3I5BA

Crystal structure of the isolated ggdef domain of wpsr from pseudomonas aeruginosa
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
170
structure length
170
Chain Sequence
b'ALMNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords WspR response regulator
molecule tags Signaling protein
source organism Pseudomonas aeruginosa
publication title Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb
total genus 58
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i5bA00
4G1QA 1GX6A 4TY9A 1S10A 1LWEA 1K1SA 3ISNC 4O44B 3CJ4A 3MEGB 3N6LA 5KFIA 1KLMB 1TKZB 1VRUB 2C22A 5I3UB 2ASLA 2YNGB 1C1CB 1FKOB 1MU2B 4NLUA 4RNOA 3BSOA 3BGRA 5J2PB 4TYAA 1KLMA 3Q8QB 3I5AA 2WTFA 3KHGA 4ED7A 2AQ4A 3E51A 4IRDA 2AX1A 4LSNB 4J9NA 5D3GA 2I5JA 2XGPA 1ZETA 2WOMA 4DL5A 1RA6A 2HNZA 4XPEA 1D0EA 2FVPA 5DLGA 3LP1B 3KLHB 3GQCA 2WHOA 4KAIA 1RTDA 3V81A 1JLGB 1RTHA 4KO0B 1LWCB 5FDLB 3BREA 4NYZA 3GYNA 3DYAB 4ZP6A 4J9OA 2FJWA 4I7FA 4MFBA 4TY8B 1C0UA 2XCPA 3IGNA 4ECXA 1VRTB 3IS9B 2W9AA 4QWDA 3ICLA 4RW7B 4MH8A 1C0UB 4PWDB 5HLFA 4NLQA 2FVQA 2YNIB 2OPRA 2RDJA 4RU9A 4R8UA 1NHUA 2XI2A 3KLFA 3BJYA 2HNDB 2R8IA 2YNHA 1S49A 5KFBA 2FVCA 5CYMB 5J2QA 4RW6B 4ZPCA 3DLKB 4F4YA 5I42A 4NLRA 4ZVFA 5KFAA 5EWFA 1TQLA 2R2TA 2ILYA 1IKWB 4NRTA 2IJNA 3BGRB 3I5CA 5KFUA 5J2PA 2UVVA 1HNIB 2IJFA 2OPPA 2JEJA 1BQMA 3KHHA 3H59A 3OLAA 1DTTB 4WE1A 2C2DA 1HYSA 1HNIA 5KFDA 3T1AA 5DQHA 4ID5A 4WXOA 4NLPA 4DEZA 4KKOB 1RTJA 4WYLA 2EC0A 2VA3A 2AX0A 4KSEB 1IKVB 3QIPB 1DTQA 4MIAA 3PJWA 4Y3CA 4FBTA 3H98A 3MEDA 3T5HA 3FFIB 5L1IA 3FDSA 4MK7A 3IS9A 4NCGA 3GV7B 4B3OA 2YKNA 4Q8EA 2GC8A 1RT7A 3M8QB 1EP4B 5C24B 3DRSA 1U09A 2ZKUA 5KFXA 2HWIA 5J2NA 2IM0A 1S9GB 1LW2B 3HVWA 4ECTA 3G6XA 4RNNA 3KLIA 4QWAA 1SUQB 4WFYA 5CYQB 5F8GA 4J9LA 5KT6A 3Q8PB 1XR7A 4EO8A 1HPZA 4O4GB 2IAJB 4JV0A 4JV1A 1YVFA 5T14A 3C6TB 3HVTA 1UWBB 3M8PB 3IG1A 4RZRA 1T03B 4O3PA 1KHVA 5JXSA 2R2UA 3H5UA 1LWFB 1BQMB 2JEGA 3M8PA 4DL3A 3LP2B 5KFSA 4YR0A 4G1QB 4XPCA 2JEFA 3QGGA 3DRPA 3C6UB 3QZ8A 5DG7A 3CJ0A 3DI6B 2FJXA 4PUOA 4K4VA 5C25A 4QW8A 3PW7A 4ZMMA 4WZQA 1VRTA 1TVRB 4H4MB 3KMSA 3H5SA 1TKXA 1T05A 1LW0B 4DG1B 4EEYA 3DLGB 1HQEB 3OL7A 2HNYB 4IOBA 3CDEA 1HQEA 3MEEA 4MIBA 5HP1B 4RUAA 4J9SA 3PZPA 3MEEB 3BR9A 5KG3A 2B5JB 4ED3A 1RAJA 2E9TA 1JLGA 1RTHB 2IA6A 1K1QA 4PQUB 3GILA 2I1RA 4QWCA 2RKIA 1S6PB 4Q43A 4YQWA 3H40A 1RT3B 4ZP9A 2BQUA 5KFCA 3H2LA 2IM1A 3CJ2A 4K4WA 3KK1B 2BQ3A 3M9NB 2V4RA 4J9MA 4ZPAA 2D7SA 5KFPA 4J9KA 1DTTA 4WE1B 3QLHA 4EBCA 3RAXA 3IG1B 1T03A 2R8JA 4O3RA 4IG3B 1C1BB 1RT2A 2YKMB 1S6QA 4O4RA 2BE2A 5KG6A 1RTJB 3JSMA 4NLGA 1S1WB 3OL8A 4FBUA 1RT4B 1GX5A 2R8KA 3DRPB 1IKVA 3OL6A 3TQ1A 3D28A 1S0MA 3FQLA 4TLRA 4IH5A 5KT5A 4RW6A 2XGQA 5I42B 5F8IA 2R8HA 2UVWA 2WB4A 5EWEA 1IKXA 2W9CB 3MR5A 1S1VA 2W9BA 2YNFA 4NLDA 4IR1A 3JYTB 1ZTWA 2F8EX 1QAJA 4ECUA 4R5PA 3LP0B 5J2NB 3MF5A 5CYMA 5C42A 1SV5A 1JLFA 1TV6B 1FK9A 5DQIA 1REVB 1SH0A 2O5DA 2B5JA 4JV2A 1S4FA 4ED6A 4ECSA 2VG6A 4IFVB 1HPZB 4O4GA 1C0TA 4Y2AA 1S6PA 5HROB 5F8LA 5KT7A 1RT6B 2FVRA 4NCGB 4B3OB 3H4BA 5KFLA 4ZHRA 1RT6A 3FRZA 3G6VA 4YP3A 3PW4A 5KFQA 3BQ0A 3MEGA 4K4TA 3DI6A 4K4UA 5J1EB 3QIPA 5C25B 1FKOA 3FFIA 1TVRA 4RW9A 3H5YA 1S1TB 3BSNA 2I5JB 4F50A 4IG0A 1TKTA 2AWZA 1N6QB 4NLSA 1WNEA 1QUVA 1T94A 3BQ2A 3HVTB 4Q44A 1IKXB 2IM3A 1TKTB 2W9BB 3M9MB 2BANB 2CKWA 5KFMA 1LWFA 3DM2B 4LSLA 4RNMA 3QGHA 4KBIA 4NLWA 3T19A 3LP2A 1J5OB 4LQ3A 2UVUA 4I7FB 4KFBA 4TY8A 3V6JA 4IR9A 5KFFA 2FLPA 4IH6A 3BSCA 4PQUA 3BSAA 2IAJA 4ZVHA 4XO0A 4K50A 4KO0A 3C6TA 4FS2A 3IN5A 1RYSA 4IFVA 3KLVA 1DLOB 4GC7A 4ZP7A 4MFBB 2HAIA 3CJ5A 3RB3A 3KJVA 1XR6A 5HROA 1HQUA 2E9ZA 2JC1A 4ECZA 2OH2A 3KHRA 2D3ZA 3EPIA 1HQUB 2IM2A 5L1LA 3KK2B 4I2PA 3MFHA 4H4MA 4DL4A 5L9XA 2OPSB 2VG5B 4J9QA 3GV8B 2FLLA 3UPFA 3I0RA 4ECRA 3RBEA 1BQNA 1RT5B 1S1VB 3H5XA 2IC3B 4X2BA 1N6QA 1IKWA 3T5KA 2C28A 2E9RX 3OLBA 4DL2A 3HVAA 3KLHA 2WONB 3RB6A 2BE2B 3DM2A 4LSLB 4WFXA 3RB4A 2JLEA 1S9EA 4J9PA 4J9RA 3D5MA 1S97A 3CO9A 4TYBA 3V6DA 3QO9B 1S9EB 5HBMA 3V4IA 3OSNA 5DGAA 1HNVA 4JUZA 3KLEA 2UUWA 2VG7B 1N5YB 3DRSB 3JSMB 4PWDA 4ZHRB 4HKQA 1S1WA 3KJVB 4MK8A 1Z4UA 1S9GA 2QV6A 2V0NA 1MMLA 5K14A 4K4ZA 1N48A 3V6KA 4F4WA 1W25A 1HMVA 1RT7B 4RUCA 3PR5B 1S1XB 4WFZA 4TQSA 3NAHA 4RW9B 4YMEA 2AU0A 4I2PB 1HMVB 1QE1A 1LW2A 3PVXA 1JIHA 3DLEA 5KG4A 3CIZA 4K4SA 4ED8A 2YNFB 1QE1B 4WYWA 5KFOA 4LSNA 5D3GB 1JX4A 2ZE2A 3NAIA 5KFJA 3G6YA 4R5PB 3PJXA 3DOKB 5C42B 5J2MA 4MKAA 3DMJA 3LP1A 1I6JA 3OHAA 3NL0A 3C6UA 1FKPB 1REVA 3ITHB 4URQU 1J5OA 2V9WA 1HYSB 2B6AB 3GIIA 3EZUA 3I5BA 2VG6B 4Y2CA 2JEIA 3PW0A 1S1UA 3Q8RB 4EYIB 1RT1A 2WK4A 4YR3A 3PR4A 5KFTA 1S1UB 2HNYA 3CDWA 1IKYB 1EETA 4IH7A 2WCXA 4IG0B 5HBMB 3V4IB 2J6UA 4RW8B 2V4QA 3PW2A 3KLGB 3FSIA 1TKXB 2OPRB 2FJVA 5C5JA 1S9FA 4GC6A 5J1EA 4O44A 1EP4A 3CWJA 4ECQA 1NHVA 3KK2A 5KT3A 4U7CA 4NLTA 5KFHA 3MR2A 3SFGA 3SI8A 3KLIB 2WRMA 5KFRA 3KK1A 1S0NA 4O3OA 5CYQA 1BQNB 1RT5A 5L1KA 3NKYA 1RYRA 2ATLA 1OS5A 1TL3A 2RF2B 3ISND 4ZP8A 3QZ7A 2W8KA 4URGA 3IRXA 4Q45A 3DOKA 1R0AA 3MR6A 3E01B 4NRUA 4NLYA 4RW4A 2WOMB 4QWEA 2ZD1A 4FS1A 5KFEA 3NGDA 3DYAA 1T3NA 3LALA 4I2QB 4IDKB 3UDLA 2ZD1B 2XWYA 4ECYA 1DLOA 2BR0A 1QAIA 2IBKA 3MEDB 4KHRA 4Y34A 1LWCA 5FDLA 1NNDA 3MFIA 2W8LA 2W9CA 4F4XA 3DRRB 5KFYA 4F4ZA 1SH3A 2R8GA 1LW0A 4DG1A 5DGBA 1JXLA 4ZPBA 4RNFA 4K4YA 3TVKA 4ZVEA 3HKWA 1TV6A 2C2RA 3KLFB 3KMQA 4ED2A 3T5LA 4Q0BA 4ZVGA 1TL1B 4NLVA 4RNHA 3DDKA 5DG9A 4G3IA 2HWHA 4IRCA 2FVSA 4KE5A 3PW5A 5F8JA 1JLAA 2IC3A 5J2QB 4TQRA 1RA7A 2OPPB 1UWBA 2RKIB 3I0SA 1RT3A 5JUMA 3DMJB 3OL9A 5KFGA 4MK9A 2J6SA 2DPIA 3HHKA 5K14B 1RT2B 2YKMA 4YR2A 5KFKA 4RW4B 3OSPA 4NZ0A 1S1XA 2AGQA 3LAMA 4ID5B 3KK3A 3QGIA 4I2QA 1HARA 4EBEA 1KHWA 2GIRA 2ILZA 3KLEB 1T05B 2YKNB 3KK3B 3DLGA 5I3UA 4RW8A 3VQSA 3M8QA 1XR5A 2XI3A 5C24A 5F8MA 3RB0A 1ZTTA 2BQRA 2OPQA 4QW9A 3V6HA 3JYTA 4ECWA 4KFBB 3N6MA 4QWBA 3UQSA 5KFVA 2HNZB 2GIQA 3TAMB 2FLNA 5F9NA 4U6PA 2BANA 1TKZA 1VRUA 3TAMA 1CSJA 1RTDB 3CVKA 5KG5A 1C1CA 1MU2A 2YNGA 4IKAA 1JKHB 2IMWP 2DPJA 2R2SA 4IQXA 2VA2A 1TP7A 1JLEB 3NBPB 1SH2A 5KG0A 5KFZA 2ALZA 3H4DA 3MR3A 2R2RA 1FKPA 3ITHA 3IRXB 5EDWA 1R0AB 3MTKA 1C1BA 4EYHB 4M94A 2AGPA 1N56A 5L1JA 4O3SA 1RT4A 4URSA 2VG5A 1RT1B 4ED1A 3GIKA 3I0RB 3IGVA 1D1UA 4WXWA 3NMAA 2AGOA 3SFUA 4NLXA 2HNDA 3EPGA 3PHEA 1JLBA 4RW7A 2W7PA 4WZMA 5HLFB 3MECA 1JLQB 3DOLA 3G86A 1JLBB 3LANA 3N6NA 2YNIA 5HP1A 1TL3B 2CJQA 2RF2A 4O3NA 3MECB 3LP0A 4EBDA 2J6TA 5F8NA 1S48A 3LAKA 5EUHA 1N4LA 4DL6A 4KHMA 1RDRA 3E01A 1TL1A 3QIDA 3V81B 2QE5A 3DLKA 2BRKA 4TN2A 2WONA 4NLOA 3T5JA 4ED0A 2ASDA 1JKHA 4QPXA 4ICLB 1DTQB 5KG1A 4IRKA 3QO9A 5KFNA 5KFWA 4ICLA 1JLCA 4HYKA 1RTIA 3FQKA 2VG7A 2ASJA 3Q8SB 3QLHB 4IDKA 1JLCB 4KV8B 4IG3A 1C2PA 4R8UB 2D3UA 5KT4A 1S6QB 4Q0BB 2XCAA 3BQ1A 4KV8A 2UUTA 2YNHB 3DRRA 2OPSA 1S1TA 2ZE2B 5KG2A 2C2EA 3QYYA 4O3QA 5DLFA 1SUQA 5J2MB 3KHLA 3DLEB 3CJ3A 4ECVA 4EO6A 2OPQB 2BRLA 1JLQA 3DOLB 3GV5B 4IFYB 4ZPDA 2B6AA 4R0EA 3UR0A 1SV5B 4H54A 3GIJA 2D41A 2UVRA 1FK9B 4IFYA 4K4XA 5F9LA 4Q8FA 3RBDA 4TXSA 4H4OA 4KKOA 5F8HA 5KG7A 1JLAB 3GIMA 3OHBA 1IM4A 2RDIA 5DQGA 1JLFB 1C0TB 3RAQA 2B43A 4M95A 3I0SB 4H4OB 1JLEA 3NBPA 2W7OA 4PUOB 3KNAA 5EWGA 5DG8A 3KLGA 3M9OB 3V6DB 4DL7A 1S0OA 4MKBA 4OL8A 3KOAA 2HMIB 4LQ9A 2JC0A 4KB7A 1HNVB 1N5YA 5KT2A 2XC9A 1IKYA 1EETB 3CDUA 2HMIA 1LWEB 1RTIB
chains in the Genus database with same CATH superfamily
1TELA 3JTNA 2MKCA 1N34J 2XZDB 1XBWA 1H0HB 1HHQA 1LWEA 1NO8A 5H9EK 3Q86A 1QDUB 3ISNC 4O44B 3MEGB 1RCXB 3N6LA 3NWRA 2OFHX 2PT0A 4NMLA 2DGOA 5KFIA 3G82B 4DQRA 1MU2B 4NLUA 3TQEA 1HI0P 5J2PB 3KHGA 4ZPTR 3Q8QB 3WC0A 1JNRB 1FA0A 2AX1A 1JQGA 4KH0B 5D3GA 2XGPA 4PWWA 3PCOB 4N56A 4DL5A 1RA6A 2HNZA 2OMLA 5F41A 4XPEA 2ZH9A 1ZA2B 4F67A 2V8GA 5K8NA 3SQGA 1Q82T 2FVPA 2ZZTA 3D7SB 3EZOA 4NA2A 1DHMA 2EXUA 4QYZJ 3TR5A 1RLCL 1RSCA 3WQPA 4IUFA 2ZH8A 3Q2TC 2KJWA 3BBCA 4XDCA 2XWXA 2XCPA 1R43A 4EFAC 1VRTB 3IS9B 3CCRS 2UXDF 5IWAJ 1O8BA 4PWDB 4RWXA 4X4SA 2B9WA 2Y1IA 2DITA 2W4DA 4AFFA 2XSFA 2HIYA 3HHDA 4D3HA 2RDJA 4RU9A 2EG2A 4DV7J 4R8UA 2XI2A 1FD8A 1WEZA 2RD5C 3Q8YA 2FY1A 3D68A 1NMEB 2KL8A 2DD8S 5B7WA 2EG1A 3KG0A 3DLKB 4LVNP 5HMXA 1FTRA 4JV5J 5HAOA 5DRKA 4ZVFA 2ILYA 1M5SA 4U7UD 3NXZA 5LT5A 4CO1A 1N5VA 3I5CA 5J2PA 2XLKA 3EICA 1F0XA 3GFXA 1RACB 3H59A 4MTPA 4WE1A 1HYSA 1HNIA 3ZZZA 5M2PA 1L3TA 4DLGA 4ID5A 4WXOA 3ZNUA 1QTNB 3FKBA 2CPZA 4L3KA 3LGNA 3W65A 2X1BA 3CDBA 1VJWA 4OYBA 4MIAA 4Y3CA 1KVJA 1T0TV 4OHYA 1UPPA 2GX8A 3WDOA 3FFIB 1I94F 1KQGB 4ED5A 3LGMA 3QNWB 3VALA 3IS9A 3CJ8A 4NCGA 2YKNA 1FDNA 1RWVB 1SCJB 1LQ9A 3I4PA 1LFWA 2DCLA 5C24B 3IAM9 4ATNA 2HQIA 3DRSA 3TVYA 3OVSA 4Y2MA 4HI1A 4C6AA 1YHQS 3GJRB 2IM0A 3US5A 4DR2J 1AUSL 2VPWB 3VVUA 2M2BA 1SUQB 2WVFA 3V4MA 4J9LA 3MM6A 2Y0SD 3AQPA 3M2RA 4JV0A 5HJYA 2IAJB 4FVMA 4JV1A 5T14A 3B4DA 1JWWA 4L76A 4OLPA 3HVTA 3OXLA 4PCQA 4ZVRB 3M8PB 3SDEA 4OJ1A 2AJFE 2YH1A 4KT0C 1UEKA 2HHHF 1KHVA 3TUJC 4DFPA 3RBXA 1B3TA 3HVRA 4OJGA 2OSRA 4DL3A 4ZPWR 3OTBA 3KJNB 4CLPA 5GAEI 1R7IA 2RVJA 4PXCA 3C6UB 2KRBA 3QZ8A 4U9RA 1FJEB 4K4VA 4PUOA 1HKAA 8AT1B 4TU8A 4QW8A 2KJVA 3PW7A 5C2GA 4DR5J 1DQ9A 4B3RJ 3RTVA 4H4MB 3THPA 3ZTRA 1VQLS 4LJMA 3VAGA 5SZTA 1T05A 3MAHA 2G0JA 2X1FA 1HQEB 3DLHA 1RGVA 2CVEA 3LPEA 3U02A 1WF0A 3CDEA 1RAAB 2PEBA 2PIIA 1Q8LA 4DJBA 1T9XA 1V9OA 2MQNA 1W2BR 3FMWA 3IWLA 4W4MA 2MLXA 5HP1B 4M5KA 4OJHA 2RS2A 2B51A 1K8AT 3GFYA 2QSFA 3KUHA 3NS5A 4X65J 2ZHBA 2DEJA 3BR9A 5EX3A 2J0WA 5KG3A 3KG4A 4ED3A 2J9EA 4BS2A 1JLGA 4M5NA 1N5QA 1CJTB 2KYXA 2ZBIA 1K1QA 5IV4A 1AA1B 4DV6F 3H90A 1GXUA 2VODA 1S6PB 2CIMA 2PFDA 3HULA 4E0DA 2CPIA 2IM1A 4BC9A 3CJ2A 1NDCA 4EMDA 1DTTA 1MG7A 4IG3B 1RT2A 5KG6A 1JMTA 1S6QA 2ZM6F 1S1WB 4FBUA 1RT4B 3HZGA 1M5HA 2F5GA 2HVDA 2K8GA 1TUGB 2DBBA 2NLWA 2VC1A 4NEYA 4B08A 3TQ1A 1IKVA 3OL6A 3AH6A 1S0MA 3IM8A 4WCEQ 2GO8A 3FEZA 4TLRA 3OW2R 4U96A 2EFNA 5I42B 2R8HA 3OJUA 2UU9J 2QA4G 1FCAA 2VBXA 2XEXA 3EXYA 4ID8A 1FRMA 2UVWA 4CO3A 1IVZA 3W5YA 3MUMP 1IKXA 5GAGU 2MB0B 3MR5A 4EGLA 1MN7A 2YNFA 3H8YA 4QIVA 2DH8A 3JYTB 1ZTWA 2F8EX 1IQTA 1UP1A 4CT8A 3QAUA 2QZ8A 2D74B 2ROGA 3S1TA 4WTOB 4Q7AA 3BGFA 1EB0A 1VQMS 2O67A 5HK4A 1RKJA 1FX2A 3MZIA 1NSPA 1YJ9S 1N0UA 3TAPA 1S4FA 2AZ3A 4B3TJ 4JV2A 1UVLA 3NLCA 3RAMA 3MUTP 1CJTA 3HFKA 4O4GA 3TX8A 2V4JB 2AEJA 1VC0A 4HACA 1UFWA 2X3DA 1S6PA 4F3QA 3FBBA 5KT7A 5HMYA 1RT6B 1Y00A 2QMWA 2FVRA 2C42A 1VQNS 2CQCA 5KFLA 2B9YA 3K57A 1Q78A 2UV8A 4OHXA 1D8YA 4YP3A 1X4EA 2KM8B 1C4CA 2GVZB 3W63A 4K4TA 3DI6A 2YXLA 3O2IA 1WELA 1FE0A 2DHHA 3A3PB 3QIPA 5F0WA 2FB0A 2PA8D 1YX2A 2B4OA 3F44A 2KVQE 1VK3A 4ZITA 1FRKA 5LJ3Y 1JXEA 3ZC4A 3UN2A 2XYHB 2R7RA 4YFUA 5L1LA 3R27A 2AWZA 2NPIA 4QOTA 1WNEA 3BF4A 5CCMA 3NCPA 3R1LA 1IKXB 3LH2S 1CJVB 2FY8A 4CQ1A 3GZ7A 3K5OA 3LPYA 2HBRB 4DPOA 4ZLLA 4D3GA 1YWXA 2CKWA 5KFMA 2O1PA 2IDLA 4ZS6A 4WZQA 4KBIA 4NLWA 1J5OB 4LQ3A 4F3OA 3CD5A 3U1MA 1EZZB 3NCRA 3J7AN 4IR9A 2AEMA 2FLPA 5E33A 4PQUA 5CCLA 2H51B 2VKZG 1KTVA 1RAEB 2OEKA 3IN5A 4KPYA 2HHWA 3KLVA 2V4JA 5KTQA 4GC7A 5D15A 1YRTA 3P5BP 3KJVA 1XR6A 4I6AA 4C11B 1RWOB 1NJWA 4BWJA 3GCXP 4WK1A 1F9FA 3NS7B 2OH2A 4K2XA 2ZZNA 1KDNA 4OZ1A 2IM2A 4RUBA 1RWWB 4PG7A 2FLOA 2VU5A 5L9XA 4DPWA 1S79A 2QMUB 3TEHB 3GV8B 1HBUB 1VIOA 3UPFA 1RHRB 3GG1A 3K17A 5AXKA 3R6LB 3SIPB 1VC5A 1EKSA 3PFOA 5T41A 2K06A 1HHTP 4LF2A 4OV6A 1U1LA 1HQ2A 1FJGF 1B7FA 1CJVA 1S76D 3GONA 3SQGB 2WONB 4YY3J 3VGSA 2KG1A 2GMJA 3M2UA 4LF4F 2VJUA 4CLYA 3K5LA 2L9NA 3NGTA 1AYEA 4J9PA 2MKSA 3R1HA 4N41A 2HHUA 1S97A 3CO9A 3LO3A 3V6DA 1YJVA 1S9EB 5DGAA 1HNVA 1MWZA 3CCMS 1N5YB 2VG7B 1YBTA 4B3SF 2XSJA 3JSMB 3ZTQA 5J1PA 2YVSA 3PHTA 4DSJA 4PWDA 3KJVB 4YB1P 7AT1B 2CNKB 5HI7A 3TA2A 1TU0B 4LIRA 2XLIA 4WIQA 3WC2A 1Q0NA 1RT7B 1FNXH 1V3SA 4TQSA 1CLFA 1FJ7A 1CJKB 3QT7A 1HMVB 1CQMA 1LW2A 1QE1A 3NOCA 1NSAA 2F3JA 3DLEA 4X66J 3CIZA 4C7QA 3PVXA 1JJHA 2EC2A 1VI7A 1KS2A 2B3TB 3TEGA 5KFOA 1FXLA 4HT7A 1U0HA 1U1PA 3A8JA 2VF3A 1WHYA 3HX9A 3U1LA 3DOKB 4DCOB 5A8WA 5CYJA 1O6XA 2QTWA 1X4AA 1KFSA 2FHOB 2FJDB 2LQJA 2QEXS 2V8VA 3ITHB 3N79A 1HYSB 3QJJA 2ZUAA 2VD3A 4AQYJ 1H74A 3IR6B 3GIIA 4DV5F 1WEYA 3DGPA 1LWXA 2K7JA 2Q43A 2RRAA 5A0YA 1H2TZ 2JEIA 2RJZA 4PG5A 2BW2A 5EHHA 1FI4A 4MYUA 4EYIB 2G13A 2QLXA 1NJXA 2HAFA 2EFOA 4M5DB 1S1UB 2HNYA 1F6TA 3OFFA 3ILIA 4IH7A 2WCXA 2UZAA 3EJMA 1SQFA 2H54B 2ZOFA 5A8RB 3HT3A 2YWWA 3KLGB 3FSIA 3P49B 3H20A 1V6HA 3FBEA 3DDNA 5C5JA 3HFZB 4GC6A 4ER8A 1H3DA 1MWYA 3KUGA 3UR3C 2ZH1A 3CWJA 1HBOB 4CLUA 1AT1B 4MMOA 3MCOA 1X4FA 3DCAA 4OZJA 3DRXA 3MR2A 2MLYA 5F3TA 2WRMA 3OFEA 4FN5A 1XNQF 2Q1LA 2IVYA 5CZXA 2DRAA 1F5BA 1JXVA 1VLYA 2MSSA 3A8IA 1D9DA 2ZC3A 1N5SA 3GTYX 4AD6A 3DOKA 2D9PA 3HF5A 3E01B 4OX8A 1GXTA 4OLOA 2YKAA 3JQJA 4UOHA 2DNMA 2YPYA 5KFEA 2VBZA 1MMNA 3LALA 3TJAA 1UVJA 3MR7A 4ECYA 4Z7YA 3RRGA 2DISA 4P10A 2GZOA 1P8GA 3B8HA 2W1BA 3R6GB 4KHRA 1RHMB 4Y34A 3MFIA 3C15B 2CQDA 5B09A 5KFYA 1S0VA 1WF1A 2R8GA 2MY7A 2GIFA 3TA1A 1JXLA 1X4HA 3POTB 3ZZ0A 2C2RA 2H5JB 2RHQB 3AA8A 1NSQA 2NPFA 3ZFVA 1BGXT 4HDGA 1VRQC 1FFWB 1QJHA 2W2NP 3TARA 4B3MF 3I96A 1KKHA 1RZMA 3TWZA 4G3IA 1KBRA 4ZVUB 4FNIA 3EGZA 2JZ5A 3A8EA 4QR2A 1KC8T 5E7OB 1GAOA 2R4FA 2W25A 4DX8H 3PW5A 2IC3A 2XMVA 2Z57B 1UZDA 4TQRA 1VMBA 1N5YA 2ALYB 2FD2A 3H25A 1NXIA 3Q8UA 2D9OA 4JI0F 5BYQA 1F60B 4PZVA 3UNGC 3BO3A 1HBMB 3HHKA 2IBOA 3IBFB 5HMWA 1RAFB 1RT2B 4DQIA 3OSPA 2XULA 1FJGJ 1S1XA 3LAMA 2CQHA 2DTJA 3QGIA 1LV5A 1B0VA 1HARA 3K58A 4I1TA 3KLEB 2W2MP 3PIPQ 4ZCMA 3J81Y 2JL9A 2QA4S 2AMCB 3N28A 3M8QA 2E5IA 5F8MA 2AHOB 2OHDA 1NBEB 3DU5A 2BVZA 5ETTA 3POTA 1PC4A 3BN7A 4L73A 4CNYA 4ZJOA 3JYTA 1QM9A 4QR0A 4QWBA 4C3MA 2MHNA 5KFVA 2FLNA 1WHXA 4IO1A 4P2XA 3ZNJ1 4CLLA 1RE1B 5F9NA 2XYGB 3CJSA 2GGPA 2BANA 3I82A 3DLBA 1VRUA 4F36A 3GIRA 2QC3A 2NZ4A 3CVKA 5KG5A 1C1CA 2NSCA 2SXLA 1FRHA 4IQXA 4JI4J 2ZH2A 4LRBA 4KHPF 5D6GA 1SH2A 2BBEA 5HVGA 2YY3A 5KFZA 2BA9A 5IC4B 3CD7A 5G4DA 4A8SA 5H9EJ 4F8RA 5JJBA 2C1EB 3MTKA 1C1BA 3UD3P 5B0FA 4A8FA 2MZSA 3D1HA 2I38A 1OIAA 4S0MA 3MM7B 3W8GA 2MQ8A 3GLJA 3IMQJ 4I69A 2DH9A 2VC0A 2GVZA 2V50A 2Z8QA 3I0RB 1MSWD 4WXWA 2M88A 5GMKa 3CPWR 1WOPA 2GCFA 4NLXA 1RABB 3PHEA 4WZMA 2F9JA 1U0SA 2O01C 1JLBB 1M0SA 1RAGB 3N6NA 4DX6A 2YNIA 1ZS6A 1DBDA 1RU2A 1TL3B 2J7WA 4P52A 3MECB 2MTLA 3LP0A 3G8TA 4FF2A 4V19X 4X4OA 5F8NA 5AE3A 1N4LA 4DV1F 2XMTA 1RDRA 1AFIA 1OPIA 4I0WA 4AL6A 2W7AA 3QIDA 3IC1A 1HIYA 8ATCB 2QE5A 2Y8YA 2C2NA 5LOQA 3CO0P 1O51A 4NLOA 2CZVC 4ED0A 1VBZA 1UETA 1TMJA 3DXSX 1FDAA 4ICLB 3VWSA 4IRKA 4QPTA 4DUYF 3AAWB 3S8SA 1M5PC 3UDCA 5KFWA 4LRAA 4KC5A 1UCNA 2H5EA 1RTIA 5A6WA 4F25A 3UWTA 1HBNB 2HBYB 1YRUA 2VHGA 5IFMA 2Q79A 2HFZA 3D1OA 2FJAB 3MPYA 4R8UB 3M8YA 3T1YJ 3CC4S 4GKKF 2BOAA 2B56A 1SI9A 2UUTA 2A18A 2HFVA 2IIHA 3GWCA 2UUBJ 2ZE2B 2WSFC 4EWTA 2GHVC 2K3KA 4UTGA 1U26A 5J2MB 1U2RA 1NZ8A 3SSSA 3CJ3A 2HFUA 2M8HA 4CTAB 2XQCA 3O6QA 4QIEA 3CULA 4H54A 4XTTA 2CNLB 1FK9B 2OFGX 3ILJA 2BJDA 4ERDA 3PEHA 3AT1B 1NRKA 2XMKA 4IFYA 4K4XA 1XC9A 4LF4J 5HN0A 4Q8FA 4DV3J 2FJVA 3QJLA 1JLAB 1SL1A 2Z2LA 3RGIA 1JLFB 1C0TB 3Q23A 3W2VA 4QIFA 2W7OA 1NJYA 5EWGA 3CB4A 2JH3A 2J7KA 3V6DB 3N9UC 1S0OA 4OL8A 4WKRA 4KQZA 4A8QA 2HMIB 4N77A 1HNVB 4OI3A 4ZLNA 2OMOA 2OLWA 5KT2A 5GAHI 1U1MA 2E7WA 4KGMA 2KFNA 3QAEA 1RTIB 1GEHA 2UV8G 2BKPA 4G1QA 5AXLA 2L41A 2J0SD 3D4JA 1K1SA 2Z4PA 4LF1A 4R5PB 4ZK7M 4PAAA 3W2WB 1KLMB 1TKZB 2Z2YB 4PR6A 5ETOA 5I3UB 2RQKA 1HFEL 2MGZB 2YNGB 2RQCA 4DR1F 4RNOA 3BGRA 2WTFA 4TYAA 2AQ4A 4ETXA 3I5AA 3BJYA 3FNNA 2HSEB 2YKOA 3KWMA 4J9UE 3R8YA 4OI0A 2BKNA 2I5JA 3HP6A 4FXWA 4Q2MA 2WOMA 1TL4A 2V67A 4CTAA 1N8RT 1WSVA 4WIIA 3KLHB 3GQCA 1S12A 2VFUA 1RTDA 1R0BG 2G2YA 4UUXA 2A10A 3V81A 1FT8A 4KO0B 5FDLB 4E98A 1WJ9A 2ZH6A 2XS2A 3L7PA 4PYDA 3DYAB 4ZP6A 3OV7A 3D6HB 4I7FA 2NXUA 4MFBA 5IM0B 1WOSA 2PMZD 2AW0A 3ILOA 5E41A 4ECXA 2ZZMA 2N7CA 4QWDA 4RW7B 1L3SA 1TL7A 1C0UB 2UU9F 1T9VA 2XZWA 3QFHA 4NLQA 2XLJA 1RI7A 2A1BA 2E7VA 2DNNA 1FDDA 3V4IA 3QRPA 3RRHA 2GV1A 3PRBA 1ICEB 3F56A 2A2CA 3CSKA 1UW9A 3IM9A 4OYZA 3BH7B 2JNJA 3KLFA 2R8IA 1S49A 1BXNA 2FVCA 2YQ0A 5J2QA 2VONA 1FTCA 1U49A 3H42A 4F4YA 1S4EA 3K5NA 5EWFA 2HZCA 2I0XA 2J0XA 2R2TA 3D1QA 4ALZA 3OUYA 3BGRB 3M8RA 5CXTA 1OWXA 2KYZA 3FZ2A 2OPPA 1BQMA 1FNOA 1Y3KA 2VBYA 1DTTB 1OO0B 2KZZA 1PAEX 3T1AA 4DEZA 2EC0A 4KKOB 1WC5A 4WYLA 3ZTPA 4L74A 1Y10A 4USTA 2VA3A 3HSGA 3BS9A 3H7HB 4OX9J 1IKVB 1RADB 1W7WA 1WOOA 2CPYA 2FQQB 2FGCA 2VIHA 3B78A 1JJ4A 1CVJA 3W3SA 3H98A 3TW0A 3T5HA 2V2VA 1OJ4A 1M1GA 2OELA 1Y4ZB 4M5IA 4B3OA 2CWXA 5H9FJ 3OVBA 1RCOB 4DR1J 1NK5A 1VS3A 2P9GA 4Q2LA 1EP4B 3M05A 4K8RA 2ZKUA 4XDDA 4L75A 4C3KA 2HWIA 5BR8J 3PO5A 4ZJQA 2ZBRA 3W9HA 5DO2A 4JYAJ 4DPTA 5CD4A 1MROA 1YLXA 1TAUA 3IO1A 1EIYB 1UVIA 1NDKA 3KLIA 1VQ5S 3ZZYA 2BJ8A 4L72B 5CYQB 5F8GA 1U1OA 5KT6A 3Q8PB 2HFSA 3MDFA 2V68A 2IMOA 3JSYA 4O4GB 4EO8A 1DQAA 1N5TA 1YVFA 2QYGA 3IAS9 1I5OB 3C6TB 2ZBPA 1XMOF 1VIXA 2PE8A 4FNHA 5FD1A 1T03B 1XEZA 1NKBA 2CJYB 4NYPA 5JMNA 1VHFA 1BQMB 2Q6BA 2XM3A 1TK8A 3ETOA 2KO1A 5KFSA 4CLFA 2JEFA 3R5DA 3DI6B 4RO0A 4OI4A 5IQQA 2VASA 4J37A 5B0EA 3RBZA 1RLDA 3KXDA 2DVIA 4GKJJ 5IOLA 2C3OA 1W26A 3KUEA 1TKXA 5FLXY 4FYXB 4N76A 3MCNA 3OL7A 4TLQA 5HATA 1SC4B 2KG0A 1YGYA 2JFDA 1U1KA 2QL9B 4IOBA 4K0KF 1LEOA 1GFWB 1F9EB 2QLBB 3MEEA 4FKXA 4ILLA 4MIBA 3CJKA 1GH8A 2Q3PA 3AFGA 3IWNC 2OIHA 2OSQA 2A2DA 4W90B 5T7LB 2CNOB 2IJRA 2ZDPA 5SUHA 1KQKA 4F3MA 1AXQA 2EKYA 5D0HA 4AL7A 2FZGB 2HRTA 1VQ6S 4PQUB 1VQOS 3T9NA 2DR8A 3K59A 4FF1A 2CJXB 5K5MA 4JI2J 4K4WA 2ACYA 3KKFA 5U47A 2NR0A 4ILMA 1TK0A 1YJTA 4OI6A 5KFPA 4J9MA 4J9KA 2ROEA 3RAXA 3QLHA 1D3WA 2CNNB 1VBYA 1ZM3A 1JK9B 4GO5X 1T03A 5B0CA 1C1BB 2VZ9A 5CQGA 4O4RA 1T7PA 1VISA 3ZZTA 2XMAA 1FESA 3OL8A 2LXFA 2B9EA 3PRDA 3MM7A 1KWMA 3CCJS 4LF8F 3JAMY 2E66A 4B17A 3MOJB 4WU3A 4QQBA 3C66A 3FQLA 1FKAF 2XGQA 4PG4A 1KN6A 1RWNB 3JQKA 1U6BA 4PQAA 3NOGA 4U8VA 3HCXA 5BR8F 3QQCD 4LMZA 2DIVA 4I6WA 4WTYA 2WB4A 5EWEA 3MMCB 2WB1D 1NLKL 2YQ1A 4X66F 4C8YA 4NLDA 1FEEA 4IR1A 5D78A 3PJ9A 1MN9A 2LA6A 5HL7Q 1GT8A 1X4BA 1DY3A 3LP0B 5J2NB 1KRPA 4WF9Q 4RU2A 3HD2A 4LT6A 3QSIA 1TV6B 1CEZA 1S59A 1SH0A 5DQIA 1FWKA 1PJ5A 4ED6A 2LQ5A 2J9CA 3BR8A 1YZ7A 4ECSA 1HPZB 5GAEU 3RJMB 2YWHA 1S5ZA 2BKOA 3Q8VA 4IRCA 2CJBA 3KDNA 4P9SA 5FJ4A 1E6VB 1WORA 1YJ7A 5HROB 3AOBA 5THWA 5F8LA 3MAAA 4NCGB 2BE7D 3PY8A 2VUGA 2AT1B 4X4UA 1LK7A 3SMZA 3K2YA 3OR2A 3FRZA 3TYTA 4NE9C 3G9CA 3CMES 1HBNA 1NAQA 4K4UA 2RMLA 3QT8A 2ZNZA 4BC7A 5C25B 1ZOTA 1FKOA 5CABA 3FGVA 4UZBA 2PI5A 2UXCF 3FFIA 2NQPA 3CCVS 3GJSB 4ZCKA 5JUMA 3H5YA 3BSNA 3Q83A 1N33J 4Y6IA 1TKTA 3R5GA 4FPIA 4NLSA 2QA1A 1B64A 1U47A 1RTZA 1T94A 3OVAA 3HVTB 4Q44A 2FHJD 4A8XA 2GQ2A 2W2PP 2M70A 4NI2B 3PKYA 3VTIA 3GG0A 1G6BA 5EGYA 4LSLA 4DU7A 1VQYA 4M5HA 2V34A 4KFBA 4TY8A 4XIUA 2UXDJ 3DGPB 2E5HA 5L38A 1X5TA 3BSAA 2IAJA 2XYPB 2X1AA 4DFJA 4ELUA 2HHHJ 1RP5A 2H4YB 3N01A 2PGCA 4J7CA 2VJVA 3UCGA 1D8ZA 3F41A 2JSXA 4I6YA 4AE5A 2P2CB 2UUCJ 3GP9A 5HROA 2R7SA 2EW9A 3UFCX 4CO2A 4DN0A 2E9ZA 1XMOJ 2HK2A 1RWUA 3EPIA 1HQUB 3DDIA 4PPZA 3CC7S 1H98A 1H73A 3AQOA 3EDQB 3UN5A 4ZN1A 2J8AA 2OUGA 1FEHA 1HBOA 1Y11A 4H4MA 2V5HG 6FD1A 3MFHA 1VQKS 1FRXA 1V3ZA 2VG5B 4U95A 3MXHP 2Y1RI 2Q6CA 1IM6A 4LFAJ 4CO5A 1PO6A 2CAJA 3FJ2A 2VV5A 2ABYA 1KFDA 1S1VB 3H5XA 4JI1F 2LMIA 3TO8A 1IKWA 3TI0A 2E9RX 2QLFB 2Y8WA 4DV0F 4P73A 2KI2A 4NI2A 4YUDA 3LWMA 1WG1A 2K2PA 2JLFA 2J76E 2OGUA 3KLHA 2QFJA 4JI0J 4LFCF 4OV1A 4LSLB 5GADI 4I64A 4Z2XA 1WI8A 4X64J 4UQTA 4ZPVR 4ZCIA 4J5OA 4NWBA 1IBKF 2DNZA 1C4AA 2N4CA 4O23A 2J7UA 2WAQD 1SQGA 2IHR1 2A6OA 4LFAF 3OSNA 3H2UB 5LSOA 1U4BA 3ISZA 2P8IA 1G7CB 3DLJA 4HKQA 1S1WA 1Z4UA 2G2ZA 4N8NA 1S9GA 1HW8A 2V0NA 4WP9A 4YB5A 5CZVA 1D09B 1RHKB 2WBRA 3L7UA 3TX0A 5CA5A 3V6KA 4A8YA 1N48A 1W25A 3NGRA 1RJJA 4RUCA 4LREA 1N34F 1FXDA 3NAHA 2VQEF 1NEEA 4RW9B 3WIUA 1U02A 2K1RA 2HQFA 4DF8A 2QL5B 1NK9A 1N88A 4K4SA 5KG4A 4M5MA 4OYXA 1EHWA 2E7XA 2DR9A 2YNFB 3G96A 4LSNA 2DT9A 1JX4A 2QFIA 3NAIA 2J9DE 4UY85 5IT9U 3AD8C 3G2XA 1Y5LB 1IBCB 3M6VA 1I6JA 3LP1A 4QJVA 5J1NA 3NL0A 2GMHA 1FKPB 4URQU 3ENVA 2B6AB 2HHVA 3W9JA 3MOZA 3H0PA 4PXEA 3I5BA 4DZ6A 1SB6A 5RUBA 2E29A 3R5JB 2CXEA 1OY8A 3G8QA 5A8KA 3VQTA 4B9MA 5BYRA 5KFTA 2I9SA 4FF4A 3C8YA 2HS3A 1IKYB 1EETA 3GE9A 4LSZB 3GSDA 5I3QA 2V4QA 3JXOA 2IVFB 2VQFJ 3CCQS 1FX4A 2OPRB 1OQ3A 1EJ7L 5M2RA 1UVNA 3F73A 1NK7A 4L6V3 2RILA 1O0PA 3IFEA 2P6TA 1EP4A 1I51B 4NEZA 4O44A 4CO0A 1SKRA 3WX8A 3KK2A 1X8DA 1VDHA 2F4FA 3KYLA 2AYGA 2K3IA 3SFGA 2DGUA 2QMXA 3KLIB 4ITSA 3D66A 4O3OA 5CYQA 1BQNB 3VZHA 3KK1A 2ZOMA 5HSPA 5L1KA 3NKYA 3AA9A 2ATLA 4QU6A 2J8SA 1Q7YT 3MM5A 4ZIVA 2MJNA 2RF2B 4ZP8A 3QZ7A 3E2EA 2H3EB 2W8KA 1PYTA 3ZTSA 2FPHX 3MR6A 4NRUA 3KTQA 1H2UX 2JDJA 4NLYA 4RW4A 3W60A 2ZD1A 4YHHJ 3EE3A 3OBIA 3NGDA 1G1XA 3PNIA 2GNKA 4WP8A 4CWBA 2XHWA 3HHEA 4I2QB 4IDKB 1KD1T 2DHXA 2GO9A 4F4XA 4RBVA 1BC6A 2E1AA 4FVCA 2AKWB 2W9CA 2W8LA 1EQ0A 2KXHA 4F4ZA 1XMBA 2HVZA 3FC9A 2VQEJ 4UZCA 1ZZFA 1PGZA 4X4RA 2UUBF 5DS7A 4ZPBA 1NM2A 4RNFA 2JVOA 3HKWA 4DUZJ 2QJ3A 3EMTA 5LL6d 4JI3J 1VOMA 1U24A 4Z7CA 2P9EA 3OXGA 4A8OA 5DG9A 2GQCA 4RNHA 3A3OB 1H38A 4ZVPB 2OTJS 3ILLA 3ZZOA 2QLJB 3BO2A 3UD5A 2ADCA 1RA7A 1SKWA 1UWBA 2GAHC 3QWUA 3ET6B 1YITS 3DMJB 4NCBA 4USJC 4OIXA 2DXDA 5CD4H 3MM8B 4WBFA 5DZ6A 3FCHA 2AJ1A 4DUZF 2DPIA 2UXBJ 1SIWB 3PYEA 3RYLA 2CQBA 2HQDA 1R89A 3AY0A 1QVGR 3KNGA 5ETMA 1FXRA 4RW4B 5K8MA 1IBMJ 2EPIA 4C97A 5B0BA 2OAUA 2IRUA 4NZ0A 1WTBA 3A3NB 4ID5B 1CJKA 5ETSA 4I2QA 1E6YA 2CQ2A 2M3DA 1T9UA 1KHWA 9RUBA 1YTYA 4B3SJ 4QR1A 2YKNB 2IDEA 2J9DA 3DLGA 3KK3B 3VAMA 3G71S 4RW8A 3G87A 3KJFB 1SL2A 5C24A 5MLCV 2XNRA 1ZTTA 2BQRA 3MMCA 2RHSB 4FYVB 4C8NA 1ZPWX 5GAHU 4B9TA 4HL9A 4ECWA 3UQSA 2RQ4A 4USKA 3UNYA 1ZYQA 1T9TA 3UE2A 1TMMA 3HXMA 2KH9A 3M30A 3TAMA 1CSJA 4X4TA 1VC6A 1APSA 1JKHB 1HWIA 1LK5A 1P1TA 2VKRA 3LW5C 4C8KA 3SV3A 5E0OA 3R9LA 3TZWA 4JI6J 3HM9A 5KG0A 1KOHA 4Y65A 4CDIA 3MR3A 3ITHA 2Z58B 3J80U 2P9CA 4UOFA 3OJSA 2EI5A 4DV1J 4EYHB 1LNQA 2C3MA 3HHLD 1N56A 2EWHA 2ZH7A 5MAOA 2IPOB 5IZHA 3C2PA 3X1LB 1KR4A 4P2MA 2I6WA 4O0IA 1R6VA 2UXCJ 3ONQA 3UCZP 2ZBQA 2B8PA 4IO9Q 3SFUA 1X0FA 2EKNA 3IA0A 2HNDA 3M2VA 3UN3A 3EPGA 5DDOC 2QRRA 4KYZA 4F0MA 2XNQA 4DFMA 5HLFB 1U7LA 3DOLA 3TRGA 2IRYA 3LANA 4NA1A 1N32J 5HP1A 1DQ8A 4EBDA 1FFSB 4O3NA 3SQOP 2E1CA 2KFZA 2CQ0A 2RRNA 3LAKA 3T41A 4DV0J 1CC8A 2DK2A 2KT5A 2NUHA 3E01A 3OXFA 5AT1B 2IVMA 4Y00A 1X9WA 2HHXA 5KAKA 4M1KA 3V81B 4NXNF 3IR5B 4JI7J 3T5JA 4HHJA 2VFVA 1YBAA 2R7QA 1JKHA 1NU4A 4ETZA 1FWLA 3T9ZA 1DTQB 5KG1A 1TFWA 3IP0A 3R5CA 3CGIA 3QO9A 4OHVA 5AE2A 1JLCA 2M7SA 3FQKA 1IWAA 4P72A 1PILA 4F0KA 4DV2J 2L9WA 3Q8SB 4C3LA 2ASJA 3I9V9 2ADBA 1XMQF 2XTJP 1CS4A 4KV8B 4DI6A 3CCSS 3CD0A 4IG3A 2A3JA 3AXMA 1S6QB 5KOWA 5HMZA 4YN3B 4CM2A 2B9XA 3HSJA 3HJVA 1WKLA 3M2VB 3QYYA 3VV2B 1PYSB 5DLFA 3KHLA 1SJQA 4ECVA 3GMGA 2OPQB 3LUYA 4Y28C 3DOLB 3GJTB 3LF0A 3M1VA 3PXGa 1R8PA 3VHQA 2HIQA 1UJ5A 1YJUA 1SPBP 1WC6A 4GVBA 2C3UA 1X9MA 1FRLA 4U8YA 1LXNA 3VR1A 4X64F 1ZAVA 4H4OA 4KKOA 4CM0A 5F8HA 4OI1A 7FDRA 3I55S 4ELVA 1WHVA 3RAQA 4MT1A 1YG0A 2ACMA 3N5FA 4USUA 1F3FA 1R8CA 2JHEA 2W01A 3T6BA 4DR3F 1X9SA 3P6YC 5DG8A 3M9OB 4DL7A 2XMJA 4MKBA 3KOAA 5D4OA 4I67A 4LQ9A 1HBMA 3QGPA 4K2JA 2GJ2A 2CWKA 3M32A 3B6BA 2KN4A 3M8WA 4HACB 4BWMA 2XC9A 1D9AA 5GMEA 4ANDA 1LWEB 4DPXA 3AB4B 2FC8A 2WSCC 1VGYA 1GX6A 2JRSA 4N5SA 1PAUB 4F2RA 4F4KA 2R42A 2R8KA 2R7TA 2KHCA 2FHMA 3AOAA 2U1AA 2HBQB 1VRUB 2M4MA 2ASLA 9ATCB 3OTDA 1FWPA 1C1CB 3VAIA 4HI2A 5DDQC 1S0NA 1Q86T 5IT0A 4ED7A 2E1RA 4IRDA 3G82A 3E51A 2RQMA 2BJ7A 3K8VA 4LSNB 4J9NA 3PV8A 1KQSR 4NXMF 4JI8F 1ULRA 1HA1A 1V5IB 4OYPA 3D54A 3SCIE 1BWEA 5DLGA 4C2MA 1X4CA 2RB7A 3LP1B 4CLZA 1S6UA 1MNEA 2BJ9A 2DY9A 4KAIA 5IV3A 4A8WA 2DO4A 2AIRB 4YY3F 4CI0B 4RJVA 3OFGA 2XO6A 1RTHA 1SL0A 4DN9A 4FDFA 1LWCB 3SBMA 1TL5A 4CLTA 4ES3A 1U1QA 1XNRF 3BREA 5LXRA 3GYNA 1K47A 1LXJA 3IGNA 2DNOA 2W9AA 2B4VA 1VBKA 2X3GA 1MLAA 2EK6A 1UFLA 3ICLA 1S7IA 2MPUA 3CTRA 3R5AA 2W4CA 1HNZF 2LVWA 2MZJA 4PPDA 3CEDA 4F0HA 1TKDA 3BKTA 2YNIB 1EX8A 3MPUB 2OPRA 2Q66A 1G2EA 2CPXA 2CRLA 2EFVA 4WKYA 1FD2A 4C9DA 4LBPA 2N3OA 3U7JA 1OYEA 2M9KA 1RHUB 2ZEJA 4NMXA 4DHVA 5CYMB 1SIZA 5KFBA 4RW6B 4ZPCA 3FEXB 3OR1A 4DL0C 2XG8A 1J5EJ 4OZLA 4TNOA 5KFAA 1IBLF 1F2GA 2GHPA 1GTHA 2IJNA 5KFUA 2LEAA 4DS5A 2FVQA 4WWSA 1HNIB 2IJFA 3A1YG 1NK8A 1P9QC 2H4WB 4NZ7A 2VL1A 2BM1A 2NYIA 5ITHA 3G6ES 1PYOB 2HZVA 1G4CA 4HEA9 4OX6A 3PM9A 2AD9A 2BYCA 1U1RA 3DC2A 2F9DA 3MPDA 1VQSA 2M52A 2DH7A 3R5BA 4MIWA 4NLPA 5D4LA 3U27A 4DV5J 4AQYF 2AX0A 3BGUA 2ZC4A 1RHQB 3LQVA 4CZCA 1VCTA 2NREA 4WU2A 1WC4A 3PJWA 4P6QA 3N0VA 4NA3A 1I3OB 3SXLA 1Q95G 1WI6A 3P45B 4MK7A 2G9OA 5ETNA 3GV7B 2L08A 1QTMA 2PI4A 3MMBB 2V8HA 3D6TB 4Q8EA 1RT7A 2I2YA 4A47A 1U09A 1SC3B 3THVA 2Z30B 1QAXA 1CBKA 1UFKA 5J2NA 3HVWA 1LW2B 4ES1A 4C8LA 2CVIA 4ECTA 2RUGA 4ZVQB 3J7YI 3NCQA 4W98A 2VFRA 4C0HA 2CUYA 3CCTA 4QWAA 4WFYA 3OT9A 2OI2A 1XR7A 4OX9F 1JNZB 1HPZA 3DGVA 1CJUA 3PX6A 2C2MB 2MKHA 1T8EA 1UWBB 3LGHA 1XNQJ 3QMQA 2KKHA 2R2UA 1HD0A 1Z2LA 1LWFB 3H5UA 5LJ5Y 3M8PA 2MKYA 3ENWA 3LP2B 4RWWA 4TU7A 4YR0A 3QFWA 4G1QB 1RHJB 3BYRA 4XPCA 2RRBA 2M8DB 3NNAA 1UW4A 2FHKA 4CLWA 3PYGA 4X4QA 2FJXA 4M5DA 5C25A 2G4BA 1JB0C 3VVTA 2RUSA 4M5LA 1SJ4P 2OD4A 3TVZA 2D1CA 1U8SA 3KMSA 4A8MP 1LW0B 4EEYA 2HWTA 3J7A1 1HLWA 1N0VC 2CPDA 3DLGB 3NGKA 4CH0S 4EI2A 1PBUA 2CYYA 1Q16B 2HNYB 3DNCA 1HQEA 4LF5J 3B82A 4RUAA 1R0CB 4ELTA 3PZPA 3UD4P 3BGOP 2KXFA 2V69A 3BYPA 3AHPA 1URRA 4C8OA 3M8SA 2X7IA 4OZ0A 4R25A 3IBCB 1TAQA 1U6FA 1FRIA 2EVZA 2I1RA 2MQLA 3GILA 4B3RF 1DRZA 3H40A 1RT3B 4ZP9A 5F3ZA 3H2LA 2V8DA 2CG8A 2PMHA 3NRBA 4DV4F 3GFHA 3M9NB 4ZPAA 2G0CA 4EBCA 2PEHA 2QO3A 2R8JA 4DOZA 2YKPA 3TZXA 3DRYA 2ZH4A 4NLGA 2BE2A 3D6FB 1RTJB 4YDXA 5C2CA 1REGX 3TZYA 3VAFA 3Q89A 7FD1A 1VFJA 3J81U 2XMUA 4B3TF 2OP5A 2V9KA 3D0HE 4IH5A 5KT5A 2KDOA 3PTWA 2BUNA 5F8IA 4F7VA 2CQGA 2OEJA 5D4NA 4WJBA 1GMWA 1NK0A 3C14B 3C15A 1RKIA 2MZRA 1S1VA 3SEOA 3P3DA 2W9BA 1UAWA 1B0TA 1T02A 2DGVA 2NS1B 4QYRA 2LECA 3PX4A 3M6WA 1QAJA 2FHJA 1VR6A 3MF5A 5C42A 4UT4A 1MWQA 1S99A 1SV5A 3NWGA 2XB2D 1CPZA 5LMUF 1FJCA 1REVB 5ETQA 1QY7A 4K7QA 3CIMA 3M6UA 3K5MA 3QRQA 1Y0HA 4HT5A 3R7NB 3MTJA 1RBLA 1U8WA 2VG6A 4IFVB 5E3QA 3R7SB 2E5LJ 2AYEA 3MMJA 4HLBA 4Y2AA 3BZQA 2B4PA 4PRFA 2R9LA 2AYMA 1PJ7A 2QX0A 4CRJA 4B3OB 1A9NB 3H4BA 1IBLJ 2MKJA 3I4HX 4LR9A 1NCLA 2LQ8A 1RT6A 2JVRA 3G6VA 3PW4A 4LF9J 5KFQA 1Q5YA 3BQ0A 1ITPA 4BBYA 3MEGA 3TJ9A 4ANCA 3QSYB 2ZFHA 3ADAC 5D77A 4ZJLA 5J1EB 1H6KX 4ZLPA 1HWJA 1S77D 4ENOA 3QT6A 2HKEA 1TVRA 4RW9A 4A48A 3SSRA 4LF5F 4LF7F 1KTQA 3EDRB 4IG0A 4DSKA 1OSDA 1UWAA 3VZIA 1QAYA 4OYOA 1XIQA 2F4VF 4JB8B 3BQ2A 3JTPA 2IM3A 2QN6B 3C14A 4PXBA 3FZBA 2K7KA 4DCPB 2W9BB 2OJ3A 4ZOSA 3DOMB 2BANB 4LFBJ 2HS0A 3AD9C 3DM2B 4RNMA 3CJQA 2FJBB 3R3TA 4R0JA 4PKDB 5DM6Q 4DBQA 4DV4J 1VQPS 1ZM4A 2VH7A 5LSLA 3V6JA 1O5JA 5KFFA 3BSCA 4XO0A 1RQ0A 2CDQA 4QIGA 2BEFA 3C6TA 1Z2ZA 3RR8A 4O0NA 2BABA 4GMKA 4IFVA 4P2SA 1DLOB 3V2UC 1ZA1B 3UVJB 2DB1A 2HAIA 2Z2MA 2IA0A 3D9BA 2LU2A 3MUVP 1N33F 3GPAA 1NPRA 2HQCA 1U48A 3HPOA 3GU0A 2D3ZA 2G1DA 3GFZA 1FE4A 3I87A 4J90A 1FVSA 3CJKB 4C11A 3W1YC 4DXLA 4ED4A 2C3YA 3HZEA 3NGSA 1R31A 4LVOP 1HBUA 2LQ9A 4I2PA 3KK2B 4DL4A 4QU7A 1SJ1A 4FXVA 2D69A 4A8KA 4J9QA 2MYFA 3TA0A 5H1SV 2FLLA 4P75A 5FIIA 3I0RA 2O3DA 1SJRA 4KGKA 3J80Y 1Q8KA 4ECRA 2PA3A 3RBEA 1FHTA 1BQNA 1FF2A 1WKKA 4Y2KA 4LRFA 3BKUA 5A76A 1Y3JA 3BDPA 4OZNA 1UPMB 1KOOA 2DXEA 2PDAA 2C28A 1FDBA 3QJPA 2E5LF 3OLBA 4DWIA 2NXCA 1Q4RA 3D0GE 1WG4A 1HHSA 4OMFG 3T6JA 3DM2A 3RB6A 1Q8IA 3EGVA 1YI2S 1XNRJ 1XN9A 4WFXA 3P4UB 1Z1ZA 2QYCA 4NZ6A 2CQ1A 2BW7A 1S9EA 3RB4A 3QWPA 1FNMA 4HH0A 4UOCA 1A0OB 3QT5A 5DETA 4DV3F 1NK6A 2DR7A 1WACA 3BB5A 2P6SA 1A6LA 1JJCB 2HEKA 1T11A 2V63A 3BN4A 3FVYA 4IYQA 4JUZA 2UUWA 2X51A 4RKUC 4JYAF 2BX6A 3DRSB 2W2QP 4ZHRB 3CMAS 2XS5A 5IXUA 4MK8A 2RSQA 2WW8A 1NUEA 1UVMA 5K14A 1IUJA 1MMLA 2F63A 5B0DA 2XS7A 4F4WA 1EQMA 4F4AA 1HMVA 2HQGA 3PR5B 2CZ9A 4WFZA 2B7BB 4ES2A 2BJEA 1X4DA 2EFQA 4I2PB 2AU0A 1QSLA 2A6MA 4LRCA 2ZM6J 2UP1A 2R7XA 1JIHA 3CC2S 4BHQA 4EUVA 1HWKA 1ZAWA 2NYHA 4ED8A 1YQHA 2ATCB 4WYWA 1QE1B 3FUYA 1IJEB 2R7VA 2ZE2A 1Y5IB 5ETLA 5KFJA 2QG9B 5B0AA 4FYWB 2ZJPQ 5J2MA 3DMJA 3TAQA 1CQNA 2WSEC 3OHAA 3C6UA 4WPAA 2N3LA 2UUAJ 3I31A 5E3CA 2CQ4A 2V9WA 4X62F 1Y5NB 4DR6F 4QIWD 3EZUA 4DR4J 4CH7A 4Y2CA 4PG6A 1S1UA 3SV4A 1CULB 1RT1A 2WK4A 3DU6A 3PR4A 1SC6A 1WHWA 3L4BC 2ROPA 2P5VA 3CMQA 3MD1A 3FBCA 4LR8A 2QA2A 1OY6A 3GYGA 3DHXA 4LUBA 2HG4A 1R8HA 2JFKA 4RW8B 3V4IB 2J6UA 4MJKA 1TUVA 3HT0A 5IC6B 5GAGI 1QSYA 1GMUA 3WZ0A 4PXDA 2QIFA 4AT1B 5IT4A 4I56A 3EWGA 3VAJA 5A8RA 1N32F 2CA9A 1NHVA 4OFZA 2YX1A 3W64A 3BGLA 1PG5B 2OD6A 1R27B 2U2FA 3M30B 5GVQA 3C19A 5KFRA 3BEGB 3SI8A 1RT5A 3KDOA 2AV5A 1RYRA 3SCJE 1TZ0A 2Y9HA 4LF8J 3VF0B 1OS5A 2VDIA 3F0NA 2E1MC 2C2OB 2EBGA 2WVEA 4GRSA 4CT9A 6FDRA 4F04B 4URGA 2GW8A 2XO7A 3I56S 3RR7A 2LQBA 3MD3A 2HRUA 2WOMB 4QWEA 1GMVA 2F4VJ 4KHPJ 3DYAA 4ZLJA 1T3NA 2DNPA 2YX7A 4DU8A 4JI8J 1RAOA 5HQLA 2G2OA 2IYIA 2BR0A 1QAIA 3MEDB 2IBKA 5FDLA 1OQ6A 1SVDA 4KGXB 3BBFA 2KM8C 5M2UA 3DRRB 3HMJG 2NSBA 4HHUA 1SH3A 3ENAA 4USVA 2X1GA 4G1IA 1LW0A 2AP6A 1VLOA 4P74A 4NX9A 1B7YB 2J5AA 6AT1B 3J7Z5 4QYZK 3FCVA 3Q2SC 4GVLA 1IBMF 3KLFB 2FJEB 4DZDA 4OYWA 4WK3A 1U2CA 2LEPA 4AXJA 1ZZNA 4Q0BA 2Y1JA 2CPEA 1XJWB 3DDKA 4HDHA 4LBIA 4NLVA 5GMDA 2HW3A 3C16B 3EGWB 2UUAF 5J2QB 4B9NA 5IT9Y 5HVFA 1NPKA 2OPPB 4DR6J 3O8WA 2BDPA 1BD6A 1P27B 1WWHA 1RT3A 1ZM9A 3I0SA 3GB0A 4OJ3A 3TP2A 4CLKA 4DX5A 5B08A 3TUZC 3W7BA 3G4SS 3OL9A 4DR7F 3NG8A 2HLTA 5KFGA 1RBOB 2Z56B 3D3BJ 2AJ4A 1DFDA 4FP9A 3K0JA 4DCJB 3AODA 2CJ9A 3AJ2A 1S6OA 2IYGA 2KHDA 1SKSA 1AROP 1FRJA 2AGQA 3A8KA 3K89A 1BUXA 3P96A 3PIOQ 2CPFA 2GIRA 3IXQA 4UUWA 3ZZRA 2DIUA 5E3AA 2H48B 2DNYA 3TUIC 4C48A 1QVFR 3T1YF 3RB0A 1HD1A 4CO4A 4GKKJ 2OPQA 3IWXA 3W66A 1X5OA 3N6MA 3A4TA 4UW2A 2HNZB 2GIQA 3HKZD 1S7HA 1RWKB 4GO7X 3PKMA 2BZ2A 1NJIT 2KRRA 2UUCF 3O44A 2YH0A 1MU2A 1IXKA 2VFSA 3FSYA 4IKAA 2IMWP 2R2SA 2CJKA 1MMDA 2HGLA 2MZ1A 3PFEA 3J7YU 4KH1B 2ALZA 2ZVSA 2LXUA 1UKUA 4NYOA 2R2RA 1FKPA 2BJ3A 3BPDA 3IRXB 3AJ1A 5A2QY 1R0AB 4RL1A 2AJ2A 2AGPA 2BXJA 4M94A 2FC9A 4CLSA 2CQPA 5L1JA 1BY9A 4CYUB 1UJ6A 3KFWX 2Y1LB 4NOHA 5A8KB 2C3PA 4ED1A 2HHPA 5D4PA 3BV8A 3CJTA 2Y3YA 1D1UA 4JI1J 3NMAA 1MW7A 2V2ZA 1H2VZ 1M1HA 4W92B 1JLBA 5IQ6A 5LSRA 1NB2A 5F0UA 2HRYA 4FPRA 2VB6A 3MECA 1JLQB 3G86A 4DV2F 3HJFA 3MM5B 4J91A 2PSZA 2RF2A 2CJQA 2OTLS 3BPSP 2FGOA 1WEXA 2DGSA 2GHWA 3IR7B 3W5ZA 1IBKJ 4YOEA 3CUNA 1Y7PA 4DL6A 4OHWA 5K8OA 4FYYB 4Y0FA 4UY8T 3X3UA 1HWUA 1TL1A 3FK4A 8RUCA 1VQ8S 3B54A 3DLKA 2WONA 2Y0BB 1YJWS 1U2FA 4DFKA 3TANA 4DLEA 1ZPVA 1RU1A 3CNQP 2ASDA 1GMWD 2JOQA 2XSJB 3GSIA 4QPXA 1T9WA 1GK8A 2VICA 4ILRA 1NZAA 5D0GA 3TJ8A 3PX0A 3CCZA 4FF3A 3L95X 4ICLA 5DDRC 2HPUA 3SCLE 2DJWA 4Q5VA 2DO0A 2VG7A 4HYKA 4BDPA 1W2IA 2DNGA 2ZOGA 2YQ3A 1H7WA 5HO4A 3QLHB 4IDKA 3M4XA 1C2PA 1PJ6A 2D3UA 1M1KT 1HNXJ 2XCAA 4RX6A 4K59A 1KSPA 1QUPA 1S1TA 1U0HB 3P5TL 2C2EA 3OR1B 4I68A 5LXYA 3HD1A 4ZA1A 1SUQA 2V2KA 3E3XA 4O3QA 5L9NA 4F2SA 3DLEB 4FXDA 2HHTA 4C98A 3M2RB 1JLQA 1X4GA 2MY8A 4IFYB 4ZPDA 1VK8A 3UR0A 3HO1A 1NH8A 1M5OC 1SC1B 4OQJA 2D41A 2UVRA 2JLGA 1XQIA 3RG6A 5HANA 2F8MA 4KGVB 3MM9A 1ZH5A 3RBDA 4ZVSB 1JJ2R 2KT2A 3EGNA 3D0IE 3OHBA 1IM4A 2RDIA 3DN9A 4TU9A 3EZ5A 1AFJA 4L3NA 1JLEA 2HLUA 2V94A 3NBPA 3JSBA 4PUOB 3KNAA 4NXMJ 3KLGA 3OTOF 3PO4A 2OEMA 2G1HA 4EZ9A 1V3RA 3RZAA 2JC0A 1B70B 4KB7A 3L3CA 1F5CA 5D0EA 3G8SA 2MHEA 3K7RA 2HFOA 3CDUA 2LU1A 2HMIA 2RE1A 3RW6A 4X4NA 1SJFA 3L09A 3DHWC 5DZ7A 4B9SA 3JQMA 2QGFB 4TY9A 1S10A 1AW0A 2AZ1A 3FMBA 5BYSA 1K0VA 2DGQA 3OTEA 4YB6A 3CJ4A 4ZN3A 3CT9A 2BJ1A 2CDRB 2C22A 3CW2C 3RW7A 3BSOA 1F1BB 1FKOB 2EFPA 5IWAF 4AL5A 1KLMA 4OYIA 2MGZA 5ETRA 1AUDA 1FFGB 5D8HB 4YHHF 2HGMA 1U45A 3CD6S 1ZETA 3HHNB 1D0EA 2POKA 5AXNA 4H4KA 3IRWP 4LF6F 1R6YA 2ZWPA 3ZXWA 2WHOA 4OX7A 4DR4F 2M0GB 2DGWA 4CCHA 1BE4A 1WG5A 2FUG9 2DHAA 4HH1A 5HVHA 3MM9B 1JLGB 4XK8C 3BM7A 4JI6F 1CG2A 2GS8A 5I4MA 2RU3A 1OPZA 4H4KC 2ZJRQ 1IQZA 2R7OA 4NYZA 4EU0A 4PG8A 4J9OA 1IR0A 1WC1A 2CPJA 2GFFA 4TY8B 1C0UA 5C7PA 2H1YA 2FJWA 5BXIA 4LFBF 2YKQA 2E44A 4MH8A 1HWLA 4BLGA 2F7VA 5HLFA 1NK4A 1N54B 1M5KC 1NKEA 2V2QA 1B4SA 2BE9B 2MEWA 4HTIA 1T9YA 2BM0A 4JBCA 4J9VA 2ZDOA 3DFEA 2N4DA 3JS9A 5CHCB 3UDVA 3VCDA 5AE1A 4JI5J 1F3VA 4IOAQ 2RH3A 2WVCA 1GQEA 4DPYA 1NHUA 4P7VA 3W9IA 2HNDB 2YNHA 3RRKA 1UA0A 2Z2ZA 2EBEA 4CNZA 2AYBA 2RU9A 5AJ3J 5I42A 1L5UA 1VQ7S 3AOCA 3DXBA 1ELOA 4NLRA 2VOOA 2MSTA 1AZSA 1TQLA 4KRWA 4YDDB 1IKWB 2L48A 2DHSA 2QL7B 4KY3A 4NRTA 4Z37A 3MWBA 2UVVA 2IRXA 4E2FB 4RLEA 1UVKA 3KHHA 2JEJA 3OLAA 2C2DA 4U7UK 1L3KA 1IR1A 2LDIA 3MAQA 4JI7F 3OTOJ 5KFDA 5DQHA 1HI1A 2D3OR 4PABA 4BCAA 4DDFA 1RTJA 2HYIB 2VPXB 2NUUG 2V6AA 3PACA 2XHCA 3SSQA 1NJZA 4G65A 4KSEB 3HHLA 5G0RA 3QIPB 1DTQA 4P71A 4RBUA 1K73T 3UW1A 3M6XA 4FBTA 3MEDA 1D9FA 1YJRA 1RK8A 5L1IA 1YJNS 3FDSA 3VGUA 2UXBF 1OSCA 2H5IB 2NXNA 3FBFA 2BACA 3NS6A 2DNKA 2GC8A 3WHIA 1R3NA 3M8QB 1EKRA 2CJAA 5KFXA 2H65B 1WC3A 3AB2B 3T1HJ 2BOPA 3M7VA 1S9GB 3WBZA 4DR5F 2KU7A 1G3OA 1WDTA 1WF2A 4RNNA 3G6XA 1V5VA 4HHHA 2GGPB 4TVAB 1X60A 3C16A 1K0TA 3L7OA 1GNKA 4IOCQ 1AZSB 1YKWA 4KR0B 5E3RA 1HL6A 4Y2IA 2JWNA 3IG1A 4RZRA 4DQQA 5ADZA 5CAAA 4O3PA 2ZHOA 5JXSA 1RBAA 1VQ9S 4PYAA 1DURA 2JEGA 3S01A 1WUUA 1I1GA 3ZO7A 2W4PA 3ETMA 1ROFA 2FZKB 1KNZA 3QGGA 3PDNA 3EX7B 3DRPA 3MCSA 1PIEA 2WVBA 3CJ0A 2AEFA 3D3CJ 3EM1A 3VAKA 5DG7A 2WZ1A 3HI9A 1NKCA 3SYZA 2NZCA 2RAQA 4ZMMA 3O1LA 2LEBA 1VRTA 1TVRB 2QT7A 4KJIA 2JJ4D 3H5SA 4HTJA 4RBTA 1YSJA 2C2ZB 4DG1B 3TOQA 3CE8A 3ZTOA 4DUTA 2DR6A 3BBBA 4ZCLA 3LWLA 2JX2A 5D0RA 1IJFB 5I3PA 5T7LA 4B9UA 1Q5VA 4DMZA 2IY5B 1ZBTA 2WW4A 2LXIA 3PYDA 3MEEB 4USMA 4OI2A 2B5JB 3BDEA 2PMWA 2N82B 4J9SA 1RAJA 3MI7X 1RTHB 4PWUA 1PSDA 3JTOA 2IA6A 3LA0A 1YBUA 1LKZA 4JI4F 1FO1A 1TUWA 1XTZA 2RKIA 4QWCA 2LA4A 4HR2A 4Q43A 4YQWA 1NB7A 1KEKA 2BQUA 1LFPA 5KFCA 1F5AA 3MURP 2KFYA 3KK1B 2BQ3A 4QBUA 2V4RA 2E9TA 3EYZA 2D7SA 4WE1B 1KLNA 2E5JA 3IG1B 3OD2A 2ZHAA 4O3RA 5DJBA 2YKMB 5LMUJ 1DAXA 3JSMA 1RWPB 2XY7A 1R8AA 1AB8A 1SBRA 1YZ6A 4CYUA 5FLXU 1GX5A 2AJ0A 3M2UB 3DRPB 3HDSA 3D28A 1DZ5A 5E5NA 2DNLA 4RW6A 1IR2A 3T1HF 3FEYB 1VJQA 2W9CB 3O5TB 1DJ0A 4LF9F 4DSIA 2R7UA 2ZWOA 4DQSA 2ZH5A 4ECUA 5A8WB 4R5PA 4DF4A 4NPOA 5CYMA 1QLNA 3I9ZA 1JLFA 1UTAA 1X0PA 2OKQA 3I6PA 1FK9A 3OQ2A 2O5DA 3HSZA 3W2VB 5IS2A 2YBVA 3D67A 1Q1KA 2B5JA 2YX4A 3OPKA 2YTCA 4X62J 3J7ZT 2RIJA 1E6VA 2RDDA 1N36J 3HLUA 2WVDA 2F65A 1C0TA 3LTOA 4LFCJ 3OR2B 3PRVA 1U25A 4B3MJ 4AUKA 4JP8A 1F9HA 3MMBA 4M63A 3EVOA 4ZHRA 4CH1A 2LP4A 2MLZA 2VFTA 1PC5A 3ELHA 3MAAB 3KG1A 4A4JA 5AXMA 3W2WA 3MM8A 1OY9A 5HQ8A 3Q0AA 2KB2A 5ETVA 4G1PA 3W5XA 3R2CJ 4ZVTB 1IWGA 3PYFA 2DGTA 3CCUS 1S1TB 2EK1A 2I5JB 4F50A 1NH7A 4DPUA 1N6QB 2AJQA 3H2VE 1CJUB 4F02A 1QUVA 4DSFA 3SZ2A 1TKTB 4RPFA 2CG4A 1T95A 2ZNYA 1N52B 3M9MB 3CCWA 1LWFA 3QGHA 3T19A 4JI2F 3W61A 1J27A 1UZHA 3GYXB 1XWLA 3LP2A 3C46A 4UQGA 4I7FB 4KPCA 2KXNB 2UVUA 1XK8A 4NXNJ 1M90T 4IH6A 4ZIWA 4ZVOB 5DM7Q 2LCWA 3EUNA 2R3VA 4ZVHA 4KO0A 1TL7B 4XAKA 4FS2A 4K50A 2MDAA 1CULA 1B0PA 1YRXA 2CZ4A 4AYBD 1RYSA 4C4WA 3NMRA 2HVHA 4ZP7A 4MFBB 5IM0A 2AF6A 3CJ5A 3RB3A 2GJIA 2NXEA 2MJUA 1HQUA 2JC1A 2FYXA 3W8PA 2APOA 2DXFA 4ECZA 3KHRA 1J5EF 1OMSA 3K8WA 2VBWA 3R97A 2E1PA 3EVWA 5B0GA 2E5GA 3RU0A 2OPSB 2ZKTA 2CQIA 2WBMA 2L9DA 5A2QU 5LMNJ 4B9LA 1RT5B 4F26A 3O3LA 4X2BA 2IC3B 3B4MA 1N6QA 1X31C 2BV3A 3T5KA 3JB9k 2XMWA 1Q53A 5K9FA 4NASA 4DL2A 3HVAA 5KOXA 5H9FK 1KVIA 2BE2B 4U67Q 2LYVA 4K5SA 4UF4A 3SCKE 1SKUB 1UL3A 5DDPC 1ZM2A 2JLEA 4DSLA 3TUPA 2BMBA 1L3UA 4X4VA 2XMMA 2GQQA 4RUHA 4J9RA 3D5MA 4DR3J 4TYBA 5BJRA 3QO9B 2DCUB 2GVDB 5HBMA 3HK2A 3KLEA 2MZTA 2ASYA 2MZQA 2DKOB 2G0IA 5E3PA 2LDYA 3M8ZA 3OFHA 1SQEA 5ETPA 1SXLA 3FRYA 4HVZA 2QV6A 2W24A 3ULHA 5L39A 3CCES 1MROB 4K4ZA 2HVIA 2QSWA 4OZ2A 4MKYA 2L3MA 3WIVA 4DUYJ 1S1XB 5AJ3F 1PBAA 3P8BB 4FZVA 4YMEA 1NSKL 4YS2A 1M5VC 3THTA 3OTCA 2A0FB 2K1RB 4PEOA 4N7TA 3VGVA 5D3GB 1RXOB 1HNXF 2YWEA 2VOPA 3G6YA 3PJXA 5C42B 4MKAA 4AXIA 2MQOA 3RUBL 2HHQA 4WP3A 1REVA 2CFXA 1J5OA 1A7GE 2HVEA 1WD6A 5K8PA 1U1NA 1VBXA 2VG6B 1HR0J 2FTRA 4OZ3A 5HQMA 4OHZA 3Q8RB 3LOUA 3PW0A 1DARA 3QATA 4USWA 2DNQA 2FDNA 4YB7A 1KQFB 2COLA 4YR3A 4JV5F 2PC6A 2KZMA 3M32B 2HZAA 1BWVA 3CDWA 4UOGA 4X4PA 4USHA 4IG0B 4V19J 5HBMB 3Q22A 5JVGQ 1H7XA 2GJFA 2VPZB 4G6VB 3PW2A 2YWFA 1TKXB 3PG9A 1GXLA 3NNCA 1YIJS 1KONA 1S9FA 1R8BA 1YDLA 3AD7C 4MAKA 5J1EA 1HNZJ 4ECQA 3DOMA 4FKYA 1P1LA 1Q81T 4DV7F 5KT3A 2IFXA 1TK5A 4U7CA 1UMJA 4NLTA 3UI3A 5KFHA 1S72S 1QSSA 3A12A 2FIUA 4EK2A 5GADU 2RNEA 1LOUA 2MXYA 2O66A 1RISA 2PFFB 1TL3A 1B99A 3ISND 5E2QA 2MKKA 2ZBCA 2ZITA 1RWXB 3IRXA 1NPPA 4Q45A 1R0AA 2C2KB 1TFYA 3EXCX 1NHKL 1X7VA 1Q79A 3FSXA 4FS1A 2GAGC 3NY0A 1RAIB 1VHIA 2H9ZA 3BH6B 5EX0A 4E8UA 4KIAA 3UDLA 4M8LA 4N8OA 2ZD1B 2XWYA 4C0BA 3BO4A 1DLOA 1LWCA 3UVJA 1NNDA 2B4UA 3ENQA 2FZCB 2EFGA 3VAHA 1I94J 3VGTA 1UJ4A 4DSEA 4MKVA 4B02A 4DG1A 5DGBA 2MQPA 4K0KJ 4M5GA 4K4YA 4QZVB 2ERRA 3S7RA 2DR5A 3TVKA 4ZVEA 3K5PA 1TV6A 4YEAA 2VDHA 3TNVA 3KMQA 4ED2A 1TR0A 1WDDA 2ZUGA 4ZVGA 4WFBQ 1TL1B 1PKUA 3EVMA 3MEKA 1BLUA 2F8HA 1TTHB 1RB0A 2HWHA 2LFVA 3I32A 3MM6B 3R7BB 4KE5A 5ETKA 4DS4A 2FVSA 5F8JA 1JLAA 2M5YA 3V5RA 2RKIB 3SDEB 1HR0F 3GCWP 4NL5A 2EEYA 3N5BA 1YK9A 3CDAA 3N4WA 4KGZB 2MKIA 1KP6A 3ET6A 1F2HA 4MK9A 3WX4A 2HK3A 2J6SA 4RR5A 4QCLA 3DKDA 3T3FA 5K14B 1HNWF 2YKMA 3GJQB 4YR2A 1UEUA 5KFKA 2XBPA 4C8MA 3ZZPA 5A0YB 3HFVA 3UDEA 1PCAA 2ZH3A 4V1Ak 1Y9OA 3KK3A 2QLWA 4WFAQ 3U1NA 4EBEA 2GMLA 2ILZA 3NGUA 4TKTA 3D6MB 3MMAB 4MYTA 4N47A 1T05B 5I3UA 1E6YB 3JAMU 4IQMA 1EAYC 3VQSA 1XR5A 2DHGA 2XI3A 4OZ5A 1HI8A 1T3OA 4QW9A 3CJRA 3QBCA 1IN0A 4USIA 2CPHA 2YWGA 3V6HA 3GR1A 4KFBB 2W2OP 1CC7A 4FYDA 4P2FA 1BHNA 2RT3A 3TAMB 5K20B 2D3O1 4NCAA 4M5JA 5A6PA 3NEKA 1XMQJ 4U6PA 1SJ3P 4LF6J 1TKZA 3R2DJ 1RTDB 2YNGA 3TZZA 1N36F 1X5SA 2DPJA 4EZ6A 4DV6J 2XY5A 2VA2A 1TP7A 2KTQA 1JLEB 3A13A 3NBPB 4A46A 4OYMA 1S57A 3AXKA 3MPVA 2YPZA 3H4DA 2DEIA 1WTFA 2DRDA 5EDWA 3PEJA 4ZDNA 3E8OA 2MQMA 3S6EA 2NCKL 1U6ZA 3AJDA 2XY6A 4O3SA 1RT4A 3MCMA 1UEVA 2F40A 4URSA 3HHLC 2VG5A 4LR7A 4I4BA 3NNHA 3QRRA 1RT1B 4JI5F 3GIKA 2LLZA 3IGVA 3CF5Q 1NDPA 2AGOA 1ACMB 2VPYB 4DQPA 1BQXA 4JI3F 1K44A 1ZAXA 2DNRA 2HQ3A 3KJQB 4RW7A 5CH7B 5L8RC 1RUSA 2W7PA 3MGJA 3JSRA 3MMAA 3D2WA 3IBWA 2PO4A 2ZJQQ 1H72C 3QPIA 4OYAA 1P9YA 2MMYA 3ZZUA 2B8QA 2J6TA 1S48A 3BKFA 5EUHA 4GKJF 4C8ZA 4LRDA 4KHMA 3UCUP 1L3VA 3W62A 4JOUA 2VQFF 4K5RA 1WKJA 1HW9A 2R7WA 1WSRA 1NDLA 2BRKA 3L9ZA 4TN2A 4ZKAA 4ANEA 1GTEA 4P7TA 3OUYB 4WFNQ 1HNWJ 5L46A 2GA7A 4C0OC 3DLLQ 4LBHA 2J0QD 2LKZA 5KFNA 5JVHQ 1VQ4S 1CS4B 2HFNA 2PN6A 4DR2F 1URNA 2KVIA 2XZTB 2ZVIA 3Q24A 2HURA 3GR0A 1JLCB 1FVQA 3FCWA 4DX7A 2F1FA 5KT4A 4Q0BB 4KTQA 2DNHA 2DY1A 3BQ1A 1UA1A 3MPWA 4KV8A 2YNHB 1EARA 5LMNF 2DGXA 3DRRA 1Q7LB 2OPSA 2CADA 2YWKA 2N7YA 4LIWA 5HJXA 5KG2A 4LF7J 5EN1A 3HSDA 1RWMB 1XERA 2DYAA 3CCLS 1OYDA 4EO6A 1BMQB 4GVBB 2BRLA 2MQQA 1X5PA 3CXCR 3GV5B 1K9MT 2B6AA 4R0EA 1SV5B 2I8EA 3GIJA 2V8PA 4CIOA 2OO4A 3NP5A 2DRBA 3M1VB 2HHSA 3UO0A 1WC0A 2Z0GA 5F9LA 2NXJA 1KVKA 2HGNA 4TXSA 5KG7A 3GIMA 1VYAA 2B7CB 3T5LA 5DQGA 1FERA 4M95A 4X84A 2HS4A 2B43A 2HBZB 3I0SB 4H4OB 1J2VA 3HHLB 5G0RB 4CP5A 2B0GA 4DR7J 1RAHB 2KT3A 1P6TA 2GVDA 4B9VA 3MHYA 2PD1A 3C3LA 2RS8A 5LM7E 1IKYA 1EETB 1Q8BA 1QD1A 2CQ3A 4X65F 3J81j
chains in the Genus database with same CATH topology
3JTNA 2MKCA 1XBWA 1H0HB 1LWEA 1NO8A 3ISNC 4O44B 3MEGB 3N6LA 5KFIA 4YOEA 2OFHX 2PT0A 4NMLA 2DGOA 4DQRA 1MU2B 4NLUA 1HI0P 5J2PB 3KHGA 4ZPTR 3Q8QB 3WC0A 1JNRB 1FA0A 2AX1A 5D3GA 2XGPA 4N56A 4DL5A 1RA6A 2HNZA 2OMLA 5F41A 4XPEA 2ZH9A 4F67A 1Q82T 2V8GA 5K8NA 3SQGA 2FVPA 1JWWA 4NA2A 1DHMA 4QYZJ 3TR5A 3Q2TC 4IUFA 2ZH8A 2KJWA 4XDCA 2XWXA 2XCPA 1R43A 4EFAC 1VRTB 3IS9B 3CCRS 2UXDF 1O8BA 4PWDB 4RWXA 4X4SA 2B9WA 2Y1IA 2DITA 2W4DA 4AFFA 2XSFA 3HHDA 4D3HA 2RDJA 4RU9A 2EG2A 4R8UA 2XI2A 1FD8A 1WEZA 2RD5C 2FY1A 2DD8S 5B7WA 2EG1A 3KG0A 3DLKB 4LVNP 5HMXA 1FTRA 5DRKA 4ZVFA 2ILYA 1M5SA 5LT5A 4CO1A 1N5VA 3I5CA 5J2PA 2XLKA 1F0XA 3GFXA 3H59A 1HYSA 4MTPA 4WE1A 1HNIA 3ZZZA 5M2PA 1L3TA 4DLGA 4ID5A 4WXOA 2CPZA 3LGNA 2X1BA 3CDBA 1VJWA 4MIAA 4Y3CA 1KVJA 4OHYA 2GX8A 3WDOA 1I94F 3FFIB 4ED5A 1KQGB 3LGMA 3VALA 3IS9A 4NCGA 2YKNA 1FDNA 3I4PA 1LQ9A 1LFWA 2DCLA 5C24B 3IAM9 4ATNA 2HQIA 3DRSA 3TVYA 3OVSA 4Y2MA 4HI1A 1YHQS 2IM0A 3US5A 2VPWB 2M2BA 1SUQB 3V4MA 4J9LA 3MM6A 2Y0SD 3AQPA 3M2RA 4JV0A 2IAJB 4FVMA 4JV1A 5T14A 3B4DA 4OLPA 3HVTA 3OXLA 4PCQA 3SDEA 3M8PB 2HHHF 4OJ1A 2AJFE 2YH1A 4KT0C 1KHVA 3TUJC 4DFPA 3HVRA 4OJGA 2OSRA 4DL3A 4ZPWR 3OTBA 5GAEI 1R7IA 2RVJA 4PXCA 3C6UB 2KRBA 3QZ8A 4U9RA 1FJEB 4K4VA 4PUOA 4TU8A 4QW8A 2KJVA 3PW7A 1DQ9A 3RTVA 4H4MB 3THPA 1VQLS 4LJMA 3VAGA 5SZTA 1T05A 3MAHA 2X1FA 1HQEB 3DLHA 1RGVA 2CVEA 3U02A 1WF0A 3CDEA 2KZMA 2PIIA 1Q8LA 4DJBA 1V9OA 2MQNA 3FMWA 3IWLA 5HP1B 4OJHA 2RS2A 2B51A 1K8AT 3GFYA 2QSFA 3NS5A 2ZHBA 3BR9A 5EX3A 5KG3A 2J0WA 4ED3A 3KG4A 2J9EA 1JLGA 1N5QA 2KYXA 2ZBIA 1K1QA 4DV6F 2VODA 1GXUA 1S6PB 2CIMA 4E0DA 2CPIA 2IM1A 4BC9A 3CJ2A 1DTTA 4IG3B 1RT2A 5KG6A 1JMTA 1S6QA 2ZM6F 1S1WB 4FBUA 1RT4B 3HZGA 1M5HA 1W2BR 2K8GA 2R8KA 2NLWA 2DBBA 2VC1A 3TQ1A 1IKVA 3OL6A 3AH6A 1S0MA 4WCEQ 2GO8A 3FEZA 4TLRA 3OW2R 2EFNA 5I42B 2R8HA 3OJUA 2QA4G 1FCAA 2VBXA 2XEXA 3EXYA 4ID8A 1FRMA 2UVWA 4CO3A 3MUMP 1IKXA 5GAGU 2MB0B 3MR5A 4EGLA 2YNFA 3H8YA 4QIVA 2DH8A 3JYTB 1ZTWA 2F8EX 1IQTA 1UP1A 4CT8A 3QAUA 2QZ8A 2D74B 2ROGA 3S1TA 4Q7AA 3BGFA 1VQMS 2O67A 1RKJA 3MZIA 1YJ9S 1N0UA 3TAPA 1S4FA