3I56I

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 50S ribosomal protein L2P
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3i56I00
3CCUI 3I56I 2ZJQF 4UY8I 3CCJI 2OTLI 5GAGJ 5GAHJ 1YI2I 1VQ7I 4IOAF 1VQPI 1QA6A 2NXNB 1VQ5I 1HC8A 3CC7I 3CCQI 3J7YJ 5DM6F 2FOWA 3CCRI 2OTJI 1FOXA 2K3FA 2ZJRF 1ACIA 3CD6I 3CC4I 1VQ9I 4V19K 3CJTB 1VQMI 1YHQI 5DM7F 3PIOF 3CCEI 3CCVI 3CCSI 3G6EI 1S72I 1FOYA 3CCLI 1VQLI 3G71I 3CMAI 1FOWA 2ZJPF 3CCMI 1YJWI 2JQ7A 4IO9F 2QA4I 1Y39A 1VQ6I 1YITI 3CF5F 1VQNI 2H8WA 3I55I 2E34A 5GAEJ 4IOCF 3G4SI 3CC2I 5GADJ 3PIPF 2E35A 1MMSA 1YJNI 1YIJI 2E36A 5JVGF 1VQOI 3J7ZI 3CMEI 1VQ4I 3DLLF 1VQKI 1YJ9I 1VQ8I 2QEXI
chains in the Genus database with same CATH superfamily
1LFBA 5E1WA 4YFXF 3JCUC 1OYIA 2LF8A 1FYLA 2YX4A 2CG4A 4EEFG 3S14J 2K7LA 1OFCX 2ZMEB 5M3FJ 2M1BA 2H1KA 2E1NA 3K4BA 2WAQA 4DBQA 1UELB 3CTAA 4H4KC 3CCVI 2EK5A 5EZHA 2VC0A 1Y8RB 3QP6A 2LRDA 3PFYA 3QWLA 2KT0A 3CCYA 2HDDA 4M6XA 5HLTA 5FKLA 2L7MP 3KP5A 1TQMA 3R0AA 1BR1A 1Y6IA 4HV5A 4EJTA 4BXXJ 1Y8QB 3HSFA 3SYTA 4GYGA 3T5XA 4CA0A 3FKIJ 4RBOA 4DZJA 1HW5A 3FXKA 3FMSA 4E7HA 3TEDA 4JX5A 5FKKA 1O3TA 2MLKA 2N8GA 1U0JA 2ZB9A 4X0GA 2CH0A 1REPC 3LNQA 4G7ZF 4GDFA 1FLIA 2XGCA 1JKRC 1D1BA 2MLGA 1U78A 2QQAA 3S2WA 4CO8A 2QLZA 1JUSA 3ASOH 2ZO4A 2XVCA 3FHZA 2DFFA 2HZDA 1E3HA 2X85A 3ZQIA 2VBXA 1VQ5I 2JZYA 1RESA 1TQPA 1LDKB 1ZGAA 3SXYA 3OS1A 3WTUC 2XV4S 3WU0A 3QAHA 4CZZA 3A4CA 3ABUA 1WH5A 3FMRA 2JUCA 3E6DA 3IP4B 3V8JA 2L5QA 4WF2A 3SHFA 3CCMI 1IN5A 4MQ9F 1UFMA 4RM2A 4ZDOA 1UZCA 4IRHA 4PSWA 1MZBA 2DOAA 3G2BA 3KYLA 2ISZA 1TWAJ 1FTZA 5J47A 3KP4A 4I01A 2E2JJ 3KYDB 2MSYA 4YG2F 2V26A 4E7JA 3Q9SA 3IC7A 3QODA 2GOMA 3IH4A 4UUTA 1RPWA 4KIGA 4AD9A 2DMPA 2DQRA 4NB5A 3F21A 1MBGA 3BG7A 2GOXB 1K4SA 3DLAA 3I5UA 3GEZA 3D5RC 2JTVA 3E1SA 4F91B 3FDYA 1QVUA 3OSFA 3G1OA 2JSPA 2Y0SN 1PUEE 2DYRH 4B47A 1PJRA 2M34A 3G1LA 2PN6A 4ENMA 2VUMJ 1BI0A 2VBYA 2VKHA 1XGMA 4D7NA 3OY9A 2R7UA 3C2BA 4II3A 1VQKI 1ORKA 3LSGA 3BR2A 3H5NA 3BPVA 1G59A 3IWZA 1DDNA 4KJZA 5DS9A 1XTAA 2IVMA 4P5OA 2LFBA 5CYVA 3MKYB 2ME0A 2XF7A 3JR9A 3HRUA 3FISA 4ZYAA 3KEYA 4UV9A 3S1MJ 1PVEA 2TDXA 3F8BA 3VWBA 3GFJA 4W1UA 4N9IA 1U9NA 1IZ1A 2CU7A 4Z6YA 1ZLKA 1IUFA 1FYMA 1EJ9A 4II2A 3VYRB 1UAAA 1E0EA 2QBYA 3I58A 1R1UA 3QOPA 4XL9A 4BEHB 1EH7A 3I54A 2VQCA 4N4OB 2XGXA 1A6IA 3I59A 4ZDLA 2Y0SA 2KDZA 4OIOF 2F4IA 1O57A 3CCJI 1JTXA 3T8RA 4DOZA 1PP8F 2Y9YA 3BG3A 4L9VA 2XGDA 3R0JA 1XB4A 3DTKA 2A5WA 1WJEA 1UG2A 1LEAA 3ZCOA 2BXYA 1F5TA 2Y75A 3Q0VA 1BA5A 2FF4A 4KT6A 1OCRH 3HGYA 4UB6C 1X58A 3TDUC 3OYBA 3BG6A 1F43A 2JVGA 2ZJPF 2L7KA 3BJ6A 3BCBA 3GWZA 3H1CA 2HQAA 3I55I 2EZIA 2IP2A 5FROA 4EM1A 3MWMA 2QZ8A 2ZXHA 4LD5A 3DU5A 3JTHA 2VQGA 3C3WA 5CVRA 4ZZDA 5BQTA 3SJMA 3N97A 1U3EM 3H3ZA 1SFXA 2K9QA 1MW7A 5L3DA 2YUSA 2OCCH 2R7OA 5LRSA 2Z5UA 4WXDA 2Y31A 5GTIC 5DCMB 1OCPA 4LLLA 4WXCA 2ISYA 4BS9A 4E70A 1BI1A 3JRAA 4MFDA 4EM2A 2LBFB 4XM3A 4H0EA 3L2RA 5IT9Z 4MO7A 3RJPA 2E35A 5F1JA 3DEUA 2BY3A 5JVGF 1ZK8A 4BJTA 1X1AA 2TRTA 2Z2SB 2P81A 1MBHA 3GTOJ 1ODDA 2AXLA 1K61A 4EM0B 1IUYA 4Y13A 1I1SA 2DA2A 2OBPA 4NDLA 3CMYA 1SC7A 3K4MA 2DU9A 3K9TA 5K7ZA 2LREA 2ETHA 4EV0A 3EPZA 1I1GA 3BG5A 3DV8A 1W4MA 1T6SA 3WGGA 3ZRGA 3MKZA 1VQNI 2IA1A 5L3FA 5DYMA 1FIAA 2LSOA 4M74A 2DFHA 1YS7A 1DP3A 2PI0A 2L9SA 2HKOA 2OCEA 4LIUA 3FKJA 4M3BA 3ABKH 4J00A 3CC7I 4D5FA 3SQNA 3WTWC 3WTXC 2VOPA 4U88A 1J0RA 4B44A 4B48A 3A0HC 3FHNA 1T2KA 5D6FA 2D1VA 3HIFA 2Y0MA 4ZTFA 4KICA 4PGHA 2X1EA 5JI6A 2BYVE 1BIBA 4IVNA 1IC8A 1Q1VA 2G9WA 3FXRA 1Z0XA 4CYDA 1YQAA 2QCOA 5A2QZ 5IPAA 5CQGA 3QOEA 1GVDA 1RR8C 2Z9OA 2O61A 5ERIA 2HTSA 5F64A 3CC2I 4HQMA 1DU6A 2P5LC 1RZ4A 3S17J 1SD6A 3GFMA 3WU2C 2CUJA 2B7EA 3QU3A 4RDUA 1KZHA 4DYRA 1E3OC 3HRSA 4XKWA 4CYCA 1MMDA 4W97A 2EIJH 2JT1A 1XMXA 3K70D 3JRBA 4A93J 4M3FA 1IJWC 2E2HJ 3KP7A 5K5OA 2L01A 4ESFA 5F0CA 1MNDA 1UHWA 4Y3OA 3G3ZA 4KN4X 4BE2A 1J59A 3D1NI 5EGOB 2WAFA 4HF2A 3ERED 4HSRA 3FWEA 5LGNA 4IO9F 1AKHB 1O7FA 1KQ9A 3BTLA 3OIQA 4Y7NJ 5H2FC 3SEQA 4OU0A 1X1PA 2EA4A 3K0LA 2F6CA 1IO2A 1YO5C 1EV7A 2RV8A 3MKWB 3JAMZ 1WJCA 1USTA 2NOGA 1WZ2A 3KIOA 3M9AA 2JA8J 3MQ0A 2WADA 4A5MA 4KIBA 1XG1A 5E20A 5D5WB 2FBKA 4ABZA 1STZA 5BNGA 1D5VA 5E18F 2EILH 1LE8B 3QYBA 5CVUA 2K85A 4KIFA 2VXZA 3ZQCA 4UNOA 2EH3A 3KE2A 1NH3A 2F5DA 3CZ6A 2E36A 2EV5A 2F48A 4XOPA 1Z91A 1W0TA 1U9OA 3DTIA 4HAMA 4U0WA 1MD0A 1X3UA 3GUDA 1P2FA 1A35A 2E1CA 3HRMA 5C44J 3MD2A 4PJLA 1W7PA 2E5ZA 4P9FA 2YU9J 4G7HF 4XLAA 3E3VA 3IKTA 2FU4A 1FOKA 2EBIA 1LE8A 1FMVA 5M5XJ 4DBRA 1IN8A 2QENA 3G4SI 3PIPF 5JLXA 1YW9A 2HYGD 1AWCA 4RGXA 2LTPA 4AU7A 4XKBA 1OQYA 4YIRX 2ZSIB 3LA2A 3PSFA 4PJNA 1S7EA 3DU6A 4LJZF 3WTZA 9ANTA 2PMHA 1GXQA 3F8CA 4DYCA 1KU9A 2R7RA 2VT3A 4OIPF 1D1CA 2GM4A 2P5VA 2L0KA 4KN7X 5H6RA 2Y9ZA 1LPQA 1KU2A 1K6YA 2D5VA 1IV8A 2HEOA 3PQJA 3DEWA 4XLNF 5EEAA 4E6KG 5KAFC 2FNAA 1HDDC 1UJ8A 2CWEA 2IPQX 2XKOA 2NS8A 1FNNA 5CPRB 3RPQA 1S5LC 2DDBA 1RNLA 2HR3A 3HZJA 3H0DA 4BY1J 2IEKA 3QYEA 4X6AJ 2ZNYA 1I3QJ 3HEFA 4KA4A 1U5TA 3CCRI 2KRCA 1XCVA 4ZYDA 5EGOA 1MBFA 2QQBA 1YHQI 3GTKJ 3CJRB 1FZPB 1WRJA 4A69C 3RZDJ 3FX3A 1AKHA 3HL2A 2CGPA 2EINH 2WB1A 1JJ8C 4E7LA 2K9LA 1YJWI 4FE4A 2CFOA 4NUBA 2VASA 3SZPA 3KZYA 5GPCA 1QPMA 2HNHA 2QYOA 3FF5A 2LKXA 2JJ7A 2NOJB 5LHIA 2Z99A 4XKCA 4MQVA 1O3RA 1LFPA 2R3SA 1HSTA 4C3JJ 1N25A 2MGQA 4OINF 1FMWA 3MCZA 3ZOBA 2M4GA 1WVRA 2VI6A 3F9KA 1MMGA 3DBHB 1Z6TA 3K69A 4BHCA 2W57A 1R5HA 5TJJA 4L0YB 2CS3A 1XX5A 4BQAA 3RYRA 2VN2A 3TDZC 4XMYA 5D8KB 4CCLA 3EUHC 1TC3C 5JVTA 4BYYA 3NWSA 4ZJZA 3DFGA 2QEXI 3IH2A 2F2EA 3QQAA 1ONVA 1B72B 2GXBA 2O3FA 3OYAA 4HLXA 2LKSA 3C18A 2AXTC 3S3OA 4CGZA 4I6ZA 4OMYA 2X4HA 2EB7A 1ZR4A 4GRIA 4E7SA 2H6CA 5K5QA 2P5KA 1IGNA 1ON2A 2O03A 3AG4H 3HM5A 1YYVA 2Q2EB 3AAFA 2MD0A 2GBYA 3FXQA 2ZCWA 3LSPA 3LSRA 2VQHA 2JQ7A 6PAXA 5D6EA 2VBWA 4Q48A 5FD5A 2MC3A 3M1CA 4YIIA 3W6KB 5IYCJ 1LB2A 3HTUA 4PFPA 2MYSA 3H92A 3P9KA 2W24A 2VONA 3H5RA 2LY2A 2DT5A 1HW1A 4IHTA 3DKYA 1FJLA 5CVVA 2R5ZB 1Y1WJ 4O3MA 2V6EA 4CSWA 3IL2A 2ESHA 2XRLA 2ESNA 3CJTB 1W5SA 3KPHA 3BZ6A 3A01B 3ONQA 2R7DA 1HKQA 3G6EI 2A61A 1FOYA 2DT6A 3PM1A 3SFZA 3F23A 1Z67A 3ZMDA 1Z7UA 2PG4A 4MFEA 2VIXA 4V2FA 3SDBA 1EKEA 3ASNH 1X1CA 3DPTA 4A3CJ 4K2EA 3VDXA 3KFWX 5ICGA 2JRTA 2X6WA 3MEXA 3REOA 3T0YA 1ETQA 2COBA 3E97A 1Z05A 4M9ZA 2FJ1A 2KRHA 2EFQA 3HPGA 4XRMA 4PJMA 4PK4A 3E7LA 4HX4A 5CJ9A 1ZLJA 4C3IJ 2VLAA 4A6EA 1T39A 4HRIA 4Q5SF 3LA7A 4IHWA 3VSLA 4PFOA 1VQ9I 5E3OA 2ZC2A 4ANJA 3Q5FA 1ETXA 4MTDA 2UZKA 1R1VA 1MBKA 1XMKA 4M9SA 4R79A 1DPRA 4OOIA 5LRRA 3NAUA 4B3AA 2FX0A 5LEKA 4Z2YA 3OYFA 2BY1A 2H94A 3MKLA 4YRVA 1D1AA 5ICFA 4XQFA 5LEJA 1ZRCA 1TW3A 3MZ8A 5HLHA 1JE8A 5DUIA 2GWRA 1X2NA 1IDYA 4I98B 4F7ZA 2HU9A 4RB1A 4HX8A 4XKVA 3FMQA 4CCMA 2DMQA 3CP2A 4IPAA 1U2WA 1ZH5A 5CVIA 5J1RA 3MAJA 3U21A 1FX7A 4O5VA 1IV6A 1FP1D 2XSDC 1V5EA 2JA2A 4ZYEA 2DA3A 3I53A 4RGSA 4BHBA 4M71A 2DFEA 2UV1A 3G71I 1GUUA 3J81Z 1J75A 1RUNA 2E34A 2FA5A 3HGGA 3F3XA 1JUMA 2P8TA 5LGUA 1Y56A 2WB1N 3DTEA 3CUOA 1MSEC 3R6SA 1ULYA 2W1OA 2WWYA 1C0WA 4KISA 4IQJA 3GTPJ 3DP7A 1UMQA 4AVPA 2XDVA 5IP6A 3N4MA 3IRRA 2PLYA 1ZGWA 2ECBA 2IS2A 3I71A 2LLKA 3OOUA 1CQTA 3DKWA 4RA2A 4ASNA 3CCEI 5J1UA 5L3EA 1TT5B 2DYSH 2I8DA 1V5GA 2WV1A 4I99C 4L5JA 4A0XA 2HKXA 2VL8A 1OYYA 2NNYA 2HYFA 2W84A 1YW8A 1B6AA 3CP8A 1ERDA 3IUOA 3P5JA 2E71A 2CQNA 1JHFA 4LOCA 4E7ZA 3DF8A 2DFIA 3L9FA 2CUFA 4GGGA 4BGDA 1MMNA 2F5EA 2M4KA 1K6OA 1VQMI 4JOMA 2R7QA 3BR0A 4YEJA 4L9JA 3OR2C 1ZG1A 1OMIA 5K7HA 1FBUA 5EJCA 2GQQA 2WTEA 4I0BA 2PBIA 1E17A 4BDYA 3CDHA 3L2WA 2K9SA 2OQRA 4NC8A 3G1MA 2IGMA 3EUAA 3OWTA 4ZH4F 1VQ4I 3BR6A 4JX6A 3WE2A 4RAGA 5M3MJ 4HEA2 3IAM2 5CQEA 3GTLJ 1XN7A 1R6RA 2I5UA 2R0QC 1KYWA 3K70C 1R9TJ 2HVQA 3BPXA 4GFBA 2MA3A 3QPSA 2GLOA 3WG7H 5J1YA 3F8FA 4BNCA 2DLLA 1LKXA 5DCMA 2KJBA 1TZLA 1WWXA 2KKOA 4OAZA 2JA5J 3CMMA 2EJRA 2ZXWH 3FIWA 2RC4A 3TW7A 2VJ4A 4XONA 1ETYA 4XR6A 3H0GJ 2VPRA 5FD6A 3F0CA 3I56I 2ZMEC 1OR7A 2VJJA 5E3LA 2PJRA 1W36D 1TL8A 1YX3A 5DTDA 3GTGJ 4ENKA 4XRSA 2KIFA 4L0ZB 3BTCA 2R7WA 1WJDA 3LL7A 4BH9A 4L9NA 2V9VA 3PQKA 4MTEA 1QVTA 3JAMK 3RPUD 3R4KA 2O0YA 1G2HA 2KL4A 2M8EA 3RZOJ 5H6QA 3H3VK 4DJAA 2QGUA 5IOZA 4XNFA 1X3WB 3TGNA 4FHTA 2O8XA 4F93B 2VB6A 5EF6A 4A3IJ 4KITB 1N75A 3OSGA 1SD7A 2FE3A 5JHFA 3D0SA 2XHKA 3COAC 3UKGA 1HSJA 1E2XA 1T38A 4L5EA 2V7FA 2W7NA 4XLFA 2E7XA 5DEQA 1AHDP 3QP5A 1UHMA 4RM3A 4NNJA 1TWCJ 3CD6I 1DPUA 3HSRA 1R5ID 3WTYC 1G4DA 5KNLA 3BTJA 2CFXA 3FK6A 4FT8A 3H35A 2A05A 3HB9A 5F0FA 4ON0A 4G12A 3PSIA 3SFIA 2K86A 3OYIA 2X51A 2KFDA 4G94A 1JUPA 3OIPA 1RUOA 1H9GA 2HOEA 3M8FA 4CYCB 2ZFWA 2CSOA 3WODF 2I10A 1X4OA 1ZN2A 2IGKA 5GAHJ 1JGSA 2OJED 3LSJA 4NHJA 3MZYA 4M72A 5L3CA 2YU3A 3DEEA 5M5WJ 2H8RA 2HQNA 3CLOA 1R36A 2F5CA 1AOYA 3MMYB 4X1EA 2LK2A 3RQIA 5LHHA 3AFHA 3P9CA 2R5YA 1WCMJ 3JRIA 1QZZA 2QA4I 1BC8C 2NNNA 1YITI 1QHGA 2X6YA 4QTRA 5D4RA 1TQIA 1KQ8A 3ABLH 5F08A 4AYBN 3LFUA 3GX4X 4U0VA 4G6DA 4PZJA 2CMPA 1T0FC 4LB6B 3HJEA 4D5CA 4EATA 2JK3A 2ZJ2A 3JSOA 3H9JA 5BPIA 3BC8A 3WGHA 2L4MA 2XC7A 3I0TA 4LGWA 1B1BA 4HYEA 4MLOA 2XGEA 1W36C 1QQIA 2E19A 4RAYA 3VFZA 4BBRJ 3M8JA 3F72A 4AVZA 4M73A 3IWFA 4FX4A 3ZP5A 2Q2EA 5JLWA 2LMDA 5IT9K 2LDUA 1EA3A 2DW4A 2FNPA 3RSNA 4JX4A 3UR3C 3HHHA 4RMNA 1JXSA 1MNEA 1MSFC 4HOBA 5HOOA 4S05A 3Q0WA 2AO9A 4UB8C 1GLNA 3VPRA 1HW2A 3ZMUA 1LNWA 1TW2A 1R49A 2LVSA 2RREA 3ML6A 1R1TA 2Z33A 3V7CA 3A1YA 2ME6A 2DI3A 2ZXIA 3RQ4A 2HDCA 1MBJA 4PCQA 1ITYA 3TKYA 2VE9A 2L02A 3FM5A 1ETVA 5HLIA 1YOVB 2IGOA 3L09A 4LFUA 1GVJA 1JI8A 3GFLA 1FSHA 2KLOA 4RGUA 4IJAA 1I27A 1F1ZA 1FSEA 3VYSB 1W5CC 3WTVC 4DZPA 2L9RA 3KZIC 1EH6A 2DDAA 1BJZA 1G3YA 2CQXA 4A3EJ 5E8GA 5AIPA 3ZQ7A 2YX7A 3KEQA 2HOTA 2OUMA 3EETA 2HTJA 2K9MA 3TW6A 2VKVA 3CUQB 3OS0A 1YI2I 2W48A 3H5AA 1R7JA 2XUBA 5FRNA 5DV5A 1Z21A 3G73A 3J80K 3RI4A 4QPOA 1BR2A 2KIQA 3FM3A 4XLEA 2VKDA 4P96A 1I6HJ 3KYCB 3WG9A 1VQLI 2NVTJ 1HBXG 4L18B 3OS2A 4R1HA 2JPCA 1POGA 2W25A 2V6CA 4F55A 2Q1ZB 2IS6A 3BP8A 2LC2A 3I4NJ 5GTHC 1V3FA 1XSVA 2DXIA 2IA2A 2BZTA 3V8KA 3KEOA 4I76A 1HA8A 4HNTA 1WPKA 2DOEA 4XLHA 3GW2A 4LK0F 4XIDA 5M5YJ 4UVCA 4JBAA 2E1MB 2HDWA 4N9HA 3TQNA 4A5NA 3GBGA 1N77A 5DM7F 1T33A 4BBSJ 1S29A 5J4YA 2XKPA 4MHGA 2GA1A 2XAGA 2VT2A 2OV7A 4Y17A 1R23A 4ENNA 4FE7A 5FGMA 3M3YJ 4EJUA 1MMSA 1SAXA 3DLLF 2FOKA 2O7OA 3ZN0A 4CDGA 2M3AA 2V9PA 2LH9A 3Q0UA 3LQQA 3PFIA 4B3XA 1B72A 4A2UA 3RCOA 3ZQGA 5GPAA 1OISA 1SVOA 3MN2A 2PJPA 2E1OA 4IHYA 2L2OA 5B1AH 3JW4A 2Q8KA 4HLYA 3S15J 4JK1X 2HOSA 1KGSA 2FEZA 1BL0A 1T08B 4OIRF 1PP7U 3HDDA 3RDIA 1BI3A 2XAFA 4Y33A 2OTJI 1BIAA 2P4WA 3TOAA 2RAEA 2X48A 4C2MJ 2MH9A 2KMUA 1D0YA 3IKVA 2LD5A 2HGCA 2RNJA 2LOOA 5FFXA 3BTIA 4LLGF 2XAQA 1R71A 1M1EB 1P6RA 2BXZA 3J7AO 5FRMA 2M7BA 4CCOA 1MJBA 4JP0A 2QUFA 2P0WA 3J7AY 1Z3YA 2IGNA 3L2CA 1MNMC 2ACJA 1XGSA 4C2UA 2FBIA 2VJIA 3FXOA 4HV6A 3GTMJ 5EZGA 3ZMVA 4LMYA 5J3LA 3LSMA 2K3PA 3GLXA 3LSKA 2FSWA 2FBHA 4IHVA 3BZCA 1SVMA 3LSHA 1ZRDA 2X9DA 4OWRB 1JT0A 3LQRA 1QO0D 3L1PA 4Y52J 4BXFA 3ROUA 2K4JA 2KZVA 2VE8A 4AUXA 3W2AA 5HS8A 5ILUA 1K78B 3S1RJ 5F27A 1UHSA 1LDDA 3KP3A 2V1UA 1P4XA 3HOSA 2DJIA 3K7AJ 4UVAA 1TWFJ 4BU2A 1OCCH 4YIFA 2CW8A 5D8LB 1QZYA 4C2TA 3BZKA 5FFZA 1RIOH 2M8GX 4ZC3A 3A03A 3H9QA 3ZXSA 3IH3A 2LP0A 3U1KA 4BHPA 5C4XJ 4HSTA 4A3DJ 3BJOA 4IEJA 4HF1A 4EGZA 2WAEA 2ADUA 4BXUA 3ECHA 4B4CA 3LFKA 5HVQC 1XPXA 5IYBJ 1KU7A 3T8TA 4LG0A 3QYFA 1R22A 1B8IA 2B0LA 1MMAA 1G8XA 1XGOA 1MH3A 3A0BC 4RS8A 2DA1A 1IN4A 3L2QA 2HQRA 3W3CA 3HOXJ 2VPLA 2JN6A 3DKXA 3BDDA 5FB2A 4V2GA 1Z1DA 1UB9A 1DP7P 2CV1A 2NXNB 4A3MJ 5J6XA 2XAUA 5FLMJ 5DM6F 1WJAA 3V42A 4F92B 3Q9VA 1R00A 2KP6A 1YIOA 4E7IA 1QU3A 4IF4A 3ZMTA 2EQRA 2GA2A 2DA5A 1BR4A 3IHUA 2HXOA 4FASD 4A3KJ 2CW7A 3A02A 3NWTA 4IZZA 2H1LA 2B9SA 2D1HA 1V55H 1ZARA 1T98A 3H3UA 1YJ9I 1U6GA 1NG6A 3FXMA 1AA7A 1MBEA 2CQQA 4ESJA 2E60A 3O8GA 1OYWA 4DGWB 1DUXC 4AM3A 4P9UA 2EWNA 4B1RA 4NC7A 4EJWA 1N78A 4AIDA 1B9NA 1CF7A 3DPUA 5HDGA 4IKFA 2UUZA 3OYNA 3WGIA 3AG1H 2Y48A 2LKPA 1K4TA 1T56A 3HBLA 1TP4A 2ZXJA 1F4KA 2ZSHB 4EGYA 2DN0A 4F52A 4UHTA 5J8CA 3K2AA 2R5YB 1MH4A 3WE3A 3S3MA 1D5YA 2OU2A 3CQZJ 3S3NA 2UXNA 2ZBKA 5E3MA 4I2OA 4KUMA 1K79A 2LY9A 1PUFB 1ZG3A 2XB0X 2R7FA 5LD2C 2XAJA 3BR3A 5B5EC 1K7AA 1J5YA 3TMOA 1O7LA 5LHGA 5E3NA 5D5XB 2OPTA 4A3FJ 2F5VA 2JA6J 3M7GA 1IXCA 1APLC 2X6XA 1UG0A 1IAWA 2PMZA 4HBLA 3I59B 1O3QA 3GF2A 5C4JJ 4Q4ZF 1HOMA 1P92A 2RGVA 3SZGA 1YIJI 4B43A 1WGXA 1NG7A 3P9IA 3QPHA 4RLFA 1ETOA 4A12A 2AS5F 1TLHB 5GAGJ 1ZR2A 2IA0A 4UUSB 2BVMA 3ZN1A 2VJ5A 4LG0B 1OJLA 3LMMA 3GTJJ 1CGPA 1HDPA 2HI3A 1VZ0A 3AL0B 3CCLI 1VQ6I 2KIMA 4D1QA 4ENJA 5HNHA 2XPWA 1MJAA 4G8XA 2LYCA 4G7OF 2MW8A 2IBDA 3EQLF 2KDOA 4OMZA 5IY5H 2IS1A 5KAIC 1MIJA 2OZ6A 3M07A 5KHDA 1DQUA 1ZYRF 2ZJQF 2XAHA 2HPMA 1ZAOA 5KK1A 2K27A 5JR3A 4CXFA 4MIMA 4RB3C 4KT5C 3K10A 5DD8A 2YR2A 2NS7A 1Z3XA 4M3GA 5FKMA 3HOYJ 1A5JA 1YS6A 2FUG2 3E5UA 1YLFA 2HWVA 2D2WA 2XSJC 1D0XA 2ELHA 4AIHA 5CLSA 1HKSA 1XSXA 2MC4A 2Z1DA 1YX5A 4G6TB 2L7FP 1LJ9A 2KRFA 4KDPA 1S3JA 1FBSA 2F5FA 3F8NA 1VI0A 2K40A 1BM9A 3IAS2 2QQ8A 4FX0A 5B1BH 3CCQI 2M7AA 4HDUA 1YFHA 3HTSB 4HZFA 2BGCA 4LK1F 1D8JA 1X1BA 2MABA 3L2UA 1SMTA 3GYHX 2EIKH 3O2PE 2O6GE 1G3WA 3E6MA 2ELJA 2VKEA 2QBYB 1DGWY 2LY1A 4CCKA 3LSIA 1Z77A 1Y0UA 2L7ZA 5ILSA 1ZG5A 1QPIA 2V9KA 2NVQJ 1RKWA 2J5OA 5KVRA 1T0FA 3CO6C 2P7CB 1X19A 2XIGA 3F8MA 1ZRFA 1FPQA 1B9MA 4HNVA 3PUFA 1IXSB 2A6HF 2DBBA 3C2GA 4QLCU 2K3FA 2IRFG 1IRZA 3K4CA 3H36A 5AONA 2DOFA 3OYGA 3IV5A 2BW3B 3CCSI 2H6BA 3HOZJ 2GAUA 4BDZA 3JRHA 2CJJA 4KYWA 1HKTA 2WAQN 3F6VA 1MGTA 5L3BA 4J01A 3U2RA 2WC2A 3CCUI 4AYBA 4QIWN 2DO7A 2OTLI 4L5IA 2Y69H 3BROA 4IOAF 2Q0OA 1QZEA 3M1EA 1GHCA 2A6TA 5J40A 1XGNA 3B02A 4N4NB 3DBRB 1NK2P 3L2VA 2XF6A 5EEGA 1LVKA 3K6GA 2FMLA 1GV5A 2MH2A 4F3QA 4Q47A 2DA6A 1OCZH 2ICWG 4CUGA 4LG3A 1LDJA 3FBNB 4BJ6C 3W6JB 3OR1C 5FLXZ 3L00A 1ETKA 1ZTRA 3BQZA 3GTQJ 1FC3A 2F4OB 4DYQA 4OAYA 2PMUA 3RPUA 5A2QK 4HX7A 4C3HJ 5TRDA 5BMZA 5EEHA 2CO5A 1H9TA 4I7HA 3S1QJ 3ERMA 4MEXF 2DTRA 2OC6A 4XN3A 4BJ5C 3F22A 3OV8A 2W00A 4EQQA 3I4MJ 3ABTA 2VXDA 2PJRB 2QWWA 4BQQA 1W0UA 3IRQA 2IW5A 4RAZA 4M6YA 1VQ8I 2FXAA 1RRJA 1G3TA 4EMSA 5JHUA 3RKQA 1LEBA 5DCFA 1J2XA 3E5XA 2F4MB 4NC6A 2EIMH 1V5FA 2PX9A 1WJFA 3VEPA 4R8HA 4BL0B 5D4SA 3OOPA 4BE0A 4RLQA 4AIJA 1I50J 2X6OA 3VYTB 2D45A 1Y1VJ 4PJJA 4BKXA 2IT0A 1NHAA 3S32A 3SDGA 3BCAA 3EDPA 4IRGA 1BW5A 3A01A 1WQ2A 3HOWJ 1CF7B 4Y4RA 2FQ4A 4IOCF 4L9TA 4J19A 3CO7C 4IHSA 2M0CA 2HVRA 2HYJA 5C3EJ 1UCRA 3HOTA 1V4RA 2XB5A 1L0OC 2OF7A 1J7KA 2IXSA 4OIQF 2QVOA 2VQLA 2W85A 2XROA 3OYJA 4UVBA 2HZTA 3RTRA 2EFWA 2O8KA 4CHUA 2RN7A 4D9JA 5F6FA 3S93A 2BW3A 1FWZA 5B66C 4HW0A 4C30A 2OZUA 2CRGA 1K83J 3BQYA 5HS7A 1QHHD 3H9GA 1SVLA 5B3SH 3K4JA 4Y15A 1TNSA 1IRFA 3GO5A 1XSDA 3RKYA 1LFUP 2BOLA 1GDTA 2VODA 2Z16A 3BR5A 4RAFA 3OYEA 2CQKA 2GIVA 4AIKA 3MZHA 4HF0A 2X1DA 3ZPLA 3B73A 2CUEA 5K5RA 1JKOC 3VB2A 2XASA 1H89C 2A6EF 1BI2A 2FMYA 1GXPA 1ZKGA 2K9NA 3C7JA 1MKMA 5AIQA 4QWQA 2L9VA 4CZCA 1TT0A 2RVCA 4RB2C 3O8HA 2OA4A 1HLVA 1O4XA 2G7HA 3K4LA 2V79A 1H0MA 1IDZA 3OYLA 3R61A 5HODA 1S6LA 4CH7A 3F6OA 2VOOA 1XC5A 1SD4A 2L9NA 1XD7A 2X1CA 2DA4A 3CJQB 4P1WA 2CV0A 3PO2J 1G3SA 1RKTA 5D5UB 3V7SA 1TTYA 4GO1A 3GVAA 3KX2A 3ELKA 3ZR8X 2A07F 5F1RA 5LBQA 1OCOH 2E2IJ 3TL4X 1WFXA 4IL6C 2X0LA 4BEHA 3J81K 5EG0A 3PNYA 2ZMEA 4XRSG 5H20A 2NRAC 4GCVA 4GYIA 3PNVA 3OYHA 2WY7Q 5E17F 2CW0F 3B6CA 2H27A 2WBMA 5HDNA 1IXRC 3BG9A 3ZQQA 3RKWA 3V8LA 3AG3H 5GADJ 5LGTA 1KA8A 2PMZN 4U87A 5BPDA 2JSCA 1RC9A 4XORA 5EYRA 3WHBA 5FO5A 2R7VA 2TCTA 5IP9J 2O9LA 2JPBA 4S04A 2HPIA 4TV7A 4XK4A 3ZQLA 2L3DA 1H8AC 2GZWA 5ICEA 2HOAA 3E0JB 2V1NA 1K78A 2L54A 5K7FA 1FP2A 2PEXA 5E1ZB 3OYMA 4LIVA 4UV8A 4FQGA 4WX9A 1EH8A 4IRIA 2H8WA 1BBYA 2MFZA 2UXXA 4DW6A 1KU3A 3PL8A 3ZGKA 4FCYA 1X3ZB 3ESWB 2YSRA 1D8KA 1TWHJ 1OR7C 2FQ3A 2W82A 1Q1HA 1QGPA 1KYZA 1VNDA 2W4SA 4S0HB 4E4HA 1QNTA 3ISPA 1SFUA 4LITA 4A3BJ 1OPCA 4N0BA 4KFCA 4E7KA 1FIPA 4RB0A 1B8IB 3CESA 4I09A 5D5VB 2A5YB 1USSA 1HQCA 2V1DA 4ZZLA 2CV2A 3PUBA 2BV6A 2BE5F 3FXUA 4ZYHA 4HDVA 2K5CA 4A3GJ 3CC4I 1FT9A 4V19K 4A3LJ 1OKRA 3K1MA 4AC0A 2VC1A 1YE9A 1B59A 3AKZA 4M6VA 4ESBA 2AQFA 2NVXJ 2RDPA 1IF1A 3FK7A 1TBXA 1ZREA 3HOVJ 2WV0A 1I6XA 3BY6A 1YTYA 1VTNC 2R92J 3OYCA 3BT9A 4FISA 3VODA 3HXLA 4FTHA 5FLVA 3HHGA 1XDUA 2R7SA 3AL0C 1KQ0A 1A36A 1FY7A 4YFKF 3ZQFA 2M45A 2DPDA 3AG2H 3EYIA 2AHQA 2LG4A 4O6JA 1QRYA 2P6TA 4BE1A 3TOBA 3QU6A 5BOXA 3V7RA 5EDNA 3M8EA 1BOBA 4XSZF 1PDNC 2EZHA 3E6BA 4QPQA 3LA3A 5EG0B 1ZELA 1DGRM 3J80Z 3CF2A 2JRMA 1WH7A 2M0MA 3GZNB 3KP2A 3OMYA 3ZMZA 3K1PA 3TO7A 4I02A 3T1BA 4XRFA 3KZZA 4D7MA 1MDMA 4EVIA 3VSKA 1YRNB 1RR7A 4BY7J 3JREA 3GMEA 3L7WA 4HQEA 5BS6A 5F0HA 3P7NA 4G6QA 2KHMA 5ED4A 3CUQA 2ZNZA 3K2ZA 4A3JJ 1SFOJ 2BVLA 3MVPA 3SZTA 3DBLB 4M9XA 2EFNA 5LFAA 2BHYA 2RQPA 1WI3A 4EJVA 3J7YJ 1SFKA 2G0EA 1NTCA 3O3KA 1J09A 1BOAA 3UNGC 2UWMA 2DAOA 2R4GA 1U5TB 1IRXA 2PFBA 1ON1A 5IT3A 1WI9A 2CYYA 3CDLA 1A04A 1S72I 2DJNA 3OYDA 1FOWA 4I0AA 3DXJF 4PSXA 1FEXA 1MDMB 1YRNA 3PO3J 4ZDPA 3MFKA 2MG4A 2JWTA 3ECOA 3WTSC 1TWGJ 2A69F 2L4AA 4MEYF 2M87A 2STWA 2EZKA 5TISC 1WKMA 1BJAA 3HKZN 1BC7C 4IHXA 4A6DA 2ZJRF 2P7VB 1L3LA 4NQWA 1SFEA 3HYIA 2Y2ZA 3B6AA 1S7OA 4PJ0C 4KNYA 2B63J 1RI7A 5IOYA 2KIUA 4JQFA 5HS9A 2MD5A 4M3EA 2A68F 3TP3A 1ENHA 4XSXF 1R5GA 4BAYA 3RKXA 4CCNA 3K4KA 4WXHA 3A2KA 2DA7A 2P6SA 3I3LA 2HQ5A 2LBFA 3QPTA 4PGGA 4DQ2A 2ZFUA 3W2VA 1FTTA 4CCJA 4C9YA 2V4JC 5DD4A 1IW7F 1VQPI 4HNUA 1SD5A 2QQ9A 2RNGA 1WJBA 2NVUB 3KP6A 1IN7A 4B09A 4AWXB 2OQGA 3HC7A 4ZTJA 4U7BA 4XOTA 4LB5A 1SEUA 3GZ5A 3C1DA 4YFNF 3Q3SA 3ZQHA 4UUVA 2FRHA 3K4NA 1BN5A 2WA0A 1ZQ3P 2XPVA 3HOUJ 1XCBA 4XN0A 3BLYA 1I5ZA 1VQ7I 3E6CC 2R7XA 2M9HA 4EJOA 2DT7B 4IQ4A 1SMYF 4XBFA 2NVYJ 3I64A 3NEUA 4WWCA 1R58A 1F9NA 1PYVA 4GXOA 2R5ZA 1JTYA 4ZYGA 4CICA 3V4GA 3WU1B 2C6YA 1VF9A 2QKLB 3GLLA 3BR1A 3X2QH 1DU0A 1Z6RA 5GAEJ 5IP7J 4HG2A 2QSGX 1YJNI 1VQOI 3QRFF 2R93J 5F04A 3W2WA 2ECCA 2JUGA 3DWLE 3FXJA 3NARA 5TGTA 1R4MB 2ID3A 1JT6A 1W5TA 5ICCA 1T95A 1W1WE 1LVAA 2DODA 2FOWA 1JJ6C 4IXAA 1HCRA 2A3SA 4P55A 4A0YA 2IJLA 1S7AA 1X2MA 5DDGA 4ITVA 3PIOF 2NS0A 5CVJA 2ID6A 1A31A 2BY0A 4B8XA 1IRGA 1KONA 3CLQA 3CMAI 3CF5F 1MJ9A 3OIOA 2QF7A 3VYUB 3HSEA 3PNTA 5K1YA 4WK8F 2QKMB 3JRCA 4XLPF 3S8PA 1WJ5A 3DPLC 2KPMA 2EZLA 3ABMH 3RIRA 1YG2A 4NQWB 2EV0A 3GXOA 4BACA 3OL3A 5L3GA 2EFPA 2JVHA 2KQRA 2BBYA 3NRVA 3S1NJ 3KLNA 2DQLA 4FETA 5FLXK 1P9QC 1D3YA 1R4NB 2E5NA 2RKHA 2ELKA 2XF5A 1JHHA 2YS9A 1HF0A 1SAUA 1XS9A 1U8RA 4D0PA 4U7DA 1U8BA 2DPUA 2EV6A 3HRTA 3CJNA 5CKTA 3GZ6A 3BJAA 3J7ZI 1I39A 2QSFX 2XRNA 4UUSA 1W7PD 4M3DA 2GXGA 3GCMA 3JTGA 2XPUA 4IX7A 3KCCA 4KMUX 4QSHA 3U1DA 1JGGA 3I9V2 2V1XA 1P4AA 3WHCA 2HFHA 5DUKA 2DCEA 4BUPA 1O3SA 4MNUA 4HPQA 2QSHX 1W7PB 5FKNA 4MGRA 3O6BB 1EF4A 1ETWA 3TO9A 2GXAA 2M2EA 1RETA 1X1DA 2DK5A 2KISA 3CUQC 2IAIA 4BQOA 3LSTA 5HLGA 4KMFA 3S2DJ 2LNBA 1F36A 1T8IA 3RYPA 1HXDA 5E8IA 2ZKZA 3CMEI 1D0ZA 3TP0A 5J4VA 3PJRA 1NK3P 2O5RA 3N05A 4DIQA 2J5PA 2BY2A 2BEOA 1U5TC 3BOQA 1E3PA 3OYKA 2Z3YA 2VBZA 3U9GA 2EFOA 1BW6A 5FJ8J 4PUSA 4XLCA 3SEZA 3HUGB 1P4WA 3HKZA 5LLQA 3KETA 1V54H 2COMA 3ZMSA 2Y30A 1GT0C 1LQ1A 1S9HA 1I3AA 2YPRA 1GV2A 3OL4A 3D5SC 2OD5A 1OCTC 2R7TA 2WY8Q 2DK8A 1OLTA 1P7IA 1PUFA 2GIZA 3E5QA 1FYKA 1YW7A 2E1MC 1TNTA 4UY8I 1IG7A 2HXIA 5GP9A 5KCMA 3TO6A 2KZGA 2STTA 1H88C 5E79C 2K02A 3S2HJ 1WSUA 2DMUA 3HUGA 4BQNA 2BHZA 4DNCA 1FOXA 4PDKA 1S8NA 1XDSA 1ACIA 2E7WA 2NYXA 3R60A 2MBFA 2PQ8A 4A0ZA 4HA8A 3LWFA 4JYKA 1WHUA 1G6NA 1Y39A 5E1XA 1IN6A 3EUHA 4U0YA 2G7UA 3FBIB 5ILVA 3JRDA 5J8FA 4G9YA 3CDIA 3C2HA 3I4PA 4ETSA 2DTZA 5JFRA 2H09A 1P7JA 5HDKA 2DMNA 3ULQB 3DCFA 1LUJB 2CQ7A 4YELA 2HS5A 1J9IA 1VFCA 2M30A 1A6QA 2JMWA 3FXLA 1ZGJA 3GFIA 4WCGA 4UXNA 2JA7J 2LF7A 1X4PA 3WTTC 1FBQA 1B4AA 2CUZA 3BWGA 4XICA 1SANA 1HC8A 3K1NA 3LOCA 3W6VA 3EYYA 1QBJA 1Z7LA 2HVSA 3FZVA 3VOEA 1Z9CA 5IYDJ 4LLNA 2QM3A 1JKQC 1XMAA 3D5LA 3JRFA 3LAPA 3LAJA 3TBIA 2AQEA 2RQQA 1QA6A 3HPHA 5FKOA 3HG9A 3S16J 4RGRA 1Y0NA 2KJCA 3NQOA 2NAZA 2LR8A 2IS4A 2OAZA 3KLOA 3JSPA 2DMTA 3EUKL 3DQVC 4NBQA 5HNFA 2R7ZJ 1JKPC 3QPLA 3JRGA 1ZHFA 2M5WA 2FD5A 2K4BA 2EA2A 1AU7A 2EPFA 3M4OJ
chains in the Genus database with same CATH topology
3CCUI 3I56I 2ZJQF 4UY8I 3CCJI 2OTLI 5GAGJ 5GAHJ 1YI2I 1VQ7I 4IOAF 1VQPI 1QA6A 2NXNB 1VQ5I 1HC8A 3CC7I 3CCQI 3J7YJ 5DM6F 2FOWA 3CCRI 2OTJI 1FOXA 2K3FA 2ZJRF 1ACIA 3CD6I 3CC4I 1VQ9I 4V19K 3CJTB 1VQMI 1YHQI 5DM7F 3PIOF 3CCEI 3CCVI 3CCSI 3G6EI 1S72I 1FOYA 3CCLI 1VQLI 3G71I 3CMAI 1FOWA 2ZJPF 3CCMI 1YJWI 2JQ7A 4IO9F 2QA4I 1Y39A 1VQ6I 1YITI 3CF5F 1VQNI 2H8WA 3I55I 2E34A 5GAEJ 4IOCF 3G4SI 3CC2I 5GADJ 3PIPF 2E35A 1MMSA 1YJNI 1YIJI 2E36A 5JVGF 1VQOI 3J7ZI 3CMEI 1VQ4I 3DLLF 1VQKI 1YJ9I 1VQ8I 2QEXI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCU I;  3I56 I;  2ZJQ F;  4UY8 I;  3CCJ I;  2OTL I;  5GAG J;  5GAH J;  1YI2 I;  1VQ7 I;  4IOA F;  1VQP I;  1QA6 A;  2NXN B;  1VQ5 I;  1HC8 A;  3CC7 I;  3CCQ I;  3J7Y J;  5DM6 F;  2FOW A;  3CCR I;  2OTJ I;  1FOX A;  2K3F A;  2ZJR F;  1ACI A;  3CD6 I;  3CC4 I;  1VQ9 I;  4V19 K;  3CJT B;  1VQM I;  1YHQ I;  5DM7 F;  3PIO F;  3CCE I;  3CCV I;  3CCS I;  3G6E I;  1S72 I;  1FOY A;  3CCL I;  1VQL I;  3G71 I;  3CMA I;  1FOW A;  2ZJP F;  3CCM I;  1YJW I;  2JQ7 A;  4IO9 F;  2QA4 I;  1Y39 A;  1VQ6 I;  1YIT I;  3CF5 F;  1VQN I;  2H8W A;  3I55 I;  2E34 A;  5GAE J;  4IOC F;  3G4S I;  3CC2 I;  5GAD J;  3PIP F;  2E35 A;  1MMS A;  1YJN I;  1YIJ I;  2E36 A;  5JVG F;  1VQO I;  3J7Z I;  3CME I;  1VQ4 I;  3DLL F;  1VQK I;  1YJ9 I;  1VQ8 I;  2QEX I; 
#chains in the Genus database with same CATH topology
 1LFB A;  5E1W A;  4YFX F;  3JCU C;  1OYI A;  2LF8 A;  1FYL A;  2YX4 A;  2CG4 A;  4EEF G;  3S14 J;  2K7L A;  1OFC X;  2ZME B;  5M3F J;  2M1B A;  2H1K A;  2E1N A;  3K4B A;  2WAQ A;  4DBQ A;  1UEL B;  3CTA A;  4H4K C;  3CCV I;  2EK5 A;  5EZH A;  2VC0 A;  1Y8R B;  3QP6 A;  2LRD A;  3PFY A;  3QWL A;  2KT0 A;  3CCY A;  2HDD A;  4M6X A;  5HLT A;  5FKL A;  2L7M P;  3KP5 A;  1TQM A;  3R0A A;  1BR1 A;  1Y6I A;  4HV5 A;  4EJT A;  4BXX J;  1Y8Q B;  3HSF A;  3SYT A;  4GYG A;  3T5X A;  4CA0 A;  3FKI J;  4RBO A;  4DZJ A;  1HW5 A;  3FXK A;  3FMS A;  4E7H A;  3TED A;  4JX5 A;  5FKK A;  1O3T A;  2MLK A;  2N8G A;  1U0J A;  2ZB9 A;  4X0G A;  2CH0 A;  1REP C;  3LNQ A;  4G7Z F;  4GDF A;  1FLI A;  2XGC A;  1JKR C;  1D1B A;  2MLG A;  1U78 A;  2QQA A;  3S2W A;  4CO8 A;  2QLZ A;  1JUS A;  3ASO H;  2ZO4 A;  2XVC A;  3FHZ A;  2DFF A;  2HZD A;  1E3H A;  2X85 A;  3ZQI A;  2VBX A;  1VQ5 I;  2JZY A;  1RES A;  1TQP A;  1LDK B;  1ZGA A;  3SXY A;  3OS1 A;  3WTU C;  2XV4 S;  3WU0 A;  3QAH A;  4CZZ A;  3A4C A;  3ABU A;  1WH5 A;  3FMR A;  2JUC A;  3E6D A;  3IP4 B;  3V8J A;  2L5Q A;  4WF2 A;  3SHF A;  3CCM I;  1IN5 A;  4MQ9 F;  1UFM A;  4RM2 A;  4ZDO A;  1UZC A;  4IRH A;  4PSW A;  1MZB A;  2DOA A;  3G2B A;  3KYL A;  2ISZ A;  1TWA J;  1FTZ A;  5J47 A;  3KP4 A;  4I01 A;  2E2J J;  3KYD B;  2MSY A;  4YG2 F;  2V26 A;  4E7J A;  3Q9S A;  3IC7 A;  3QOD A;  2GOM A;  3IH4 A;  4UUT A;  1RPW A;  4KIG A;  4AD9 A;  2DMP A;  2DQR A;  4NB5 A;  3F21 A;  1MBG A;  3BG7 A;  2GOX B;  1K4S A;  3DLA A;  3I5U A;  3GEZ A;  3D5R C;  2JTV A;  3E1S A;  4F91 B;  3FDY A;  1QVU A;  3OSF A;  3G1O A;  2JSP A;  2Y0S N;  1PUE E;  2DYR H;  4B47 A;  1PJR A;  2M34 A;  3G1L A;  2PN6 A;  4ENM A;  2VUM J;  1BI0 A;  2VBY A;  2VKH A;  1XGM A;  4D7N A;  3OY9 A;  2R7U A;  3C2B A;  4II3 A;  1VQK I;  1ORK A;  3LSG A;  3BR2 A;  3H5N A;  3BPV A;  1G59 A;  3IWZ A;  1DDN A;  4KJZ A;  5DS9 A;  1XTA A;  2IVM A;  4P5O A;  2LFB A;  5CYV A;  3MKY B;  2ME0 A;  2XF7 A;  3JR9 A;  3HRU A;  3FIS A;  4ZYA A;  3KEY A;  4UV9 A;  3S1M J;  1PVE A;  2TDX A;  3F8B A;  3VWB A;  3GFJ A;  4W1U A;  4N9I A;  1U9N A;  1IZ1 A;  2CU7 A;  4Z6Y A;  1ZLK A;  1IUF A;  1FYM A;  1EJ9 A;  4II2 A;  3VYR B;  1UAA A;  1E0E A;  2QBY A;  3I58 A;  1R1U A;  3QOP A;  4XL9 A;  4BEH B;  1EH7 A;  3I54 A;  2VQC A;  4N4O B;  2XGX A;  1A6I A;  3I59 A;  4ZDL A;  2Y0S A;  2KDZ A;  4OIO F;  2F4I A;  1O57 A;  3CCJ I;  1JTX A;  3T8R A;  4DOZ A;  1PP8 F;  2Y9Y A;  3BG3 A;  4L9V A;  2XGD A;  3R0J A;  1XB4 A;  3DTK A;  2A5W A;  1WJE A;  1UG2 A;  1LEA A;  3ZCO A;  2BXY A;  1F5T A;  2Y75 A;  3Q0V A;  1BA5 A;  2FF4 A;  4KT6 A;  1OCR H;  3HGY A;  4UB6 C;  1X58 A;  3TDU C;  3OYB A;  3BG6 A;  1F43 A;  2JVG A;  2ZJP F;  2L7K A;  3BJ6 A;  3BCB A;  3GWZ A;  3H1C A;  2HQA A;  3I55 I;  2EZI A;  2IP2 A;  5FRO A;  4EM1 A;  3MWM A;  2QZ8 A;  2ZXH A;  4LD5 A;  3DU5 A;  3JTH A;  2VQG A;  3C3W A;  5CVR A;  4ZZD A;  5BQT A;  3SJM A;  3N97 A;  1U3E M;  3H3Z A;  1SFX A;  2K9Q A;  1MW7 A;  5L3D A;  2YUS A;  2OCC H;  2R7O A;  5LRS A;  2Z5U A;  4WXD A;  2Y31 A;  5GTI C;  5DCM B;  1OCP A;  4LLL A;  4WXC A;  2ISY A;  4BS9 A;  4E70 A;  1BI1 A;  3JRA A;  4MFD A;  4EM2 A;  2LBF B;  4XM3 A;  4H0E A;  3L2R A;  5IT9 Z;  4MO7 A;  3RJP A;  2E35 A;  5F1J A;  3DEU A;  2BY3 A;  5JVG F;  1ZK8 A;  4BJT A;  1X1A A;  2TRT A;  2Z2S B;  2P81 A;  1MBH A;  3GTO J;  1ODD A;  2AXL A;  1K61 A;  4EM0 B;  1IUY A;  4Y13 A;  1I1S A;  2DA2 A;  2OBP A;  4NDL A;  3CMY A;  1SC7 A;  3K4M A;  2DU9 A;  3K9T A;  5K7Z A;  2LRE A;  2ETH A;  4EV0 A;  3EPZ A;  1I1G A;  3BG5 A;  3DV8 A;  1W4M A;  1T6S A;  3WGG A;  3ZRG A;  3MKZ A;  1VQN I;  2IA1 A;  5L3F A;  5DYM A;  1FIA A;  2LSO A;  4M74 A;  2DFH A;  1YS7 A;  1DP3 A;  2PI0 A;  2L9S A;  2HKO A;  2OCE A;  4LIU A;  3FKJ A;  4M3B A;  3ABK H;  4J00 A;  3CC7 I;  4D5F A;  3SQN A;  3WTW C;  3WTX C;  2VOP A;  4U88 A;  1J0R A;  4B44 A;  4B48 A;  3A0H C;  3FHN A;  1T2K A;  5D6F A;  2D1V A;  3HIF A;  2Y0M A;  4ZTF A;  4KIC A;  4PGH A;  2X1E A;  5JI6 A;  2BYV E;  1BIB A;  4IVN A;  1IC8 A;  1Q1V A;  2G9W A;  3FXR A;  1Z0X A;  4CYD A;  1YQA A;  2QCO A;  5A2Q Z;  5IPA A;  5CQG A;  3QOE A;  1GVD A;  1RR8 C;  2Z9O A;  2O61 A;  5ERI A;  2HTS A;  5F64 A;  3CC2 I;  4HQM A;  1DU6 A;  2P5L C;  1RZ4 A;  3S17 J;  1SD6 A;  3GFM A;  3WU2 C;  2CUJ A;  2B7E A;  3QU3 A;  4RDU A;  1KZH A;  4DYR A;  1E3O C;  3HRS A;  4XKW A;  4CYC A;  1MMD A;  4W97 A;  2EIJ H;  2JT1 A;  1XMX A;  3K70 D;  3JRB A;  4A93 J;  4M3F A;  1IJW C;  2E2H J;  3KP7 A;  5K5O A;  2L01 A;  4ESF A;  5F0C A;  1MND A;  1UHW A;  4Y3O A;  3G3Z A;  4KN4 X;  4BE2 A;  1J59 A;  3D1N I;  5EGO B;  2WAF A;  4HF2 A;  3ERE D;  4HSR A;  3FWE A;  5LGN A;  4IO9 F;  1AKH B;  1O7F A;  1KQ9 A;  3BTL A;  3OIQ A;  4Y7N J;  5H2F C;  3SEQ A;  4OU0 A;  1X1P A;  2EA4 A;  3K0L A;  2F6C A;  1IO2 A;  1YO5 C;  1EV7 A;  2RV8 A;  3MKW B;  3JAM Z;  1WJC A;  1UST A;  2NOG A;  1WZ2 A;  3KIO A;  3M9A A;  2JA8 J;  3MQ0 A;  2WAD A;  4A5M A;  4KIB A;  1XG1 A;  5E20 A;  5D5W B;  2FBK A;  4ABZ A;  1STZ A;  5BNG A;  1D5V A;  5E18 F;  2EIL H;  1LE8 B;  3QYB A;  5CVU A;  2K85 A;  4KIF A;  2VXZ A;  3ZQC A;  4UNO A;  2EH3 A;  3KE2 A;  1NH3 A;  2F5D A;  3CZ6 A;  2E36 A;  2EV5 A;  2F48 A;  4XOP A;  1Z91 A;  1W0T A;  1U9O A;  3DTI A;  4HAM A;  4U0W A;  1MD0 A;  1X3U A;  3GUD A;  1P2F A;  1A35 A;  2E1C A;  3HRM A;  5C44 J;  3MD2 A;  4PJL A;  1W7P A;  2E5Z A;  4P9F A;  2YU9 J;  4G7H F;  4XLA A;  3E3V A;  3IKT A;  2FU4 A;  1FOK A;  2EBI A;  1LE8 A;  1FMV A;  5M5X J;  4DBR A;  1IN8 A;  2QEN A;  3G4S I;  3PIP F;  5JLX A;  1YW9 A;  2HYG D;  1AWC A;  4RGX A;  2LTP A;  4AU7 A;  4XKB A;  1OQY A;  4YIR X;  2ZSI B;  3LA2 A;  3PSF A;  4PJN A;  1S7E A;  3DU6 A;  4LJZ F;  3WTZ A;  9ANT A;  2PMH A;  1GXQ A;  3F8C A;  4DYC A;  1KU9 A;  2R7R A;  2VT3 A;  4OIP F;  1D1C A;  2GM4 A;  2P5V A;  2L0K A;  4KN7 X;  5H6R A;  2Y9Z A;  1LPQ A;  1KU2 A;  1K6Y A;  2D5V A;  1IV8 A;  2HEO A;  3PQJ A;  3DEW A;  4XLN F;  5EEA A;  4E6K G;  5KAF C;  2FNA A;  1HDD C;  1UJ8 A;  2CWE A;  2IPQ X;  2XKO A;  2NS8 A;  1FNN A;  5CPR B;  3RPQ A;  1S5L C;  2DDB A;  1RNL A;  2HR3 A;  3HZJ A;  3H0D A;  4BY1 J;  2IEK A;  3QYE A;  4X6A J;  2ZNY A;  1I3Q J;  3HEF A;  4KA4 A;  1U5T A;  3CCR I;  2KRC A;  1XCV A;  4ZYD A;  5EGO A;  1MBF A;  2QQB A;  1YHQ I;  3GTK J;  3CJR B;  1FZP B;  1WRJ A;  4A69 C;  3RZD J;  3FX3 A;  1AKH A;  3HL2 A;  2CGP A;  2EIN H;  2WB1 A;  1JJ8 C;  4E7L A;  2K9L A;  1YJW I;  4FE4 A;  2CFO A;  4NUB A;  2VAS A;  3SZP A;  3KZY A;  5GPC A;  1QPM A;  2HNH A;  2QYO A;  3FF5 A;  2LKX A;  2JJ7 A;  2NOJ B;  5LHI A;  2Z99 A;  4XKC A;  4MQV A;  1O3R A;  1LFP A;  2R3S A;  1HST A;  4C3J J;  1N25 A;  2MGQ A;  4OIN F;  1FMW A;  3MCZ A;  3ZOB A;  2M4G A;  1WVR A;  2VI6 A;  3F9K A;  1MMG A;  3DBH B;  1Z6T A;  3K69 A;  4BHC A;  2W57 A;  1R5H A;  5TJJ A;  4L0Y B;  2CS3 A;  1XX5 A;  4BQA A;  3RYR A;  2VN2 A;  3TDZ C;  4XMY A;  5D8K B;  4CCL A;  3EUH C;  1TC3 C;  5JVT A;  4BYY A;  3NWS A;  4ZJZ A;  3DFG A;  2QEX I;  3IH2 A;  2F2E A;  3QQA A;  1ONV A;  1B72 B;  2GXB A;  2O3F A;  3OYA A;  4HLX A;  2LKS A;  3C18 A;  2AXT C;  3S3O A;  4CGZ A;  4I6Z A;  4OMY A;  2X4H A;  2EB7 A;  1ZR4 A;  4GRI A;  4E7S A;  2H6C A;  5K5Q A;  2P5K A;  1IGN A;  1ON2 A;  2O03 A;  3AG4 H;  3HM5 A;  1YYV A;  2Q2E B;  3AAF A;  2MD0 A;  2GBY A;  3FXQ A;  2ZCW A;  3LSP A;  3LSR A;  2VQH A;  2JQ7 A;  6PAX A;  5D6E A;  2VBW A;  4Q48 A;  5FD5 A;  2MC3 A;  3M1C A;  4YII A;  3W6K B;  5IYC J;  1LB2 A;  3HTU A;  4PFP A;  2MYS A;  3H92 A;  3P9K A;  2W24 A;  2VON A;  3H5R A;  2LY2 A;  2DT5 A;  1HW1 A;  4IHT A;  3DKY A;  1FJL A;  5CVV A;  2R5Z B;  1Y1W J;  4O3M A;  2V6E A;  4CSW A;  3IL2 A;  2ESH A;  2XRL A;  2ESN A;  3CJT B;  1W5S A;  3KPH A;  3BZ6 A;  3A01 B;  3ONQ A;  2R7D A;  1HKQ A;  3G6E I;  2A61 A;  1FOY A;  2DT6 A;  3PM1 A;  3SFZ A;  3F23 A;  1Z67 A;  3ZMD A;  1Z7U A;  2PG4 A;  4MFE A;  2VIX A;  4V2F A;  3SDB A;  1EKE A;  3ASN H;  1X1C A;  3DPT A;  4A3C J;  4K2E A;  3VDX A;  3KFW X;  5ICG A;  2JRT A;  2X6W A;  3MEX A;  3REO A;  3T0Y A;  1ETQ A;  2COB A;  3E97 A;  1Z05 A;  4M9Z A;  2FJ1 A;  2KRH A;  2EFQ A;  3HPG A;  4XRM A;  4PJM A;  4PK4 A;  3E7L A;  4HX4 A;  5CJ9 A;  1ZLJ A;  4C3I J;  2VLA A;  4A6E A;  1T39 A;  4HRI A;  4Q5S F;  3LA7 A;  4IHW A;  3VSL A;  4PFO A;  1VQ9 I;  5E3O A;  2ZC2 A;  4ANJ A;  3Q5F A;  1ETX A;  4MTD A;  2UZK A;  1R1V A;  1MBK A;  1XMK A;  4M9S A;  4R79 A;  1DPR A;  4OOI A;  5LRR A;  3NAU A;  4B3A A;  2FX0 A;  5LEK A;  4Z2Y A;  3OYF A;  2BY1 A;  2H94 A;  3MKL A;  4YRV A;  1D1A A;  5ICF A;  4XQF A;  5LEJ A;  1ZRC A;  1TW3 A;  3MZ8 A;  5HLH A;  1JE8 A;  5DUI A;  2GWR A;  1X2N A;  1IDY A;  4I98 B;  4F7Z A;  2HU9 A;  4RB1 A;  4HX8 A;  4XKV A;  3FMQ A;  4CCM A;  2DMQ A;  3CP2 A;  4IPA A;  1U2W A;  1ZH5 A;  5CVI A;  5J1R A;  3MAJ A;  3U21 A;  1FX7 A;  4O5V A;  1IV6 A;  1FP1 D;  2XSD C;  1V5E A;  2JA2 A;  4ZYE A;  2DA3 A;  3I53 A;  4RGS A;  4BHB A;  4M71 A;  2DFE A;  2UV1 A;  3G71 I;  1GUU A;  3J81 Z;  1J75 A;  1RUN A;  2E34 A;  2FA5 A;  3HGG A;  3F3X A;  1JUM A;  2P8T A;  5LGU A;  1Y56 A;  2WB1 N;  3DTE A;  3CUO A;  1MSE C;  3R6S A;  1ULY A;  2W1O A;  2WWY A;  1C0W A;  4KIS A;  4IQJ A;  3GTP J;  3DP7 A;  1UMQ A;  4AVP A;  2XDV A;  5IP6 A;  3N4M A;  3IRR A;  2PLY A;  1ZGW A;  2ECB A;  2IS2 A;  3I71 A;  2LLK A;  3OOU A;  1CQT A;  3DKW A;  4RA2 A;  4ASN A;  3CCE I;  5J1U A;  5L3E A;  1TT5 B;  2DYS H;  2I8D A;  1V5G A;  2WV1 A;  4I99 C;  4L5J A;  4A0X A;  2HKX A;  2VL8 A;  1OYY A;  2NNY A;  2HYF A;  2W84 A;  1YW8 A;  1B6A A;  3CP8 A;  1ERD A;  3IUO A;  3P5J A;  2E71 A;  2CQN A;  1JHF A;  4LOC A;  4E7Z A;  3DF8 A;  2DFI A;  3L9F A;  2CUF A;  4GGG A;  4BGD A;  1MMN A;  2F5E A;  2M4K A;  1K6O A;  1VQM I;  4JOM A;  2R7Q A;  3BR0 A;  4YEJ A;  4L9J A;  3OR2 C;  1ZG1 A;  1OMI A;  5K7H A;  1FBU A;  5EJC A;  2GQQ A;  2WTE A;  4I0B A;  2PBI A;  1E17 A;  4BDY A;  3CDH A;  3L2W A;  2K9S A;  2OQR A;  4NC8 A;  3G1M A;  2IGM A;  3EUA A;  3OWT A;  4ZH4 F;  1VQ4 I;  3BR6 A;  4JX6 A;  3WE2 A;  4RAG A;  5M3M J;  4HEA 2;  3IAM 2;  5CQE A;  3GTL J;  1XN7 A;  1R6R A;  2I5U A;  2R0Q C;  1KYW A;  3K70 C;  1R9T J;  2HVQ A;  3BPX A;  4GFB A;  2MA3 A;  3QPS A;  2GLO A;  3WG7 H;  5J1Y A;  3F8F A;  4BNC A;  2DLL A;  1LKX A;  5DCM A;  2KJB A;  1TZL A;  1WWX A;  2KKO A;  4OAZ A;  2JA5 J;  3CMM A;  2EJR A;  2ZXW H;  3FIW A;  2RC4 A;  3TW7 A;  2VJ4 A;  4XON A;  1ETY A;  4XR6 A;  3H0G J;  2VPR A;  5FD6 A;  3F0C A;  3I56 I;  2ZME C;  1OR7 A;  2VJJ A;  5E3L A;  2PJR A;  1W36 D;  1TL8 A;  1YX3 A;  5DTD A;  3GTG J;  4ENK A;  4XRS A;  2KIF A;  4L0Z B;  3BTC A;  2R7W A;  1WJD A;  3LL7 A;  4BH9 A;  4L9N A;  2V9V A;  3PQK A;  4MTE A;  1QVT A;  3JAM K;  3RPU D;  3R4K A;  2O0Y A;  1G2H A;  2KL4 A;  2M8E A;  3RZO J;  5H6Q A;  3H3V K;  4DJA A;  2QGU A;  5IOZ A;  4XNF A;  1X3W B;  3TGN A;  4FHT A;  2O8X A;  4F93 B;  2VB6 A;  5EF6 A;  4A3I J;  4KIT B;  1N75 A;  3OSG A;  1SD7 A;  2FE3 A;  5JHF A;  3D0S A;  2XHK A;  3COA C;  3UKG A;  1HSJ A;  1E2X A;  1T38 A;  4L5E A;  2V7F A;  2W7N A;  4XLF A;  2E7X A;  5DEQ A;  1AHD P;  3QP5 A;  1UHM A;  4RM3 A;  4NNJ A;  1TWC J;  3CD6 I;  1DPU A;  3HSR A;  1R5I D;  3WTY C;  1G4D A;  5KNL A;  3BTJ A;  2CFX A;  3FK6 A;  4FT8 A;  3H35 A;  2A05 A;  3HB9 A;  5F0F A;  4ON0 A;  4G12 A;  3PSI A;  3SFI A;  2K86 A;  3OYI A;  2X51 A;  2KFD A;  4G94 A;  1JUP A;  3OIP A;  1RUO A;  1H9G A;  2HOE A;  3M8F A;  4CYC B;  2ZFW A;  2CSO A;  3WOD F;  2I10 A;  1X4O A;  1ZN2 A;  2IGK A;  5GAH J;  1JGS A;  2OJE D;  3LSJ A;  4NHJ A;  3MZY A;  4M72 A;  5L3C A;  2YU3 A;  3DEE A;  5M5W J;  2H8R A;  2HQN A;  3CLO A;  1R36 A;  2F5C A;  1AOY A;  3MMY B;  4X1E A;  2LK2 A;  3RQI A;  5LHH A;  3AFH A;  3P9C A;  2R5Y A;  1WCM J;  3JRI A;  1QZZ A;  2QA4 I;  1BC8 C;  2NNN A;  1YIT I;  1QHG A;  2X6Y A;  4QTR A;  5D4R A;  1TQI A;  1KQ8 A;  3ABL H;  5F08 A;  4AYB N;  3LFU A;  3GX4 X;  4U0V A;  4G6D A;  4PZJ A;  2CMP A;  1T0F C;  4LB6 B;  3HJE A;  4D5C A;  4EAT A;  2JK3 A;  2ZJ2 A;  3JSO A;  3H9J A;  5BPI A;  3BC8 A;  3WGH A;  2L4M A;  2XC7 A;  3I0T A;  4LGW A;  1B1B A;  4HYE A;  4MLO A;  2XGE A;  1W36 C;  1QQI A;  2E19 A;  4RAY A;  3VFZ A;  4BBR J;  3M8J A;  3F72 A;  4AVZ A;  4M73 A;  3IWF A;  4FX4 A;  3ZP5 A;  2Q2E A;  5JLW A;  2LMD A;  5IT9 K;  2LDU A;  1EA3 A;  2DW4 A;  2FNP A;  3RSN A;  4JX4 A;  3UR3 C;  3HHH A;  4RMN A;  1JXS A;  1MNE A;  1MSF C;  4HOB A;  5HOO A;  4S05 A;  3Q0W A;  2AO9 A;  4UB8 C;  1GLN A;  3VPR A;  1HW2 A;  3ZMU A;  1LNW A;  1TW2 A;  1R49 A;  2LVS A;  2RRE A;  3ML6 A;  1R1T A;  2Z33 A;  3V7C A;  3A1Y A;  2ME6 A;  2DI3 A;  2ZXI A;  3RQ4 A;  2HDC A;  1MBJ A;  4PCQ A;  1ITY A;  3TKY A;  2VE9 A;  2L02 A;  3FM5 A;  1ETV A;  5HLI A;  1YOV B;  2IGO A;  3L09 A;  4LFU A;  1GVJ A;  1JI8 A;  3GFL A;  1FSH A;  2KLO A;  4RGU A;  4IJA A;  1I27 A;  1F1Z A;  1FSE A;  3VYS B;  1W5C C;  3WTV C;  4DZP A;  2L9R A;  3KZI C;  1EH6 A;  2DDA A;  1BJZ A;  1G3Y A;  2CQX A;  4A3E J;  5E8G A;  5AIP A;  3ZQ7 A;  2YX7 A;  3KEQ A;  2HOT A;  2OUM A;  3EET A;  2HTJ A;  2K9M A;  3TW6 A;  2VKV A;  3CUQ B;  3OS0 A;  1YI2 I;  2W48 A;  3H5A A;  1R7J A;  2XUB A;  5FRN A;  5DV5 A;  1Z21 A;  3G73 A;  3J80 K;  3RI4 A;  4QPO A;  1BR2 A;  2KIQ A;  3FM3 A;  4XLE A;  2VKD A;  4P96 A;  1I6H J;  3KYC B;  3WG9 A;  1VQL I;  2NVT J;  1HBX G;  4L18 B;  3OS2 A;  4R1H A;  2JPC A;  1POG A;  2W25 A;  2V6C A;  4F55 A;  2Q1Z B;  2IS6 A;  3BP8 A;  2LC2 A;  3I4N J;  5GTH C;  1V3F A;  1XSV A;  2DXI A;  2IA2 A;  2BZT A;  3V8K A;  3KEO A;  4I76 A;  1HA8 A;  4HNT A;  1WPK A;  2DOE A;  4XLH A;  3GW2 A;  4LK0 F;  4XID A;  5M5Y J;  4UVC A;  4JBA A;  2E1M B;  2HDW A;  4N9H A;  3TQN A;  4A5N A;  3GBG A;  1N77 A;  5DM7 F;  1T33 A;  4BBS J;  1S29 A;  5J4Y A;  2XKP A;  4MHG A;  2GA1 A;  2XAG A;  2VT2 A;  2OV7 A;  4Y17 A;  1R23 A;  4ENN A;  4FE7 A;  5FGM A;  3M3Y J;  4EJU A;  1MMS A;  1SAX A;  3DLL F;  2FOK A;  2O7O A;  3ZN0 A;  4CDG A;  2M3A A;  2V9P A;  2LH9 A;  3Q0U A;  3LQQ A;  3PFI A;  4B3X A;  1B72 A;  4A2U A;  3RCO A;  3ZQG A;  5GPA A;  1OIS A;  1SVO A;  3MN2 A;  2PJP A;  2E1O A;  4IHY A;  2L2O A;  5B1A H;  3JW4 A;  2Q8K A;  4HLY A;  3S15 J;  4JK1 X;  2HOS A;  1KGS A;  2FEZ A;  1BL0 A;  1T08 B;  4OIR F;  1PP7 U;  3HDD A;  3RDI A;  1BI3 A;  2XAF A;  4Y33 A;  2OTJ I;  1BIA A;  2P4W A;  3TOA A;  2RAE A;  2X48 A;  4C2M J;  2MH9 A;  2KMU A;  1D0Y A;  3IKV A;  2LD5 A;  2HGC A;  2RNJ A;  2LOO A;  5FFX A;  3BTI A;  4LLG F;  2XAQ A;  1R71 A;  1M1E B;  1P6R A;  2BXZ A;  3J7A O;  5FRM A;  2M7B A;  4CCO A;  1MJB A;  4JP0 A;  2QUF A;  2P0W A;  3J7A Y;  1Z3Y A;  2IGN A;  3L2C A;  1MNM C;  2ACJ A;  1XGS A;  4C2U A;  2FBI A;  2VJI A;  3FXO A;  4HV6 A;  3GTM J;  5EZG A;  3ZMV A;  4LMY A;  5J3L A;  3LSM A;  2K3P A;  3GLX A;  3LSK A;  2FSW A;  2FBH A;  4IHV A;  3BZC A;  1SVM A;  3LSH A;  1ZRD A;  2X9D A;  4OWR B;  1JT0 A;  3LQR A;  1QO0 D;  3L1P A;  4Y52 J;  4BXF A;  3ROU A;  2K4J A;  2KZV A;  2VE8 A;  4AUX A;  3W2A A;  5HS8 A;  5ILU A;  1K78 B;  3S1R J;  5F27 A;  1UHS A;  1LDD A;  3KP3 A;  2V1U A;  1P4X A;  3HOS A;  2DJI A;  3K7A J;  4UVA A;  1TWF J;  4BU2 A;  1OCC H;  4YIF A;  2CW8 A;  5D8L B;  1QZY A;  4C2T A;  3BZK A;  5FFZ A;  1RIO H;  2M8G X;  4ZC3 A;  3A03 A;  3H9Q A;  3ZXS A;  3IH3 A;  2LP0 A;  3U1K A;  4BHP A;  5C4X J;  4HST A;  4A3D J;  3BJO A;  4IEJ A;  4HF1 A;  4EGZ A;  2WAE A;  2ADU A;  4BXU A;  3ECH A;  4B4C A;  3LFK A;  5HVQ C;  1XPX A;  5IYB J;  1KU7 A;  3T8T A;  4LG0 A;  3QYF A;  1R22 A;  1B8I A;  2B0L A;  1MMA A;  1G8X A;  1XGO A;  1MH3 A;  3A0B C;  4RS8 A;  2DA1 A;  1IN4 A;  3L2Q A;  2HQR A;  3W3C A;  3HOX J;  2VPL A;  2JN6 A;  3DKX A;  3BDD A;  5FB2 A;  4V2G A;  1Z1D A;  1UB9 A;  1DP7 P;  2CV1 A;  2NXN B;  4A3M J;  5J6X A;  2XAU A;  5FLM J;  5DM6 F;  1WJA A;  3V42 A;  4F92 B;  3Q9V A;  1R00 A;  2KP6 A;  1YIO A;  4E7I A;  1QU3 A;  4IF4 A;  3ZMT A;  2EQR A;  2GA2 A;  2DA5 A;  1BR4 A;  3IHU A;  2HXO A;  4FAS D;  4A3K J;  2CW7 A;  3A02 A;  3NWT A;  4IZZ A;  2H1L A;  2B9S A;  2D1H A;  1V55 H;  1ZAR A;  1T98 A;  3H3U A;  1YJ9 I;  1U6G A;  1NG6 A;  3FXM A;  1AA7 A;  1MBE A;  2CQQ A;  4ESJ A;  2E60 A;  3O8G A;  1OYW A;  4DGW B;  1DUX C;  4AM3 A;  4P9U A;  2EWN A;  4B1R A;  4NC7 A;  4EJW A;  1N78 A;  4AID A;  1B9N A;  1CF7 A;  3DPU A;  5HDG A;  4IKF A;  2UUZ A;  3OYN A;  3WGI A;  3AG1 H;  2Y48 A;  2LKP A;  1K4T A;  1T56 A;  3HBL A;  1TP4 A;  2ZXJ A;  1F4K A;  2ZSH B;  4EGY A;  2DN0 A;  4F52 A;  4UHT A;  5J8C A;  3K2A A;  2R5Y B;  1MH4 A;  3WE3 A;  3S3M A;  1D5Y A;  2OU2 A;  3CQZ J;  3S3N A;  2UXN A;  2ZBK A;  5E3M A;  4I2O A;  4KUM A;  1K79 A;  2LY9 A;  1PUF B;  1ZG3 A;  2XB0 X;  2R7F A;  5LD2 C;  2XAJ A;  3BR3 A;  5B5E C;  1K7A A;  1J5Y A;  3TMO A;  1O7L A;  5LHG A;  5E3N A;  5D5X B;  2OPT A;  4A3F J;  2F5V A;  2JA6 J;  3M7G A;  1IXC A;  1APL C;  2X6X A;  1UG0 A;  1IAW A;  2PMZ A;  4HBL A;  3I59 B;  1O3Q A;  3GF2 A;  5C4J J;  4Q4Z F;  1HOM A;  1P92 A;  2RGV A;  3SZG A;  1YIJ I;  4B43 A;  1WGX A;  1NG7 A;  3P9I A;  3QPH A;  4RLF A;  1ETO A;  4A12 A;  2AS5 F;  1TLH B;  5GAG J;  1ZR2 A;  2IA0 A;  4UUS B;  2BVM A;  3ZN1 A;  2VJ5 A;  4LG0 B;  1OJL A;  3LMM A;  3GTJ J;  1CGP A;  1HDP A;  2HI3 A;  1VZ0 A;  3AL0 B;  3CCL I;  1VQ6 I;  2KIM A;  4D1Q A;  4ENJ A;  5HNH A;  2XPW A;  1MJA A;  4G8X A;  2LYC A;  4G7O F;  2MW8 A;  2IBD A;  3EQL F;  2KDO A;  4OMZ A;  5IY5 H;  2IS1 A;  5KAI C;  1MIJ A;  2OZ6 A;  3M07 A;  5KHD A;  1DQU A;  1ZYR F;  2ZJQ F;  2XAH A;  2HPM A;  1ZAO A;  5KK1 A;  2K27 A;  5JR3 A;  4CXF A;  4MIM A;  4RB3 C;  4KT5 C;  3K10 A;  5DD8 A;  2YR2 A;  2NS7 A;  1Z3X A;  4M3G A;  5FKM A;  3HOY J;  1A5J A;  1YS6 A;  2FUG 2;  3E5U A;  1YLF A;  2HWV A;  2D2W A;  2XSJ C;  1D0X A;  2ELH A;  4AIH A;  5CLS A;  1HKS A;  1XSX A;  2MC4 A;  2Z1D A;  1YX5 A;  4G6T B;  2L7F P;  1LJ9 A;  2KRF A;  4KDP A;  1S3J A;  1FBS A;  2F5F A;  3F8N A;  1VI0 A;  2K40 A;  1BM9 A;  3IAS 2;  2QQ8 A;  4FX0 A;  5B1B H;  3CCQ I;  2M7A A;  4HDU A;  1YFH A;  3HTS B;  4HZF A;  2BGC A;  4LK1 F;  1D8J A;  1X1B A;  2MAB A;  3L2U A;  1SMT A;  3GYH X;  2EIK H;  3O2P E;  2O6G E;  1G3W A;  3E6M A;  2ELJ A;  2VKE A;  2QBY B;  1DGW Y;  2LY1 A;  4CCK A;  3LSI A;  1Z77 A;  1Y0U A;  2L7Z A;  5ILS A;  1ZG5 A;  1QPI A;  2V9K A;  2NVQ J;  1RKW A;  2J5O A;  5KVR A;  1T0F A;  3CO6 C;  2P7C B;  1X19 A;  2XIG A;  3F8M A;  1ZRF A;  1FPQ A;  1B9M A;  4HNV A;  3PUF A;  1IXS B;  2A6H F;  2DBB A;  3C2G A;  4QLC U;  2K3F A;  2IRF G;  1IRZ A;  3K4C A;  3H36 A;  5AON A;  2DOF A;  3OYG A;  3IV5 A;  2BW3 B;  3CCS I;  2H6B A;  3HOZ J;  2GAU A;  4BDZ A;  3JRH A;  2CJJ A;  4KYW A;  1HKT A;  2WAQ N;  3F6V A;  1MGT A;  5L3B A;  4J01 A;  3U2R A;  2WC2 A;  3CCU I;  4AYB A;  4QIW N;  2DO7 A;  2OTL I;  4L5I A;  2Y69 H;  3BRO A;  4IOA F;  2Q0O A;  1QZE A;  3M1E A;  1GHC A;  2A6T A;  5J40 A;  1XGN A;  3B02 A;  4N4N B;  3DBR B;  1NK2 P;  3L2V A;  2XF6 A;  5EEG A;  1LVK A;  3K6G A;  2FML A;  1GV5 A;  2MH2 A;  4F3Q A;  4Q47 A;  2DA6 A;  1OCZ H;  2ICW G;  4CUG A;  4LG3 A;  1LDJ A;  3FBN B;  4BJ6 C;  3W6J B;  3OR1 C;  5FLX Z;  3L00 A;  1ETK A;  1ZTR A;  3BQZ A;  3GTQ J;  1FC3 A;  2F4O B;  4DYQ A;  4OAY A;  2PMU A;  3RPU A;  5A2Q K;  4HX7 A;  4C3H J;  5TRD A;  5BMZ A;  5EEH A;  2CO5 A;  1H9T A;  4I7H A;  3S1Q J;  3ERM A;  4MEX F;  2DTR A;  2OC6 A;  4XN3 A;  4BJ5 C;  3F22 A;  3OV8 A;  2W00 A;  4EQQ A;  3I4M J;  3ABT A;  2VXD A;  2PJR B;  2QWW A;  4BQQ A;  1W0U A;  3IRQ A;  2IW5 A;  4RAZ A;  4M6Y A;  1VQ8 I;  2FXA A;  1RRJ A;  1G3T A;  4EMS A;  5JHU A;  3RKQ A;  1LEB A;  5DCF A;  1J2X A;  3E5X A;  2F4M B;  4NC6 A;  2EIM H;  1V5F A;  2PX9 A;  1WJF A;  3VEP A;  4R8H A;  4BL0 B;  5D4S A;  3OOP A;  4BE0 A;  4RLQ A;  4AIJ A;  1I50 J;  2X6O A;  3VYT B;  2D45 A;  1Y1V J;  4PJJ A;  4BKX A;  2IT0 A;  1NHA A;  3S32 A;  3SDG A;  3BCA A;  3EDP A;  4IRG A;  1BW5 A;  3A01 A;  1WQ2 A;  3HOW J;  1CF7 B;  4Y4R A;  2FQ4 A;  4IOC F;  4L9T A;  4J19 A;  3CO7 C;  4IHS A;  2M0C A;  2HVR A;  2HYJ A;  5C3E J;  1UCR A;  3HOT A;  1V4R A;  2XB5 A;  1L0O C;  2OF7 A;  1J7K A;  2IXS A;  4OIQ F;  2QVO A;  2VQL A;  2W85 A;  2XRO A;  3OYJ A;  4UVB A;  2HZT A;  3RTR A;  2EFW A;  2O8K A;  4CHU A;  2RN7 A;  4D9J A;  5F6F A;  3S93 A;  2BW3 A;  1FWZ A;  5B66 C;  4HW0 A;  4C30 A;  2OZU A;  2CRG A;  1K83 J;  3BQY A;  5HS7 A;  1QHH D;  3H9G A;  1SVL A;  5B3S H;  3K4J A;  4Y15 A;  1TNS A;  1IRF A;  3GO5 A;  1XSD A;  3RKY A;  1LFU P;  2BOL A;  1GDT A;  2VOD A;  2Z16 A;  3BR5 A;  4RAF A;  3OYE A;  2CQK A;  2GIV A;  4AIK A;  3MZH A;  4HF0 A;  2X1D A;  3ZPL A;  3B73 A;  2CUE A;  5K5R A;  1JKO C;  3VB2 A;  2XAS A;  1H89 C;  2A6E F;  1BI2 A;  2FMY A;  1GXP A;  1ZKG A;  2K9N A;  3C7J A;  1MKM A;  5AIQ A;  4QWQ A;  2L9V A;  4CZC A;  1TT0 A;  2RVC A;  4RB2 C;  3O8H A;  2OA4 A;  1HLV A;  1O4X A;  2G7H A;  3K4L A;  2V79 A;  1H0M A;  1IDZ A;  3OYL A;  3R61 A;  5HOD A;  1S6L A;  4CH7 A;  3F6O A;  2VOO A;  1XC5 A;  1SD4 A;  2L9N A;  1XD7 A;  2X1C A;  2DA4 A;  3CJQ B;  4P1W A;  2CV0 A;  3PO2 J;  1G3S A;  1RKT A;  5D5U B;  3V7S A;  1TTY A;  4GO1 A;  3GVA A;  3KX2 A;  3ELK A;  3ZR8 X;  2A07 F;  5F1R A;  5LBQ A;  1OCO H;  2E2I J;  3TL4 X;  1WFX A;  4IL6 C;  2X0L A;  4BEH A;  3J81 K;  5EG0 A;  3PNY A;  2ZME A;  4XRS G;  5H20 A;  2NRA C;  4GCV A;  4GYI A;  3PNV A;  3OYH A;  2WY7 Q;  5E17 F;  2CW0 F;  3B6C A;  2H27 A;  2WBM A;  5HDN A;  1IXR C;  3BG9 A;  3ZQQ A;  3RKW A;  3V8L A;  3AG3 H;  5GAD J;  5LGT A;  1KA8 A;  2PMZ N;  4U87 A;  5BPD A;  2JSC A;  1RC9 A;  4XOR A;  5EYR A;  3WHB A;  5FO5 A;  2R7V A;  2TCT A;  5IP9 J;  2O9L A;  2JPB A;  4S04 A;  2HPI A;  4TV7 A;  4XK4 A;  3ZQL A;  2L3D A;  1H8A C;  2GZW A;  5ICE A;  2HOA A;  3E0J B;  2V1N A;  1K78 A;  2L54 A;  5K7F A;  1FP2 A;  2PEX A;  5E1Z B;  3OYM A;  4LIV A;  4UV8 A;  4FQG A;  4WX9 A;  1EH8 A;  4IRI A;  2H8W A;  1BBY A;  2MFZ A;  2UXX A;  4DW6 A;  1KU3 A;  3PL8 A;  3ZGK A;  4FCY A;  1X3Z B;  3ESW B;  2YSR A;  1D8K A;  1TWH J;  1OR7 C;  2FQ3 A;  2W82 A;  1Q1H A;  1QGP A;  1KYZ A;  1VND A;  2W4S A;  4S0H B;  4E4H A;  1QNT A;  3ISP A;  1SFU A;  4LIT A;  4A3B J;  1OPC A;  4N0B A;  4KFC A;  4E7K A;  1FIP A;  4RB0 A;  1B8I B;  3CES A;  4I09 A;  5D5V B;  2A5Y B;  1USS A;  1HQC A;  2V1D A;  4ZZL A;  2CV2 A;  3PUB A;  2BV6 A;  2BE5 F;  3FXU A;  4ZYH A;  4HDV A;  2K5C A;  4A3G J;  3CC4 I;  1FT9 A;  4V19 K;  4A3L J;  1OKR A;  3K1M A;  4AC0 A;  2VC1 A;  1YE9 A;  1B59 A;  3AKZ A;  4M6V A;  4ESB A;  2AQF A;  2NVX J;  2RDP A;  1IF1 A;  3FK7 A;  1TBX A;  1ZRE A;  3HOV J;  2WV0 A;  1I6X A;  3BY6 A;  1YTY A;  1VTN C;  2R92 J;  3OYC A;  3BT9 A;  4FIS A;  3VOD A;  3HXL A;  4FTH A;  5FLV A;  3HHG A;  1XDU A;  2R7S A;  3AL0 C;  1KQ0 A;  1A36 A;  1FY7 A;  4YFK F;  3ZQF A;  2M45 A;  2DPD A;  3AG2 H;  3EYI A;  2AHQ A;  2LG4 A;  4O6J A;  1QRY A;  2P6T A;  4BE1 A;  3TOB A;  3QU6 A;  5BOX A;  3V7R A;  5EDN A;  3M8E A;  1BOB A;  4XSZ F;  1PDN C;  2EZH A;  3E6B A;  4QPQ A;  3LA3 A;  5EG0 B;  1ZEL A;  1DGR M;  3J80 Z;  3CF2 A;  2JRM A;  1WH7 A;  2M0M A;  3GZN B;  3KP2 A;  3OMY A;  3ZMZ A;  3K1P A;  3TO7 A;  4I02 A;  3T1B A;  4XRF A;  3KZZ A;  4D7M A;  1MDM A;  4EVI A;  3VSK A;  1YRN B;  1RR7 A;  4BY7 J;  3JRE A;  3GME A;  3L7W A;  4HQE A;  5BS6 A;  5F0H A;  3P7N A;  4G6Q A;  2KHM A;  5ED4 A;  3CUQ A;  2ZNZ A;  3K2Z A;  4A3J J;  1SFO J;  2BVL A;  3MVP A;  3SZT A;  3DBL B;  4M9X A;  2EFN A;  5LFA A;  2BHY A;  2RQP A;  1WI3 A;  4EJV A;  3J7Y J;  1SFK A;  2G0E A;  1NTC A;  3O3K A;  1J09 A;  1BOA A;  3UNG C;  2UWM A;  2DAO A;  2R4G A;  1U5T B;  1IRX A;  2PFB A;  1ON1 A;  5IT3 A;  1WI9 A;  2CYY A;  3CDL A;  1A04 A;  1S72 I;  2DJN A;  3OYD A;  1FOW A;  4I0A A;  3DXJ F;  4PSX A;  1FEX A;  1MDM B;  1YRN A;  3PO3 J;  4ZDP A;  3MFK A;  2MG4 A;  2JWT A;  3ECO A;  3WTS C;  1TWG J;  2A69 F;  2L4A A;  4MEY F;  2M87 A;  2STW A;  2EZK A;  5TIS C;  1WKM A;  1BJA A;  3HKZ N;  1BC7 C;  4IHX A;  4A6D A;  2ZJR F;  2P7V B;  1L3L A;  4NQW A;  1SFE A;  3HYI A;  2Y2Z A;  3B6A A;  1S7O A;  4PJ0 C;  4KNY A;  2B63 J;  1RI7 A;  5IOY A;  2KIU A;  4JQF A;  5HS9 A;  2MD5 A;  4M3E A;  2A68 F;  3TP3 A;  1ENH A;  4XSX F;  1R5G A;  4BAY A;  3RKX A;  4CCN A;  3K4K A;  4WXH A;  3A2K A;  2DA7 A;  2P6S A;  3I3L A;  2HQ5 A;  2LBF A;  3QPT A;  4PGG A;  4DQ2 A;  2ZFU A;  3W2V A;  1FTT A;  4CCJ A;  4C9Y A;  2V4J C;  5DD4 A;  1IW7 F;  1VQP I;  4HNU A;  1SD5 A;  2QQ9 A;  2RNG A;  1WJB A;  2NVU B;  3KP6 A;  1IN7 A;  4B09 A;  4AWX B;  2OQG A;  3HC7 A;  4ZTJ A;  4U7B A;  4XOT A;  4LB5 A;  1SEU A;  3GZ5 A;  3C1D A;  4YFN F;  3Q3S A;  3ZQH A;  4UUV A;  2FRH A;  3K4N A;  1BN5 A;  2WA0 A;  1ZQ3 P;  2XPV A;  3HOU J;  1XCB A;  4XN0 A;  3BLY A;  1I5Z A;  1VQ7 I;  3E6C C;  2R7X A;  2M9H A;  4EJO A;  2DT7 B;  4IQ4 A;  1SMY F;  4XBF A;  2NVY J;  3I64 A;  3NEU A;  4WWC A;  1R58 A;  1F9N A;  1PYV A;  4GXO A;  2R5Z A;  1JTY A;  4ZYG A;  4CIC A;  3V4G A;  3WU1 B;  2C6Y A;  1VF9 A;  2QKL B;  3GLL A;  3BR1 A;  3X2Q H;  1DU0 A;  1Z6R A;  5GAE J;  5IP7 J;  4HG2 A;  2QSG X;  1YJN I;  1VQO I;  3QRF F;  2R93 J;  5F04 A;  3W2W A;  2ECC A;  2JUG A;  3DWL E;  3FXJ A;  3NAR A;  5TGT A;  1R4M B;  2ID3 A;  1JT6 A;  1W5T A;  5ICC A;  1T95 A;  1W1W E;  1LVA A;  2DOD A;  2FOW A;  1JJ6 C;  4IXA A;  1HCR A;  2A3S A;  4P55 A;  4A0Y A;  2IJL A;  1S7A A;  1X2M A;  5DDG A;  4ITV A;  3PIO F;  2NS0 A;  5CVJ A;  2ID6 A;  1A31 A;  2BY0 A;  4B8X A;  1IRG A;  1KON A;  3CLQ A;  3CMA I;  3CF5 F;  1MJ9 A;  3OIO A;  2QF7 A;  3VYU B;  3HSE A;  3PNT A;  5K1Y A;  4WK8 F;  2QKM B;  3JRC A;  4XLP F;  3S8P A;  1WJ5 A;  3DPL C;  2KPM A;  2EZL A;  3ABM H;  3RIR A;  1YG2 A;  4NQW B;  2EV0 A;  3GXO A;  4BAC A;  3OL3 A;  5L3G A;  2EFP A;  2JVH A;  2KQR A;  2BBY A;  3NRV A;  3S1N J;  3KLN A;  2DQL A;  4FET A;  5FLX K;  1P9Q C;  1D3Y A;  1R4N B;  2E5N A;  2RKH A;  2ELK A;  2XF5 A;  1JHH A;  2YS9 A;  1HF0 A;  1SAU A;  1XS9 A;  1U8R A;  4D0P A;  4U7D A;  1U8B A;  2DPU A;  2EV6 A;  3HRT A;  3CJN A;  5CKT A;  3GZ6 A;  3BJA A;  3J7Z I;  1I39 A;  2QSF X;  2XRN A;  4UUS A;  1W7P D;  4M3D A;  2GXG A;  3GCM A;  3JTG A;  2XPU A;  4IX7 A;  3KCC A;  4KMU X;  4QSH A;  3U1D A;  1JGG A;  3I9V 2;  2V1X A;  1P4A A;  3WHC A;  2HFH A;  5DUK A;  2DCE A;  4BUP A;  1O3S A;  4MNU A;  4HPQ A;  2QSH X;  1W7P B;  5FKN A;  4MGR A;  3O6B B;  1EF4 A;  1ETW A;  3TO9 A;  2GXA A;  2M2E A;  1RET A;  1X1D A;  2DK5 A;  2KIS A;  3CUQ C;  2IAI A;  4BQO A;  3LST A;  5HLG A;  4KMF A;  3S2D J;  2LNB A;  1F36 A;  1T8I A;  3RYP A;  1HXD A;  5E8I A;  2ZKZ A;  3CME I;  1D0Z A;  3TP0 A;  5J4V A;  3PJR A;  1NK3 P;  2O5R A;  3N05 A;  4DIQ A;  2J5P A;  2BY2 A;  2BEO A;  1U5T C;  3BOQ A;  1E3P A;  3OYK A;  2Z3Y A;  2VBZ A;  3U9G A;  2EFO A;  1BW6 A;  5FJ8 J;  4PUS A;  4XLC A;  3SEZ A;  3HUG B;  1P4W A;  3HKZ A;  5LLQ A;  3KET A;  1V54 H;  2COM A;  3ZMS A;  2Y30 A;  1GT0 C;  1LQ1 A;  1S9H A;  1I3A A;  2YPR A;  1GV2 A;  3OL4 A;  3D5S C;  2OD5 A;  1OCT C;  2R7T A;  2WY8 Q;  2DK8 A;  1OLT A;  1P7I A;  1PUF A;  2GIZ A;  3E5Q A;  1FYK A;  1YW7 A;  2E1M C;  1TNT A;  4UY8 I;  1IG7 A;  2HXI A;  5GP9 A;  5KCM A;  3TO6 A;  2KZG A;  2STT A;  1H88 C;  5E79 C;  2K02 A;  3S2H J;  1WSU A;  2DMU A;  3HUG A;  4BQN A;  2BHZ A;  4DNC A;  1FOX A;  4PDK A;  1S8N A;  1XDS A;  1ACI A;  2E7W A;  2NYX A;  3R60 A;  2MBF A;  2PQ8 A;  4A0Z A;  4HA8 A;  3LWF A;  4JYK A;  1WHU A;  1G6N A;  1Y39 A;  5E1X A;  1IN6 A;  3EUH A;  4U0Y A;  2G7U A;  3FBI B;  5ILV A;  3JRD A;  5J8F A;  4G9Y A;  3CDI A;  3C2H A;  3I4P A;  4ETS A;  2DTZ A;  5JFR A;  2H09 A;  1P7J A;  5HDK A;  2DMN A;  3ULQ B;  3DCF A;  1LUJ B;  2CQ7 A;  4YEL A;  2HS5 A;  1J9I A;  1VFC A;  2M30 A;  1A6Q A;  2JMW A;  3FXL A;  1ZGJ A;  3GFI A;  4WCG A;  4UXN A;  2JA7 J;  2LF7 A;  1X4P A;  3WTT C;  1FBQ A;  1B4A A;  2CUZ A;  3BWG A;  4XIC A;  1SAN A;  1HC8 A;  3K1N A;  3LOC A;  3W6V A;  3EYY A;  1QBJ A;  1Z7L A;  2HVS A;  3FZV A;  3VOE A;  1Z9C A;  5IYD J;  4LLN A;  2QM3 A;  1JKQ C;  1XMA A;  3D5L A;  3JRF A;  3LAP A;  3LAJ A;  3TBI A;  2AQE A;  2RQQ A;  1QA6 A;  3HPH A;  5FKO A;  3HG9 A;  3S16 J;  4RGR A;  1Y0N A;  2KJC A;  3NQO A;  2NAZ A;  2LR8 A;  2IS4 A;  2OAZ A;  3KLO A;  3JSP A;  2DMT A;  3EUK L;  3DQV C;  4NBQ A;  5HNF A;  2R7Z J;  1JKP C;  3QPL A;  3JRG A;  1ZHF A;  2M5W A;  2FD5 A;  2K4B A;  2EA2 A;  1AU7 A;  2EPF A;  3M4O J; 
#chains in the Genus database with same CATH homology
 3CCU I;  3I56 I;  2ZJQ F;  4UY8 I;  3CCJ I;  2OTL I;  5GAG J;  5GAH J;  1YI2 I;  1VQ7 I;  4IOA F;  1VQP I;  1QA6 A;  2NXN B;  1VQ5 I;  1HC8 A;  3CC7 I;  3CCQ I;  3J7Y J;  5DM6 F;  2FOW A;  3CCR I;  2OTJ I;  1FOX A;  2K3F A;  2ZJR F;  1ACI A;  3CD6 I;  3CC4 I;  1VQ9 I;  4V19 K;  3CJT B;  1VQM I;  1YHQ I;  5DM7 F;  3PIO F;  3CCE I;  3CCV I;  3CCS I;  3G6E I;  1S72 I;  1FOY A;  3CCL I;  1VQL I;  3G71 I;  3CMA I;  1FOW A;  2ZJP F;  3CCM I;  1YJW I;  2JQ7 A;  4IO9 F;  2QA4 I;  1Y39 A;  1VQ6 I;  1YIT I;  3CF5 F;  1VQN I;  2H8W A;  3I55 I;  2E34 A;  5GAE J;  4IOC F;  3G4S I;  3CC2 I;  5GAD J;  3PIP F;  2E35 A;  1MMS A;  1YJN I;  1YIJ I;  2E36 A;  5JVG F;  1VQO I;  3J7Z I;  3CME I;  1VQ4 I;  3DLL F;  1VQK I;  1YJ9 I;  1VQ8 I;  2QEX I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...