3I5BA

Crystal structure of the isolated ggdef domain of wpsr from pseudomonas aeruginosa
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
170
structure length
170
Chain Sequence
ALMNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords WspR response regulator
publication title Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 58
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i5bA00
2OPQB 4NRUA 1JKHB 5EWGA 5KFXA 4ZMMA 5KFBA 3KLFA 1RT7B 3QO9B 4RUAA 2AGQA 4M94A 4WZMA 1JLFA 4IFVB 5DQIA 2ATLA 1LW0B 4MH8A 1FK9A 5J2PA 5KFOA 4LSLA 5C25A 1IKYA 1JLBA 1KHWA 3BSOA 3RB0A 1HPZB 1MU2A 4EO6A 3H5YA 4DL6A 4K4ZA 2JEJA 4MFBB 3DM2B 5EWFA 3DLKA 3T5JA 3OSPA 2FVSA 4IOBA 2W9AA 4FS1A 3T5KA 4NLYA 3SFGA 2R2RA 1Z4UA 4ZPCA 3PR4A 3H5UA 4H4MB 3FFIB 4Y3CA 4RW7B 2YKNB 4J9RA 1QAIA 1IKXB 2BRLA 1R0AB 2V9WA 2E9RX 3JSMB 3CO9A 5HLFB 3D28A 2WOMA 4G1QB 4K4XA 4ECUA 2BANA 3BSAA 4J9KA 3V6DA 4NRTA 4KE5A 2ZD1B 3V81A 1I6JA 2VG5A 1T03B 1TKXB 3GILA 1JLCA 1EETB 1S9GA 2XGPA 5D3GA 5CYQB 2JC1A 2RDJA 4ID5A 1RDRA 1JLGA 4O4GA 5C5JA 4DL7A 3OLBA 1S0MA 1J5OA 2YNFA 1REVA 2WONB 4RW9A 3MR3A 3KLEB 2IM1A 4DG1A 3RBDA 3TAMB 3RB3A 4MK9A 2ASLA 1U09A 4TY8B 1S1UB 1S1XA 4YR3A 3G6YA 4ED3A 2WTFA 5HP1A 5KFRA 3KLHA 3GYNA 3KK3B 4R8UA 1GX6A 4QWDA 3M8PB 4H4OB 3G6VA 3PW2A 1BQNA 5I3UB 2VA3A 2JEFA 4B3OA 1TVRB 5CYMA 3NBPB 1HQUB 4IRDA 5F8LA 5J2NA 3BJYA 4MKBA 4RW4B 3V4IB 1C0UB 2V4RA 2W9CA 1HARA 1NNDA 3PVXA 1HNVB 3DOKA 1RT2B 3QZ8A 3BQ1A 3I0RB 4PUOB 3H2LA 5KFTA 2UVVA 3FRZA 2D3UA 2I5JB 3OL7A 1S6PA 5KFEA 2FJVA 4ICLA 2AQ4A 3RAXA 5J1EB 2I1RA 4IFYA 4IQXA 3RB6A 2V4QA 1TL3A 1RTHA 3C6UA 5F8IA 1JLEB 1KLMB 1VRUA 3E01A 3EPIA 2JEGA 3KOAA 5KFWA 2W7PA 3BGRB 2RDIA 1UWBA 3MR5A 1N56A 1HNIA 5JXSA 4Q0BA 3GIMA 4Y34A 4ZVFA 2EC0A 2UUWA 2YKMB 2FVRA 2R8GA 3CVKA 2BQ3A 4TYBA 5DQGA 1C0TA 2R8HA 2HNZB 4XPCA 3OL8A 4YP3A 3KJVB 4NLVA 3V6KA 3G6XA 3KLGB 2HNDA 3CIZA 3PJXA 5KFQA 4IR9A 2C2DA 3KK1A 3QGGA 1D1UA 3MF5A 4TN2A 1S1TB 4QW9A 4YR2A 2XC9A 3IS9B 2GC8A 3DI6B 3CJ3A 4ECSA 1BQMA 1VRTB 4J9SA 3TVKA 1EP4A 1XR5A 3DLGB 1KHVA 1HMVB 3DOLA 3QLHA 4ED7A 2OPPB 2R2UA 2OPRA 4IRCA 4NLGA 1HQEA 1RTIA 5KFUA 5DG9A 2IBKA 3DLEB 3MFIA 1S9FA 1HQEB 1OS5A 2RKIA 3LP2B 4R5PB 4J9QA 4K4WA 1S1VA 3KHHA 2HWHA 4G3IA 3LP1B 4IRKA 3T1AA 1DTQB 3MECB 3CDEA 5KG5A 1JLQA 1RTJB 3I0SA 2YNIA 2GIQA 4KSEB 2AGPA 3H5XA 5K14A 1RT3A 5KG4A 1T05B 1N4LA 5C24A 2OPSB 4NCGA 3LAKA 4ECXA 5KT7A 4ECTA 3NAIA 3M8QA 2VA2A 2XI2A 1NHUA 4YMEA 3CJ2A 4TXSA 3ICLA 2C28A 2WHOA 3BR9A 3MEEA 1MMLA 4O3NA 3GV7B 3I5CA 3VQSA 3KLFB 2W8KA 3KK2A 3HVAA 4NLQA 3T19A 1JLFB 3RAQA 2IMWP 5KFFA 4XO0A 4TYAA 3M9NB 1FK9B 4KO0A 3QGHA 5J2PB 4LSLB 1T94A 5C25B 3RB4A 1IKYB 1JLBB 2FVPA 5L1LA 1RT1A 1MU2B 3GV5B 3IG1A 3HVTA 3SFUA 4NLSA 3DRRA 3DLKB 4DL5A 3H4DA 4ZVHA 3FSIA 5KFNA 3ITHA 5F8NA 4KFBA 1SH2A 4DEZA 4KHRA 5F8GA 3G86A 5T14A 5KFGA 3MR6A 2W9BA 2ZKUA 5I42A 3N6MA 2WOMB 2BANB 3OL6A 5F9LA 5FDLA 3GV8B 5J2MA 5KFJA 3V6DB 1LWEA 3V81B 2VG5B 3NKYA 5FDLB 3DDKA 1N5YA 3H5SA 4FBUA 1JLCB 1S9GB 3KMSA 2F8EX 4PWDA 5D3GB 4KHMA 4IDKA 3H4BA 4NLRA 4NLOA 4TLRA 1DTTA 4ID5B 4RZRA 1ZTTA 1JLGB 4O4GB 5EWEA 3KLIA 1J5OB 2FJXA 2YNFB 4RU9A 4ED1A 1REVB 4Q43A 4RW9B 1RT5A 2B6AA 4RNMA 4DG1B 1LWCA 3CWJA 4I2PA 3OHAA 2IAJA 2R8JA 3OLAA 2D7SA 3QIPA 1HYSA 3ISNC 3KHRA 5HP1B 1QUVA 1S1XB 4YR0A 1S49A 3KLHB 3NMAA 3PHEA 5KFIA 4R8UB 2FLPA 4O3PA 1BQNB 2ZE2A 1S4FA 4ECVA 4RW6A 5J2QA 1XR7A 4K4VA 3BSCA 2FJWA 2E9TA 4Q8FA 4B3OB 1SUQA 3KMQA 5CYMB 4LQ9A 4KBIA 3GIJA 3SI8A 4F4XA 5J2NB 4EYIB 3DRPA 1IKVA 1RTDA 2W9CB 3PW7A 3IGNA 1FKPA 1LWFA 2R2SA 1SV5A 3DOKB 4DL2A 4WE1A 2IJNA 3CDUA 1S6PB 3N6LA 1JX4A 4ICLB 4WZQA 2BQRA 1TL1A 1GX5A 4IG0A 3JYTA 1DLOA 4IFYB 4ECWA 2VG7A 1N48A 1TL3B 3OHBA 4NYZA 1RTHB 4EEYA 1JXLA 5HROA 3C6UB 1VRUB 3E01B 4Q44A 1TKTA 3MFHA 4O3OA 1TQLA 1S9EA 4JV1A 2C2RA 5DQHA 1UWBB 1C1CA 3IRXA 1HNIB 4J9NA 4Q0BB 2WRMA 2IM0A 1QE1A 3CJ0A 4I7FA 4ECZA 2YNGA 1QE1B 1RT6A 2BRKA 4NLWA 4TQSA 1C0TB 1RT6B 3I5BA 4NLPA 4K4YA 2RF2A 4ECYA 2W7OA 1LW2A 3KLVA 2HNDB 4RW8A 3BQ0A 4J9PA 2AX1A 2CKWA 3MR2A 2AU0A 3KK1B 1S0OA 3MEGA 2XCPA 5L1KA 3GQCA 4X2BA 2D41A 2VG6A 4NLDA 4WFYA 5L1IA 3QZ7A 3Q8PB 2FLLA 1BQMB 3HKWA 3KHLA 2YNHA 1FKOA 1EP4B 1S6QA 3DYAA 4WFXA 2BR0A 1CSJA 4IG3A 3DOLB 3QLHB 2OPRB 3UPFA 4IG3B 4JV2A 2IC3A 1RTIB 5C42A 5KFCA 3LAMA 4ECRA 2DPIA 2RKIB 4ZP9A 2B5JA 1S1VB 3IGVA 1YVFA 2WK4A 4ECQA 1RA7A 3TQ1A 4F4YA 3C6TA 3DMJA 3MEDA 1NHVA 4MKAA 4EBDA 4WXWA 1RT4A 1JLQB 3I0SB 2YNIB 3H98A 3QYYA 4ED2A 2BQUA 1D0EA 4IH5A 1RT3B 5K14B 4RNNA 3CJ4A 1N6QA 3NL0A 4R0EA 5C24B 4K50A 2JEIA 4NCGB 4O3QA 1WNEA 1W25A 1XR6A 2HNYA 3UQSA 1JLAA 4O44A 4MK8A 5HBMA 1C1BA 2ILYA 5KFDA 5KT2A 4PQUA 4KV8A 5KFZA 3M8QB 4U6PA 4ED8A 3KNAA 1S10A 4KKOA 5DG8A 2WB4A 3UR0A 4RNOA 1S1WA 3MEEB 3PZPA 4ZHRA 3LP0A 2IJFA 4EBCA 2HMIA 4I2QA 4URSA 3KK2B 1TKZA 4K4TA 4ZPAA 2BE2A 5KT3A 4U7CA 4HYKA 4EBEA 4QWEA 4LSNA 3ISND 1T3NA 1RYSA 4K4UA 2W9BB 3DRSA 4KO0B 2FVQA 3Q8SB 1TV6A 1ZETA 1IKWA 4ZP7A 2OPQA 1RT1B 5KT4A 4F4WA 5F8MA 1JKHA 5KFVA 4J9MA 4ZVGA 3IG1B 3HVTB 3DRRB 2XCAA 4MIAA 4ZVEA 1RT7A 3QO9A 4ED0A 4GC6A 3PW4A 5KFYA 2JC0A 3ITHB 1S97A 4KFBB 5L9XA 2OH2A 4IFVA 4O4RA 3E51A 1IM4A 3RBEA 1LW0A 4H54A 5KG7A 2D3ZA 5KFLA 4M95A 5I42B 3M9OB 3PW0A 1HPZA 2AGOA 3N6NA 2QE5A 5J2MB 1JIHA 1LWEB 1RA6A 4MFBA 3BQ2A 3DM2A 4RUCA 1N5YB 1RAJA 3T5HA 4FBTA 4PWDB 5DLGA 5KG2A 3CJ5A 4IDKB 2ASDA 1DTTB 4H4MA 3FFIA 5KG1A 4RW7A 3KLIB 2YKNA 3LALA 1IKXA 1R0AA 2UUTA 1RT5B 2B6AB 5KFAA 3JSMA 2R8KA 4LQ3A 1LWCB 4I2PB 5EUHA 2QV6A 2IAJB 4MIBA 2R8IA 4G1QA 5HLFA 1K1SA 5KFMA 3QIPB 4KAIA 1HYSB 2ZD1A 3QIDA 2IM3A 4IH7A 4J9LA 1T03A 5KFHA 4Q45A 1TKXA 2ASJA 1EETA 5KT6A 2UVUA 2ZE2B 4GC7A 4RW6B 5CYQA 5J2QB 3H40A 4DL3A 3FQLA 2DPJA 2HAIA 1SUQB 5DG7A 4IR1A 3QGIA 4QWAA 2WONA 3DRPB 1IKVB 3KLEA 4JV0A 4QW8A 3H59A 2ILZA 3TAMA 5KG6A 1RTDB 2IM2A 2B43A 1FKPB 4K4SA 4TY8A 1S1UA 1LWFB 1SV5B 3NGDA 3KK3A 4WE1B 4TQRA 3M8PA 4H4OA 3Q8RB 4O3SA 4YQWA 3M9MB 5KG3A 3D5MA 5I3UA 4TY9A 3PR5B 3V6JA 1TL1B 4IG0B 3JYTB 2WCXA 5KFPA 1DLOB 1TVRA 2VG7B 3HHKA 1HQUA 3NBPA 4WFZA 4RNFA 1S48A 5HROB 4RW4A 4URGA 1C0UA 3V4IA 4O3RA 1TKTB 5JUMA 5F8JA 1S9EB 4URQU 1C1CB 1HNVA 3IRXB 3V6HA 2E9ZA 4NLTA 1RT2A 4PUOA 3I0RA 4I7FB 2YNGB 3KHGA 4QPXA 2I5JA 4NLXA 4ZPBA 2ALZA 4Q8EA 4RNHA 1C2PA 5J1EA 2RF2B 2C2EA 2XGQA 1LW2B 3PW5A 4RW8B 5L1JA 1KLMA 1JLEA 4OL8A 3BREA 2XI3A 3MTKA 4WYWA 3IN5A 4F50A 3BGRA 3MEGB 1RYRA 5KT5A 2VG6B 4MK7A 4KB7A 2FVCA 2JLEA 3EPGA 2UVRA 2YKMA 3BSNA 2YNHB 1FKOB 1S6QB 3DYAB 1ZTWA 2HNZA 2O5DA 3CDWA 3PJWA 4Y2CA 5F9NA 5EDWA 2XWYA 2GIRA 3KJVA 2FLNA 2C22A 2J6TA 5DLFA 1SH0A 4ZP8A 2IC3B 3KLGA 3GIIA 2AX0A 5C42B 5KFKA 3Q8QB 2B5JB 4FS2A 4NLUA 1S1TA 3OSNA 4NZ0A 3IS9A 3C6TB 3DMJB 3DI6A 3MEDB 4WYLA 1K1QA 1RT4B 1VRTA 2V0NA 3DLGA 2IA6A 1SH3A 2UVWA 1HMVA 4IH6A 2W8LA 1N6QB 3OL9A 2OPPA 4Y2AA 4QWCA 4F4ZA 4QWBA 2HNYB 5KFSA 1JLAB 3DLEA 3I5AA 4O44B 3LP2A 1C1BB 4EO8A 5HBMB 5F8HA 5DGBA 4R5PA 4KV8B 5KG0A 2R2TA 5DGAA 2HWIA 4PQUB 4ZP6A 3LP1A 4JUZA 4KKOB 1DTQA 1TP7A 3MECA 4ED6A 1S1WB 1QAJA 4IKAA 2CJQA 4WXOA 1RTJA 4ZHRB 3FQKA 3HVWA 3LP0B 3GIKA 4DL4A 1S0NA 2HMIB 4I2QB 1TKZB 3NAHA 4EYHB 3T5LA 1T05A 2BE2B 4ZPDA 3UDLA 2AWZA 2J6UA 2J6SA 2OPSA 4HKQA 4LSNB 3LANA 4XPEA 3DRSB 4J9OA 3EZUA 1TV6B 3FDSA 1IKWB
chains in the Genus database with same CATH superfamily
4WBFA 3MMAA 2W7AA 1X4FA 1SKWA 4MH8A 1NEEA 1FRHA 4IOBA 4HI1A 4P9SA 3LTOA 2EKNA 3D28A 3ZTRA 1GTEA 3AXKA 2GQ2A 5IM0A 2DGSA 3T1YF 3P4UB 3FBEA 1S9GA 1WHXA 3MPWA 2U1AA 3TAMB 4V19J 4R0JA 2UU9J 3SCJE 4PWUA 5I3UB 3ZO7A 4P72A 2AT1B 2X3GA 1TELA 3VAFA 2FY8A 2AJ0A 5KFEA 1QVGR 5IV3A 4ELUA 2W4PA 4DV6F 4OI1A 2XM3A 1N5TA 1JWWA 2RDIA 1T8EA 2VZ9A 3FRYA 3C14B 5DQGA 4OI3A 1CULA 1AZSA 5E7OB 3V6KA 4E8UA 1WF2A 2CQ2A 3KK1A 3QGGA 2XC9A 2GFFA 2CRLA 1HMVB 2OPRA 1K0VA 3GJRB 3HD2A 5B0AA 3MD3A 4K4WA 3KHHA 2CJKA 2GCFA 4CYUB 5C24A 2BYCA 4FP9A 3LAKA 3NS7B 5GMDA 3CJ2A 4TXSA 4GVBB 2WHOA 4JI7J 2FJAB 2XY5A 2LXFA 3D4JA 4P7TA 3I82A 1WKKA 3NNCA 4QU6A 2WVCA 1RHJB 5KTQA 4WPAA 3M8YA 1QTMA 4HEA9 1VJQA 5HMYA 4ENOA 4DPOA 3Q24A 5DDQC 3FMBA 1PKUA 3B6BA 4OX6A 1IWAA 4Q7AA 4DG1B 4USUA 3QJJA 2GO9A 2JDJA 3AXMA 1IJEB 4PG6A 3GWCA 2BJ8A 2QLJB 3CXCR 1NSAA 4V1Ak 3CD0A 2VG7A 1JXLA 1GQEA 1NDCA 1TQLA 2UXCJ 4MJKA 3J81Y 1YJUA 3JXOA 4JOUA 1R27B 5AXLA 3I32A 5BR8J 1LK5A 2IIHA 2HNDB 3BQ0A 3MR2A 2G1DA 3NGTA 5L1IA 4UT4A 2MKKA 3ZZUA 1SXLA 1WF1A 3VGTA 4DR5F 5I4MA 4DHVA 5DO2A 1RA7A 3AJ1A 5D4LA 4OI4A 2ILYA 4ED8A 2WB4A 3L9ZA 4NEYA 1S1WA 3MEEB 2HMIA 4CT8A 4K4TA 4EBEA 2WSCC 2VFRA 5KOWA 2ZVSA 1F5CA 2VU5A 1RT7A 2CVEA 1REGX 1QAYA 1F1BB 2DH9A 5DZ6A 1RWMB 4CH1A 3DM2A 2HVIA 1N5YB 2CWXA 1RWVB 1HWJA 2KH9A 1RT5B 3QIPB 1HBMA 4IH7A 1HI8A 2R4FA 3IR6B 3EJMA 1TK0A 2UVUA 4JI2F 2I38A 4CDIA 3H59A 3OBIA 2IRUA 1S1UA 3DLHA 3IO1A 3V6JA 2R7VA 3BN7A 1NJWA 1UVJA 3F0NA 2HFUA 2L48A 2EK1A 4M5HA 4NLTA 2EXUA 5K8PA 4I7FB 2YNGB 4QPXA 2HFVA 2ALZA 1X4HA 4ZJOA 2C2EA 4DX6A 1VIXA 2DGUA 1MSWD 1ICEB 2ZVIA 3BGRA 1RWNB 1FKOB 2E29A 2HNZA 3E2EA 3K58A 3PRBA 1NJZA 2CPYA 4MAKA 5DLFA 5KFKA 5C42B 3D6TB 1PAUB 3PDNA 5C7PA 3SQGA 2ROGA 2IVFB 5B0DA 1JLAB 1S7IA 2RU9A 2R2TA 5HI7A 1QAJA 3P6YC 5HVGA 3T5LA 1T05A 3UI3A 4L6V3 1X9MA 1Z2ZA 1IKWB 1UZDA 3AH6A 3QO9B 4RUAA 1OY6A 3EXCX 3P96A 1Q95G 4JI3F 1YLXA 5J2PA 2VIHA 4BC7A 4M5MA 3AA9A 2KFZA 1IKXB 2LEAA 4N8NA 4C8LA 1KP6A 1TKXB 1UPMB 3MOZA 2XEXA 5EN1A 2XYHB 4O4GA 5C5JA 4DL7A 3ZZ0A 4RBTA 2RQMA 1I1GA 5DRKA 1IJFB 4PR6A 2K7JA 1VHIA 2W2MP 3LPYA 1WDDA 3MMCB 3PW2A 4YDDB 4X4NA 4TVAB 4DFMA 1HA1A 1C0UB 4CLSA 1D3WA 3OL7A 3Q0AA 4A8SA 4QJVA 2HVZA 3B4DA 1RAAB 1FDDA 4DX8H 1R8HA 2B7BB 4EZ9A 4DV2J 3CVKA 2UUAJ 4ED4A 4C11B 1CULB 4IQMA 1VLYA 2OTJS 3UDCA 3PYEA 4MKYA 1Q53A 1KHVA 2JRSA 1VK8A 1UVLA 2DR9A 5KFUA 1VQNS 2QRRA 2Z2MA 1N34F 1IR1A 2VA2A 2MHNA 1RHKB 2MKIA 4CTAA 3WC2A 2FZKB 2KG0A 5D0EA 3IP0A 3LOUA 1GK8A 4U8VA 2DR5A 1MW7A 2GJFA 3Q8YA 4JYAJ 3SFUA 4ZK7M 3DLKB 4FXVA 2RHSB 1HNXJ 4ZVHA 5IZHA 1WI6A 4DEZA 2KYZA 3N6MA 5AXMA 2CQ3A 2J9EA 3KJQB 3ILLA 3H4BA 1NUEA 3KLIA 2FJXA 1REVB 1X5PA 3CCES 3BKUA 2K8GA 3NMAA 2X1AA 3G96A 2FJDB 1HKAA 3MM6A 2R2SA 3EGVA 3BGFA 1HNWJ 4WE1A 5DM7Q 3R1HA 2FQQB 1TKDA 3JTOA 1DLOA 4ECWA 2HGNA 4Y00A 4ZPVR 2GJIA 3P3DA 1DQAA 1S9EA 3Q86A 4J9NA 5M2UA 1UETA 3M2RA 5AJ3J 1C0TB 3G6ES 2H9ZA 4F26A 2PEBA 2WB1D 1CJTA 1RBOB 1S0OA 1NZAA 3CD7A 3SEOA 3N01A 4NLDA 1T0TV 2MQ8A 2RE1A 1BQMB 1FD2A 2BR0A 5GMEA 3S6EA 1HR0J 1YVFA 3QRQA 2NXEA 2QA4S 4LF5J 1NHVA 1UVKA 1SC1B 1T9UA 3P5BP 1N0UA 4Z2XA 1WORA 5KFZA 2YPYA 4DSEA 3MXHP 3VAGA 4U95A 4P2FA 2F7VA 1CLFA 1X4BA 2KHDA 3IM8A 2HYIB 3FBBA 4ZVGA 3N0VA 3A8IA 4PQAA 5L9XA 3AOBA 1FWLA 5GADI 2HHHJ 2CQ0A 1XMOJ 3IBFB 2D3ZA 3DHWC 2CA9A 5ETSA 5I42B 3N6NA 4ER8A 2XSFA 4FBTA 4LJMA 4NL5A 1Z1ZA 3TUZC 1PCAA 3IAS9 1FXRA 3NCRA 3MPVA 2DNLA 3RRGA 1LWCB 4UQTA 2DRDA 2IM3A 1T03A 1H3DA 3G8TA 3K59A 2V8VA 1RTDB 2LQ8A 2Z4PA 3IBCB 2MZRA 5CZVA 4ZLPA 4YQWA 4TY9A 4XIUA 2EBGA 3Q2TC 1HWKA 1U24A 5HROB 3V4IA 5JUMA 1FTCA 4DUYJ 1YDLA 5HMZA 3BO2A 1C1CB 1HNVA 1XNQF 1U6FA 2FGOA 4Y0FA 2YX7A 5IOLA 2V50A 4YN3B 2DR6A 3TJ8A 4E98A 2CNOB 4OJGA 1WC3A 3BREA 3IN5A 4WYWA 3MEGB 3SDEB 3HVRA 2OUGA 3GIIA 2PI4A 3PKMA 1WELA 4OYPA 1LWXA 4H4KA 1HBOA 2MMYA 3DI6A 4X4RA 1M5VC 4W90B 2AEMA 3VCDA 2OPPA 2ZDPA 4F4ZA 4DV0F 4O44B 5HBMB 4ZS6A 3MECA 3GIKA 1YIJS 3SIPB 3NAHA 4K2XA 1GXUA 2XLJA 3W64A 3WIVA 4CO2A 1JKHB 2P9GA 4DQSA 1S79A 2HS4A 2KYXA 1RWXB 2CZ4A 1QVFR 1I3OB 4IFVB 2CFXA 2VUGA 2I9SA 2HQCA 3CJTA 3T5JA 4GO5X 4DFPA 4P2XA 1WACA 2BRLA 1CJKB 1S77D 3RAMA 3W8PA 4ZIVA 1EETB 3K5OA 5BYRA 2DRBA 4F4AA 3CCLS 3I9V9 2VBXA 3G6YA 3GLJA 3QMQA 3M8PB 4JI4F 1A7GE 2PIIA 1HD0A 2QMUB 1SBRA 3J80U 2V4RA 4KGMA 2BOPA 1XNRJ 2M8HA 1RT2B 3QZ8A 3PV8A 1NK0A 2YKAA 2JJ4D 1UWBA 4JP8A 5ETTA 3X3UA 5ETQA 1S1TB 2RHQB 2OP5A 3CJ3A 2KB2A 4J9SA 1PO6A 2RDDA 4O23A 5ETVA 4ELTA 2G13A 2C2NA 1XQIA 3FK4A 3KWMA 4IRKA 4C8OA 3I0SA 3H5XA 4B3MF 2GMLA 1NBEB 2OPSB 4NCGA 1NHUA 3QRRA 2CZ9A 3JTPA 2DJWA 3T19A 2XMKA 4DN0A 3M9NB 1GMWA 1B7FA 1T94A 1JLBB 2MY7A 2RU3A 2CPZA 4PXEA 2ZKUA 3DGPA 3VGUA 3SYZA 2BANB 5ETKA 3R2DJ 2EC2A 4NYOA 3G8SA 4OX9F 4NLRA 1X0PA 4RW9B 4I2PA 3OHAA 4WP9A 3ISNC 1QUVA 5H9EJ 1S49A 1VFJA 2MJUA 3L7PA 4F3OA 4Z7CA 2NQPA 1XR7A 1RHUB 4OX7A 4X64F 4Q8FA 1IKVA 3K5NA 3KJNB 5HK4A 4ZA1A 3A3OB 3CMES 2PEHA 3CDUA 4C8NA 3N6LA 3MI7X 5CHCB 1VRUB 2XY6A 4DR7F 3GMGA 2YWKA 3LW5C 1HNIB 4DV1J 2CDQA 5AE3A 2WZ1A 1GFWB 3Q8VA 4I67A 2CKWA 4KR0B 2RH3A 1UEKA 5F3TA 4X2BA 1VDHA 1NZ8A 2MZJA 4TNOA 1BMQB 1EQ0A 4X62J 2R7XA 2KL8A 2QT7A 1DBDA 3Q8UA 2LFVA 2V4JB 1APSA 4EBDA 5CXTA 4WXWA 2WAQD 1OSDA 2OLWA 3O2IA 1RJJA 1R31A 3AQOA 1S6UA 1N36F 2B0GA 4KKOA 3R5DA 2UZAA 2RIJA 2ZM6F 3KK2B 5A8KA 2PE8A 1WF0A 2PO4A 2FVQA 1ZETA 3R5BA 1RT1B 3O3LA 2DNRA 1SKSA 3ITHB 4DR4F 2FUG9 3E51A 4HACA 3SZ2A 2I2YA 4YEAA 2DVIA 4NA1A 1RA6A 4PKDB 2C2ZB 4N76A 3T5HA 1S7HA 2M8DB 4OYBA 1TL4A 3L09A 4WU2A 1DTTB 4MTPA 1AFIA 2MQQA 2QA4G 5CYQA 1KLNA 1XC9A 1RU1A 5DG7A 1I94J 4M5DA 2DY9A 3Q8RB 2R7QA 3FJ2A 1WC6A 5THWA 2F4VF 1RK8A 3IM9A 2QFIA 3IWNC 2VPWB 1AA1B 1RCXB 4ZLLA 1ZM2A 1LW2B 2VFTA 4Z37A 3RRHA 5K8OA 2OFGX 4OV1A 2JFDA 2AJ4A 3K0JA 2N3LA 4NMLA 3OTOJ 2B5JB 2XG8A 4FS2A 1QM9A 2P9EA 3IR7B 4WYLA 2MKCA 1K1QA 1VQ7S 2UVWA 4ZLJA 1N6QB 2DTJA 2M52A 2CWKA 4GRSA 5KG0A 2J5AA 3TOQA 1D9AA 4DL4A 2KT2A 1AW0A 1N5SA 2BE2B 3HFZB 5BJRA 1QTNB 5E33A 2ACYA 1RBAA 4EGLA 4UUWA 1PYOB 2WSEC 3L95X 3EWGA 4X84A 4LSLA 1FJ7A 5EWFA 4K0KJ 2IPOB 4Y2MA 3NNHA 3DCAA 3R2CJ 1V9OA 1Y9OA 3TEGA 1VISA 1HI0P 1JXVA 1TAUA 5CCLA 4ID5A 1LFPA 3QT8A 4PXDA 3A3PB 1WC0A 3UDVA 3GYNA 2LMIA 3G6VA 1GX6A 2UU9F 1BQNA 4B3OA 3DXSX 1TVRB 4C97A 4BC9A 2A2CA 4RW4B 5D6GA 1HARA 1U1QA 2EFOA 3PVXA 4MYTA 2XMAA 2RQKA 2BACA 4F04B 3CD5A 3C6UA 4LR8A 1JLEB 3EPIA 1CS4A 1N56A 2YKMB 3NS6A 1N54B 4RKUC 2BQ3A 3G82A 4OMFG 3M2VA 3KLGB 4IR9A 1PBAA 2HFOA 3ZXWA 3C15B 1QSSA 2QIFA 1VRTB 3DLGB 2YWHA 1FVQA 1WEYA 4QBUA 3CCRS 2BKOA 1KOHA 5I3QA 1BWEA 4OZ5A 1JLQA 1RTJB 2CQCA 3I4PA 1U4BA 3EM1A 1RT3A 2BM0A 2IYGA 1SC6A 2ZOMA 1Q8BA 1CG2A 2DNOA 1Q0NA 1WC5A 4JI7F 1RXOB 3VAKA 2RRNA 2DHGA 1UJ4A 3MCOA 3IG1A 4NLSA 1J5EJ 2IYIA 2BKNA 2F63A 1P6TA 4NXMJ 2RS8A 5F8GA 4X4PA 2CDRB 1E6VA 1VIOA 2VG5B 4XDCA 2Y0BB 1SJQA 1RB0A 4DCOB 4R8UB 4DDFA 2ZHAA 1H74A 3BSCA 5CYMB 4KBIA 3W5YA 1H73A 3B54A 1ZPVA 2NUUG 3S8SA 4FKYA 4EEYA 3UN5A 3D1OA 4GO7X 2UXCF 2IM0A 5IT9U 3MCNA 4CLKA 1IVZA 4TQSA 5BR8F 1BGXT 4X4OA 2KZMA 1E6YB 3B4MA 3OJUA 2VKZG 3BBFA 4RUBA 4UY85 2LA4A 3HKWA 2BJEA 3TO8A 5B0CA 2IC3A 3DU6A 2H48B 2E7XA 3C6TA 1O8BA 1FHTA 4CLTA 3UDEA 2BMBA 4NI2B 3NLCA 2FHJD 2V9KA 5KFDA 3M8QB 3DRXA 2Z0GA 2LA6A 1YITS 4ZHRA 4EMDA 2OJ3A 1SJ4P 1TKZA 1GEHA 4FZVA 4CLWA 3ISND 4F7VA 4KO0B 3H90A 1OQ6A 5BYQA 3HVTB 4ED0A 1QSYA 3SV3A 4KH0B 3HKZD 1HWUA 1JIHA 1SJ3P 4DWIA 4DPTA 5LMNJ 5KFAA 4U7UD 2E66A 2HGLA 2RJZA 3JQMA 3QIDA 5KFHA 3OR2A 1SKRA 1UPPA 4ILMA 4IR1A 1WTFA 5L8RC 3CCQS 5D4PA 3WIUA 1UEVA 3PR5B 4HDGA 5FJ4A 4YB7A 3JYTB 4FF1A 4CT9A 3QSIA 2DITA 4ZJQA 2P6TA 1RBLA 3IRXB 4A4JA 2HKEA 4OHVA 1Q8IA 4DV6J 3C66A 2V63A 2MKYA 2UUCJ 1VQ6S 2VG6B 2IVYA 2FVCA 2UVRA 2CXEA 1ZM4A 2VPYB 2R42A 5F9NA 2DHHA 4UQGA 3VAIA 1HWLA 3PX4A 4YOEA 3FCHA 3GZ7A 2AX0A 3SCIE 1UFKA 3Q8QB 2J76E 1HW9A 3DDIA 2BJ3A 2VHGA 1R8AA 2OMLA 5KFSA 3P45B 4F3QA 2OHDA 2I6WA 1IN0A 5IV4A 2OIHA 4M5IA 3M8SA 1XMQJ 3LANA 1P1TA 1B70B 3MM8B 3MUVP 2GO8A 2DHXA 3M30A 3ELHA 5ETMA 2R7TA 2CQPA 5LMUJ 1FRJA 3MMBA 3UVJB 1R7IA 1KD1T 1S59A 4ZVSB 3SFGA 3Q89A 3KUGA 3PR4A 1R8BA 3WX8A 4RW7B 4LF9J 1U48A 3CCUS 2H3EB 3JSMB 3CO9A 3W7BA 1HLWA 3QWPA 4OZJA 3RR7A 2WVFA 1S0MA 1F0XA 1KVJA 1RLDA 3DHXA 5F8LA 5J2NA 3M2UA 2A18A 2RMLA 1SC4B 3U1NA 2D3UA 3BYPA 2FJVA 2YWWA 4F2RA 1GMVA 1FI4A 3E01A 5D78A 4ANCA 4HLBA 3GIMA 1EKRA 3D67A 4DV2F 3HFVA 2UUAF 3CIZA 3PJXA 2Q66A 3HPOA 4ZOSA 2VFSA 2MLZA 2AW0A 1EP4A 1ZA2B 5J1NA 4P10A 2J0SD 3DOLA 2R2UA 5DG9A 5L9NA 3K89A 4R5PB 4KQZA 1JJHA 4G3IA 4KSEB 2V34A 4DQPA 4CM2A 5IWAJ 1ZBTA 4NCBA 2G2YA 5KT7A 1MLAA 2XI2A 4Z7YA 2C28A 2XYGB 1ULRA 3GV7B 4WCEQ 2W9BA 4DFJA 1KKHA 4DL5A 4JYAF 2GA7A 1FNOA 3MR6A 2BX6A 2RVJA 1Y7PA 4DR3J 3V81B 2Y0SD 4GKKJ 4YB5A 4N47A 2AKWB 1NSKL 2CJAA 4IDKA 4RUHA 4WFBQ 4ED1A 4RNMA 1EB0A 1U7LA 3OLAA 1HYSA 5CZXA 4WK1A 1RWUA 1S1XB 1ZYQA 2MSTA 1VC6A 3C46A 4KGXB 1LWFA 1HNWF 1S6PB 4ILLA 4YDXA 4WWSA 1RTHB 4E0DA 2WVDA 4CLFA 2HG4A 5DS7A 2H5JB 2DB1A 2ALYB 4RW8A 2D41A 1LK7A 2MKSA 3OTCA 4LIWA 4TKTA 1RTZA 1G1XA 1HR0F 3LAMA 2ASYA 4G1IA 2KT5A 2V2ZA 1A6LA 4LF5F 3HULA 2ZH4A 2CPFA 4KT0C 1XN9A 2HNYA 3CJKB 4KV8A 3PEJA 6FDRA 3PX6A 1S10A 1NK5A 2IJFA 3ZTPA 2RUGA 1Q4RA 2V8DA 1T3NA 3DRSA 2DCUB 2L08A 1U6BA 2OPQA 4PG8A 4DV7F 2B9YA 3M1VA 3AD9C 2P9CA 4A8KA 2XCAA 3PHTA 2B4UA 1V3SA 1LW0A 2CPEA 3VAHA 2HHHF 1XMOF 3FSXA 2BE9B 2ZH9A 4C8YA 5DLGA 7AT1B 2YKNA 3VTIA 3LALA 1KWMA 2UUTA 4RO0A 1A9NB 2DY1A 2IAJB 1SL1A 2ZD1A 5K8MA 2NZ4A 4Y2KA 1FO1A 1PGZA 4QWAA 3KLEA 2E5IA 4C8MA 3J7Z5 2HBYB 4IG0B 3K7RA 4O0IA 2WVBA 1JJ2R 3NGKA 3CCZA 4DUYF 3KHGA 2BXJA 4CH7A 3GFXA 2XGQA 1IR2A 3EMTA 3S01A 2CPJA 3NXZA 1WG5A 1N5VA 1FX4A 1NAQA 3HHLB 4QZVB 1RAHB 4NLUA 2CYYA 4U9RA 4S0MA 4PEOA 2NREA 1FJEB 4QPTA 1F3VA 3DOMA 3LP2A 5F8HA 1WC1A 4PQUB 2UUBJ 2DD8S 1OWXA 3EVWA 4OYOA 4I2QB 5D0HA 4HDHA 4EYHB 3UDLA 1N34J 2JH3A 1U02A 4J37A 3US5A 2KRBA 4NA3A 4NPOA 2NS1B 2M5YA 1SL0A 3PYFA 2L9NA 5ETRA 1WG1A 3K5MA 5C25A 1IKYA 2EWHA 2BV3A 5DDOC 4DL6A 2JEJA 4MFBB 3EDQB 5AXKA 2LXIA 2C3YA 1QAIA 1XBWA 1CEZA 4TLQA 3AB2B 2YX1A 3GILA 4FXDA 3HP6A 4OLOA 3R7BB 3W2VB 3OLBA 2IM1A 1HIYA 3RB3A 4CLUA 3QT7A 2J0QD 3A3NB 4ERDA 2M88A 4A46A 2UXDJ 1H72C 5ADZA 4AL6A 1XNRF 4PUOB 1BWVA 5IFMA 4USJC 3M6XA 2I1RA 4IFYA 4W98A 2V5HG 1TUVA 4GVLA 2XMWA 4Q0BA 2NSCA 4NLVA 1RWPB 4Y65A 5KFQA 2CADA 3EYZA 1NHKL 4JI0F 2HSEB 2N82B 3BV8A 4ECSA 1VJWA 2ZC3A 3QLHA 1YRUA 1H98A 1S1VA 2DNHA 2N3OA 2K1RA 1UFWA 4KPYA 5F0WA 6AT1B 4K7QA 5BYSA 2MPUA 4IYQA 3J81j 3QJPA 4ETZA 1KONA 1NJYA 4KJIA 1UA1A 4X4QA 2DGQA 5HJXA 1WHWA 1YJRA 2QZ8A 3PNIA 3M32B 4JI5F 2I8EA 4HHJA 4NE9C 4HT5A 1IQZA 3DRYA 1NJXA 3M4XA 4ZKAA 3OL6A 1LXJA 3EICA 1JLCB 1R8CA 3TW0A 2GZOA 2YXLA 2AMCB 1J5OB 4OYZA 1DRZA 4RPFA 1SKUB 4DFKA 2FTRA 2QG9B 2FLPA 5DZ7A 5A8RB 2Z2ZA 4ECVA 3PACA 5J2QA 4F0HA 2E9TA 1SUQA 4ALZA 2YQ1A 3JSBA 2W9CB 2H4WB 1G6BA 1TK8A 4XTTA 1X4EA 3MTJA 1RWWB 2KFYA 1TKTA 3HT3A 1XNQJ 4JV1A 5DQHA 2GVDB 2WRMA 2F1FA 4DV1F 3THPA 1YJTA 2BRKA 4NLPA 5D0GA 4QIEA 2W7OA 4WFYA 4G6VB 1NPPA 2BBEA 4P71A 2YNHA 4IG3A 4DCPB 2G0CA 4X62F 1KR4A 4ECRA 1OPIA 5EGYA 3TQ1A 2HLUA 1PYSB 1RT4A 1TUWA 5K14B 1S0VA 3NL0A 3W66A 4K50A 3KG0A 1W2BR 3IFEA 3D68A 5GVQA 1KS2A 3NCQA 4HYKA 4U7CA 4X65J 1TV6A 2QSWA 1RCOB 4F4WA 2EG1A 3HHEA 2OEMA 4L3NA 3PW4A 1UP1A 2OH2A 1SQFA 2B8QA 4P75A 5J2MB 1LWEB 3GSDA 3UD3P 1PYTA 4HHHA 4DOZA 1VMBA 4J9LA 4Q45A 3EZ5A 4DZ6A 1VBXA 1VK3A 1RWKB 1U1MA 1U2RA 5KG6A 1HBNB 3TAMA 3CTRA 3Q83A 1I94F 1LNQA 1SV5B 3DNCA 2OKQA 5I3UA 2DXEA 4FF2A 1TL1B 1N33J 1SC3B 3BPSP 2DNQA 4URGA 5GAEU 4OHXA 4WF9Q 2Z8QA 4OYXA 3ENWA 4Q8EA 1FFWB 1WEXA 2D9PA 3TI0A 3R5GA 4LVOP 2B7CB 1ROFA 2DCLA 1Y4ZB 5H9FJ 4F50A 4NCAA 1K8AT 3W3SA 4P2MA 1RYRA 1NDKA 1F5BA 1QDUB 3SSRA 5ITHA 3IWLA 3C14A 4Y2CA 1SH0A 3SSQA 2PFDA 3FKBA 3FEXB 5DM6Q 1U0HB 3H8YA 2M2BA 1HMVA 4YS2A 1VQOS 2Y8YA 2LQ9A 2QYCA 1C1BB 2IA0A 1PIEA 3W9HA 2MZTA 2DKOB 4OLPA 4USMA 4CYUA 3ENQA 4G1PA 2GV1A 1OMSA 3MPDA 1L3TA 2QMXA 4GVBA 1AYEA 3A13A 5KFXA 1UAWA 2HHWA 2AYEA 3SXLA 3BZQA 1HBUA 3N79A 3CC2S 4KH1B 1YJVA 4K59A 1HPZB 2VOPA 1V6HA 3OSPA 1ZAVA 1HHSA 2R2RA 1YZ7A 2CPIA 4OYMA 4LF1A 1I6JA 4ECUA 3FC9A 2D69A 2XGPA 8RUCA 3TUPA 4DG1A 5B7WA 3KDNA 3HHNB 2VJUA 3RU0A 2GMJA 4UOHA 1FJGF 5KAKA 3BJYA 1L3UA 3QAEA 2IY5B 5M2PA 1Q7YT 1AUDA 3D9BA 4DR7J 1KLMB 3TUJC 2JEGA 1JJ4A 1J2VA 4OZ0A 4Y34A 5B0GA 4ZVFA 2R8GA 1RKIA 2HHTA 4DCJB 2HQFA 1WSRA 4RWWA 2HNDA 3HK2A 4WU3A 2NR0A 5FLXY 3B8HA 5JVHQ 1UJ5A 3CCTA 3VVTA 1OS5A 2BJ7A 1RAOA 1YI2S 1YBTA 2AGPA 1S12A 5KG4A 4EK2A 1ZPWX 3OVBA 3JQKA 3GYXB 1ZZFA 1YHQS 3MEEA 1O5JA 3PCOB 1TZ0A 2XZWA 2MKJA 3CJSA 5DGAA 2V94A 1FK9B 2VKRA 2R7WA 4P7VA 3ZTOA 3VF0B 1TUGB 2AP6A 1J5EF 4UOFA 3BDEA 1CJUB 3I9ZA 1XK8A 3ONQA 2DGXA 1TMJA 2HQIA 4NXMF 2BM1A 2HVDA 5KFJA 3D6FB 3NKYA 1JMTA 3DDKA 1N5YA 3N28A 2DH8A 2EVZA 1W26A 2F8EX 3W61A 1NH8A 2VBYA 6FD1A 1RT5A 3QIPA 2GQQA 4IUFA 5HP1B 2DGOA 2DNMA 2AYBA 2B8PA 4CIOA 2A0FB 3SCLE 3ZZRA 3PW7A 3EX7B 3DOKB 1EJ7L 3GONA 3MM5B 1MROB 1M5SA 3UD5A 4UZBA 4I7FA 4A8QA 2YNGA 4ECZA 1ZZNA 1RT6A 1X8DA 1L3SA 4K4YA 4ECYA 2YKOA 1YJ9S 1U45A 4DV3F 2DNKA 3KHLA 1FKOA 2Z56B 4IG3B 1RTIB 4LIRA 5C42A 2B9EA 2HGMA 4DN9A 2YNIB 3BO3A 2JOQA 2OTLS 1JLAA 5EX0A 2V8HA 4FNIA 3UR0A 4B02A 3CW2C 9ATCB 4QWEA 2C2OB 1IKWA 4K5SA 4L75A 2X3DA 1DY3A 5KFVA 3UD4P 3QO9A 3R5JB 1OY9A 3CCJS 4GC6A 2CVIA 4KFBB 2JZ5A 3BF4A 3RBEA 3HSGA 4ES3A 1RZMA 5KFLA 3PW0A 5A0YB 1KTVA 3M8ZA 2QLWA 3MAQA 3C2PA 2ZNYA 5E41A 1IKXA 5LMNF 4I56A 2KXNB 2BA9A 1TKXA 2AYMA 2MXYA 2YX4A 3O44A 5E3CA 1U1NA 3HT0A 3FVYA 1WJ9A 1BQXA 5KOXA 2M70A 2HZCA 3MMCA 5HQ8A 4RJVA 1C0UA 3ZZZA 3W1YC 4JI8J 2C3UA 2LVWA 2E9ZA 5EHHA 4C0BA 1GMWD 1FXLA 2FZGB 2E5LJ 5L1JA 2EFVA 2UUCF 1GTHA 2IVMA 4L73A 1WD6A 4C11A 3OD2A 2MGZB 5JJBA 2FPHX 2ZBCA 3RBZA 3MURP 5D15A 4Y2AA 3RGIA 4CP5A 1GT8A 3QPIA 1WDTA 3NS5A 2MKHA 2AJQA 4JUZA 3LP0B 1H2UX 2LKZA 2V8GA 2J6UA 1X0FA 4U96A 2KJVA 2ZBPA 1XMQF 4LF7J 4B3SJ 1VC5A 2HEKA 4UUXA 1UEUA 2RD5C 5DQIA 2OELA 1HBUB 3IWXA 3UE2A 1ZOTA 2V6AA 2F9DA 3DLKA 3JSYA 5LMUF 3BH7B 3OV7A 2W9AA 2L41A 2B4OA 2EFNA 2IJRA 3PX0A 4LF9F 1XMBA 5HLFB 5L38A 3BSAA 5F41A 3X1LB 3EGZA 4TU7A 5B08A 2YWEA 4KHPJ 1REVA 3UN2A 1UL3A 4MK9A 2ZZTA 4C8KA 1B0PA 2CJXB 4QIVA 3D6HB 3OR1B 1HQUB 3RYLA 3UWTA 2G1HA 2NSBA 3J7A1 2AZ1A 2DEIA 5CAAA 1YRXA 3UCZP 4NXNF 3MPYA 3I0RB 1VBZA 4C9DA 3HHLC 2MQPA 3CCSS 5F8IA 1Q1KA 4LF4J 2E5JA 4KIAA 3L7OA 2DHSA 1QD1A 2DIVA 1C0TA 5D4NA 3MF5A 4CM0A 2UXBJ 2XZTB 1FRIA 1BQMA 1JXEA 5LT5A 4IRCA 3VAMA 2QJ3A 4DR6J 3N5FA 3Q2SC 3CDBA 3HSZA 3M6VA 4PXBA 2ZBQA 2KG1A 2VC1A 5IWAF 1HNZF 1Y10A 2W8KA 3HM9A 3M6UA 4ZCKA 3RUBL 3NEKA 1JLFB 2DNYA 1NKCA 4IO1A 4FYDA 3WC0A 4UZCA 2VFUA 2KXHA 2CQ4A 1PJ7A 3T6JA 4LFAJ 3J7YU 2HHPA 2V8PA 3GP9A 2JLGA 5I42A 1KEKA 2WOMB 2D9OA 5F9LA 4DR3F 1CC7A 2AEJA 2IDEA 3PO5A 4GKKF 5D3GB 1V5IB 3MWBA 1JLGB 2YNFB 1LWCA 3W9IA 3KLHB 2EPIA 3PHEA 1KC8T 3TA0A 1JQGA 4C0OC 1D9FA 4F36A 1RTDA 1VLOA 3R27A 2CPHA 2ZITA 2JVOA 3SCKE 1AFJA 2KXFA 1N48A 2XSJB 5HROA 3G9CA 4ES1A 1NSQA 2MYFA 1C1CA 5B0BA 1X5OA 3KDOA 3S7RA 1RT6B 5C2CA 3MEGA 4K5RA 2DH7A 3W2WB 3SDEA 2M0GB 4LRBA 2XBPA 4RR5A 2ZJPQ 4AQYJ 2WK4A 4UTGA 2OAUA 1U8WA 1D0EA 2GGPB 1RHMB 4J9UE 2JEIA 5DJBA 4WFNQ 1FJCA 4O44A 5HBMA 3IXQA 1Q82T 4NX9A 4K4UA 2QSFA 1UVMA 3DKDA 3DLJA 3FBCA 3MD1A 1RQ0A 5F8MA 1JKHA 4UY8T 3DRRB 4CI0B 5LL6d 2EKYA 4IFVA 4H54A 4ED5A 4QR1A 3OTDA 2QE5A 2CZVC 2W2OP 1VHFA 4DJBA 3CCVS 2GIFA 4PWDB 3LH2S 5KG1A 3FEYB 1IM6A 3LQVA 3WBZA 1CJKA 2B6AB 4JBCA 2CNKB 4LQ3A 4MIBA 1QJHA 2J7WA 2DXDA 3MR7A 2QLBB 1EETA 2L9WA 4QW8A 2BJDA 1RGVA 1OSCA 7FDRA 3M8PA 4UW2A 5KG3A 5T7LB 4DUTA 2D1CA 2A6OA 3O1LA 4CWBA 3V6HA 1RT2A 3C19A 2G0JA 1FRKA 2IHR1 1URRA 4RLEA 4C3MA 2R7RA 2OO4A 2HW3A 1WHYA 4B9LA 5AT1B 2DBBA 3DYAB 1ZTWA 2JSXA 2DHAA 2FLNA 1T02A 2APOA 1NK9A 1S1TA 3VGSA 3OSNA 1CJVB 3DMJB 3IR5B 3MEDB 2JNJA 2DR7A 1KTQA 4B9UA 1P1LA 4C3KA 4Q2LA 2BJ9A 3RW7A 4LRDA 2UUBF 1D9DA 1X5SA 3IC1A 4M8LA 2OPSA 2EW9A 1NDPA 2QL5B 1RACB 2LDIA 2XS5A 5EWGA 1SVDA 1OQ3A 2LDYA 3I55S 4WZMA 2B9WA 3VZIA 1FFSB 1JLBA 3T41A 3H5YA 2OEKA 5RUBA 2BOAA 3ETMA 4H4MB 1U47A 2KZZA 2BANA 7FD1A 2ZFHA 2GJ2A 2XHCA 4D3GA 1VGYA 1SJ1A 4RW9A 4TY8B 5G0RB 2IRXA 4H4OB 1KBRA 2F3JA 4DR1J 3NBPB 1J27A 1H7WA 1MMDA 2UXDF 2AEFA 2ZH6A 1RADB 1C4CA 4LF2A 3TAPA 3RAXA 4PABA 3MM9B 1FWKA 1WWHA 1VRUA 1HNIA 1FDAA 3JQJA 2E5GA 4TYBA 1M5KC 3HJVA 4YP3A 3KJVB 4HTJA 2ERRA 2EFGA 1T9YA 1UWAA 2RQCA 1XERA 1XR5A 4Q5VA 4QR2A 3DU5A 2FDNA 2AZ3A 3OPKA 4DV5J 4FVCA 2V4JA 2C3OA 1DTQB 1SCJB 3JSRA 2E7VA 5KG5A 2GIQA 1FEHA 4ZVQB 5IT0A 1DQ9A 4LREA 4OFZA 4OJ1A 2QA2A 4GKJJ 3WDOA 3NAIA 3H2UB 4OZ3A 3KLFB 1M90T 3HZEA 3KK2A 3V2UC 4JI1J 3RAQA 4XO0A 2QTWA 4DV7J 5L1LA 1RT1A 5HATA 3D66A 1I5OB 3ITHA 3VQTA 3R3TA 5GAEI 2E1MC 3WX4A 2PA3A 3D2WA 4ZVUB 1U6ZA 4OI6A 4B17A 1WKJA 2BE7D 3KMSA 1MMNA 2J0WA 4TLRA 1DTTA 4EU0A 4RU9A 1FA0A 5F3ZA 3VHQA 1RISA 2ZWPA 2NPFA 1BXNA 1S4FA 4OHWA 3PXGa 3WHIA 2PDAA 4AXJA 3KMQA 3SI8A 4CCHA 2LECA 3BPDA 4ICLB 4WZQA 4CRJA 4C98A 3T1HJ 2Y1JA 1N8RT 3BBBA 3MOJB 2DO4A 5LSLA 3U1MA 4LF8J 1QE1A 3CJQA 4NLWA 1LW2A 4J9PA 5E3AA 8AT1B 3JAMY 3TAQA 3BKFA 1KQKA 3M7VA 2VDHA 4W92B 1BUXA 5HO4A 3CCMS 4OHYA 4CNYA 2B5JA 4LBPA 1U26A 1N6QA 1N5QA 1XR6A 2KI2A 3UQSA 5A2QU 1HW8A 1Q8KA 2MEWA 3TZXA 2AIRB 5K9FA 1FFGB 2JWNA 2BE2A 1UMJA 4X65F 5HMWA 3D7SB 2CQGA 3W5XA 4J9MA 4MIAA 3OXLA 3GFZA 1U0SA 1FX2A 2PT0A 1FDNA 1T9VA 1LKZA 2KM8C 1JNRB 2M7SA 2DK2A 1G3OA 2R8IA 4ZLNA 2HK2A 2ASJA 1U1KA 4RW6B 4DL3A 2FLOA 3POTB 2C3PA 3ADAC 2XMMA 3DRPB 1FKPB 4USTA 1TVRA 2GHWA 4F67A 1N33F 4RW4A 1PJ6A 5HQLA 5A8WB 2WW8A 5SUHA 4DXLA 1CQMA 3U02A 2GHVC 3JTNA 1JLEA 3H7HB 3EPGA 4LFCJ 1X4AA 2YKMA 3LGHA 1S6QB 1DFDA 1B99A 4J9QA 2XWXA 3PJWA 2G2OA 4ZP8A 3RBXA 3KLGA 3N9UC 2BEFA 3OT9A 1RSCA 1T9WA 4JI0J 2XULA 2K2PA 3ZFVA 3C15A 4U7UK 1VRTA 3DLGA 2DXFA 3LO3A 3OL9A 2LP4A 5HSPA 4QWBA 2CJYB 1Q78A 3GE9A 2O66A 1ZH5A 1RTJA 1S0NA 5DDPC 2ZC4A 4ETXA 2AWZA 3OW2R 2MZ1A 1HFEL 4WKRA 3L4BC 3ET6B 3HXMA 2NPIA 4ZMMA 2VQEJ 2BW7A 5HQMA 4CLLA 1XJWB 4K4ZA 4JI5J 3FMWA 3T5KA 4NLYA 3KYLA 3H5UA 4QOTA 3FFIB 4Y3CA 1EHWA 1R0AB 2E9RX 3P8BB 3BEGB 1G7CB 4K4XA 5DETA 3BKTA 4KE5A 1SIWB 2VBWA 1B0TA 2VG5A 1VS3A 3NGUA 2RDJA 2E1CA 5IQ6A 1RDRA 3RBDA 1RE1B 1U09A 2W2PP 1SQEA 2WTFA 3EE3A 3KK3B 4R8UA 4QWDA 2DR8A 3OTEA 5CYMA 2GVZB 1ACMB 3NG8A 2XNRA 2RNEA 4UOCA 1ELOA 2I5JB 3K2YA 1WI8A 3J80Y 5KFWA 2LLZA 2HLTA 2VONA 3KUHA 4LRAA 2R8HA 1E6YA 5U47A 1X9WA 3PRDA 1LXNA 3IS9B 2GC8A 3W62A 1M1HA 1B3TA 1X4GA 4YUDA 1Y11A 2B56A 4DR2J 4QR0A 2Z57B 3LP1B 5M2RA 5ETPA 3TANA 4NI2A 1VI7A 4B3TJ 3M8QA 4X4UA 4YMEA 4O3NA 5CYJA 2J9DA 2XTJP 1G4CA 2E1RA 5KFFA 4UF4A 1KOOA 3QGHA 4KO0A 2MY8A 3PJ9A 1MU2B 3HVTA 3AHPA 1KFDA 4XK8C 3RRKA 4HH0A 3NWGA 3S1TA 1T9TA 3V6DB 5HVFA 1FKAF 3CUNA 4FBUA 1YZ6A 4KPCA 4AUKA 4KGKA 2F5GA 3TZYA 4Q43A 4PCQA 3ZZTA 2FJEB 4K8RA 1VQKS 3QQCD 1TL7B 3OJSA 2FJWA 4F4XA 3J81U 2BW2A 1NPKA 2HVEA 5D0RA 4V19X 4QIWD 3JYTA 1TL3B 4NYZA 3T3FA 4Q44A 3IRXA 2BUNA 1KVIA 3TRGA 3UCUP 1QE1B 1KDNA 2VL1A 1LOUA 4RX6A 3KLVA 3R7NB 9RUBA 3ZZPA 4Y2IA 2VG6A 3QNWB 1VQMS 3PEHA 1R0CB 5GAGI 4AD6A 5K8NA 2RB7A 1ZAXA 1B4SA 4C0HA 3GFYA 2RKIB 2VDIA 3IGVA 1O51A 4B3RJ 3QYYA 3CJ4A 1F2GA 2ROPA 2MLYA 3DDNA 2OD4A 4DS4A 1TMMA 2LQJA 5CQGA 3RW6A 5KT3A 3D0IE 4NASA 1RYSA 2FD2A 2XO6A 5KT4A 3THVA 3D6MB 4HVZA 3MM8A 2F65A 1WSVA 2XHWA 3M8RA 1OY8A 3OXGA 4CNZA 2GHPA 2FYXA 4QQBA 3UVJA 4DI6A 3I31A 4RW7A 1UFLA 3JSMA 2QV6A 2XY7A 4ANDA 3CMAS 3UNYA 2ZZMA 4DSFA 1VQYA 2ZE2B 3OQ2A 2HAIA 1BE4A 3FSYA 4JV0A 2R9LA 4WKYA 2FGCA 4RL1A 4HR2A 1FJGJ 2E44A 4I69A 1HHTP 2J0XA 4JI8F 3TX0A 4NLXA 2F9JA 3NOCA 2RF2B 1SJRA 1QUPA 2H5IB 2MZQA 2E5LF 2NUHA 3M8WA 1MN7A 4F2SA 1KQFB 2DGWA 2J6TA 1GXTA 1TR0A 4ZCLA 1AB8A 2ZOGA 4A8YA 4ELVA 4CO1A 3J7YI 5A76A 2VODA 3OFHA 1NKBA 3BM7A 4R5PA 3MEKA 2MZSA 3QAUA 3K57A 1MWYA 3GSIA 3CC4S 3MPUB 2KO1A 4XAKA 3AJDA 4ZPDA 5H9EK 1SQGA 5IS2A 4HKQA 4LSNB 2VBZA 4OQJA 2C1EB 4ECXA 1V3RA 4LF7F 4ZVRB 4B3SF 2A3JA 3AAWB 2UV8G 2FHOB 2B3TB 1OO0B 2GAHC 3TP2A 1U8SA 3OTBA 2PN6A 3BSOA 1NJIT 2A6MA 2O3DA 2ZUGA 3CJRA 2ADCA 2M9KA 1Q5YA 2PI5A 2H65B 4I68A 1KFSA 4G1QB 3V81A 3CIMA 3ZZOA 3FCWA 1B7YB 2U2FA 2WONB 4KHPF 2HIQA 3MM7B 1S1XA 3GFHA 4QU7A 3CF5Q 3FZ2A 3H2LA 5KFTA 3OFFA 2BKPA 1S6PA 4AXIA 1DURA 5J1EB 1RTHA 2DNZA 3OXFA 2GS8A 2O01C 3VWSA 1R6VA 3OFEA 4LF4F 4CO3A 2FJBB 4I4BA 4UOGA 4OJ3A 4ITSA 4LF6F 5LXYA 4DV3J 1VQ5S 1D1UA 4BCAA 4WJBA 1SB6A 2QGFB 2UXBF 2F8MA 1HWIA 4ZCIA 1EZZB 1HQEA 1S9FA 3DLEB 2ATCB 3NCPA 4DR6F 5JVGQ 3CC7S 2YBVA 3CJKA 3C16B 4FPRA 3CGIA 3MMAB 2E7WA 2XZDB 1ZA1B 1NO8A 4YHHJ 4LFBJ 3RB4A 3TARA 1A0OB 1NDLA 3LA0A 1IBLJ 4LBIA 3ILOA 1KRPA 3G86A 4LFAF 5KFGA 5CA5A 4WFAQ 3ZTSA 1BY9A 2HHXA 5IM0B 5A6WA 1S9GB 4NLOA 3FCVA 1UKUA 3CSKA 1F6TA 2IAJA 2PA8D 4ZITA 4YR0A 4NZ6A 1T11A 4O3PA 1TL5A 4BWMA 3PRVA 1M0SA 2B51A 1NU4A 3IGNA 2NXNA 2CQBA 2CUYA 3DLBA 3VVUA 4F8RA 4IG0A 2PD1A 1R8PA 1K44A 4OV6A 5GAHU 2JX2A 4PAAA 3VZHA 2SXLA 2X1GA 1AZSB 4B08A 3PYDA 2AX1A 3B82A 2E1AA 2QMWA 2AU0A 3KK1B 3RG6A 3F56A 3EVOA 3FNNA 5IT9Y 4FF4A 2CQ1A 1LEOA 2OPRB 4JV2A 1TFYA 4DSLA 3HHLA 4JV5J 5KFCA 3VV2B 4AQYF 2CQHA 1H0HB 3BO4A 4R0EA 3FGVA 5C24B 1WNEA 4PQUA 1RAEB 3HI9A 5LJ5Y 2RAQA 4I2QA 3MGJA 2J7KA 3B78A 2AHOB 4ZP7A 2YTCA 1X5TA 5D77A 5K20B 2JC0A 1KNZA 1S97A 2QYGA 3T9ZA 4IOAQ 3D1QA 2HS3A 4K2JA 4X4TA 2JVRA 3ISZA 2EFQA 4MFBA 1Y5IB 4RUCA 1RAJA 5CH7B 3CJ5A 1IWGA 4M5NA 3NOGA 3QRPA 3W2VA 4DL0C 4CH0S 3BGUA 4F4KA 2Z2LA 3HD1A 1W7WA 3NGDA 4O3SA 1YJNS 2MJNA 2VG7B 3HHKA 2HQDA 3JAMU 2Q3PA 1IR0A 1K73T 4NXNJ 2D3O1 1WOPA 2LU2A 1PC4A 3R9LA 4PUOA 3PY8A 2KKHA 1VQ9S 4OL8A 3MTKA 1EAYC 1WHVA 1VOMA 4MK7A 3TWZA 4OX8A 3QFHA 2RRBA 3CDAA 2E1PA 1T9XA 4CLZA 3CDWA 2AF6A 4DV4J 1FVSA 4C2MA 3PM9A 1NKEA 2MLXA 2PMZD 4ZVTB 2IA6A 3CCWA 4IH6A 2W8LA 3TJ9A 3HLUA 3SSSA 2OMOA 4OYAA 2OI2A 1S1WB 4IKAA 2HMIB 1BC6A 4DUZJ 3MCMA 5F0UA 1HNZJ 2A10A 5E3RA 1RT7B 2AGQA 1H7XA 1Q81T 4I64A 3M32A 5CD4A 3DM2B 3MAAA 3CE8A 4FPIA 1X9SA 4FS1A 3ZTQA 4ZPCA 5IQQA 2VQFF 1HBMB 2V69A 1JLCA 2JC1A 3GR0A 3THTA 1U25A 2FHKA 1J5OA 2WBRA 1V3ZA 1S1UB 4YR3A 2CG8A 5A8RA 1FCAA 2VB6A 4IRDA 2GX8A 4DR1F 2Y8WA 2W9CA 2BDPA 1LFWA 5B0FA 2AQ4A 3D0GE 1SPBP 3H42A 3BR8A 3BGRB 1PSDA 2GVDA 1YKWA 2QO3A 4DQRA 4IOCQ 2HNZB 3ETOA 3H20A 3W8GA 2C2DA 2H51B 2IRYA 4TN2A 2C2KB 1JB0C 3SQGB 3TA1A 3R6GB 1U2FA 4ZVPB 4F25A 1HQEB 2DGTA 2GNKA 3HF5A 3QFWA 1S76D 4DV5F 5MAOA 5K14A 1YBUA 1T05B 4F0MA 1RKJA 5HN0A 2FZCB 2HHSA 2VF3A 3ENVA 4GKJF 3GJSB 1L5UA 3I87A 1VR6A 1R6YA 3R97A 4JI6J 4JI1F 1CVJA 2K06A 5J2PB 2FVPA 1Y3KA 5B09A 3ILJA 3LGMA 3BGOP 1JK9B 1FD8A 3OUYA 4KHRA 3DC2A 3I6PA 2DEJA 5FDLA 5J2MA 1LWEA 5JMNA 5C2GA 1D8ZA 3KTQA 4KHMA 4O4GB 3ENAA 3MCSA 4M5LA 3F73A 2YKQA 1QAXA 1PAEX 2KTQA 2OSRA 4LQ9A 1B0VA 3BS9A 1HBNA 2AJ2A 1SV5A 3EVMA 4DL2A 4YFUA 1UCNA 1S4EA 2ZBRA 1TL1A 1GX5A 4Q2MA 4X4VA 3T1HF 3MFHA 5LXRA 4HL9A 2VC0A 5LJ3Y 4LF8F 2IBOA 2J8SA 4F3MA 1IBKJ 2HFSA 1LQ9A 2J9DE 3KUEA 3GQCA 3Q8PB 5GMKa 1IUJA 4WFXA 2ZNZA 3NY0A 2PMHA 1FT8A 4DX5A 1NRKA 4DBQA 2DPIA 4ZP9A 3OVSA 2MDAA 3CT9A 5ETOA 1U0HA 3H98A 5HL7Q 4LMZA 1YJWS 1C1BA 2AV5A 3K8VA 2W24A 1S99A 4U6PA 3AQPA 2C2MB 4CTAB 4WTOB 5DG8A 1KSPA 4C4WA 4EBCA 3V5RA 3TQEA 1L3VA 4C8ZA 4N77A 2Z2YB 2GQCA 2CPDA 2VASA 4ZVEA 4WTYA 2YH1A 4O4RA 3PO4A 2XMJA 4XDDA 1UA0A 1HPZA 2AGOA 1CQNA 3KG4A 3JB9k 4MYUA 2W4CA 5KG2A 4LSZB 1Y5NB 2H54B 2VICA 3KLIB 1N32J 4EFAC 1K1SA 4USHA 4C3LA 3HSJA 3HDSA 4N7TA 3MM6B 3D1HA 2MQOA 4N41A 4WE1B 3QGPA 3WZ0A 4B9SA 3E3XA 3D5MA 3NRBA 5KFPA 1DLOB 3D54A 3G71S 2MQNA 2XS7A 5BXIA 4DS5A 5F8JA 1S9EB 2C3MA 1KVKA 3M2RB 4PZVA 1N88A 2H1YA 4IO9Q 4DQQA 1KLMA 2LQ5A 1CJTB 4TU8A 2JHEA 3BB5A 5ETLA 5D4OA 2JLEA 3BSNA 4LFCF 1OPZA 5I3PA 5HMXA 5EDWA 2XWYA 2GIRA 1Q5VA 1F9FA 4B9NA 4CO5A 1D09B 4DX7A 3R5CA 4C7QA 2KVIA 2LYVA 3UN3A 3P49B 5DGBA 3ULHA 4ZIWA 2PMWA 2W01A 3J7AN 2VPZB 2X7IA 1YK9A 4FDFA 1VQLS 2XLIA 3ZNUA 2G0IA 2QL7B 4OJHA 2ZWOA 2DGVA 1OIAA 3LUYA 2VQEF 2ATLA 1FK9A 1AXQA 5KFOA 1KHWA 3UNGC 3RB0A 1KQSR 2OEJA 2ZH2A 4LBHA 5L46A 3FZBA 3MAAB 4I6YA 3R5AA 1CJUA 4J9RA 4BDPA 1VQPS 1FWPA 4ZVOB 1Q8LA 4NRTA 4LR7A 1T03B 4PPZA 4P2SA 5HAOA 4OYWA 2P2CB 4KRWA 1Y0HA 4G65A 5HP1A 4LVNP 5KFRA 4A8MP 2YQ3A 2KHCA 3QJLA 3DGVA 4NYPA 3V4IB 1NNDA 1HNVB 3DOKA 3BQ1A 1IBCB 1NSPA 2GMHA 3MM5A 2ZEJA 2HVHA 1MROA 3KOAA 2K3IA 2DO0A 4RBUA 4XPCA 3G6XA 2FB0A 3UR3C 3BGLA 1DARA 2MB0B 4YR2A 1HBOB 2XLKA 3MMJA 1U1RA 3DI6B 3N4WA 2RT3A 2OPPB 4NLGA 1RTIA 2HRYA 4DR2F 1RHRB 2QA1A 3MECB 2NYIA 3K17A 2YNIA 1EX8A 4YY3J 2DISA 1Y5LB 3R1LA 4ECTA 2POKA 4B3TF 1U1PA 2QL9B 3U27A 3BR9A 1UTAA 1YBAA 2L9DA 2EFPA 4I6AA 3LWLA 4KFBA 2CNLB 3OUYB 5T14A 1Q79A 2EG2A 1FRXA 2BJ1A 5A0YA 1F5AA 5FDLB 2D3OR 1NH7A 4DPXA 2J8AA 3AD8C 1RHQB 2Q6BA 2DNNA 3G2XA 1D8YA 3AOCA 1NB7A 2KVQE 4EYIB 1FF2A 5IC6B 2XQCA 4NZ7A 2HBZB 1VBKA 4USKA 3PYGA 1X31C 2BQRA 4QIGA 1VYAA 1DHMA 3G8QA 2JLFA 3OHBA 3MDFA 1DZ5A 2Z30B 3A8EA 1UWBB 2AJ1A 3CJ0A 4NEZA 2H4YB 3QZ7A 4J91A 1R0BG 3HX9A 3C3LA 3GTYX 2MGZA 1T95A 4ID8A 2DRAA 2HZAA 3TYTA 3I0SB 2HFNA 4B3RF 4IH5A 1F9EB 3TZWA 3OVAA 1FXDA 4NCGB 4AYBD 3Q22A 3UW1A 3VALA 5CCMA 4CQ1A 1UW4A 2ZDOA 4RNOA 1F2HA 1GH8A 3LP0A 4URSA 4ZPAA 4I0WA 1UZHA 4M1KA 4O0NA 2DYAA 1FE0A 2K7KA 1IM4A 5KG7A 2W1BA 3DGPB 4B9MA 3AJ2A 3EGWB 1N0VC 3NNAA 3OFGA 4YB1P 1IBMJ 3O8WA 4I2PB 3DXBA 4DLEA 5HLFA 1OYDA 4DU8A 4JB8B 2LXUA 3I96A 5KT6A 2P5VA 2N4DA 3CPWR 3IBWA 4EUVA 3QGIA 4WIQA 2HRUA 1IKVB 4K4SA 1FNMA 2HHUA 4HT7A 3D3BJ 1S72S 2F8HA 5LSRA 3OR1A 5MLCV 1HQUA 3FEZA 4EZ6A 4O3RA 2OD6A 4FN5A 4X66J 1YRTA 3I0RA 2P8IA 3A8KA 4RNHA 4ANEA 4DZDA 2WSFC 3TEHB 2X1FA 2XI3A 2O5DA 5CD4H 3CEDA 4P74A 2HRTA 4NZ0A 3RJMB 1PBUA 4DSIA 1WC4A 4N5SA 1SH3A 4QWCA 1V5VA 4U67Q 2LEPA 1WEZA 4KKOB 2NYHA 2VH7A 1LV5A 2CJQA 5A8KB 3G4SS 2ZHOA 4XPEA 2HIYA 4NRUA 4OI2A 3GIRA 5KFBA 2ABYA 1JLFA 2G9OA 4HACB 1VCTA 1JJCB 4EO6A 4U8YA 4PYAA 1FNXH 4F02A 2R7UA 1Z4UA 2LEBA 2W2NP 2Y1LB 4M5KA 5GAHI 3FUYA 2WOMA 2QLFB 3T1YJ 4USWA 3HZGA 5ETNA 5D3GA 5CYQB 1AT1B 1JLGA 2YNFA 4DPWA 3MR3A 3QSYB 4M5DB 3KLHA 3KNGA 3HMJG 3GJTB 4MIWA 3LWMA 3HSDA 1GXLA 4CO4A 1RAGB 2K3KA 2F4FA 3UO0A 3DLLQ 1M1GA 2NXCA 1MWZA 1G2EA 1YX2A 3EDRB 2XSJA 5JXSA 2ZJRQ 3D0HE 4ES2A 2XO7A 3GR1A 2FVRA 2YY3A 3SBMA 3GG1A 4A48A 2ZH3A 1VQSA 4OYIA 3QT5A 4BLGA 2RSQA 3W2WA 5IXUA 4AT1B 3L7UA 2MTLA 2QX0A 1NPRA 4CO0A 2KFNA 3TZZA 3T1AA 1VQ4S 3SV4A 1KN6A 1CC8A 2LU1A 1H2VZ 4M63A 2GGPA 3ICLA 2ROEA 4WIIA 3ZC4A 4KGZB 3ILIA 1JNZB 2M4MA 3BYRA 1OJ4A 3HVAA 4NLQA 1Q86T 2IMWP 3WQPA 4I1TA 4TYAA 1NMEB 3GCWP 4LSLB 4AL7A 4YHHF 4LFBF 1IBLF 1RAFB 3GV5B 1YJ7A 3DRRA 3D3CJ 4BHQA 2OSQA 2KDOA 2LQBA 3BH6B 1URNA 1SH2A 3PTWA 2HK3A 2N4CA 2FY1A 4ZN1A 1BD6A 2Z58B 5H9FK 4PWDA 2CJ9A 4ID5B 4ZJLA 5EWEA 4P52A 2B6AA 3K5PA 3CWJA 2R8JA 1NCLA 1RUSA 3QWUA 3KHRA 1NB2A 4J9VA 1BQNB 2MQLA 4K4VA 4B3OB 3F44A 1Q16B 4PG4A 3M05A 1GMUA 1K47A 4R25A 4J7CA 5T7LA 5E5NA 4P73A 3LGNA 1P9YA 3C6UB 2A1BA 1CS4B 4O3OA 3IAM9 4B9VA 2V2QA 3G82B 3MZIA 3K5LA 3M2VB 4FYVB 2I0XA 1VBYA 4NA2A 3T6BA 5L1KA 2FLLA 3DYAA 4DR5J 4CZCA 1PC5A 2Y1RI 3TUIC 3UPFA 1Y3JA 4AL5A 4JV5F 3TX8A 4PPDA 4ECQA 1CJVA 4F4YA 3DMJA 3MEDA 4ZDNA 1JLQB 3PKYA 4ED2A 1RT3B 2HWTA 1W25A 4OZ2A 3MUMP 2FC8A 2AYGA 1FRMA 1TFWA 3PZPA 5AE1A 3T9NA 1CPZA 3TVYA 2A2DA 3IG1B 1DJ0A 1HNXF 4I6WA 3KXDA 1MN9A 5GAGU 5FD1A 1E6VB 2B4PA 2C42A 3BQ2A 2W25A 1X4CA 4H4MA 3EXYA 3DN9A 3NP5A 2R8KA 1HQ2A 1VQ8S 3RZAA 1S57A 4NOHA 4WK3A 3GPAA 3H40A 4JI2J 2NXUA 2BVZA 1YSJA 1RAIB 2YWGA 2IM2A 2B43A 4TY8A 5G0RA 4TQRA 4H4OA 4P6QA 2QEXS 1R89A 3NBPA 4RNFA 1YWXA 4KYZA 4WFZA 1S48A 1MNEA 3HCXA 1NK7A 4KY3A 2WBMA 1C2PA 5AJ3F 2EI5A 4OZLA 3MM9A 3N5BA 4F0KA 5HJYA 4KTQA 2MHEA 4L72B 2RUSA 4HH1A 1PILA 2UP1A 2V68A 3KJVA 4DF4A 4LF6J 2C22A 2CQIA 2IC3B 2Y9HA 4DV4F 2WVEA 2V67A 1SL2A 3C6TB 4Y6IA 2KT3A 4RWXA 4EO8A 3I5AA 5CABA 4RU2A 2YVSA 2W4DA 1DTQA 1TP7A 3U1LA 4ED6A 4WXOA 3TNVA 4ZHRB 3HVWA 3NWRA 1TK5A 1TKZB 4DUZF 5G4DA 2CG4A 3A1YG 1DAXA 2RS2A 2NZCA 2BABA 3PIOQ 2IDLA 3KLFA 3CB4A 2DNGA 4M94A 4JI3J 3BBCA 3IRWP 4MMOA 3GJQB 2O67A 2HURA 1EQMA 1H38A 2V9WA 1O6XA 4DLGA 4QYZK 4J9KA 5E3QA 2ZOFA 5L39A 1U2CA 3OR2B 3EZOA 1T3OA 1XTZA 1GAOA 4ED3A 1I51B 5AXNA 4EI2A 2VA3A 2JEFA 4USVA 4Y28C 4MKBA 4BWJA 5T41A 2H5EA 4A47A 2UVVA 3HFKA 4KC5A 1UVIA 4ICLA 4ZPWR 2VV5A 2V4QA 3RB6A 4LR9A 5K5MA 3BN4A 2W7PA 3MR5A 1YTYA 4N56A 4LRCA 1CBKA 1MWQA 2EC0A 3SQOP 5EX3A 3OL8A 2ZZNA 1K0TA 2B9XA 3TVZA 3MAHA 2KRRA 4QW9A 1UJ6A 2YWFA 5E2QA 2HBQB 2DIUA 3AY0A 2R7SA 4ED7A 4L76A 2IBKA 5B0EA 3PFEA 3MFIA 2Q79A 2F40A 4FYYB 2V2KA 2MSSA 1SI9A 1XEZA 3I5CA 4OHZA 3H0PA 3VAJA 2L3MA 2JFKA 4JI6F 3M30B 5IT4A 2Q1LA 4DPYA 1ZAWA 1L3KA 4QIFA 3MMBB 2ZUAA 3H4DA 4PG5A 1UW9A 1IQTA 5F8NA 5LOQA 4AFFA 1HL6A 3GV8B 5FIIA 1OYEA 4L74A 3LF0A 4CLPA 1WUUA 3K8WA 3PFOA 4QYRA 4RZRA 1ZTTA 4AE5A 3PIPQ 5LSOA 1K9MT 1Y00A 5KFIA 2NLWA 4RW6A 3KJFB 3POTA 3A4TA 2VJVA 1T7PA 5J2NB 3DRPA 1EKSA 3M2UB 4J5OA 1FKPA 2YQ0A 2CQDA 1HD1A 2OFHX 4C48A 4GMKA 3E01B 1BLUA 5E3PA 4H4KC 4A8XA 4OZ1A 5A8WA 2RQ4A 4WP3A 3I5BA 3AFGA 2ZHBA 4A8FA 4M5GA 2FHMA 3R6LB 1IBKF 2XCPA 1S6OA 1TU0B 2ZBIA 4HHUA 4KGVB 3W65A 4PG7A 3E8OA 1S6QA 1EP4B 3DOLB 2XMVA 3CJ8A 3P5TL 1AROP 1P27B 4ZPTR 3H25A 2R3VA 3EUNA 1RU2A 1QY7A 2J7UA 1C4AA 4C6AA 4N8OA 2G2ZA 2D74B 2XS2A 1W2IA 2PGCA 1H6KX 2W9BB 3ET6A 1B64A 2N7YA 4DSJA 4FNHA 2Q43A 4HI2A 2HHQA 5KFYA 4DU7A 1FEEA 2CAJA 2KJWA 3FBFA 3G87A 4M95A 1YG0A 1M5OC 3CMQA 2JL9A 4IDKB 3GB0A 3FFIA 5IC4B 3O5TB 2VQFJ 1R0AA 2HQ3A 1N32F 1HYSB 1F9HA 3IMQJ 1AUSL 3AOAA 2DPJA 3L3CA 3QBCA 2ILZA 4ILRA 1FTRA 1LWFB 3KK3A 1P9QC 5HVHA 3EGNA 2WCXA 3VR1A 4TU9A 2GVZA 4LRFA 2XMUA 3MHYA 3HO1A 3M6WA 2Y1IA 5E0OA 2ZJQQ 4X4SA 2I5JA 4ZPBA 3VGVA 2M3DA 1U1OA 2AJFE 4RW8B 1VC0A 1MG7A 2V2VA 4LT6A 1F3FA 5HANA 5LM7E 2UV8A 2P6SA 3H2VE 1DQ8A 1X60A 3F41A 3IS9A 1SIZA 5DDRC 2V0NA 3GYGA 1FE4A 2E5HA 4DV0J 4CLYA 2HNYB 2OGUA 3CNQP 4KV8B 2HWIA 4A8WA 2XNQA 4ZP6A 3LP1A 2LCWA 3FQKA 3AT1B 2J6SA 4MT1A 3DRSB 3EZUA 3NMRA 2O1PA 3FDSA 2OPQB 3M1VB 1WKLA 1M1KT 1LW0B 5AE2A 1MU2A 1NXIA 3GU0A 2FVSA 4FXWA 3TJAA 2FC9A 2RILA 5D8HB 2YKNB 3I4HX 3V6DA 2ZD1B 3AA8A 4EWTA 2QC3A 4USIA 3ZNJ1 3HHLD 4E2FB 4OIXA 3KLEB 1RLCL 2FHJA 2ASLA 1ITPA 3IA0A 4JI4J 1TL7A 4WP8A 2VPXB 3CULA 5GADU 4J90A 2YKPA 3FRZA 5SZTA 2KN4A 4IQXA 1TL3A 2J9CA 4D3HA 5FLXU 1X7VA 2UUWA 2ZKTA 2PC6A 4FKXA 1U49A 1Q7LB 1H2TZ 3OTOF 1NM2A 1ZM9A 2G4BA 1NLKL 1O0PA 3TVKA 3C8YA 1NK4A 2HZVA 2IMOA 2RKIA 2HPUA 3DOMB 3LP2B 3W9JA 2HWHA 2YPZA 2VD3A 3CO0P 3CDEA 2GW8A 3A12A 4B3MJ 2EBEA 1WTBA 3GCXP 4PWWA 1PJ5A 2COLA 2QLXA 1N4LA 4YY3F 1F60B 2XMTA 3UCGA 3NGRA 1MMLA 3U7JA 3VQSA 3I56S 3UFCX 2NCKL 4FF3A 1YGYA 2DT9A 5C25B 1IKYB 4OI0A 3ZZYA 3FSIA 5KFNA 4LUBA 4K0KF 5H1SV 1RWOB 2ZH8A 2RRAA 2YH0A 2ACMA 1TAQA 2HAFA 3H5SA 1N52B 2CIMA 4OX9J 2ADBA 2PFFB 3QT6A 2D7SA 2VFVA 4MKVA 1M5PC 4X64J 2ZE2A 2HHVA 3GIJA 4NWBA 2B4VA 1XWLA 3RR8A 2HS0A 4NMXA 4DSKA 2IJNA 5J1PA 1JX4A 2X1BA 3AD7C 4IFYB 4BBYA 2EK6A 3HJFA 1RP5A 4RBVA 3TR5A 2C2RA 3Q23A 4Q0BB 3DFEA 1U1LA 1KQGB 2RF2A 2QN6B 1EIYB 3W63A 4QCLA 3LPEA 1ZM3A 1WG4A 1XIQA 1R3NA 2X51A 1CSJA 2FIUA 4ZCMA 4DQIA 3CD6S 3QLHB 2EEYA 1ZS6A 1S1VB 4A8OA 2K1RB 3R8YA 3J7ZT 4MKAA 2PSZA 1R43A 2BQUA 1GNKA 1SJFA 4RNNA 4ZN3A 4O3QA 2CPXA 1N36J 3RTVA 4PYDA 8ATCB 4MK8A 5KT2A 4OZNA 4ATNA 3KNAA 2Q6CA 4YB6A 2ZM6J 1QLNA 4M5JA 2ZH5A 4LSNA 3BDPA 3W5ZA 3TA2A 4PRFA 2CJBA 3Q8SB 5A2QY 3MUTP 4DR4J 1HI1A 1X4DA 2W2QP 1NK6A 5A6PA 1BHNA 1NK8A 3M9OB 1WOOA 2ZH1A 1WOSA 3V4MA 2NXJA 1RABB 2ASDA 2DNPA 4L3KA 5EUHA 3HHDA 4G1QA 1IBMF 5KFMA 4KAIA 1QSLA 4DPUA 1S5ZA 2KM8B 1FERA 3AODA 4GC7A 5J2QB 2KU7A 3FQLA 1SUQB 2IFXA 2WONA 2Y3YA 4HTIA 2XB2D 3MM7A 3KG1A 3NGSA 1P8GA 3M9MB 3R7SB 2F4VJ 2ZH7A 2XYPB 1IXKA 1RI7A 1FDBA 1FRLA 1TKTB 1Z2LA 1HHQA 4URQU 2HFZA 4X66F 2WW4A 2QFJA 4QYZJ 1YQHA 3W60A 5J1EA 2MQMA 2HQGA 3GG0A 4FYWB 3PW5A 4W4MA 3SMZA 1TTHB 4FYXB 5KT5A 4KB7A 3A8JA 2YNHB 2BZ2A 4B9TA 4PXCA 2HBRB 2AD9A 3KKFA 1VRQC 1UVNA 3O6QA 1PG5B 3PG9A 1RT4B 1M5HA 3AB4B 2CNNB 2R7OA 2N7CA 4BS2A 1FESA 3DLEA 4DMZA 4FVMA 4DF8A 3QATA 3JS9A 2VOOA 2GAGC 3KFWX 1EARA 4J9OA 3C16A 1TV6B
chains in the Genus database with same CATH topology
2LDIA 2XS5A 3MMAA 4OJHA 5EWGA 3MM8B 1OQ3A 2W7AA 2LDYA 2DGVA 3MUVP 1OIAA 3I55S 4WZMA 1X4FA 3LUYA 2VQEF 2GO8A 2ATLA 1SKWA 2B9WA 4MH8A 3VZIA 1FK9A 1AXQA 2DHXA 3M30A 5KFOA 1KHWA 1JLBA 3UNGC 3RB0A 2R7TA 1KQSR 3H5YA 1NEEA 2CQPA 2ZH2A 1FRJA 3MMBA 3FZBA 1R7IA 1KD1T 1FRHA 4I6YA 4HI1A 4IOBA 3SFGA 3R5AA 3PR4A 1R8BA 4H4MB 1U47A 4RW7B 4J9RA 3CCUS 1U48A 2KZZA 4BDPA 3JSMB 1VQPS 3CO9A 3D28A 3W7BA 2BANA 1Q8LA 4NRTA 1GTEA 3QWPA 7FD1A 2GQ2A 4OZJA 5IM0A 2DGSA 4PPZA 3T1YF 1T03B 3RR7A 2ZFHA 1S9GA 1WHXA 2GJ2A 4P2SA 4KRWA 4D3GA 1S0MA 1VGYA 1Y0HA 3MPWA 2U1AA 1SJ1A 4RW9A 3TAMB 4V19J 1F0XA 1KVJA 4TY8B 5HP1A 4R0JA 4LVNP 5G0RB 3SCJE 5KFRA 2IRXA 4A8MP 4H4OB 4PWUA 3DHXA 5I3UB 2YQ3A 2KHCA 3QJLA 2F3JA 4NYPA 3NBPB 5F8LA 1H7WA 5J2NA 2X3GA 3V4IB 1NNDA 3M2UA 1MMDA 1HNVB 2A18A 2RMLA 2UXDF 3VAFA 3U1NA 2AJ0A 2ZH6A 1C4CA 3DOKA 3BQ1A 3TAPA 2D3UA 2GMHA 5KFEA 1QVGR 2FJVA 4ELUA 3RAXA 3MM5A 2W4PA 3MM9B 4F2RA 2HVHA 4DV6F 1MROA 1WWHA 1VRUA 3E01A 4OI1A 5D78A 1N5TA 3KOAA 4HLBA 1JWWA 2RDIA 1HNIA 1T8EA 2VZ9A 1FDAA 3GIMA 2K3IA 2E5GA 2DO0A 3FRYA 4TYBA 5DQGA 1M5KC 4OI3A 4RBUA 4XPCA 4DV2F 5E7OB 4YP3A 3KJVB 2UUAF 4HTJA 3V6KA 3G6XA 2ERRA 2FB0A 3CIZA 3UR3C 3PJXA 3BGLA 4E8UA 2EFGA 1WF2A 2Q66A 3HPOA 2CQ2A 4ZOSA 3QGGA 1DARA 3KK1A 2RQCA 2XC9A 2MB0B 4YR2A 2VFSA 1HBOB 2XLKA 3MMJA 2GFFA 1XERA 2AW0A 3DI6B 1U1RA 3N4WA 2CRLA 1EP4A 1XR5A 5J1NA 4Q5VA 2RT3A 2J0SD 1HMVB 3DOLA 2OPPB 4QR2A 2OPRA 2R2UA 3DU5A 4NLGA 1K0VA 5DG9A 1RTIA 5L9NA 5B0AA 4R5PB 2FDNA 2HRYA 3OPKA 4DR2F 3MD3A 4FVCA 4K4WA 4KQZA 3KHHA 1JJHA 4G3IA 2QA1A 2V4JA 2C3OA 1DTQB 3MECB 2NYIA 3JSRA 2GCFA 2CJKA 5KG5A 4KSEB 2YNIA 2GIQA 1FEHA 4DQPA 2DISA 5IT0A 5C24A 2BYCA 4FP9A 1DQ9A 3LAKA 1ZBTA 4OFZA 4OJ1A 4NCBA 1Y5LB 2QA2A 5KT7A 3R1LA 3WDOA 4ECTA 3NAIA 2POKA 4B3TF 2XI2A 3H2UB 3CJ2A 1U1PA 4TXSA 2C28A 2WHOA 3U27A 1ULRA 3BR9A 3GV7B 1YBAA 3KLFB 1M90T 3HZEA 2FJAB 3KK2A 2XY5A 3V2UC 3RAQA 2LXFA 4WCEQ 4XO0A 2W9BA 4P7TA 3I82A 5L1LA 1RT1A 3NNCA 4QU6A 2L9DA 2EFPA 4I6AA 3LWLA 4DFJA 4DL5A 4JYAF 3ITHA 5KTQA 3VQTA 2GA7A 4KFBA 3R3TA 5GAEI 1QTMA 4HEA9 2E1MC 3WX4A 1FNOA 2PA3A 3OUYB