3I56I

Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
GVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
publication title Structures of triacetyloleandomycin and mycalamide A bind to the large ribosomal subunit of Haloarcula marismortui.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2009-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
I PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Ribosomal protein L11, C-terminal domain 3i56I00
1S72I 3CMEI 1VQ9I 1VQPI 3CCMI 2H8WA 4V19K 3G6EI 1VQKI 3CCSI 2ZJRF 5GAEJ 1YITI 3I56I 1VQMI 2E35A 1YI2I 2ZJQF 1YJNI 1VQ8I 1VQ5I 3I55I 3CCVI 5GADJ 2ZJPF 2OTLI 1QA6A 1MMSA 3CD6I 5GAGJ 3DLLF 1FOXA 1VQLI 1HC8A 3CCJI 4IOCF 1VQOI 1VQ4I 1YIJI 3G4SI 2NXNB 3CCUI 3CCRI 3CJTB 2K3FA 1YHQI 1YJ9I 2JQ7A 3J7YJ 3PIPF 3CMAI 2QA4I 2E34A 1ACIA 3J7ZI 3CCEI 3CCQI 5GAHJ 4IO9F 3CC2I 2FOWA 4UY8I 5DM6F 2E36A 1FOWA 1VQNI 1FOYA 3CC4I 1VQ7I 1Y39A 3CCLI 5JVGF 5DM7F 2QEXI 2OTJI 3PIOF 1YJWI 3G71I 1VQ6I 3CC7I 4IOAF 3CF5F
chains in the Genus database with same CATH superfamily
5J1UA 3K1PA 3MZHA 3ABLH 1WPKA 1SAXA 4WWCA 2L7FP 2QQBA 3KP7A 1DGWY 3GTMJ 3L2WA 1A36A 3G3ZA 3R4KA 2FXAA 5HNFA 4HPQA 4NQWA 1W5TA 2DLLA 2JPBA 3REOA 1POGA 3GFIA 2G0EA 2NOGA 1OPCA 4XKWA 4C2UA 2MD5A 2RN7A 5F64A 5J3LA 5LRRA 4XLHA 5HDNA 1R4NB 1HDDC 2G9WA 4Y13A 1LPQA 1B8IA 4HF1A 4Q47A 1I27A 1DUXC 4OMYA 2LDUA 1UHWA 5E1XA 3GX4X 4U88A 3BG6A 3IAM2 1B8IB 1MBFA 1VZ0A 2CQNA 4N9IA 2DT7B 3V42A 5J47A 3HOVJ 3BR1A 1ZGWA 4R79A 2ZMEA 2RQPA 1WGXA 1ZR4A 1QA6A 4S05A 3HGYA 1EH6A 3KP4A 2GOXB 3QP6A 4UB6C 3ERMA 2FMLA 3IH3A 2DU9A 4ABZA 4X0GA 9ANTA 1I39A 2XPVA 2JA2A 3OMYA 2BHYA 5FLXK 1VQ4I 2VKHA 1I6XA 2DYRH 3RDIA 3LSGA 2NXNB 4L9TA 4XONA 2BOLA 1J5YA 4Y3OA 4II2A 4ANJA 4H0EA 1DPRA 2EWNA 4BNCA 3C18A 1ODDA 2R7QA 1ZAOA 1VFCA 2B0LA 5DD4A 1XTAA 2HDCA 4ZDLA 3WE3A 5FD5A 2HKXA 4CA0A 5BOXA 2FBHA 2HOEA 2XASA 2EIKH 2K9QA 1E3OC 2PMZA 5JR3A 2FUG2 1YW8A 3SEZA 3F8NA 3FMSA 3KZIC 1FIAA 4C3JJ 3D5LA 5JHUA 2LC2A 4P5OA 3W3CA 2M3AA 4IO9F 4CYCA 2H1LA 3GEZA 1UJ8A 3CC2I 2E1OA 3B73A 2XAGA 4GRIA 4XLCA 4MIMA 3FHNA 2XHKA 3FMQA 1T33A 2LR8A 5H6QA 1B6AA 2EILH 4YFNF 3CC4I 1TWAJ 3L1PA 1XMAA 4CYDA 5JLWA 1LVKA 3FISA 4U0WA 5D8KB 5JVGF 2F5EA 2M4GA 5EF6A 4CXFA 2NOJB 4HX7A 4RS8A 3QPLA 1ZH5A 2M2EA 4BJ6C 3BPXA 4XRSA 2VBYA 4OINF 3IC7A 1Z0XA 2UV1A 2ZC2A 1LNWA 4M9SA 1R49A 1LDDA 5E3NA 2W00A 1K83J 5FLXZ 3WTTC 3IRQA 1LFUP 2JA7J 3E5XA 1HW2A 5CVVA 3CCMI 2DOAA 2H8WA 3KP6A 4X1EA 4OIQF 1N25A 3WTYC 3KZZA 2LOOA 1FMVA 1LFPA 3EUHA 4XLEA 3ZQQA 3BWGA 4EM2A 4E7JA 3SHFA 1PUEE 2RREA 3GBGA 2TCTA 1VQ5I 1TNSA 2VODA 2X48A 4AD9A 5HDKA 2E2IJ 3HRUA 2HQ5A 1IXCA 3ONQA 5D5WB 1LEBA 3CZ6A 5FFZA 4WXCA 3GTLJ 3MKLA 1UZCA 3DLLF 1MJ9A 4RA2A 3VFZA 5B66C 4M71A 5DTDA 5L3FA 2JA5J 3CCYA 2FJ1A 2P6SA 5LD2C 4CZCA 2R7SA 2YUSA 2IXSA 3B6CA 1YIJI 2XPUA 3OIPA 5DUIA 2CUJA 1T2KA 1SFOJ 1BW6A 2IS6A 3S1NJ 2RVCA 4DZJA 5F0FA 4QTRA 2LF8A 2VN2A 2Y2ZA 3I54A 3M8EA 4KICA 3W2WA 3IL2A 2L02A 2L54A 1XG1A 2XUBA 3BZ6A 4Y33A 4RDUA 5K7FA 4KIBA 4YELA 1X2MA 3L09A 3IWZA 3QOEA 3Q9VA 4A2UA 1FBSA 4LITA 2DFIA 4PGGA 4B44A 5EDNA 1RNLA 3AG1H 3K4LA 1GV5A 2V9PA 5KCMA 3KYDB 2FU4A 2YPRA 4EJWA 2Y69H 3TMOA 5GAHJ 3S93A 1S6LA 2JPCA 2VL8A 1BI2A 2FF4A 1SFXA 5CLSA 2R7ZJ 1MKMA 2MA3A 4IRIA 5CJ9A 1K79A 4XN0A 2LKPA 1I3AA 1T38A 3WTVC 1TBXA 2XGEA 5F0CA 3OYDA 4LMYA 1GHCA 1D5VA 3L7WA 5BQTA 2K40A 4M3BA 5TISC 1FT9A 5B5EC 1XGNA 3SEQA 2GLOA 4LGWA 4NBQA 1RZ4A 1YJWI 1XCBA 1OYIA 1I3QJ 1FMWA 4JX6A 3RCOA 1B72A 1K6YA 1V5FA 1ZR2A 3B02A 5E3LA 1W0UA 1L0OC 3K69A 5IP6A 1SFEA 2KDZA 4FX0A 1LKXA 4BQNA 1S72I 1B72B 4MEXF 5F27A 3OYJA 5BPIA 5ERIA 4YG2F 4AVPA 2HOAA 2HZDA 5BMZA 1MBKA 4E7LA 2L2OA 1MIJA 3SZGA 4KT5C 3LNQA 5LEKA 1GXQA 1STZA 2W24A 2LK2A 2E1NA 2EFWA 1N75A 1I50J 3OV8A 2DDAA 2C6YA 5KAIC 2XIGA 2KIMA 3A03A 1L3LA 2M7AA 3ASNH 4G6QA 1FC3A 4UVCA 2FBKA 5CQEA 4DYQA 4RAFA 4FQGA 3OYKA 1U5TA 2YU9J 3GMEA 2HVRA 5HVQC 3O8GA 2O7OA 1F9NA 4IOCF 1P2FA 4L9NA 5LRSA 3QQAA 1W4MA 2ECCA 5K5QA 3FBNB 3FXLA 2ISZA 2ELJA 1YG2A 3P9CA 1MMGA 1VI0A 3ZMSA 1EV7A 3CTAA 2E2JJ 4E4HA 3PJRA 3H3UA 2R7FA 4LK1F 1IRGA 3PNTA 4M6YA 4A0YA 1K4TA 1ETWA 3A02A 3OSFA 4A0ZA 1MJAA 1R1TA 1MNEA 2VJJA 2PQ8A 1BM9A 1SVOA 3D5RC 2NVYJ 4UXNA 5C4JJ 4L0ZB 4GO1A 2EZHA 1UG2A 2DOFA 5E1WA 5FKNA 5IT9K 3CJNA 2M87A 2FX0A 4LJZF 2QKMB 2X6XA 2ZSIB 3ZQCA 3S3NA 2VXDA 1Z3YA 1T8IA 3DP7A 1JTYA 3IWFA 1R5ID 1DU0A 3W6JB 4DJAA 1ZLKA 3EETA 3ZPLA 3FM3A 2H1KA 4B3AA 1FZPB 4PSXA 5DD8A 3ECHA 4D0PA 3JRDA 2CW7A 2VXZA 2VOOA 2HTJA 3HKZA 3T8RA 2EIMH 3G73A 2DMTA 3BROA 1WI3A 2ADUA 2X6OA 1QU3A 5KVRA 2HXOA 3JRBA 2K7LA 1W36C 2R7UA 2GXBA 4AWXB 4XKVA 2V4JC 2QBYA 2IAIA 3ABUA 3P9IA 1KYWA 3GW2A 3ZQLA 1Y1VJ 3RJPA 4BAYA 3G1LA 4ZYGA 3QU6A 2FD5A 4JOMA 2KZGA 3WHCA 4CGZA 2VQGA 3BCBA 1T98A 2HWVA 3GVAA 4UB8C 4EM0B 1E3HA 2E60A 3HUGA 3IKTA 2O3FA 1N78A 2Y75A 4FCYA 2DA6A 1XMXA 3GFJA 3J81Z 2W57A 3DPLC 4MQ9F 3TW7A 3VYUB 1WJCA 2I8DA 3HB9A 2WAFA 1J0RA 3HPHA 5FRNA 2HFHA 3BG3A 3S17J 1IC8A 1KU3A 2EPFA 3ZQ7A 4N0BA 3CCVI 4KDPA 4ZTFA 3DBHB 1MBJA 4IL6C 5LGTA 2VLAA 2VPRA 4DYRA 3HKZN 3HC7A 3GZNB 1ZTRA 1FBUA 1P4AA 3N4MA 2DMPA 5IPAA 2NVQJ 1HQCA 4NHJA 1ZKGA 2NS7A 3WTWC 2WTEA 3S2DJ 1UFMA 2KISA 1FX7A 3VOEA 3OYGA 1LE8A 3CCJI 5TGTA 3ZQFA 3ZRGA 1UAAA 4EM1A 2LY2A 3WU1B 3LSMA 3K4NA 2RNGA 1AU7A 2L9SA 1H8AC 2BW3A 1KQ0A 3NAUA 2CV1A 2Y9YA 2VBWA 2BV6A 2E1CA 1MGTA 3SXYA 1SD6A 3JAMK 5AONA 3KEQA 4BHBA 1A31A 1BOBA 1MD0A 2L4MA 2VBXA 3LSHA 5E3OA 3E1SA 2W1OA 3NQOA 4WXHA 2IPQX 4PDKA 1IJWC 3BPVA 4I99C 4G9YA 4YRVA 4B3XA 3PIPF 3ZP5A 1O3TA 4LD5A 1O3SA 2LF7A 2P81A 3R6SA 2D45A 4OMZA 3L9FA 3TOBA 2OC6A 2XPWA 2R5YA 1YIOA 2AXLA 5CVIA 4YFXF 1A35A 5LLQA 3RKYA 3J7AO 4F55A 5HS7A 5F1JA 3ZN0A 2CG4A 2R5YB 5AIQA 4AU7A 2E36A 5HNHA 2ECBA 3ZMDA 1DP7P 1CQTA 5LGUA 3GCMA 1C0WA 2HDDA 5AIPA 5JFRA 5L3EA 3CCLI 4UUSA 2L7ZA 2DBBA 3OYEA 2BVMA 3J80K 1Z21A 1X3UA 1JGGA 3Q9SA 3BP8A 3F23A 2LFBA 2XRNA 1KGSA 3G2BA 4XLAA 3ZMTA 1JJ8C 3X2QH 1OCRH 3BY6A 4LB6B 1QRYA 3GO5A 4AYBA 2F48A 1TTYA 5E8IA 1JJ6C 2MW8A 3OWTA 4G8XA 4ETSA 2EFPA 2H6CA 5M3FJ 1J75A 2UZKA 1TZLA 1K61A 5LHHA 4QSHA 1YITI 1VQMI 3VODA 3WU0A 3BJAA 1DQUA 4Y17A 3JAMZ 2EV6A 4CCMA 3DKXA 1K78A 5L3BA 3AL0C 2DA5A 3VEPA 1XS9A 1P9QC 4EQQA 3FXRA 3LL7A 2STWA 2ISYA 3V8JA 2MH2A 1O3RA 2R7RA 5GADJ 2ZJPF 3OSGA 2XC7A 4K2EA 5EYRA 2A05A 1QGPA 4A3CJ 3HTUA 1IW7F 1EH8A 4BBSJ 4HF2A 5A2QK 2N8GA 3MWMA 1XDUA 2DDBA 3T1BA 3A0HC 3H35A 2I5UA 5IP9J 1Y0NA 1GLNA 2X4HA 2HOTA 1D1AA 4M74A 1BOAA 1PYVA 4HX8A 4RAZA 1FY7A 2HDWA 3CJTB 1TW3A 2PBIA 1G3TA 5HLIA 2CH0A 2DO7A 2HVSA 2BVLA 1S7EA 2WAQA 1QNTA 2M8GX 1R1VA 4ON0A 5IYBJ 2JQ7A 1SD7A 1ZARA 2XAUA 1LDKB 3F9KA 4HDVA 3Q5FA 3QRFF 2A69F 2CJJA 3KFWX 3RIRA 4WCGA 5EG0B 4A12A 4HQMA 4LFUA 5EEAA 3I59A 4KIGA 1SVMA 4CCOA 2M0MA 3BR2A 2DFFA 4XOPA 3S1QJ 4I6ZA 2P4WA 4I01A 1JT0A 2FOWA 2DA2A 2W25A 2K9SA 3F8FA 2V9VA 4FE4A 5ILSA 5L3DA 3CO6C 4CHUA 1OISA 1SVLA 1YO5C 2JJ7A 1SFKA 3AL0B 1FOWA 2Z1DA 3TO9A 3ZMZA 3KX2A 3O3KA 1XMKA 2Y0SA 2WB1A 5H2FC 1I5ZA 1HW5A 1OCPA 2KRHA 1FLIA 2F4MB 2O8XA 1Y1WJ 1X1BA 3PIOF 1FSHA 1RR8C 2DTZA 1OYWA 2H27A 4AIDA 5L3GA 1Y0UA 1XC5A 2WAQN 3FXQA 2JA8J 3SFZA 3UNGC 1KU2A 2AQEA 3VWBA 5DS9A 1SAUA 1MH4A 4L5JA 1NG6A 2LBFA 2CUFA 2GZWA 4P1WA 1RRJA 4D5FA 2ZJRF 4LOCA 4ASNA 3ZR8X 4HLYA 4RGSA 3MZYA 1XD7A 5IP7J 4E7KA 1HBXG 1TLHB 3CJQB 4LG0A 3PQKA 4G7OF 5BS6A 1BR2A 1BJAA 1HKTA 3K2ZA 4V2GA 1USTA 1U8RA 3FMRA 4ZTJA 2ZO4A 2FOKA 3GUDA 4KFCA 3U21A 2WB1N 4BXXJ 2CMPA 5D8LB 2CQKA 2D1HA 2HYGD 2XF7A 1A6QA 1EKEA 3PL8A 1S8NA 4OOIA 1Z9CA 1S5LC 2DMUA 1KU7A 2KDOA 4AIJA 3K9TA 4LLNA 2L7KA 2NAZA 3OYMA 1ZN2A 2YR2A 4UV8A 1QPMA 3E6CC 3ZOBA 3FBIB 3TDUC 4A0XA 2L9RA 2JUCA 2X1DA 1YRNB 1A04A 1YHQI 5J1RA 3OYBA 1YJ9I 3U9GA 2E2HJ 4LB5A 4ZYDA 2CU7A 1V5GA 1MMDA 5K7ZA 1RR7A 1U78A 2QGUA 2HYFA 3TO6A 3M3YJ 3I4NJ 2MG4A 4D5CA 3DXJF 4JX4A 3BTLA 3KP5A 4XLPF 2BZTA 1DGRM 1T0FA 1XX5A 2LVSA 3H9GA 3Q0WA 4XM3A 3D0SA 3HM5A 2IS4A 2K9LA 4C3HJ 3JREA 2PJRB 3WE2A 4NB5A 3VB2A 1FOYA 4RGRA 2R7DA 2IEKA 2VIXA 4FISA 3S3OA 2PMUA 2DA1A 1YFHA 2JUGA 2HXIA 1H9GA 1BA5A 3I3LA 3WODF 2LP0A 2DA3A 1NK2P 5M3MJ 3G71I 1VQ6I 3PSFA 2R7WA 1MJBA 3NARA 3DTEA 3WU2C 3WG7H 3AG4H 1F4KA 4ZZLA 3GTOJ 3SDBA 2PMHA 4Z2YA 4DGWB 2ME0A 3FXUA 5H6RA 1VQPI 4DQ2A 1UHMA 2GQQA 4M9XA 1JKPC 2MH9A 3K7AJ 2NNNA 1O3QA 1VQKI 2I10A 3VSKA 3GZ6A 4XK4A 2VE9A 2A5WA 2J5OA 2XF5A 1SEUA 5EEHA 1TQMA 3PQJA 2Y0MA 1WKMA 4UUTA 1BBYA 4HG2A 3K4CA 1YI2I 1G6NA 4LG3A 3K2AA 4KMUX 1YJNI 4ESJA 3HOTA 3KPHA 2WA0A 2VOPA 5DCMB 4AC0A 4DBQA 5J1YA 2QF7A 2ZFUA 1IRZA 1PP8F 3GYHX 1V5EA 3ZMVA 2E19A 3TEDA 1S29A 2PMZN 1HA8A 1P6RA 3L2RA 2M4KA 3KIOA 3ULQB 3IUOA 2WAEA 2DPDA 3HOWJ 4ZDOA 2WV0A 4QLCU 1J2XA 1X58A 2OU2A 4RLQA 4KA4A 2CQ7A 1HC8A 1V3FA 1W7PD 4ZH4F 3FXOA 2R5ZA 5FLVA 3KP2A 2OQRA 1T6SA 1VQOI 5EZGA 3RPUA 5D4RA 3WTSC 3E5QA 3CLQA 4PSWA 4HNTA 2R5ZB 2MC4A 1SMTA 4BS9A 1WVRA 2KKOA 4LLLA 5DEQA 1BC7C 4IHWA 2DYSH 4A3DJ 1G59A 2MLKA 3FX3A 2CS3A 4FETA 2CV0A 4M73A 1LQ1A 4U7BA 2XGDA 4RB3C 5EZHA 4CO8A 4KIFA 1KZHA 1LB2A 1JHHA 3FK7A 1DP3A 4HDUA 1X1PA 2FE3A 1ETVA 1JUSA 3NWTA 3IP4B 2E34A 1TWFJ 3TP0A 1ZK8A 1X1AA 4XRFA 5KNLA 3J7ZI 1W0TA 2L3DA 3FXMA 3RYRA 3CDHA 1QHGA 2LY9A 2ZKZA 3KLNA 3WGIA 3K70D 1B59A 1XPXA 2GIZA 3EUAA 3DU5A 3D1NI 4NUBA 5E1ZB 2BGCA 5CVRA 2XV4S 2TDXA 3F8MA 2R3SA 3RKQA 1RI7A 2CRGA 3DPTA 3IRRA 2P5VA 3DKYA 2WWYA 2OTJI 1WCMJ 2FRHA 2GIVA 4F93B 2XAFA 3R0AA 4WXDA 3H1CA 1JKOC 4EATA 3EYYA 1WJDA 1KONA 1Y6IA 4BU2A 1GVDA 4RAGA 4HEA2 4CUGA 4XQFA 3QPSA 2OUMA 2Q8KA 4TV7A 2BE5F 5ILUA 2K5CA 3V8LA 1QQIA 4M72A 2NVUB 2VT2A 4PFOA 1U9OA 1ETOA 4FX4A 1AA7A 2XB0X 2ZSHB 1TWGJ 2CGPA 4CCNA 4HF0A 3N97A 3H5NA 3PUBA 3KZYA 4KITB 5DDGA 1ZREA 2XGXA 2V1XA 3SZPA 1FNNA 2DK5A 3F21A 3HOUJ 2EK5A 4NC8A 3OOPA 3S2WA 2X1EA 1FYKA 4GXOA 3BR3A 4JBAA 3ABTA 3P9KA 2IA1A 1Z7UA 2JRTA 3ZCOA 1QVTA 5C3EJ 3CJRB 3H9QA 2ICWG 2VQCA 3NRVA 1AKHB 1R00A 2XAQA 2X0LA 2AXTC 3I64A 2QVOA 3JSOA 3CP8A 2W48A 2AO9A 2JSPA 3HSFA 4HQEA 3OL4A 3DBLB 1FYMA 5HLHA 2LTPA 5D4SA 1BN5A 3K10A 2A5YB 4Y15A 4PJJA 3G4SI 2ZXWH 2PLYA 4IPAA 1U3EM 4XIDA 3BTJA 1I1GA 2GOMA 3ABMH 3DWLE 1IXSB 2KJBA 4RM2A 2HI3A 1O4XA 2COMA 4E7HA 1D0XA 1E0EA 1MNMC 2BY3A 3ELKA 2D2WA 3M1EA 3GTQJ 2A61A 2BYVE 1S7OA 4RB0A 2KJCA 4M6XA 1U8BA 1R9TJ 4IQ4A 4C9YA 1VTNC 1SANA 4G6DA 4BE2A 1NK3P 2OA4A 5GTHC 1U2WA 2EA4A 3I9V2 4MGRA 3MKYB 2O61A 4IHYA 2HOSA 2UWMA 3FDYA 3OR1C 4PJLA 3CO7C 1RKWA 1ETQA 3LSTA 3GLLA 4Y52J 2ZXJA 3MFKA 2V6EA 1YX3A 4Q5SF 5IOYA 2QQ9A 2X1CA 3TOAA 2DJIA 5EEGA 2L4AA 4XN3A 3TP3A 2RC4A 3BQZA 2Z99A 1X2NA 4GCVA 2R93J 3KCCA 4HSRA 2CFOA 1R5HA 1KQ8A 4YIFA 2MSYA 2XKOA 2XAHA 2KRFA 1IUFA 1FPQA 2CO5A 1SD5A 1OCZH 4QWQA 1Z77A 2LD5A 2QQ8A 4I0BA 2LG4A 1IN7A 4HV5A 1K4SA 1ERDA 4N4OB 3CCSI 2KIQA 4OIRF 3FK6A 4FE7A 3S14J 2ACJA 3F8CA 5LBQA 1HKSA 4Q48A 4U87A 1H88C 1ORKA 3CESA 5GP9A 3O6BB 4QPOA 3W2VA 3L2QA 4N4NB 4OAYA 2M1BA 4XR6A 3HOYJ 1P92A 1XGSA 2DI3A 4I7HA 4JK1X 4PZJA 4J01A 1MSFC 1F43A 5BPDA 1WJ5A 2IGKA 1I1SA 3QYFA 2DXIA 2KFDA 1BIBA 1USSA 4BY1J 4C2MJ 1R58A 3DCFA 3CMMA 3CD6I 3RSNA 3H3VK 1Y56A 1XB4A 3AG2H 4A3BJ 3K0LA 4RGUA 1O7LA 1IN5A 2E7WA 4UNOA 1IXRC 3G1MA 1VQLI 2EQRA 1JI8A 3RZDJ 3P7NA 1TWCJ 5IYDJ 4L9JA 3SFIA 4HV6A 2DJNA 2M34A 4BH9A 4H4KC 5CYVA 5HS9A 3B6AA 2F4OB 3I71A 3LSKA 1KU9A 3MZ8A 4XSZF 2Q2EB 3ROUA 1IV8A 3A01A 2DQRA 1LFBA 3E7LA 5ICCA 2M8EA 2KPMA 1E2XA 4XRMA 5IT9Z 3A01B 5FKMA 1J9IA 1Y8QB 2LLKA 3K1NA 3MAJA 1IAWA 2F5FA 3J7YJ 2KMUA 3OS0A 1LJ9A 1R1UA 2EFNA 3BCAA 3R61A 4IJAA 4M3FA 2K9NA 1ZG5A 3BTIA 4KYWA 2M45A 4YIRX 4BXFA 1WWXA 1TP4A 4HW0A 1HSJA 2GWRA 1V54H 3LSRA 3LA7A 4PUSA 5E8GA 1PP7U 3UKGA 4L18B 5C4XJ 3R60A 3U1DA 2ZCWA 3EQLF 3GTPJ 2Z5UA 1FTTA 2K86A 4EEFG 1QPIA 4V2FA 1DDNA 2L9NA 3E6DA 1TL8A 3SJMA 3K4BA 2LNBA 4HBLA 2UXXA 2IGNA 2KHMA 3LA3A 1ZRCA 3S32A 3CMYA 3LQQA 2OZ6A 2HEOA 1IUYA 3CLOA 1FOKA 2RQQA 3VYTB 2M9HA 3BG9A 2HTSA 3FZVA 3M9AA 1ZG1A 2R7OA 3I0TA 3SDGA 1SFUA 2OV7A 3ABKH 3G6EI 4M3GA 3MN2A 2DFHA 2KZVA 2DFEA 2IA2A 4AUXA 4RM3A 3DEWA 1VF9A 3IH4A 4XOTA 3U2RA 1U6GA 3C2HA 4XORA 2P5LC 3E3VA 2ESNA 4LLGF 2DCEA 3GLXA 4RLFA 2EH3A 3GTJJ 1T56A 4QIWN 2TRTA 4U0YA 4EJTA 5JLXA 1JKQC 5CPRB 4LIVA 2HGCA 1ZG3A 4XRSG 3S1RJ 3BG5A 3PUFA 4ENJA 2VC0A 5BNGA 2FEZA 1XSDA 1P7IA 1PUFA 2H8RA 3MKZA 1P7JA 3DPUA 3WTXC 3ZQIA 3BJ6A 4XL9A 1J09A 2EINH 1X3WB 1PUFB 5HOOA 4RAYA 2K4BA 3HTSB 4F92B 3C1DA 3ZQHA 2YX4A 1IDYA 4HSTA 1G3WA 2QSHX 2KIUA 4DZPA 4LK0F 2RGVA 2M7BA 6PAXA 2JWTA 1BC8C 3V7SA 1TW2A 3CCRI 3Q0VA 1MNDA 1Z67A 1IZ1A 2NYXA 2FQ4A 4CDGA 2VBZA 1I6HJ 2WBMA 1D5YA 3F8BA 1HCRA 2O8KA 4GFBA 2A6HF 5DV5A 2OQGA 2OCEA 1OJLA 5IY5H 4PFPA 4BL0B 2QWWA 3JRAA 5K5OA 2LKXA 4B43A 3LWFA 2A6EF 4ENMA 5H20A 3J7AY 3KLOA 4IRGA 3KP3A 4BHCA 4KNYA 3DV8A 4AYBN 1MH3A 4IHVA 2IS2A 2VB6A 2L7MP 4YEJA 3HIFA 3I4MJ 3J80Z 2EFQA 3OYAA 1TQPA 4M9ZA 4A6EA 3OS1A 2YU3A 4BQQA 4CCKA 2IP2A 2JVHA 1WJAA 2P5KA 2O0YA 1JUPA 3OIQA 1JTXA 5EG0A 2IJLA 2L0KA 1B9MA 5FO5A 1VQ7I 3CUQC 1PDNC 1Y39A 3P5JA 4IF4A 1HF0A 4B47A 5HLGA 3DBRB 3HZJA 2DMQA 1OKRA 1Y8RB 3HHHA 1O7FA 3A4CA 1AWCA 2EJRA 4XKBA 1NTCA 4DNCA 4P55A 2A6TA 1YS7A 1EF4A 1R23A 2LREA 2M30A 4L5IA 1Q1HA 1ITYA 1VQ9I 3GZ5A 2ELKA 1D0ZA 1UHSA 3M7GA 1ZRFA 2CWEA 2EV5A 3G1OA 5TJJA 3KYCB 4L9VA 2EBIA 4OWRB 2DTRA 5F0HA 2BXYA 4XNFA 4RGXA 3ERED 2XKPA 2XVCA 4C3IJ 5B3SH 2E35A 3M4OJ 2WY8Q 4DYCA 1IF1A 2DQLA 3LQRA 4A93J 2G7UA 1V55H 4BHPA 4J00A 3LMMA 2W7NA 3WTZA 2HPIA 4MFDA 2WV1A 3LSPA 5A2QZ 2JZYA 3OL3A 4WF2A 3VPRA 2MBFA 3L00A 4IKFA 3TQNA 3CQZJ 1TT5B 3JR9A 1W7PB 1XSVA 3K4KA 3FWEA 2Y48A 4KJZA 4BYYA 2QYOA 4ITVA 4ZZDA 1NG7A 2VPLA 2D5VA 1FOXA 3OYHA 1P4WA 1QO0D 2PFBA 4GYGA 3HPGA 1QZYA 4D7MA 3QPHA 5IT3A 2NRAC 3KYLA 1W36D 1LEAA 2XROA 4OIPF 3LA2A 4ZYHA 3FKJA 4HOBA 1XCVA 1IN4A 3FKIJ 2ZMEC 3CUQB 3SQNA 5CVJA 4AIHA 4E6KG 3BDDA 3ML6A 2FNAA 5JHFA 2VUMJ 2OCCH 4R8HA 4XMYA 1YLFA 2E1MC 2Y0SN 2W82A 5HS8A 4UV9A 2V1NA 2RDPA 1Z6RA 3GXOA 5ICGA 1ZRDA 1YTYA 1TWHJ 5FD6A 1T95A 4CCLA 1S9HA 2KT0A 3JRHA 1HDPA 1A5JA 4JQFA 4B09A 4RB1A 2JRMA 3QU3A 1VNDA 1ZELA 2VI6A 4DW6A 3HXLA 1OFCX 2OZUA 1UMQA 4BQOA 2H94A 1OCCH 2L01A 1YRNA 4W1UA 3RZOJ 4UY8I 3L2VA 2X85A 2DOEA 4IQJA 4BE0A 4G6TB 2E5NA 5B1AH 1J59A 3H3ZA 2NNYA 4RBOA 3EPZA 1JHFA 1OYYA 4QPQA 2B63J 2LMDA 4NQWB 1R4MB 4EV0A 1UCRA 4BDYA 4JYKA 3KETA 2AQFA 3WGGA 3ASOH 1AOYA 2QSFX 2WC2A 3HRSA 4A3IJ 4IZZA 2L9VA 3QP5A 4M3EA 3V8KA 2V6CA 1FP1D 5TRDA 3HRTA 5DYMA 5D5VB 5ED4A 5HODA 3RQIA 1D3YA 1MDMA 1UELB 2PJRA 3QYBA 4KN4X 3VYRB 2DK8A 2FSWA 3BR6A 2XDVA 4I2OA 4BEHA 2X51A 1MBEA 3QWLA 3F22A 4PJ0C 1MDMB 4MHGA 4DOZA 3LSJA 2F4IA 2ZMEB 3BTCA 1KA8A 1GDTA 4E7IA 1TT0A 5CQGA 4BEHB 3W2AA 3CUOA 3LSIA 4KUMA 2DW4A 2EB7A 1FJLA 3IHUA 2HQRA 2E1MB 1ZHFA 4U0VA 3K4MA 2ETHA 3HSEA 5EJCA 2ID3A 3DQVC 3QAHA 2W84A 5M5WJ 4I76A 3AFHA 5J4VA 2QM3A 3EUHC 5DCFA 1Z3XA 1YW9A 5LFAA 1H9TA 1EA3A 4I02A 4P96A 2JSCA 2QZ8A 2IGMA 3S15J 3OOUA 3PNYA 2R0QC 4E7SA 1BL0A 4O5VA 1X1CA 3LAJA 2ZBKA 2MC3A 2K4JA 2LY1A 4CICA 3DLAA 4D1QA 1R71A 2XSDC 2FBIA 3MMYB 3FHZA 5DCMA 4MFEA 2E5ZA 2QKLB 4IVNA 2OD5A 3O2PE 1TC3C 3FIWA 2PJPA 1F1ZA 3NWSA 2JT1A 1TNTA 3O8HA 4OIOF 3JW4A 4CYCB 4HNVA 5ICFA 1GT0C 3JRGA 4UUVA 1RUOA 4BJTA 1SC7A 2QSGX 1FBQA 4G12A 4BUPA 4BDZA 1XSXA 4KISA 1WRJA 2BY0A 3K1MA 4BBRJ 4EJUA 3Q3SA 1M1EB 1HSTA 4BGDA 2PN6A 3E5UA 1MMNA 3HYIA 4NC6A 3HL2A 2LKSA 2EZIA 1F36A 1IN8A 1OR7C 4XLNF 3BR0A 1WJEA 3TL4X 2A3SA 2HPMA 1B9NA 1X19A 2OJED 4IX7A 1REPC 3CP2A 4F91B 3H5RA 3AG3H 1VQNI 1W5CC 4XBFA 3OYNA 1N77A 2KQRA 2LH9A 5E3MA 3HOSA 1GV2A 1X4OA 4AVZA 3PO2J 3HEFA 2IBDA 2VJ4A 1WFXA 2GXAA 3M1CA 5LGNA 3BR5A 5K7HA 2JVGA 1DU6A 1HKQA 2XRLA 3TBIA 1G3SA 1ULYA 2EA2A 2LSOA 1JKRC 1P4XA 3H0GJ 4ZC3A 3FM5A 1WJBA 3CF5F 1XGOA 2V7FA 2R7TA 2X6YA 4LIUA 3CMEI 5D6EA 3MCZA 3BOQA 5C44J 2X6WA 1ENHA 1ETXA 3WGHA 5KHDA 4A3FJ 1FEXA 3IKVA 2ZB9A 2HNHA 1OCTC 4G94A 2W4SA 3ZMUA 4XKCA 1U9NA 2P0WA 1A6IA 4EMSA 5GPAA 3D5SC 3MD2A 4F7ZA 4FHTA 1S3JA 3GTKJ 4DIQA 1GUUA 4L0YB 2RNJA 1AHDP 1Z1DA 4HA8A 1MMAA 3I55I 2HU9A 1OR7A 3A1YA 4A3EJ 5CVUA 3OS2A 2NVTJ 2O9LA 1MMSA 2P6TA 3DTIA 3RTRA 5GAGJ 1W5SA 2VQLA 1D1CA 2DPUA 5ILVA 5IOZA 1WH5A 3E97A 2QLZA 5J8CA 3IV5A 3MEXA 1RPWA 4DBRA 1CF7A 1WI9A 2F5VA 5HDGA 4XSXF 2VC1A 4MEYF 2XGCA 4D9JA 2KIFA 1NH3A 4ZYEA 3ZXSA 3S2HJ 1CF7B 1ZQ3P 1BR4A 4HRIA 2L5QA 3JRIA 1HOMA 2FMYA 2CUEA 3QODA 3CCUI 1W1WE 3HHGA 4UVAA 3BJOA 1U5TC 2P8TA 1AKHA 2FA5A 1IRXA 3ZGKA 1WJFA 1Z05A 3LOCA 5M5YJ 3V7RA 1D0YA 1OLTA 1S7AA 4PJMA 3ISPA 5FKLA 3HOXJ 5D5XB 3A0BC 2QQAA 4FTHA 2RV8A 1ACIA 2EZLA 3BG7A 1D1BA 3LAPA 4B1RA 3LFKA 5FROA 1XN7A 1JXSA 4ZDPA 2BHZA 2VJ5A 4XLFA 1ONVA 3RQ4A 1Z7LA 2YS9A 1WSUA 2EV0A 3E6BA 2DT6A 2CQQA 1FWZA 4GDFA 4BJ5C 3S16J 3GTGJ 1HLVA 1ZLJA 4I0AA 1LUJB 4KMFA 1JUMA 3T8TA 1QBJA 4A69C 2J5PA 1FYLA 5DUKA 2QEXI 2B9SA 2Y31A 2COBA 4ESFA 2IS1A 2CW8A 2KL4A 4W97A 3I58A 4HNUA 1ETKA 5F08A 3H0DA 1FTZA 3CF2A 1GXPA 4Q4ZF 3ZQGA 3L2CA 1XGMA 3WTUC 3PNVA 2HS5A 1HXDA 4IHTA 5KK1A 2V9KA 5FKKA 4E7ZA 2F2EA 5LEJA 2STTA 3FF5A 1V4RA 3E0JB 2EFOA 2JTVA 2BEOA 3U1KA 2GA1A 2YSRA 2VQHA 4NDLA 4HLXA 4PCQA 1T39A 3QOPA 1U5TB 2DMNA 3OY9A 2ELHA 2HVQA 2QENA 4WK8F 1GVJA 4MTDA 3I5UA 1X3ZB 4RB2C 1WZ2A 3TO7A 4G7ZF 2CQXA 2GBYA 2WY7Q 2HQNA 4YIIA 4A5MA 2EZKA 3HJEA 2OTLI 3J81K 3F0CA 5LHIA 3RPUD 5E18F 4XICA 2VKEA 3H36A 3EUKL 1Z91A 2MABA 1KQ9A 3HSRA 4UHTA 3C2GA 1MZBA 1JGSA 2M0CA 3IH2A 1IDZA 5K5RA 2G7HA 3MVPA 4PK4A 2VE8A 3CDLA 3HRMA 2O5RA 4EGZA 1ZYRF 2XF6A 3DFGA 3ECOA 4NC7A 2D1VA 2BY2A 3RI4A 1R7JA 4HZFA 2GA2A 3JTGA 3T0YA 1BI3A 4B8XA 2HYJA 4GGGA 2JA6J 4MO7A 2ID6A 3GFMA 4KT6A 3NEUA 5M5XJ 4Z6YA 4ENKA 1PVEA 1MSEC 2QA4I 2NS0A 2PG4A 4S0HB 4IEJA 3SZTA 1ZGAA 4ESBA 2Q2EA 2MFZA 3HG9A 2RKHA 3PSIA 2IGOA 1H0MA 4GYIA 3BZCA 3DKWA 3MQ0A 3TGNA 4P9UA 5HLTA 4BXUA 3BC8A 5JVTA 1U0JA 2BY1A 2H6BA 2Y30A 2QBYB 4ZYAA 5E79C 2Q1ZB 2GAUA 2ZXIA 4I09A 2Y9ZA 3FXJA 1Q1VA 2EIJH 3T5XA 4EVIA 3OYCA 2R7VA 3PM1A 3BZKA 1BI1A 2IVMA 4AM3A 1X1DA 2ZNZA 2DT5A 3JRFA 3UR3C 3KEYA 1F5TA 2YX7A 3I4PA 4BY7J 4IRHA 3HUGB 3VYSB 2KP6A 3RPQA 3M8JA 4F3QA 1EJ9A 2XSJC 3VDXA 4A3LJ 3GWZA 2VT3A 1R36A 1OCOH 1G2HA 4WX9A 2CFXA 4CSWA 1FSEA 3C7JA 3JTHA 5FLMJ 3HBLA 1G8XA 1QZEA 4FT8A 2VKVA 2HR3A 4D7NA 2OAZA 1BI0A 4S04A 3I56I 1OQYA 4R1HA 2V1UA 1Z6TA 3RYPA 3ZN1A 1TQIA 3TDZC 4KN7X 1OMIA 1LE8B 4PJNA 5E20A 1R5GA 2UUZA 4EJOA 1RESA 2MLGA 5GTIC 2GXGA 5J4YA 2HKOA 3L2UA 3W6KB 5GPCA 2ZJ2A 4U7DA 2Z16A 4E70A 2BW3B 3TKYA 3WHBA 2BXZA 2F5DA 2JN6A 2DAOA 2RAEA 2OF7A 5D6FA 2MGQA 3HGGA 1QVUA 1EH7A 3GFLA 4G7HF 1IG7A 2QCOA 3IAS2 5JI6A 3M8FA 3GF2A 2NVXJ 2CUZA 2W85A 3AKZA 2O6GE 2CV2A 4B48A 3BT9A 3OYFA 2PI0A 1K7AA 3MKWB 1LVAA 5J8FA 1UG0A 4ZJZA 3DU6A 2ZXHA 2NS8A 2OPTA 3JSPA 2K3FA 1FP2A 4O3MA 1B1BA 1X4PA 1DPUA 1ON2A 1CGPA 2K27A 4Y7NJ 2DODA 3I53A 3KE2A 1G4DA 4C30A 1IGNA 1RC9A 1ETYA 2HZTA 4CH7A 4P9FA 2AS5F 2K9MA 4UUSB 2KRCA 3BLYA 3H5AA 3ESWB 4HX4A 1QHHD 4A3JJ 3BQYA 3CCEI 3FXKA 2FNPA 2VASA 3W6VA 4NNJA 2OBPA 2HQAA 3F6VA 2Z3YA 3OR2C 1JT6A 4L5EA 3E6MA 5F1RA 2DA4A 2P7VB 4JP0A 4M3DA 1KYZA 2CW0F 1SMYF 2V79A 3C3WA 2LYCA 5EGOA 3OIOA 3CDIA 2X9DA 5E17F 2V26A 1K6OA 1YQAA 4F52A 5EGOB 5DM7F 4IHXA 4N9HA 5LHGA 5K1YA 3CC7I 1UB9A 1J7KA 2ESHA 1QZZA 1K78B 1RUNA 4A3KJ 2K02A 1MBGA 4MNUA 3DF8A 4OU0A 1NHAA 4A3MJ 1MBHA 4OAZA 2PEXA 3QPTA 1ON1A 4HAMA 1RKTA 4A5NA 1R22A 1D8KA 1WQ2A 2UXNA 2R7XA 4RMNA 4CCJA 4B4CA 1YOVB 3Q0UA 1XDSA 4IHSA 4V19K 3EYIA 3JCUC 1O57A 2E7XA 2Z2SB 5F6FA 5J6XA 2CYYA 4UVBA 2AHQA 2QUFA 5GAEJ 1ZGJA 2A68F 1YX5A 2DN0A 2F6CA 3COAC 2R4GA 2LRDA 4PGHA 1BJZA 3TW6A 3EDPA 4A6DA 3OYIA 2ZJQF 4IXAA 5FKOA 4EGYA 3DTKA 1YW7A 4ENNA 1VQ8I 2R92J 2VJIA 3S3MA 4Y4RA 1IV6A 5L3CA 2XAJA 2IW5A 4M6VA 1YS6A 4X6AJ 1BR1A 3H92A 3HOZJ 5ICEA 3N05A 3K70C 4BACA 5FRMA 1G3YA 3R0JA 1B4AA 1RETA 3F72A 5FJ8J 5KAFC 1H89C 3JRCA 2JMWA 2FQ3A 2VONA 3PO3J 2F5CA 2KLOA 3H9JA 4BQAA 1IN6A 4IOAF 1D8JA 1SD4A 3I59B 2A07F 3PFYA 1FIPA 2K3PA 1BIAA 1W7PA 2Z9OA 1T08B 1WHUA 2CSOA 4JX5A 2Z33A 1JE8A 4MLOA 5F04A 3RKXA 2H09A 4A3GJ 3OYLA 3K4JA 2XB5A 2BBYA 2V1DA 2IT0A 4C2TA 5FFXA 5IYCJ 3WG9A 2MD0A 1YE9A 1IRFA 5FB2A 3CMAI 3RKWA 1IO2A 1WH7A 3DEUA 3CUQA 1E17A 3C2BA 2B7EA 3CCQI 2VKDA 4O6JA 2O03A 5FGMA 5J40A 3V4GA 4CZZA 3DEEA 2K85A 2P7CB 3AAFA 5DM6F 3V7CA 2Q0OA 3HDDA 2PX9A 1MW7A 3A2KA 3M07A 4EJVA 1PJRA 1E3PA 3QYEA 2E71A 3PFIA 4II3A 4BKXA 1APLC 2ZFWA 4MQVA 2DA7A 2ZNYA 3K6GA 2LBFB 1RIOH 3KEOA 4HYEA 4MTEA 1LDJA 4FASD 4YFKF 3F6OA 4AIKA 1BW5A 2WADA 4I98B 2ME6A 2IRFG 1YYVA 5B1BH 3F3XA 1R6RA 1T0FC 2JK3A 5CKTA 3SYTA 4J19A 3S8PA 4BE1A 2GM4A 2M5WA 3LFUA 5D5UB 3VSLA 1HW1A 3S1MJ 4LG0B 2MYSA 2IA0A
chains in the Genus database with same CATH topology
1S72I 3CMEI 1VQ9I 1VQPI 3CCMI 2H8WA 4V19K 3G6EI 1VQKI 3CCSI 2ZJRF 5GAEJ 1YITI 3I56I 1VQMI 2E35A 1YI2I 2ZJQF 1YJNI 1VQ8I 1VQ5I 3I55I 3CCVI 5GADJ 2ZJPF 2OTLI 1QA6A 1MMSA 3CD6I 5GAGJ 3DLLF 1FOXA 1VQLI 1HC8A 3CCJI 4IOCF 1VQOI 1VQ4I 1YIJI 3G4SI 2NXNB 3CCUI 3CCRI 3CJTB 2K3FA 1YHQI 1YJ9I 2JQ7A 3J7YJ 3PIPF 3CMAI 2QA4I 2E34A 1ACIA 3J7ZI 3CCEI 3CCQI 5GAHJ 4IO9F 3CC2I 2FOWA 4UY8I 5DM6F 2E36A 1FOWA 1VQNI 1FOYA 3CC4I 1VQ7I 1Y39A 3CCLI 5JVGF 5DM7F 2QEXI 2OTJI 3PIOF 1YJWI 3G71I 1VQ6I 3CC7I 4IOAF 3CF5F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 I;  3CME I;  1VQ9 I;  1VQP I;  3CCM I;  2H8W A;  4V19 K;  3G6E I;  1VQK I;  3CCS I;  2ZJR F;  5GAE J;  1YIT I;  3I56 I;  1VQM I;  2E35 A;  1YI2 I;  2ZJQ F;  1YJN I;  1VQ8 I;  1VQ5 I;  3I55 I;  3CCV I;  5GAD J;  2ZJP F;  2OTL I;  1QA6 A;  1MMS A;  3CD6 I;  5GAG J;  3DLL F;  1FOX A;  1VQL I;  1HC8 A;  3CCJ I;  4IOC F;  1VQO I;  1VQ4 I;  1YIJ I;  3G4S I;  2NXN B;  3CCU I;  3CCR I;  3CJT B;  2K3F A;  1YHQ I;  1YJ9 I;  2JQ7 A;  3J7Y J;  3PIP F;  3CMA I;  2QA4 I;  2E34 A;  1ACI A;  3J7Z I;  3CCE I;  3CCQ I;  5GAH J;  4IO9 F;  3CC2 I;  2FOW A;  4UY8 I;  5DM6 F;  2E36 A;  1FOW A;  1VQN I;  1FOY A;  3CC4 I;  1VQ7 I;  1Y39 A;  3CCL I;  5JVG F;  5DM7 F;  2QEX I;  2OTJ I;  3PIO F;  1YJW I;  3G71 I;  1VQ6 I;  3CC7 I;  4IOA F;  3CF5 F; 
#chains in the Genus database with same CATH topology
 5J1U A;  3K1P A;  3MZH A;  3ABL H;  1WPK A;  1SAX A;  4WWC A;  2L7F P;  2QQB A;  3KP7 A;  1DGW Y;  3GTM J;  3L2W A;  1A36 A;  3G3Z A;  3R4K A;  2FXA A;  5HNF A;  4HPQ A;  4NQW A;  1W5T A;  2DLL A;  2JPB A;  3REO A;  1POG A;  3GFI A;  2G0E A;  2NOG A;  1OPC A;  4XKW A;  4C2U A;  2MD5 A;  2RN7 A;  5F64 A;  5J3L A;  5LRR A;  4XLH A;  5HDN A;  1R4N B;  1HDD C;  2G9W A;  4Y13 A;  1LPQ A;  1B8I A;  4HF1 A;  4Q47 A;  1I27 A;  1DUX C;  4OMY A;  2LDU A;  1UHW A;  5E1X A;  3GX4 X;  4U88 A;  3BG6 A;  3IAM 2;  1B8I B;  1MBF A;  1VZ0 A;  2CQN A;  4N9I A;  2DT7 B;  3V42 A;  5J47 A;  3HOV J;  3BR1 A;  1ZGW A;  4R79 A;  2ZME A;  2RQP A;  1WGX A;  1ZR4 A;  1QA6 A;  4S05 A;  3HGY A;  1EH6 A;  3KP4 A;  2GOX B;  3QP6 A;  4UB6 C;  3ERM A;  2FML A;  3IH3 A;  2DU9 A;  4ABZ A;  4X0G A;  9ANT A;  1I39 A;  2XPV A;  2JA2 A;  3OMY A;  2BHY A;  5FLX K;  1VQ4 I;  2VKH A;  1I6X A;  2DYR H;  3RDI A;  3LSG A;  2NXN B;  4L9T A;  4XON A;  2BOL A;  1J5Y A;  4Y3O A;  4II2 A;  4ANJ A;  4H0E A;  1DPR A;  2EWN A;  4BNC A;  3C18 A;  1ODD A;  2R7Q A;  1ZAO A;  1VFC A;  2B0L A;  5DD4 A;  1XTA A;  2HDC A;  4ZDL A;  3WE3 A;  5FD5 A;  2HKX A;  4CA0 A;  5BOX A;  2FBH A;  2HOE A;  2XAS A;  2EIK H;  2K9Q A;  1E3O C;  2PMZ A;  5JR3 A;  2FUG 2;  1YW8 A;  3SEZ A;  3F8N A;  3FMS A;  3KZI C;  1FIA A;  4C3J J;  3D5L A;  5JHU A;  2LC2 A;  4P5O A;  3W3C A;  2M3A A;  4IO9 F;  4CYC A;  2H1L A;  3GEZ A;  1UJ8 A;  3CC2 I;  2E1O A;  3B73 A;  2XAG A;  4GRI A;  4XLC A;  4MIM A;  3FHN A;  2XHK A;  3FMQ A;  1T33 A;  2LR8 A;  5H6Q A;  1B6A A;  2EIL H;  4YFN F;  3CC4 I;  1TWA J;  3L1P A;  1XMA A;  4CYD A;  5JLW A;  1LVK A;  3FIS A;  4U0W A;  5D8K B;  5JVG F;  2F5E A;  2M4G A;  5EF6 A;  4CXF A;  2NOJ B;  4HX7 A;  4RS8 A;  3QPL A;  1ZH5 A;  2M2E A;  4BJ6 C;  3BPX A;  4XRS A;  2VBY A;  4OIN F;  3IC7 A;  1Z0X A;  2UV1 A;  2ZC2 A;  1LNW A;  4M9S A;  1R49 A;  1LDD A;  5E3N A;  2W00 A;  1K83 J;  5FLX Z;  3WTT C;  3IRQ A;  1LFU P;  2JA7 J;  3E5X A;  1HW2 A;  5CVV A;  3CCM I;  2DOA A;  2H8W A;  3KP6 A;  4X1E A;  4OIQ F;  1N25 A;  3WTY C;  3KZZ A;  2LOO A;  1FMV A;  1LFP A;  3EUH A;  4XLE A;  3ZQQ A;  3BWG A;  4EM2 A;  4E7J A;  3SHF A;  1PUE E;  2RRE A;  3GBG A;  2TCT A;  1VQ5 I;  1TNS A;  2VOD A;  2X48 A;  4AD9 A;  5HDK A;  2E2I J;  3HRU A;  2HQ5 A;  1IXC A;  3ONQ A;  5D5W B;  1LEB A;  3CZ6 A;  5FFZ A;  4WXC A;  3GTL J;  3MKL A;  1UZC A;  3DLL F;  1MJ9 A;  4RA2 A;  3VFZ A;  5B66 C;  4M71 A;  5DTD A;  5L3F A;  2JA5 J;  3CCY A;  2FJ1 A;  2P6S A;  5LD2 C;  4CZC A;  2R7S A;  2YUS A;  2IXS A;  3B6C A;  1YIJ I;  2XPU A;  3OIP A;  5DUI A;  2CUJ A;  1T2K A;  1SFO J;  1BW6 A;  2IS6 A;  3S1N J;  2RVC A;  4DZJ A;  5F0F A;  4QTR A;  2LF8 A;  2VN2 A;  2Y2Z A;  3I54 A;  3M8E A;  4KIC A;  3W2W A;  3IL2 A;  2L02 A;  2L54 A;  1XG1 A;  2XUB A;  3BZ6 A;  4Y33 A;  4RDU A;  5K7F A;  4KIB A;  4YEL A;  1X2M A;  3L09 A;  3IWZ A;  3QOE A;  3Q9V A;  4A2U A;  1FBS A;  4LIT A;  2DFI A;  4PGG A;  4B44 A;  5EDN A;  1RNL A;  3AG1 H;  3K4L A;  1GV5 A;  2V9P A;  5KCM A;  3KYD B;  2FU4 A;  2YPR A;  4EJW A;  2Y69 H;  3TMO A;  5GAH J;  3S93 A;  1S6L A;  2JPC A;  2VL8 A;  1BI2 A;  2FF4 A;  1SFX A;  5CLS A;  2R7Z J;  1MKM A;  2MA3 A;  4IRI A;  5CJ9 A;  1K79 A;  4XN0 A;  2LKP A;  1I3A A;  1T38 A;  3WTV C;  1TBX A;  2XGE A;  5F0C A;  3OYD A;  4LMY A;  1GHC A;  1D5V A;  3L7W A;  5BQT A;  2K40 A;  4M3B A;  5TIS C;  1FT9 A;  5B5E C;  1XGN A;  3SEQ A;  2GLO A;  4LGW A;  4NBQ A;  1RZ4 A;  1YJW I;  1XCB A;  1OYI A;  1I3Q J;  1FMW A;  4JX6 A;  3RCO A;  1B72 A;  1K6Y A;  1V5F A;  1ZR2 A;  3B02 A;  5E3L A;  1W0U A;  1L0O C;  3K69 A;  5IP6 A;  1SFE A;  2KDZ A;  4FX0 A;  1LKX A;  4BQN A;  1S72 I;  1B72 B;  4MEX F;  5F27 A;  3OYJ A;  5BPI A;  5ERI A;  4YG2 F;  4AVP A;  2HOA A;  2HZD A;  5BMZ A;  1MBK A;  4E7L A;  2L2O A;  1MIJ A;  3SZG A;  4KT5 C;  3LNQ A;  5LEK A;  1GXQ A;  1STZ A;  2W24 A;  2LK2 A;  2E1N A;  2EFW A;  1N75 A;  1I50 J;  3OV8 A;  2DDA A;  2C6Y A;  5KAI C;  2XIG A;  2KIM A;  3A03 A;  1L3L A;  2M7A A;  3ASN H;  4G6Q A;  1FC3 A;  4UVC A;  2FBK A;  5CQE A;  4DYQ A;  4RAF A;  4FQG A;  3OYK A;  1U5T A;  2YU9 J;  3GME A;  2HVR A;  5HVQ C;  3O8G A;  2O7O A;  1F9N A;  4IOC F;  1P2F A;  4L9N A;  5LRS A;  3QQA A;  1W4M A;  2ECC A;  5K5Q A;  3FBN B;  3FXL A;  2ISZ A;  2ELJ A;  1YG2 A;  3P9C A;  1MMG A;  1VI0 A;  3ZMS A;  1EV7 A;  3CTA A;  2E2J J;  4E4H A;  3PJR A;  3H3U A;  2R7F A;  4LK1 F;  1IRG A;  3PNT A;  4M6Y A;  4A0Y A;  1K4T A;  1ETW A;  3A02 A;  3OSF A;  4A0Z A;  1MJA A;  1R1T A;  1MNE A;  2VJJ A;  2PQ8 A;  1BM9 A;  1SVO A;  3D5R C;  2NVY J;  4UXN A;  5C4J J;  4L0Z B;  4GO1 A;  2EZH A;  1UG2 A;  2DOF A;  5E1W A;  5FKN A;  5IT9 K;  3CJN A;  2M87 A;  2FX0 A;  4LJZ F;  2QKM B;  2X6X A;  2ZSI B;  3ZQC A;  3S3N A;  2VXD A;  1Z3Y A;  1T8I A;  3DP7 A;  1JTY A;  3IWF A;  1R5I D;  1DU0 A;  3W6J B;  4DJA A;  1ZLK A;  3EET A;  3ZPL A;  3FM3 A;  2H1K A;  4B3A A;  1FZP B;  4PSX A;  5DD8 A;  3ECH A;  4D0P A;  3JRD A;  2CW7 A;  2VXZ A;  2VOO A;  2HTJ A;  3HKZ A;  3T8R A;  2EIM H;  3G73 A;  2DMT A;  3BRO A;  1WI3 A;  2ADU A;  2X6O A;  1QU3 A;  5KVR A;  2HXO A;  3JRB A;  2K7L A;  1W36 C;  2R7U A;  2GXB A;  4AWX B;  4XKV A;  2V4J C;  2QBY A;  2IAI A;  3ABU A;  3P9I A;  1KYW A;  3GW2 A;  3ZQL A;  1Y1V J;  3RJP A;  4BAY A;  3G1L A;  4ZYG A;  3QU6 A;  2FD5 A;  4JOM A;  2KZG A;  3WHC A;  4CGZ A;  2VQG A;  3BCB A;  1T98 A;  2HWV A;  3GVA A;  4UB8 C;  4EM0 B;  1E3H A;  2E60 A;  3HUG A;  3IKT A;  2O3F A;  1N78 A;  2Y75 A;  4FCY A;  2DA6 A;  1XMX A;  3GFJ A;  3J81 Z;  2W57 A;  3DPL C;  4MQ9 F;  3TW7 A;  3VYU B;  1WJC A;  2I8D A;  3HB9 A;  2WAF A;  1J0R A;  3HPH A;  5FRN A;  2HFH A;  3BG3 A;  3S17 J;  1IC8 A;  1KU3 A;  2EPF A;  3ZQ7 A;  4N0B A;  3CCV I;  4KDP A;  4ZTF A;  3DBH B;  1MBJ A;  4IL6 C;  5LGT A;  2VLA A;  2VPR A;  4DYR A;  3HKZ N;  3HC7 A;  3GZN B;  1ZTR A;  1FBU A;  1P4A A;  3N4M A;  2DMP A;  5IPA A;  2NVQ J;  1HQC A;  4NHJ A;  1ZKG A;  2NS7 A;  3WTW C;  2WTE A;  3S2D J;  1UFM A;  2KIS A;  1FX7 A;  3VOE A;  3OYG A;  1LE8 A;  3CCJ I;  5TGT A;  3ZQF A;  3ZRG A;  1UAA A;  4EM1 A;  2LY2 A;  3WU1 B;  3LSM A;  3K4N A;  2RNG A;  1AU7 A;  2L9S A;  1H8A C;  2BW3 A;  1KQ0 A;  3NAU A;  2CV1 A;  2Y9Y A;  2VBW A;  2BV6 A;  2E1C A;  1MGT A;  3SXY A;  1SD6 A;  3JAM K;  5AON A;  3KEQ A;  4BHB A;  1A31 A;  1BOB A;  1MD0 A;  2L4M A;  2VBX A;  3LSH A;  5E3O A;  3E1S A;  2W1O A;  3NQO A;  4WXH A;  2IPQ X;  4PDK A;  1IJW C;  3BPV A;  4I99 C;  4G9Y A;  4YRV A;  4B3X A;  3PIP F;  3ZP5 A;  1O3T A;  4LD5 A;  1O3S A;  2LF7 A;  2P81 A;  3R6S A;  2D45 A;  4OMZ A;  3L9F A;  3TOB A;  2OC6 A;  2XPW A;  2R5Y A;  1YIO A;  2AXL A;  5CVI A;  4YFX F;  1A35 A;  5LLQ A;  3RKY A;  3J7A O;  4F55 A;  5HS7 A;  5F1J A;  3ZN0 A;  2CG4 A;  2R5Y B;  5AIQ A;  4AU7 A;  2E36 A;  5HNH A;  2ECB A;  3ZMD A;  1DP7 P;  1CQT A;  5LGU A;  3GCM A;  1C0W A;  2HDD A;  5AIP A;  5JFR A;  5L3E A;  3CCL I;  4UUS A;  2L7Z A;  2DBB A;  3OYE A;  2BVM A;  3J80 K;  1Z21 A;  1X3U A;  1JGG A;  3Q9S A;  3BP8 A;  3F23 A;  2LFB A;  2XRN A;  1KGS A;  3G2B A;  4XLA A;  3ZMT A;  1JJ8 C;  3X2Q H;  1OCR H;  3BY6 A;  4LB6 B;  1QRY A;  3GO5 A;  4AYB A;  2F48 A;  1TTY A;  5E8I A;  1JJ6 C;  2MW8 A;  3OWT A;  4G8X A;  4ETS A;  2EFP A;  2H6C A;  5M3F J;  1J75 A;  2UZK A;  1TZL A;  1K61 A;  5LHH A;  4QSH A;  1YIT I;  1VQM I;  3VOD A;  3WU0 A;  3BJA A;  1DQU A;  4Y17 A;  3JAM Z;  2EV6 A;  4CCM A;  3DKX A;  1K78 A;  5L3B A;  3AL0 C;  2DA5 A;  3VEP A;  1XS9 A;  1P9Q C;  4EQQ A;  3FXR A;  3LL7 A;  2STW A;  2ISY A;  3V8J A;  2MH2 A;  1O3R A;  2R7R A;  5GAD J;  2ZJP F;  3OSG A;  2XC7 A;  4K2E A;  5EYR A;  2A05 A;  1QGP A;  4A3C J;  3HTU A;  1IW7 F;  1EH8 A;  4BBS J;  4HF2 A;  5A2Q K;  2N8G A;  3MWM A;  1XDU A;  2DDB A;  3T1B A;  3A0H C;  3H35 A;  2I5U A;  5IP9 J;  1Y0N A;  1GLN A;  2X4H A;  2HOT A;  1D1A A;  4M74 A;  1BOA A;  1PYV A;  4HX8 A;  4RAZ A;  1FY7 A;  2HDW A;  3CJT B;  1TW3 A;  2PBI A;  1G3T A;  5HLI A;  2CH0 A;  2DO7 A;  2HVS A;  2BVL A;  1S7E A;  2WAQ A;  1QNT A;  2M8G X;  1R1V A;  4ON0 A;  5IYB J;  2JQ7 A;  1SD7 A;  1ZAR A;  2XAU A;  1LDK B;  3F9K A;  4HDV A;  3Q5F A;  3QRF F;  2A69 F;  2CJJ A;  3KFW X;  3RIR A;  4WCG A;  5EG0 B;  4A12 A;  4HQM A;  4LFU A;  5EEA A;  3I59 A;  4KIG A;  1SVM A;  4CCO A;  2M0M A;  3BR2 A;  2DFF A;  4XOP A;  3S1Q J;  4I6Z A;  2P4W A;  4I01 A;  1JT0 A;  2FOW A;  2DA2 A;  2W25 A;  2K9S A;  3F8F A;  2V9V A;  4FE4 A;  5ILS A;  5L3D A;  3CO6 C;  4CHU A;  1OIS A;  1SVL A;  1YO5 C;  2JJ7 A;  1SFK A;  3AL0 B;  1FOW A;  2Z1D A;  3TO9 A;  3ZMZ A;  3KX2 A;  3O3K A;  1XMK A;  2Y0S A;  2WB1 A;  5H2F C;  1I5Z A;  1HW5 A;  1OCP A;  2KRH A;  1FLI A;  2F4M B;  2O8X A;  1Y1W J;  1X1B A;  3PIO F;  1FSH A;  1RR8 C;  2DTZ A;  1OYW A;  2H27 A;  4AID A;  5L3G A;  1Y0U A;  1XC5 A;  2WAQ N;  3FXQ A;  2JA8 J;  3SFZ A;  3UNG C;  1KU2 A;  2AQE A;  3VWB A;  5DS9 A;  1SAU A;  1MH4 A;  4L5J A;  1NG6 A;  2LBF A;  2CUF A;  2GZW A;  4P1W A;  1RRJ A;  4D5F A;  2ZJR F;  4LOC A;  4ASN A;  3ZR8 X;  4HLY A;  4RGS A;  3MZY A;  1XD7 A;  5IP7 J;  4E7K A;  1HBX G;  1TLH B;  3CJQ B;  4LG0 A;  3PQK A;  4G7O F;  5BS6 A;  1BR2 A;  1BJA A;  1HKT A;  3K2Z A;  4V2G A;  1UST A;  1U8R A;  3FMR A;  4ZTJ A;  2ZO4 A;  2FOK A;  3GUD A;  4KFC A;  3U21 A;  2WB1 N;  4BXX J;  2CMP A;  5D8L B;  2CQK A;  2D1H A;  2HYG D;  2XF7 A;  1A6Q A;  1EKE A;  3PL8 A;  1S8N A;  4OOI A;  1Z9C A;  1S5L C;  2DMU A;  1KU7 A;  2KDO A;  4AIJ A;  3K9T A;  4LLN A;  2L7K A;  2NAZ A;  3OYM A;  1ZN2 A;  2YR2 A;  4UV8 A;  1QPM A;  3E6C C;  3ZOB A;  3FBI B;  3TDU C;  4A0X A;  2L9R A;  2JUC A;  2X1D A;  1YRN B;  1A04 A;  1YHQ I;  5J1R A;  3OYB A;  1YJ9 I;  3U9G A;  2E2H J;  4LB5 A;  4ZYD A;  2CU7 A;  1V5G A;  1MMD A;  5K7Z A;  1RR7 A;  1U78 A;  2QGU A;  2HYF A;  3TO6 A;  3M3Y J;  3I4N J;  2MG4 A;  4D5C A;  3DXJ F;  4JX4 A;  3BTL A;  3KP5 A;  4XLP F;  2BZT A;  1DGR M;  1T0F A;  1XX5 A;  2LVS A;  3H9G A;  3Q0W A;  4XM3 A;  3D0S A;  3HM5 A;  2IS4 A;  2K9L A;  4C3H J;  3JRE A;  2PJR B;  3WE2 A;  4NB5 A;  3VB2 A;  1FOY A;  4RGR A;  2R7D A;  2IEK A;  2VIX A;  4FIS A;  3S3O A;  2PMU A;  2DA1 A;  1YFH A;  2JUG A;  2HXI A;  1H9G A;  1BA5 A;  3I3L A;  3WOD F;  2LP0 A;  2DA3 A;  1NK2 P;  5M3M J;  3G71 I;  1VQ6 I;  3PSF A;  2R7W A;  1MJB A;  3NAR A;  3DTE A;  3WU2 C;  3WG7 H;  3AG4 H;  1F4K A;  4ZZL A;  3GTO J;  3SDB A;  2PMH A;  4Z2Y A;  4DGW B;  2ME0 A;  3FXU A;  5H6R A;  1VQP I;  4DQ2 A;  1UHM A;  2GQQ A;  4M9X A;  1JKP C;  2MH9 A;  3K7A J;  2NNN A;  1O3Q A;  1VQK I;  2I10 A;  3VSK A;  3GZ6 A;  4XK4 A;  2VE9 A;  2A5W A;  2J5O A;  2XF5 A;  1SEU A;  5EEH A;  1TQM A;  3PQJ A;  2Y0M A;  1WKM A;  4UUT A;  1BBY A;  4HG2 A;  3K4C A;  1YI2 I;  1G6N A;  4LG3 A;  3K2A A;  4KMU X;  1YJN I;  4ESJ A;  3HOT A;  3KPH A;  2WA0 A;  2VOP A;  5DCM B;  4AC0 A;  4DBQ A;  5J1Y A;  2QF7 A;  2ZFU A;  1IRZ A;  1PP8 F;  3GYH X;  1V5E A;  3ZMV A;  2E19 A;  3TED A;  1S29 A;  2PMZ N;  1HA8 A;  1P6R A;  3L2R A;  2M4K A;  3KIO A;  3ULQ B;  3IUO A;  2WAE A;  2DPD A;  3HOW J;  4ZDO A;  2WV0 A;  4QLC U;  1J2X A;  1X58 A;  2OU2 A;  4RLQ A;  4KA4 A;  2CQ7 A;  1HC8 A;  1V3F A;  1W7P D;  4ZH4 F;  3FXO A;  2R5Z A;  5FLV A;  3KP2 A;  2OQR A;  1T6S A;  1VQO I;  5EZG A;  3RPU A;  5D4R A;  3WTS C;  3E5Q A;  3CLQ A;  4PSW A;  4HNT A;  2R5Z B;  2MC4 A;  1SMT A;  4BS9 A;  1WVR A;  2KKO A;  4LLL A;  5DEQ A;  1BC7 C;  4IHW A;  2DYS H;  4A3D J;  1G59 A;  2MLK A;  3FX3 A;  2CS3 A;  4FET A;  2CV0 A;  4M73 A;  1LQ1 A;  4U7B A;  2XGD A;  4RB3 C;  5EZH A;  4CO8 A;  4KIF A;  1KZH A;  1LB2 A;  1JHH A;  3FK7 A;  1DP3 A;  4HDU A;  1X1P A;  2FE3 A;  1ETV A;  1JUS A;  3NWT A;  3IP4 B;  2E34 A;  1TWF J;  3TP0 A;  1ZK8 A;  1X1A A;  4XRF A;  5KNL A;  3J7Z I;  1W0T A;  2L3D A;  3FXM A;  3RYR A;  3CDH A;  1QHG A;  2LY9 A;  2ZKZ A;  3KLN A;  3WGI A;  3K70 D;  1B59 A;  1XPX A;  2GIZ A;  3EUA A;  3DU5 A;  3D1N I;  4NUB A;  5E1Z B;  2BGC A;  5CVR A;  2XV4 S;  2TDX A;  3F8M A;  2R3S A;  3RKQ A;  1RI7 A;  2CRG A;  3DPT A;  3IRR A;  2P5V A;  3DKY A;  2WWY A;  2OTJ I;  1WCM J;  2FRH A;  2GIV A;  4F93 B;  2XAF A;  3R0A A;  4WXD A;  3H1C A;  1JKO C;  4EAT A;  3EYY A;  1WJD A;  1KON A;  1Y6I A;  4BU2 A;  1GVD A;  4RAG A;  4HEA 2;  4CUG A;  4XQF A;  3QPS A;  2OUM A;  2Q8K A;  4TV7 A;  2BE5 F;  5ILU A;  2K5C A;  3V8L A;  1QQI A;  4M72 A;  2NVU B;  2VT2 A;  4PFO A;  1U9O A;  1ETO A;  4FX4 A;  1AA7 A;  2XB0 X;  2ZSH B;  1TWG J;  2CGP A;  4CCN A;  4HF0 A;  3N97 A;  3H5N A;  3PUB A;  3KZY A;  4KIT B;  5DDG A;  1ZRE A;  2XGX A;  2V1X A;  3SZP A;  1FNN A;  2DK5 A;  3F21 A;  3HOU J;  2EK5 A;  4NC8 A;  3OOP A;  3S2W A;  2X1E A;  1FYK A;  4GXO A;  3BR3 A;  4JBA A;  3ABT A;  3P9K A;  2IA1 A;  1Z7U A;  2JRT A;  3ZCO A;  1QVT A;  5C3E J;  3CJR B;  3H9Q A;  2ICW G;  2VQC A;  3NRV A;  1AKH B;  1R00 A;  2XAQ A;  2X0L A;  2AXT C;  3I64 A;  2QVO A;  3JSO A;  3CP8 A;  2W48 A;  2AO9 A;  2JSP A;  3HSF A;  4HQE A;  3OL4 A;  3DBL B;  1FYM A;  5HLH A;  2LTP A;  5D4S A;  1BN5 A;  3K10 A;  2A5Y B;  4Y15 A;  4PJJ A;  3G4S I;  2ZXW H;  2PLY A;  4IPA A;  1U3E M;  4XID A;  3BTJ A;  1I1G A;  2GOM A;  3ABM H;  3DWL E;  1IXS B;  2KJB A;  4RM2 A;  2HI3 A;  1O4X A;  2COM A;  4E7H A;  1D0X A;  1E0E A;  1MNM C;  2BY3 A;  3ELK A;  2D2W A;  3M1E A;  3GTQ J;  2A61 A;  2BYV E;  1S7O A;  4RB0 A;  2KJC A;  4M6X A;  1U8B A;  1R9T J;  4IQ4 A;  4C9Y A;  1VTN C;  1SAN A;  4G6D A;  4BE2 A;  1NK3 P;  2OA4 A;  5GTH C;  1U2W A;  2EA4 A;  3I9V 2;  4MGR A;  3MKY B;  2O61 A;  4IHY A;  2HOS A;  2UWM A;  3FDY A;  3OR1 C;  4PJL A;  3CO7 C;  1RKW A;  1ETQ A;  3LST A;  3GLL A;  4Y52 J;  2ZXJ A;  3MFK A;  2V6E A;  1YX3 A;  4Q5S F;  5IOY A;  2QQ9 A;  2X1C A;  3TOA A;  2DJI A;  5EEG A;  2L4A A;  4XN3 A;  3TP3 A;  2RC4 A;  3BQZ A;  2Z99 A;  1X2N A;  4GCV A;  2R93 J;  3KCC A;  4HSR A;  2CFO A;  1R5H A;  1KQ8 A;  4YIF A;  2MSY A;  2XKO A;  2XAH A;  2KRF A;  1IUF A;  1FPQ A;  2CO5 A;  1SD5 A;  1OCZ H;  4QWQ A;  1Z77 A;  2LD5 A;  2QQ8 A;  4I0B A;  2LG4 A;  1IN7 A;  4HV5 A;  1K4S A;  1ERD A;  4N4O B;  3CCS I;  2KIQ A;  4OIR F;  3FK6 A;  4FE7 A;  3S14 J;  2ACJ A;  3F8C A;  5LBQ A;  1HKS A;  4Q48 A;  4U87 A;  1H88 C;  1ORK A;  3CES A;  5GP9 A;  3O6B B;  4QPO A;  3W2V A;  3L2Q A;  4N4N B;  4OAY A;  2M1B A;  4XR6 A;  3HOY J;  1P92 A;  1XGS A;  2DI3 A;  4I7H A;  4JK1 X;  4PZJ A;  4J01 A;  1MSF C;  1F43 A;  5BPD A;  1WJ5 A;  2IGK A;  1I1S A;  3QYF A;  2DXI A;  2KFD A;  1BIB A;  1USS A;  4BY1 J;  4C2M J;  1R58 A;  3DCF A;  3CMM A;  3CD6 I;  3RSN A;  3H3V K;  1Y56 A;  1XB4 A;  3AG2 H;  4A3B J;  3K0L A;  4RGU A;  1O7L A;  1IN5 A;  2E7W A;  4UNO A;  1IXR C;  3G1M A;  1VQL I;  2EQR A;  1JI8 A;  3RZD J;  3P7N A;  1TWC J;  5IYD J;  4L9J A;  3SFI A;  4HV6 A;  2DJN A;  2M34 A;  4BH9 A;  4H4K C;  5CYV A;  5HS9 A;  3B6A A;  2F4O B;  3I71 A;  3LSK A;  1KU9 A;  3MZ8 A;  4XSZ F;  2Q2E B;  3ROU A;  1IV8 A;  3A01 A;  2DQR A;  1LFB A;  3E7L A;  5ICC A;  2M8E A;  2KPM A;  1E2X A;  4XRM A;  5IT9 Z;  3A01 B;  5FKM A;  1J9I A;  1Y8Q B;  2LLK A;  3K1N A;  3MAJ A;  1IAW A;  2F5F A;  3J7Y J;  2KMU A;  3OS0 A;  1LJ9 A;  1R1U A;  2EFN A;  3BCA A;  3R61 A;  4IJA A;  4M3F A;  2K9N A;  1ZG5 A;  3BTI A;  4KYW A;  2M45 A;  4YIR X;  4BXF A;  1WWX A;  1TP4 A;  4HW0 A;  1HSJ A;  2GWR A;  1V54 H;  3LSR A;  3LA7 A;  4PUS A;  5E8G A;  1PP7 U;  3UKG A;  4L18 B;  5C4X J;  3R60 A;  3U1D A;  2ZCW A;  3EQL F;  3GTP J;  2Z5U A;  1FTT A;  2K86 A;  4EEF G;  1QPI A;  4V2F A;  1DDN A;  2L9N A;  3E6D A;  1TL8 A;  3SJM A;  3K4B A;  2LNB A;  4HBL A;  2UXX A;  2IGN A;  2KHM A;  3LA3 A;  1ZRC A;  3S32 A;  3CMY A;  3LQQ A;  2OZ6 A;  2HEO A;  1IUY A;  3CLO A;  1FOK A;  2RQQ A;  3VYT B;  2M9H A;  3BG9 A;  2HTS A;  3FZV A;  3M9A A;  1ZG1 A;  2R7O A;  3I0T A;  3SDG A;  1SFU A;  2OV7 A;  3ABK H;  3G6E I;  4M3G A;  3MN2 A;  2DFH A;  2KZV A;  2DFE A;  2IA2 A;  4AUX A;  4RM3 A;  3DEW A;  1VF9 A;  3IH4 A;  4XOT A;  3U2R A;  1U6G A;  3C2H A;  4XOR A;  2P5L C;  3E3V A;  2ESN A;  4LLG F;  2DCE A;  3GLX A;  4RLF A;  2EH3 A;  3GTJ J;  1T56 A;  4QIW N;  2TRT A;  4U0Y A;  4EJT A;  5JLX A;  1JKQ C;  5CPR B;  4LIV A;  2HGC A;  1ZG3 A;  4XRS G;  3S1R J;  3BG5 A;  3PUF A;  4ENJ A;  2VC0 A;  5BNG A;  2FEZ A;  1XSD A;  1P7I A;  1PUF A;  2H8R A;  3MKZ A;  1P7J A;  3DPU A;  3WTX C;  3ZQI A;  3BJ6 A;  4XL9 A;  1J09 A;  2EIN H;  1X3W B;  1PUF B;  5HOO A;  4RAY A;  2K4B A;  3HTS B;  4F92 B;  3C1D A;  3ZQH A;  2YX4 A;  1IDY A;  4HST A;  1G3W A;  2QSH X;  2KIU A;  4DZP A;  4LK0 F;  2RGV A;  2M7B A;  6PAX A;  2JWT A;  1BC8 C;  3V7S A;  1TW2 A;  3CCR I;  3Q0V A;  1MND A;  1Z67 A;  1IZ1 A;  2NYX A;  2FQ4 A;  4CDG A;  2VBZ A;  1I6H J;  2WBM A;  1D5Y A;  3F8B A;  1HCR A;  2O8K A;  4GFB A;  2A6H F;  5DV5 A;  2OQG A;  2OCE A;  1OJL A;  5IY5 H;  4PFP A;  4BL0 B;  2QWW A;  3JRA A;  5K5O A;  2LKX A;  4B43 A;  3LWF A;  2A6E F;  4ENM A;  5H20 A;  3J7A Y;  3KLO A;  4IRG A;  3KP3 A;  4BHC A;  4KNY A;  3DV8 A;  4AYB N;  1MH3 A;  4IHV A;  2IS2 A;  2VB6 A;  2L7M P;  4YEJ A;  3HIF A;  3I4M J;  3J80 Z;  2EFQ A;  3OYA A;  1TQP A;  4M9Z A;  4A6E A;  3OS1 A;  2YU3 A;  4BQQ A;  4CCK A;  2IP2 A;  2JVH A;  1WJA A;  2P5K A;  2O0Y A;  1JUP A;  3OIQ A;  1JTX A;  5EG0 A;  2IJL A;  2L0K A;  1B9M A;  5FO5 A;  1VQ7 I;  3CUQ C;  1PDN C;  1Y39 A;  3P5J A;  4IF4 A;  1HF0 A;  4B47 A;  5HLG A;  3DBR B;  3HZJ A;  2DMQ A;  1OKR A;  1Y8R B;  3HHH A;  1O7F A;  3A4C A;  1AWC A;  2EJR A;  4XKB A;  1NTC A;  4DNC A;  4P55 A;  2A6T A;  1YS7 A;  1EF4 A;  1R23 A;  2LRE A;  2M30 A;  4L5I A;  1Q1H A;  1ITY A;  1VQ9 I;  3GZ5 A;  2ELK A;  1D0Z A;  1UHS A;  3M7G A;  1ZRF A;  2CWE A;  2EV5 A;  3G1O A;  5TJJ A;  3KYC B;  4L9V A;  2EBI A;  4OWR B;  2DTR A;  5F0H A;  2BXY A;  4XNF A;  4RGX A;  3ERE D;  2XKP A;  2XVC A;  4C3I J;  5B3S H;  2E35 A;  3M4O J;  2WY8 Q;  4DYC A;  1IF1 A;  2DQL A;  3LQR A;  4A93 J;  2G7U A;  1V55 H;  4BHP A;  4J00 A;  3LMM A;  2W7N A;  3WTZ A;  2HPI A;  4MFD A;  2WV1 A;  3LSP A;  5A2Q Z;  2JZY A;  3OL3 A;  4WF2 A;  3VPR A;  2MBF A;  3L00 A;  4IKF A;  3TQN A;  3CQZ J;  1TT5 B;  3JR9 A;  1W7P B;  1XSV A;  3K4K A;  3FWE A;  2Y48 A;  4KJZ A;  4BYY A;  2QYO A;  4ITV A;  4ZZD A;  1NG7 A;  2VPL A;  2D5V A;  1FOX A;  3OYH A;  1P4W A;  1QO0 D;  2PFB A;  4GYG A;  3HPG A;  1QZY A;  4D7M A;  3QPH A;  5IT3 A;  2NRA C;  3KYL A;  1W36 D;  1LEA A;  2XRO A;  4OIP F;  3LA2 A;  4ZYH A;  3FKJ A;  4HOB A;  1XCV A;  1IN4 A;  3FKI J;  2ZME C;  3CUQ B;  3SQN A;  5CVJ A;  4AIH A;  4E6K G;  3BDD A;  3ML6 A;  2FNA A;  5JHF A;  2VUM J;  2OCC H;  4R8H A;  4XMY A;  1YLF A;  2E1M C;  2Y0S N;  2W82 A;  5HS8 A;  4UV9 A;  2V1N A;  2RDP A;  1Z6R A;  3GXO A;  5ICG A;  1ZRD A;  1YTY A;  1TWH J;  5FD6 A;  1T95 A;  4CCL A;  1S9H A;  2KT0 A;  3JRH A;  1HDP A;  1A5J A;  4JQF A;  4B09 A;  4RB1 A;  2JRM A;  3QU3 A;  1VND A;  1ZEL A;  2VI6 A;  4DW6 A;  3HXL A;  1OFC X;  2OZU A;  1UMQ A;  4BQO A;  2H94 A;  1OCC H;  2L01 A;  1YRN A;  4W1U A;  3RZO J;  4UY8 I;  3L2V A;  2X85 A;  2DOE A;  4IQJ A;  4BE0 A;  4G6T B;  2E5N A;  5B1A H;  1J59 A;  3H3Z A;  2NNY A;  4RBO A;  3EPZ A;  1JHF A;  1OYY A;  4QPQ A;  2B63 J;  2LMD A;  4NQW B;  1R4M B;  4EV0 A;  1UCR A;  4BDY A;  4JYK A;  3KET A;  2AQF A;  3WGG A;  3ASO H;  1AOY A;  2QSF X;  2WC2 A;  3HRS A;  4A3I J;  4IZZ A;  2L9V A;  3QP5 A;  4M3E A;  3V8K A;  2V6C A;  1FP1 D;  5TRD A;  3HRT A;  5DYM A;  5D5V B;  5ED4 A;  5HOD A;  3RQI A;  1D3Y A;  1MDM A;  1UEL B;  2PJR A;  3QYB A;  4KN4 X;  3VYR B;  2DK8 A;  2FSW A;  3BR6 A;  2XDV A;  4I2O A;  4BEH A;  2X51 A;  1MBE A;  3QWL A;  3F22 A;  4PJ0 C;  1MDM B;  4MHG A;  4DOZ A;  3LSJ A;  2F4I A;  2ZME B;  3BTC A;  1KA8 A;  1GDT A;  4E7I A;  1TT0 A;  5CQG A;  4BEH B;  3W2A A;  3CUO A;  3LSI A;  4KUM A;  2DW4 A;  2EB7 A;  1FJL A;  3IHU A;  2HQR A;  2E1M B;  1ZHF A;  4U0V A;  3K4M A;  2ETH A;  3HSE A;  5EJC A;  2ID3 A;  3DQV C;  3QAH A;  2W84 A;  5M5W J;  4I76 A;  3AFH A;  5J4V A;  2QM3 A;  3EUH C;  5DCF A;  1Z3X A;  1YW9 A;  5LFA A;  1H9T A;  1EA3 A;  4I02 A;  4P96 A;  2JSC A;  2QZ8 A;  2IGM A;  3S15 J;  3OOU A;  3PNY A;  2R0Q C;  4E7S A;  1BL0 A;  4O5V A;  1X1C A;  3LAJ A;  2ZBK A;  2MC3 A;  2K4J A;  2LY1 A;  4CIC A;  3DLA A;  4D1Q A;  1R71 A;  2XSD C;  2FBI A;  3MMY B;  3FHZ A;  5DCM A;  4MFE A;  2E5Z A;  2QKL B;  4IVN A;  2OD5 A;  3O2P E;  1TC3 C;  3FIW A;  2PJP A;  1F1Z A;  3NWS A;  2JT1 A;  1TNT A;  3O8H A;  4OIO F;  3JW4 A;  4CYC B;  4HNV A;  5ICF A;  1GT0 C;  3JRG A;  4UUV A;  1RUO A;  4BJT A;  1SC7 A;  2QSG X;  1FBQ A;  4G12 A;  4BUP A;  4BDZ A;  1XSX A;  4KIS A;  1WRJ A;  2BY0 A;  3K1M A;  4BBR J;  4EJU A;  3Q3S A;  1M1E B;  1HST A;  4BGD A;  2PN6 A;  3E5U A;  1MMN A;  3HYI A;  4NC6 A;  3HL2 A;  2LKS A;  2EZI A;  1F36 A;  1IN8 A;  1OR7 C;  4XLN F;  3BR0 A;  1WJE A;  3TL4 X;  2A3S A;  2HPM A;  1B9N A;  1X19 A;  2OJE D;  4IX7 A;  1REP C;  3CP2 A;  4F91 B;  3H5R A;  3AG3 H;  1VQN I;  1W5C C;  4XBF A;  3OYN A;  1N77 A;  2KQR A;  2LH9 A;  5E3M A;  3HOS A;  1GV2 A;  1X4O A;  4AVZ A;  3PO2 J;  3HEF A;  2IBD A;  2VJ4 A;  1WFX A;  2GXA A;  3M1C A;  5LGN A;  3BR5 A;  5K7H A;  2JVG A;  1DU6 A;  1HKQ A;  2XRL A;  3TBI A;  1G3S A;  1ULY A;  2EA2 A;  2LSO A;  1JKR C;  1P4X A;  3H0G J;  4ZC3 A;  3FM5 A;  1WJB A;  3CF5 F;  1XGO A;  2V7F A;  2R7T A;  2X6Y A;  4LIU A;  3CME I;  5D6E A;  3MCZ A;  3BOQ A;  5C44 J;  2X6W A;  1ENH A;  1ETX A;  3WGH A;  5KHD A;  4A3F J;  1FEX A;  3IKV A;  2ZB9 A;  2HNH A;  1OCT C;  4G94 A;  2W4S A;  3ZMU A;  4XKC A;  1U9N A;  2P0W A;  1A6I A;  4EMS A;  5GPA A;  3D5S C;  3MD2 A;  4F7Z A;  4FHT A;  1S3J A;  3GTK J;  4DIQ A;  1GUU A;  4L0Y B;  2RNJ A;  1AHD P;  1Z1D A;  4HA8 A;  1MMA A;  3I55 I;  2HU9 A;  1OR7 A;  3A1Y A;  4A3E J;  5CVU A;  3OS2 A;  2NVT J;  2O9L A;  1MMS A;  2P6T A;  3DTI A;  3RTR A;  5GAG J;  1W5S A;  2VQL A;  1D1C A;  2DPU A;  5ILV A;  5IOZ A;  1WH5 A;  3E97 A;  2QLZ A;  5J8C A;  3IV5 A;  3MEX A;  1RPW A;  4DBR A;  1CF7 A;  1WI9 A;  2F5V A;  5HDG A;  4XSX F;  2VC1 A;  4MEY F;  2XGC A;  4D9J A;  2KIF A;  1NH3 A;  4ZYE A;  3ZXS A;  3S2H J;  1CF7 B;  1ZQ3 P;  1BR4 A;  4HRI A;  2L5Q A;  3JRI A;  1HOM A;  2FMY A;  2CUE A;  3QOD A;  3CCU I;  1W1W E;  3HHG A;  4UVA A;  3BJO A;  1U5T C;  2P8T A;  1AKH A;  2FA5 A;  1IRX A;  3ZGK A;  1WJF A;  1Z05 A;  3LOC A;  5M5Y J;  3V7R A;  1D0Y A;  1OLT A;  1S7A A;  4PJM A;  3ISP A;  5FKL A;  3HOX J;  5D5X B;  3A0B C;  2QQA A;  4FTH A;  2RV8 A;  1ACI A;  2EZL A;  3BG7 A;  1D1B A;  3LAP A;  4B1R A;  3LFK A;  5FRO A;  1XN7 A;  1JXS A;  4ZDP A;  2BHZ A;  2VJ5 A;  4XLF A;  1ONV A;  3RQ4 A;  1Z7L A;  2YS9 A;  1WSU A;  2EV0 A;  3E6B A;  2DT6 A;  2CQQ A;  1FWZ A;  4GDF A;  4BJ5 C;  3S16 J;  3GTG J;  1HLV A;  1ZLJ A;  4I0A A;  1LUJ B;  4KMF A;  1JUM A;  3T8T A;  1QBJ A;  4A69 C;  2J5P A;  1FYL A;  5DUK A;  2QEX I;  2B9S A;  2Y31 A;  2COB A;  4ESF A;  2IS1 A;  2CW8 A;  2KL4 A;  4W97 A;  3I58 A;  4HNU A;  1ETK A;  5F08 A;  3H0D A;  1FTZ A;  3CF2 A;  1GXP A;  4Q4Z F;  3ZQG A;  3L2C A;  1XGM A;  3WTU C;  3PNV A;  2HS5 A;  1HXD A;  4IHT A;  5KK1 A;  2V9K A;  5FKK A;  4E7Z A;  2F2E A;  5LEJ A;  2STT A;  3FF5 A;  1V4R A;  3E0J B;  2EFO A;  2JTV A;  2BEO A;  3U1K A;  2GA1 A;  2YSR A;  2VQH A;  4NDL A;  4HLX A;  4PCQ A;  1T39 A;  3QOP A;  1U5T B;  2DMN A;  3OY9 A;  2ELH A;  2HVQ A;  2QEN A;  4WK8 F;  1GVJ A;  4MTD A;  3I5U A;  1X3Z B;  4RB2 C;  1WZ2 A;  3TO7 A;  4G7Z F;  2CQX A;  2GBY A;  2WY7 Q;  2HQN A;  4YII A;  4A5M A;  2EZK A;  3HJE A;  2OTL I;  3J81 K;  3F0C A;  5LHI A;  3RPU D;  5E18 F;  4XIC A;  2VKE A;  3H36 A;  3EUK L;  1Z91 A;  2MAB A;  1KQ9 A;  3HSR A;  4UHT A;  3C2G A;  1MZB A;  1JGS A;  2M0C A;  3IH2 A;  1IDZ A;  5K5R A;  2G7H A;  3MVP A;  4PK4 A;  2VE8 A;  3CDL A;  3HRM A;  2O5R A;  4EGZ A;  1ZYR F;  2XF6 A;  3DFG A;  3ECO A;  4NC7 A;  2D1V A;  2BY2 A;  3RI4 A;  1R7J A;  4HZF A;  2GA2 A;  3JTG A;  3T0Y A;  1BI3 A;  4B8X A;  2HYJ A;  4GGG A;  2JA6 J;  4MO7 A;  2ID6 A;  3GFM A;  4KT6 A;  3NEU A;  5M5X J;  4Z6Y A;  4ENK A;  1PVE A;  1MSE C;  2QA4 I;  2NS0 A;  2PG4 A;  4S0H B;  4IEJ A;  3SZT A;  1ZGA A;  4ESB A;  2Q2E A;  2MFZ A;  3HG9 A;  2RKH A;  3PSI A;  2IGO A;  1H0M A;  4GYI A;  3BZC A;  3DKW A;  3MQ0 A;  3TGN A;  4P9U A;  5HLT A;  4BXU A;  3BC8 A;  5JVT A;  1U0J A;  2BY1 A;  2H6B A;  2Y30 A;  2QBY B;  4ZYA A;  5E79 C;  2Q1Z B;  2GAU A;  2ZXI A;  4I09 A;  2Y9Z A;  3FXJ A;  1Q1V A;  2EIJ H;  3T5X A;  4EVI A;  3OYC A;  2R7V A;  3PM1 A;  3BZK A;  1BI1 A;  2IVM A;  4AM3 A;  1X1D A;  2ZNZ A;  2DT5 A;  3JRF A;  3UR3 C;  3KEY A;  1F5T A;  2YX7 A;  3I4P A;  4BY7 J;  4IRH A;  3HUG B;  3VYS B;  2KP6 A;  3RPQ A;  3M8J A;  4F3Q A;  1EJ9 A;  2XSJ C;  3VDX A;  4A3L J;  3GWZ A;  2VT3 A;  1R36 A;  1OCO H;  1G2H A;  4WX9 A;  2CFX A;  4CSW A;  1FSE A;  3C7J A;  3JTH A;  5FLM J;  3HBL A;  1G8X A;  1QZE A;  4FT8 A;  2VKV A;  2HR3 A;  4D7N A;  2OAZ A;  1BI0 A;  4S04 A;  3I56 I;  1OQY A;  4R1H A;  2V1U A;  1Z6T A;  3RYP A;  3ZN1 A;  1TQI A;  3TDZ C;  4KN7 X;  1OMI A;  1LE8 B;  4PJN A;  5E20 A;  1R5G A;  2UUZ A;  4EJO A;  1RES A;  2MLG A;  5GTI C;  2GXG A;  5J4Y A;  2HKO A;  3L2U A;  3W6K B;  5GPC A;  2ZJ2 A;  4U7D A;  2Z16 A;  4E70 A;  2BW3 B;  3TKY A;  3WHB A;  2BXZ A;  2F5D A;  2JN6 A;  2DAO A;  2RAE A;  2OF7 A;  5D6F A;  2MGQ A;  3HGG A;  1QVU A;  1EH7 A;  3GFL A;  4G7H F;  1IG7 A;  2QCO A;  3IAS 2;  5JI6 A;  3M8F A;  3GF2 A;  2NVX J;  2CUZ A;  2W85 A;  3AKZ A;  2O6G E;  2CV2 A;  4B48 A;  3BT9 A;  3OYF A;  2PI0 A;  1K7A A;  3MKW B;  1LVA A;  5J8F A;  1UG0 A;  4ZJZ A;  3DU6 A;  2ZXH A;  2NS8 A;  2OPT A;  3JSP A;  2K3F A;  1FP2 A;  4O3M A;  1B1B A;  1X4P A;  1DPU A;  1ON2 A;  1CGP A;  2K27 A;  4Y7N J;  2DOD A;  3I53 A;  3KE2 A;  1G4D A;  4C30 A;  1IGN A;  1RC9 A;  1ETY A;  2HZT A;  4CH7 A;  4P9F A;  2AS5 F;  2K9M A;  4UUS B;  2KRC A;  3BLY A;  3H5A A;  3ESW B;  4HX4 A;  1QHH D;  4A3J J;  3BQY A;  3CCE I;  3FXK A;  2FNP A;  2VAS A;  3W6V A;  4NNJ A;  2OBP A;  2HQA A;  3F6V A;  2Z3Y A;  3OR2 C;  1JT6 A;  4L5E A;  3E6M A;  5F1R A;  2DA4 A;  2P7V B;  4JP0 A;  4M3D A;  1KYZ A;  2CW0 F;  1SMY F;  2V79 A;  3C3W A;  2LYC A;  5EGO A;  3OIO A;  3CDI A;  2X9D A;  5E17 F;  2V26 A;  1K6O A;  1YQA A;  4F52 A;  5EGO B;  5DM7 F;  4IHX A;  4N9H A;  5LHG A;  5K1Y A;  3CC7 I;  1UB9 A;  1J7K A;  2ESH A;  1QZZ A;  1K78 B;  1RUN A;  4A3K J;  2K02 A;  1MBG A;  4MNU A;  3DF8 A;  4OU0 A;  1NHA A;  4A3M J;  1MBH A;  4OAZ A;  2PEX A;  3QPT A;  1ON1 A;  4HAM A;  1RKT A;  4A5N A;  1R22 A;  1D8K A;  1WQ2 A;  2UXN A;  2R7X A;  4RMN A;  4CCJ A;  4B4C A;  1YOV B;  3Q0U A;  1XDS A;  4IHS A;  4V19 K;  3EYI A;  3JCU C;  1O57 A;  2E7X A;  2Z2S B;  5F6F A;  5J6X A;  2CYY A;  4UVB A;  2AHQ A;  2QUF A;  5GAE J;  1ZGJ A;  2A68 F;  1YX5 A;  2DN0 A;  2F6C A;  3COA C;  2R4G A;  2LRD A;  4PGH A;  1BJZ A;  3TW6 A;  3EDP A;  4A6D A;  3OYI A;  2ZJQ F;  4IXA A;  5FKO A;  4EGY A;  3DTK A;  1YW7 A;  4ENN A;  1VQ8 I;  2R92 J;  2VJI A;  3S3M A;  4Y4R A;  1IV6 A;  5L3C A;  2XAJ A;  2IW5 A;  4M6V A;  1YS6 A;  4X6A J;  1BR1 A;  3H92 A;  3HOZ J;  5ICE A;  3N05 A;  3K70 C;  4BAC A;  5FRM A;  1G3Y A;  3R0J A;  1B4A A;  1RET A;  3F72 A;  5FJ8 J;  5KAF C;  1H89 C;  3JRC A;  2JMW A;  2FQ3 A;  2VON A;  3PO3 J;  2F5C A;  2KLO A;  3H9J A;  4BQA A;  1IN6 A;  4IOA F;  1D8J A;  1SD4 A;  3I59 B;  2A07 F;  3PFY A;  1FIP A;  2K3P A;  1BIA A;  1W7P A;  2Z9O A;  1T08 B;  1WHU A;  2CSO A;  4JX5 A;  2Z33 A;  1JE8 A;  4MLO A;  5F04 A;  3RKX A;  2H09 A;  4A3G J;  3OYL A;  3K4J A;  2XB5 A;  2BBY A;  2V1D A;  2IT0 A;  4C2T A;  5FFX A;  5IYC J;  3WG9 A;  2MD0 A;  1YE9 A;  1IRF A;  5FB2 A;  3CMA I;  3RKW A;  1IO2 A;  1WH7 A;  3DEU A;  3CUQ A;  1E17 A;  3C2B A;  2B7E A;  3CCQ I;  2VKD A;  4O6J A;  2O03 A;  5FGM A;  5J40 A;  3V4G A;  4CZZ A;  3DEE A;  2K85 A;  2P7C B;  3AAF A;  5DM6 F;  3V7C A;  2Q0O A;  3HDD A;  2PX9 A;  1MW7 A;  3A2K A;  3M07 A;  4EJV A;  1PJR A;  1E3P A;  3QYE A;  2E71 A;  3PFI A;  4II3 A;  4BKX A;  1APL C;  2ZFW A;  4MQV A;  2DA7 A;  2ZNY A;  3K6G A;  2LBF B;  1RIO H;  3KEO A;  4HYE A;  4MTE A;  1LDJ A;  4FAS D;  4YFK F;  3F6O A;  4AIK A;  1BW5 A;  2WAD A;  4I98 B;  2ME6 A;  2IRF G;  1YYV A;  5B1B H;  3F3X A;  1R6R A;  1T0F C;  2JK3 A;  5CKT A;  3SYT A;  4J19 A;  3S8P A;  4BE1 A;  2GM4 A;  2M5W A;  3LFU A;  5D5U B;  3VSL A;  1HW1 A;  3S1M J;  4LG0 B;  2MYS A;  2IA0 A; 
#chains in the Genus database with same CATH homology
 1S72 I;  3CME I;  1VQ9 I;  1VQP I;  3CCM I;  2H8W A;  4V19 K;  3G6E I;  1VQK I;  3CCS I;  2ZJR F;  5GAE J;  1YIT I;  3I56 I;  1VQM I;  2E35 A;  1YI2 I;  2ZJQ F;  1YJN I;  1VQ8 I;  1VQ5 I;  3I55 I;  3CCV I;  5GAD J;  2ZJP F;  2OTL I;  1QA6 A;  1MMS A;  3CD6 I;  5GAG J;  3DLL F;  1FOX A;  1VQL I;  1HC8 A;  3CCJ I;  4IOC F;  1VQO I;  1VQ4 I;  1YIJ I;  3G4S I;  2NXN B;  3CCU I;  3CCR I;  3CJT B;  2K3F A;  1YHQ I;  1YJ9 I;  2JQ7 A;  3J7Y J;  3PIP F;  3CMA I;  2QA4 I;  2E34 A;  1ACI A;  3J7Z I;  3CCE I;  3CCQ I;  5GAH J;  4IO9 F;  3CC2 I;  2FOW A;  4UY8 I;  5DM6 F;  2E36 A;  1FOW A;  1VQN I;  1FOY A;  3CC4 I;  1VQ7 I;  1Y39 A;  3CCL I;  5JVG F;  5DM7 F;  2QEX I;  2OTJ I;  3PIO F;  1YJW I;  3G71 I;  1VQ6 I;  3CC7 I;  4IOA F;  3CF5 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...