The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
58
|
sequence length |
170
|
structure length |
170
|
Chain Sequence |
ALMNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLME
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb |
| source organism |
Pseudomonas aeruginosa
|
| molecule tags |
Signaling protein
|
| molecule keywords |
WspR response regulator
|
| total genus |
58
|
| structure length |
170
|
| sequence length |
170
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2009-07-03 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits |
