL F;  4O4H A;  3CCU F;  1VQO F;  2BTQ B;  1W41 A;  1W5B A;  2IQQ A;  2R6R 1;  3IEQ A;  4ZHW A;  1NQ3 A;  3TD3 A;  1OAP A;  1XV2 A;  2EWC A;  2UYJ A;  5GON B;  4B5C A;  3LWP C;  2UYP A;  1COM A;  2W8B C;  3HKE A;  3CCL F;  1KD1 H;  5EAZ A;  2OZB A;  3RYF B;  4BT4 A;  2ZAU A;  1X25 A;  1TUB A;  4C8E A;  5EIB D;  3VO8 A;  4O4L A;  2QEX F;  3K0T A;  2RHH A;  3HKC A;  4G4X A;  1U3P A;  4O4H B;  3MQW A;  1U3L A;  5LXT A;  1W3E X;  3LDT A;  2FGY A;  5C8Y A;  3IMP A;  4C8I A;  2HS4 A;  3QHD A;  1OFU A;  3MCA B;  5MN4 A;  2RB9 A;  4FFB A;  5FNV A;  3HKE B;  1UI9 A;  2N48 A;  2R75 1;  1QVF F;  1TUB B;  3JAT A;  1Q86 H;  1RQ2 A;  5FJ4 C;  1NJI H;  3LFO A;  1RA4 A;  4TV9 A;  3HKC B;  5LP6 A;  3S03 A;  2MQE A;  2Z1U A;  3I56 F;  3CYQ A;  5LXT B;  5AVM A;  5G4V C;  5C8Y B;  5GAN K;  3V7E A;  1N8R H;  2HVY D;  2F9Z C;  4TV8 A;  4X20 A;  4FFB B;  1M1K H;  5HWE A;  2LBX A;  5FNV B;  3PAF A;  5LA6 A;  1UFY A;  2VAW A;  5JCO A;  2KGW A;  5HY1 A;  1CK2 A;  2GZL A;  3P4E A;  3V3T A;  3JAT B;  3FPI A;  3JAW A;  3ZOP A;  3JAS A;  3U0O A;  3VMF B;  5LP6 B;  3WXM B;  3HWU A;  1YIJ F;  4TZZ A;  2HP0 A;  1VK3 A;  5IJ9 A;  1JD1 A;  4HNA A;  4X20 B;  4TV8 B;  2NMU A;  5HP8 A;  4C81 A;  2WAL A;  5LA6 B;  1JJ2 F;  3NMU C;  2ZVZ A;  2I6D A;  2LBT A;  4EI8 A;  5EB1 B;  3HJW C;  3JAW B;  2CHS A;  3HKB A;  5LOV A;  4BVS A;  5HXZ A;  4G4Z A;  3RYC A;  2I6R A;  4BY9 D;  3VI6 A;  5HY4 A;  4BT6 A;  1NMU B;  3OON A;  3JAS B;  4ZHQ A;  3WJQ A;  4RQO A;  1SA0 A;  3HKD A;  4BT5 A;  3WPX A;  1U43 A;  2Q1X A;  2HP0 B;  2GLZ A;  5IJ9 B;  4HNA B;  3SIU A;  4I55 A;  3O85 A;  3M1X A;  1VQ9 F;  4O2A B;  2RHL A;  3LWV C;  1KNK A;  4NQ3 A;  1VQ4 F;  5JH7 A;  1CN7 A;  3HKB B;  5LOV B;  3CCE F;  3QUW A;  3RYC B;  4R40 B;  4ZHQ B;  2JNB A;  3OW2 F;  3C9S A;  3K12 A;  3IKF A;  1KC8 H;  2YXZ A;  1SA0 B;  3HKD B;  2P6Y A;  4C82 A;  3KE1 A;  3CC7 F;  4I4T A;  1X52 A;  1QAH A;  1RLU A;  1YQN A;  1W5A A;  4I55 B;  2Z1F A;  1YIT F;  4PWT A;  3Q8H A;  5IT9 M;  2HP3 A;  2HRU A;  3M4S A;  1VQV A;  3RA6 A;  3C8L A;  5DCV A;  3WPW A;  5JH7 B;  3RA5 A;  1GZ0 A;  2LCA A;  3HTN A;  4ZI7 A;  3I7T A;  4BW0 B;  3P10 A;  3D01 A;  3DC2 A;  1XHO A;  1IV4 A;  1T0A A;  4BVT A;  3N4Z A;  4I4T B;  3FFM A;  2Z1T A;  3FD6 A;  1ZWZ A;  1W40 A;  1KQS F;  2HS3 A;  2OTJ F;  3WJR A;  2VGN A;  1FFX A;  4X1I A;  1R1M A;  3JAL A;  4EI9 A;  4G88 A;  4B62 A;  2OTM A;  2G9I A;  1E7K A;  1VQ7 F;  5G4U C;  3VYT C;  3CCS F;  3WGJ A;  3T80 A;  4G4Y A;  4G4W A;  3KJK A;  4M8I A;  1S72 F;  4ZI7 B;  3CPW F;  2FC3 A;  5EB0 A;  4DRX A;  4WBN A;  1K73 H;  2BTO A;  4B46 A;  3CXC F;  2OHW A;  3OBY A;  3K2X A;  3G6E F;  4O4L B;  1W55 A;  1VQP F;  3N2G A;  2QTP A;  1FFX B;  5HY2 A;  5GIO C;  4X1I B;  3JAL B;  3CCQ F;  1YJN F;  3IR9 A;  1Q7Y H;  4BT7 A;  2YYE A;  4U3J A;  2B33 A;  1RLG A;  3CCR F;  1FNK A;  4WBN B;  4DRX B;  1QVG F;  4IIJ A;  3V7Q A;  3V4D A;  1ONI A;  2CHT A;  2KTU A;  3NK7 A;  3DDN A;  3LYB A;  3E20 B;  3N2G B;  3EOR A;  1K8A H;  2V9Y A;  3IKE A;  4G4V A;  3N2K A;  4TV9 B;  4ZHV A;  1VQK F;  4XCQ A;  3CPQ A;  2ZF8 A;  3GHZ A;  5EO3 A;  3SIV A;  3GYQ A;  4IHJ A;  5HP7 A;  4BT3 A;  4U3J B;  1Z5W A;  2HQS C;  1H47 A;  3I55 F;  5KX5 A;  1VH8 A;  4LNU A;  2HS0 A;  4IIJ B; 
#chains in the Genus database with same CATH homology
 2LBW A;  1CN7 A;  3LWP C;  3JAM M;  3CCE F;  3JCM M;  2QA4 F;  3HAX D;  3CCL F;  1KD1 H;  1YI2 F;  3CD6 F;  2OZB A;  1W42 A;  2JNB A;  3OW2 F;  1KC8 H;  3CC7 F;  2QEX F;  1VQ6 F;  1X52 A;  1X7O A;  1YIT F;  1W3E X;  4C4W C;  5IT9 M;  2FGY A;  2QI2 A;  5DCV A;  3RA6 A;  3MCA B;  3RA5 A;  1GZ0 A;  1M90 H;  3ON1 A;  2CZW A;  3LWR C;  1GO1 A;  2KG4 A;  3CG6 A;  3NVK E;  1QVF F;  4BW0 B;  1Q86 H;  4BVT A;  3N4Z A;  3FFM A;  5FJ4 C;  1NJI H;  3LFO A;  1RA4 A;  1ZWZ A;  1VQM F;  1W40 A;  4X3M A;  5HY0 A;  1Q82 H;  3J81 M;  1KQS F;  2OTJ F;  2VGN A;  3I56 F;  1VQN F;  4EI9 A;  5G4V C;  5GAN K;  5GAP K;  3J7A R;  1E7K A;  5FLX M;  3G71 F;  1VQ7 F;  3CCS F;  1N8R H;  2HVY D;  3V7E A;  5G4U C;  3CCJ F;  2F9Z C;  2OTL F;  3CCV F;  1YJW F;  1M1K H;  5HWE A;  2LBX A;  1YHQ F;  1GO0 A;  3PAF A;  1S72 F;  1H7M A;  3CPW F;  1IPA A;  4BVR A;  1Q81 H;  5HY1 A;  2FC3 A;  3AGK A;  1CK2 A;  3V3T A;  1K73 H;  5GIN C;  3CXC F;  2VGM A;  2OHW A;  3OBY A;  3CCM F;  1SDS A;  1W2B F;  4BVQ A;  3G6E F;  3N4Y A;  1YJ9 F;  3LWQ C;  1VQP F;  2AIF A;  3VMF B;  3WXM B;  5HY2 A;  5GIO C;  1DT9 A;  3J80 M;  1YIJ F;  1PXW A;  3CME F;  4TZZ A;  3D00 A;  3CCQ F;  4LCK A;  5EWR A;  1YJN F;  3LWO C;  5HXU A;  3E1Y A;  5A2Q M;  3CC2 F;  3IR9 A;  3OBW A;  1Q7Y H;  1VQ8 F;  3CC4 F;  3PLA C;  2BO1 A;  2WAL A;  1JJ2 F;  1RLG A;  3NMU C;  3CCR F;  1QVG F;  2I6D A;  4EI8 A;  3HJW C;  1K9M H;  1XBI A;  3V7Q A;  4BVS A;  5HXZ A;  2KTU A;  5GIP C;  3G4S F;  4BY9 D;  1T0K B;  3VI6 A;  3NK7 A;  5HY4 A;  1NMU B;  3E20 B;  4NUT A;  1K8A H;  1VQK F;  3NK6 A;  4EI7 A;  4XCQ A;  3CPQ A;  2GLZ A;  3NVI B;  1VQ5 F;  2ALE A;  1X7P A;  5EO3 A;  4X3L A;  1VQL F;  3GYQ A;  3SIV A;  3SIU A;  3O85 A;  3CCU F;  1VQO F;  1VQ9 F;  3LWV C;  1W41 A;  4NQ3 A;  1VQ4 F;  3CMA F;  3I55 F;  2KTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...