3I5BA

Crystal structure of the isolated ggdef domain of wpsr from pseudomonas aeruginosa
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
170
structure length
170
Chain Sequence
ALMNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords WspR response regulator
total genus 58
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i5bA00
4TXSA 1REVB 1J5OA 2WTFA 3QZ8A 4IG3B 4NLSA 1OS5A 1S6PB 4ECWA 1QUVA 1T05A 3CJ5A 1FKOB 3DRRA 1T03B 4O44A 1S6QA 2BQUA 3GIMA 3NAIA 4JUZA 4MK9A 5D3GB 2E9RX 5DQGA 3Q8SB 5J2NA 4EYIB 1RYRA 4NCGB 4R5PA 1UWBA 4KSEB 5CYQA 3DM2A 4ZPDA 1RT2B 2UUTA 3UDLA 3DOLB 5C24B 1BQNA 2C2RA 1HARA 4KFBB 1N6QA 4IG3A 2ZE2A 4TY8B 4ZVHA 5T14A 4ECVA 1S6PA 2JEJA 1RTJB 1IKVA 3ITHB 1HMVA 3T5HA 3PW2A 2R2RA 2RKIA 3CDEA 2YKMA 5F8LA 3KLEB 2R2SA 1JLCA 5EWFA 3MEGB 2WK4A 2W9BA 2XGQA 4ECXA 3MTKA 4ZPAA 4WE1B 5FDLB 2J6TA 1TV6B 3KNAA 5KFGA 1HYSB 5L1KA 4Y34A 2CJQA 2R8GA 4Q0BA 1IKXA 3KHHA 4Q8EA 2D7SA 4DG1B 2C2DA 3MR6A 2AX1A 1JLFA 3E51A 1SUQA 2D3UA 1JLGB 2ILYA 1JLCB 2OPRB 2WOMA 3ISND 4GC6A 1T94A 4IDKA 1RDRA 4MIAA 5KFUA 1S1VB 3UPFA 2W9BB 2FVPA 1TKXA 1S10A 1S1UA 2ASLA 4IOBA 2RKIB 1U09A 3DLGA 3NBPB 2B6AA 3HVTA 4PUOA 1TVRB 3CVKA 1R0AA 1RYSA 3GIIA 3PJXA 1S9EB 4PQUB 3RB0A 4JV2A 1RT6A 2BRLA 3DLKB 3DMJA 4KAIA 5KG7A 3OL6A 3SI8A 1S0NA 2AU0A 2F8EX 4PWDA 5KT5A 2C2EA 3QIPB 2BRKA 5KT3A 5L9XA 3EZUA 3M8QB 4ZMMA 4U7CA 1S1VA 3IGNA 1LWFB 4RW8B 4MIBA 3V6HA 4RW4A 1C1BA 4YP3A 3BSNA 3N6LA 4XPCA 1FKPB 2CKWA 2E9TA 2EC0A 1TVRA 4ED3A 3FRZA 5EUHA 2V4QA 4ECQA 4ED6A 4PUOB 4ZP7A 1S9FA 5HBMB 4R0EA 1IKYB 2UVUA 2ZKUA 1ZTWA 3BR9A 3GIKA 2J6SA 4FBTA 3G86A 3N6NA 3NL0A 2BE2A 1FK9B 2XGPA 3MEGA 3C6UA 4WFXA 4ED7A 2AWZA 2E9ZA 1NHVA 4IH5A 3BJYA 3OHAA 2HWHA 3DRPB 4WFZA 3CDWA 4WYWA 4F4ZA 3D28A 3LP0B 1C0UA 2HWIA 1RT2A 4M94A 1C1BB 3QO9A 4O3PA 4K4VA 1XR7A 4IG0A 4MFBB 1RT3A 3TVKA 4FS2A 3V6KA 5L1JA 3PW5A 3M8PB 3GV7B 5C25A 2AX0A 4ECZA 1RA7A 2YKNA 4WFYA 2ILZA 2YKMB 3KMQA 4J9NA 3NMAA 5F8MA 2B43A 4O44B 1HQEA 4JV1A 2VG5B 4ECUA 4MK7A 1JLAB 1C2PA 1RTIB 1BQNB 3FFIB 2FJXA 4NLOA 1RT1B 3MECA 3CO9A 4IFVA 5KG0A 1TL3B 3LP1B 3HHKA 4ZVFA 5HP1A 2OPPA 3DLGB 4K4YA 3H4BA 3KK3B 3KHGA 3KHRA 3QLHA 5C25B 3LAKA 3MR3A 3M8PA 5KFOA 2HNYB 5CYMB 2GC8A 5K14B 3LALA 2FVSA 3QO9B 3RAQA 1SUQB 2JEIA 3PW0A 1VRTB 4WZMA 2RDIA 1S0OA 4LQ3A 1EETB 5DG9A 1WNEA 5J2QB 2YNIA 2XCAA 4I2PA 3DLEB 4I7FB 1JLQB 4RW7A 1QE1B 4G1QB 4LSLB 2W9CA 2VG6B 4ECRA 1K1QA 3V6JA 5KFTA 3KLGB 1S4FA 5EDWA 3IGVA 4TYAA 3QIDA 4TQRA 2OPQA 3M9MB 4I2QB 4RW9A 4K4WA 3FDSA 4WXWA 3QLHB 2OPRA 3C6UB 2HNYA 5CYMA 5KT6A 2UVWA 3DOKB 4TN2A 3BQ0A 5J2QA 3IG1B 4RW7B 1LWCA 4I7FA 3CJ2A 2VG7A 1TKTA 1HNIB 2HNDA 4ZHRA 5KFDA 2AGOA 3CDUA 2J6UA 5KFJA 4NCGA 1VRTA 2ASDA 3BGRB 3DI6B 5CYQB 5KFZA 3LP2A 1VRUB 4O4GA 3LANA 3KMSA 3KK2B 2R2TA 3DDKA 3IS9B 4KHRA 3Q8RB 3PR4A 4EO8A 5KG5A 4K4SA 1HMVB 4URSA 4J9OA 4F4WA 2IM2A 4J9MA 1GX6A 1LW0B 1TQLA 4Q45A 3G6VA 1XR5A 3IG1A 2UUWA 2HMIA 3I5BA 4Q0BB 5L1LA 4RUCA 4J9SA 1S0MA 1LWCB 2I5JB 4EO6A 4K4TA 4QWDA 5JUMA 3H5XA 3UR0A 1N5YA 4RW6A 4M95A 4JV0A 5KFQA 1S1TA 3KK1A 3OSPA 2C28A 3KLIA 4IRCA 5HROA 3H59A 3PJWA 4QPXA 4NLDA 5F8NA 4IG0B 3V6DA 4DG1A 2IJFA 2IM3A 4RNHA 2GIQA 4KKOA 4QWEA 1HQUB 5HLFB 3DLEA 3I0RB 3MEEA 1QE1A 4G1QA 5DG8A 2IMWP 4WE1A 2V0NA 3JSMB 5KG3A 2OH2A 4FBUA 1KLMB 3I0SB 3BSOA 5KFWA 5L1IA 3MR2A 4ZP9A 3ISNC 4RW8A 2V4RA 5KG4A 4RNNA 3KLIB 2WRMA 5KFLA 1EP4A 1HNVA 5KT4A 1RT4A 2W8KA 4RW6B 4DL4A 3G6XA 3T5JA 5KFYA 4IR9A 2OPSA 4MH8A 4EEYA 5J2PB 1IKYA 1S1WB 5EWGA 1S1XB 3PW4A 1RTIA 4ED1A 3QGGA 3TQ1A 1TKTB 2YNGA 4ECSA 4X2BA 4EBCA 3T19A 2WHOA 4ECYA 2JEFA 1HQEB 4RNMA 3DYAA 5JXSA 5D3GA 3PHEA 5J2NB 3CIZA 3OLAA 2OPQB 4PWDB 3OLBA 1KLMA 3I0SA 5DQIA 3OL8A 1C0UB 4ED8A 2HNZB 1S9EA 4PQUA 2ALZA 1S1XA 1JLQA 1ZETA 1S9GB 3I5CA 3H5SA 1LW2A 5DQHA 1T3NA 2AGPA 1RT5A 3VQSA 4KO0A 1LWEA 4ED2A 4B3OA 1TKZB 1TL1B 2RDJA 3OHBA 3C6TB 1JLEA 4H4OA 4TY9A 5C5JA 1NNDA 5DLGA 4ZVEA 1SV5B 1SH3A 5KG6A 2I1RA 2JC0A 3I0RA 3EPGA 5FDLA 2DPJA 2FVRA 3V81B 5KFKA 5KFEA 3JYTA 4Y2CA 2HMIB 5F9NA 2W8LA 3H40A 2FJVA 2IC3B 4FS1A 1GX5A 4IRDA 1JKHA 1IM4A 2RF2B 4IFYB 5DG7A 5J2MA 3LP1A 3BGRA 1CSJA 5HP1B 4QW9A 1VRUA 3CJ0A 4J9RA 2DPIA 5KFCA 1RT6B 4EYHB 2AGQA 2B6AB 1MMLA 4XO0A 5C24A 4OL8A 2IJNA 1JLEB 3C6TA 3BREA 2FLLA 2OPSB 2ZD1B 3SFGA 4H4MB 3GQCA 4F4YA 4K4UA 2RF2A 2B5JA 2FLNA 1IKWA 4NLXA 1JLBA 1C0TA 2R8IA 4DL6A 2D41A 2R8KA 4RNFA 3MF5A 5EWEA 5HBMA 1IKXB 5I42A 3H5YA 1SH2A 3MEEB 1REVA 2YNIB 5DGBA 3IN5A 4QWCA 3IRXA 3RBEA 5KFRA 3M9NB 4NLYA 1LWEB 4GC7A 4NLPA 5KG1A 1DTQB 1DTTA 2BE2B 2YNFB 3D5MA 3KLFA 2XI2A 3GV8B 4URQU 3T1AA 4YR0A 3EPIA 3BQ2A 3DI6A 4F50A 1N4LA 2I5JA 2WONB 4DEZA 4G3IA 3E01B 3RBDA 4Y3CA 4WYLA 1ZTTA 3DM2B 3DRSB 4KFBA 3RAXA 3NKYA 4RZRA 3KJVB 4Q44A 5DGAA 4J9KA 2YKNB 4DL2A 4XPEA 1W25A 1JKHB 4YR2A 1C1CA 1NHUA 4DL3A 4IFYA 1DTQA 2YNFA 4MFBA 3KLFB 2AQ4A 3PVXA 5I3UB 3IRXB 2VG7B 4ZHRB 4O3SA 1D0EA 4QWAA 4NLQA 4NLGA 4NLRA 1TV6A 3OSNA 4DL5A 1HYSA 1SV5A 4NYZA 1S97A 3PR5B 4NLUA 4ECTA 4IDKB 5K14A 3ITHA 1BQMA 2IAJA 4RNOA 3H4DA 2QV6A 3MEDB 4YR3A 4B3OB 5DLFA 1JIHA 1JLFB 2WOMB 3Q8PB 2IA6A 4LSLA 4NLWA 2W9CB 3HKWA 4ZP6A 3TAMB 4K4XA 5I42B 2XWYA 2XC9A 4DL7A 1N5YB 3OL9A 4R8UA 4TQSA 1EETA 2VA2A 5KFXA 1N48A 2BQ3A 3DOLA 4KKOB 4IR1A 5C42B 2UVVA 1RA6A 4ICLB 2IM0A 2R8JA 2JLEA 2W7OA 4ID5A 3GV5B 3H98A 2ZD1A 2HAIA 4H4MA 3QIPA 2JC1A 2ATLA 4TYBA 3DYAB 3QGIA 2IC3A 4IKAA 1RT1A 5KFFA 4MKBA 5F9LA 3CWJA 1HNIA 2HNDB 4HYKA 4EBDA 3RB6A 3KOAA 4O3RA 3PZPA 4WZQA 4R8UB 1RAJA 1K1SA 4LSNB 3G6YA 3PW7A 2BR0A 2W9AA 5KG2A 1FKPA 4IH6A 5J2PA 2C22A 3FQLA 1J5OB 4Q8FA 4ZPCA 3QZ7A 4R5PB 2FLPA 1TKZA 1TL1A 5F8HA 3BQ1A 4ID5B 4EBEA 2JEGA 3LP2B 4H54A 3KK2A 1FKOA 3DRRB 3RB4A 1T03A 1XR6A 1S6QB 5C42A 2R2UA 1RT5B 4ICLA 3GIJA 3UQSA 2YNHA 3V81A 3LP0A 1DLOB 1MU2A 2VG6A 4O3OA 3M9OB 3T5KA 4KB7A 1RT7B 2O5DA 3FSIA 3H5UA 4Q43A 3DRPA 3FQKA 3QYYA 3HVAA 1SH0A 2WONA 4I2PB 1S48A 5KFBA 4H4OB 3RB3A 3CJ3A 2ASJA 2IBKA 5KT7A 5HROB 5KFIA 2BANB 3V6DB 1BQMB 2IAJB 4QW8A 1QAJA 3MEDA 4ZPBA 5KFNA 2IM1A 4QWBA 1S1TB 4MK8A 3KK1B 4NRUA 3KLEA 2W7PA 2WCXA 4F4XA 1I6JA 1RTHA 4MKAA 1S9GA 3MECB 4IFVB 3V4IB 4YMEA 1RT7A 3I5AA 1JLAA 5KT2A 2VG5A 4Y2AA 3BSAA 5KFMA 4LQ9A 3FFIA 5J1EB 3KLHB 1LWFA 4O3QA 4IRKA 1RT4B 1TP7A 1EP4B 1HNVB 4KV8B 3LAMA 4KHMA 1C1CB 2OPPB 4WXOA 4O4GB 1JX4A 1KHVA 3MFIA 3KJVA 3DMJB 3DLKA 4RU9A 4IH7A 4KBIA 5F8IA 2BQRA 1S49A 4J9PA 3JYTB 3N6MA 4ZVGA 3V4IA 3NBPA 3HVTB 4U6PA 3TAMA 4J9LA 3NGDA 3ICLA 4K4ZA 4NZ0A 3GILA 1RTDA 5KFVA 1RT3B 3KLVA 4RW9B 1QAIA 1JXLA 4NLTA 3KHLA 1D1UA 3JSMA 1LW2B 4URGA 3HVWA 4IQXA 2VA3A 1Z4UA 2HNZA 3OL7A 2R8HA 1UWBB 2YNHB 4NLVA 3CJ4A 2UVRA 2B5JB 4HKQA 1JLBB 5I3UA 4YQWA 5KFAA 4ZP8A 4KO0B 2WB4A 2V9WA 3KK3A 2GIRA 1RTJA 3IS9A 4TLRA 5F8JA 3GYNA 4RUAA 3BSCA 2YNGB 5KFPA 1TL3A 4KE5A 3NAHA 4K50A 1N6QB 1R0AB 1HPZA 2ZE2B 4TY8A 4LSNA 2D3ZA 1LW0A 1S1WA 3E01A 2FJWA 1RTHB 3QGHA 4RW4B 1TKXB 1DTTB 5J2MB 4KV8A 3M8QA 1KHWA 4O4RA 2FVCA 4I2QA 4J9QA 4NRTA 1N56A 3MFHA 5J1EA 3KLHA 4O3NA 1T05B 3DRSA 2XI3A 1HPZB 3SFUA 5F8GA 1HQUA 5HLFA 2QE5A 1S1UB 3H2LA 2FVQA 1DLOA 1MU2B 3DOKA 1IKWB 1JLGA 1FK9A 1YVFA 1C0TB 2BANA 5KFSA 5KFHA 2XCPA 1RTDB 4ED0A 3KLGA 3MR5A 1IKVB 3Q8QB 3T5LA
chains in the Genus database with same CATH superfamily
2D9OA 4TXSA 2G1DA 1J5OA 1F9HA 3EVOA 3PYFA 3JQMA 2GQQA 3PDNA 5AJ3F 3G6ES 2UU9F 2DB1A 1WJ9A 2C42A 3DRRA 2V2VA 3FNNA 1T03B 1H2UX 4DR6F 1DHMA 4K59A 4DPUA 4EMDA 3ZNUA 3NAIA 3GIMA 4DLGA 3D6TB 1NM2A 3ZTQA 2XM3A 1M5KC 4CNYA 1UWBA 4KSEB 5CYQA 3DM2A 4DHVA 1IXKA 1RT2B 3UDLA 3DOLB 4HACB 4F0KA 3H42A 4KFBB 3HSGA 4R25A 5DETA 3FCVA 2ZE2A 3GU0A 4TY8B 3H25A 1RHKB 5A6PA 1NKCA 4S0MA 2IIHA 1DZ5A 2POKA 3NNCA 2U2FA 2VBZA 3BYPA 2RKIA 4P10A 3MHYA 2IVFB 3W2VA 2DH8A 2QSWA 1JLCA 1WKLA 4KGZB 1QVGR 3LH2S 3MTKA 2FIUA 5E2QA 4ZCLA 3JTPA 1FWPA 3CCTA 4P2XA 2CDQA 2V69A 3PRBA 1WEYA 1FJCA 1DARA 3OQ2A 2YKAA 3R3TA 3PFOA 5GAEI 3GFZA 2PEHA 2ACMA 4DPTA 2ZJQQ 2CAJA 2VBYA 4DR2J 2R8GA 3KHHA 2ZH1A 1FDNA 2YY3A 1ZAWA 3VAHA 1U1KA 3M6WA 1T7PA 4WK1A 4YEAA 2BZ2A 1O51A 3E51A 2WOMA 2ILYA 2QN6B 2DR9A 1RDRA 4C3MA 1S1VB 4DUZF 1R8HA 4B9MA 4EZ6A 1DY3A 4FXWA 1X5OA 2HG4A 1KN6A 2FHJA 2KG1A 2VFRA 3HVTA 4PUOA 3G9CA 2B0GA 3UCGA 1R0AA 5LXYA 1FDBA 1U1LA 2DHSA 1UVJA 1FFWB 2ATCB 3MAAA 3R5GA 4KAIA 2N82B 2DR5A 4FF1A 4MYUA 4WP3A 1Q8IA 4PWDA 3GE9A 1CJKB 4QIGA 3GFHA 4ATNA 3UD3P 2FHOB 2P9CA 1S1VA 3KXDA 4OHXA 4MIBA 4RW8B 1LWXA 5F0UA 4RWWA 4V19X 4ILRA 4RW4A 5CCLA 3ET6B 4YP3A 5HQLA 2KJVA 3OJUA 1IBLJ 3A3PB 4AL7A 1URNA 2V4QA 4PUOB 3RBZA 2XMUA 4LVNP 2DXDA 4F7VA 1X60A 2AYEA 2HFUA 5HBMB 4GO5X 3BR9A 2J6SA 2J9DA 3M2UA 1WACA 3PY8A 3N6NA 3QFHA 2BBEA 2BE2A 1DJ0A 1IM6A 1RK8A 3UDEA 2ZJPQ 2C3YA 4RBVA 1FEEA 1X5TA 4CLWA 2YQ3A 3HHNB 1DQ8A 1U25A 1BD6A 1WF2A 4A8KA 4B3SF 1IBCB 2NUHA 1RWVB 1N5SA 4WFZA 3RZAA 2LDIA 4N41A 1UVLA 1HKAA 2N4DA 1CJTB 2QC3A 4DJBA 2F8HA 1C1BB 1X4CA 4O3PA 4DR6J 4DCPB 3Q8UA 1XR7A 4MFBB 1RT3A 1M90T 3LW5C 1VQ5S 3GV7B 5C25A 2HLTA 4JI4F 1O6XA 1L3KA 4DR1F 5LJ3Y 2MXYA 4CM0A 1KVIA 5F8MA 2B43A 3WIUA 3E2EA 4ED5A 2F7VA 1J5EJ 3FFIB 4K7QA 1WHVA 4ES2A 1ZM9A 4DFKA 2FJXA 3E3XA 4IFVA 4W92B 3C8YA 5KG0A 2WB1D 1VDHA 1TL5A 1A0OB 1IJFB 4ZVFA 4K4YA 1NK9A 2E7WA 2EKYA 1W26A 3KK3B 3CXCR 5K9FA 3QLHA 3NGKA 5KFOA 2K06A 3HZGA 5K14B 1U1NA 4OI3A 3RAQA 1U49A 3PW0A 4GKKF 1WG4A 3M6VA 1S0OA 4LQ3A 4WZMA 4PKDB 1WNEA 5J2QB 2XCAA 1NEEA 1FJGJ 3DLEB 1JLQB 4RW7A 1T02A 5L38A 2HK3A 2VG6B 4ECRA 3V6JA 3CD6S 2EBGA 3KLGB 1ITPA 4B08A 2DIVA 2RMLA 5EDWA 2MGZB 4DV3J 4P2SA 2HHQA 1GXTA 2OPQA 3R5DA 3M9MB 3R1HA 4RW9A 1KQSR 3O5TB 2UZAA 2VFUA 2ZC3A 3C6UB 4ETZA 3OTOJ 1V5IB 5IT4A 3DOKB 4TN2A 1HWUA 2GMHA 3LGNA 1IN0A 1ZS6A 5JJBA 2U1AA 2CZ9A 1B0PA 4RW7B 1LWCA 2VKZG 3CJ2A 5JVGQ 4O23A 1TKTA 4ZHRA 1WTBA 2MYFA 4D3GA 2AGOA 4HH0A 4NCGA 1PILA 2ASDA 1LFWA 1VRUB 2Q3PA 2RB7A 2R2TA 1NPKA 4JI0F 1EKRA 1CJKA 2PO4A 2DITA 2UUAJ 5KG5A 2MQLA 2VL1A 1FRKA 1XBWA 5K8OA 4J9MA 4KPYA 1TQLA 4C97A 2Y1JA 2ZVSA 2HMIA 2UUWA 4A8OA 2YWFA 5L1LA 1S0MA 6AT1B 2GVDA 4GVLA 1B0VA 4K4TA 3MD1A 2A3JA 2MJUA 1XC9A 2COLA 2OO4A 1R6VA 1JXEA 3BS9A 1T11A 1XJWB 4Q2MA 1P1TA 3HCXA 2C28A 2OI2A 1N33F 2EKNA 2R7QA 3MM7B 3AXMA 3G8QA 3PRDA 4WWSA 5M2RA 4F25A 4QPXA 1GAOA 1GXLA 3AQPA 3V6DA 2IM3A 1RWUA 1WEXA 2D74B 2B9EA 4RNHA 2GIFA 2EFPA 1WSRA 3DDNA 3PHTA 1B0TA 4MMOA 3ZTSA 3AXKA 4AL6A 4USTA 1QE1A 2Z2YB 2HWTA 1OQ3A 2F65A 4CZCA 2AP6A 3JSMB 4FBUA 3H90A 3RRKA 2F4VF 2XS2A 1KLMB 3BSOA 5KFWA 2ZH4A 3VAFA 3NCRA 2UXDJ 5E3RA 1VMBA 1E6VA 5HAOA 2WRMA 3ZC4A 3NOCA 2KO1A 1VQKS 1H2TZ 4DL4A 4NMXA 2VPZB 3J7Z5 4X84A 1P8GA 3R7BB 2DNLA 1EJ7L 3TJAA 3CCSS 2DJWA 5ADZA 4DF4A 1YTYA 3C19A 3TANA 1HR0F 1CLFA 2MZTA 1ELOA 5B0GA 1RTIA 4OI6A 2VOPA 4ZN1A 3HI9A 4FNHA 5AE3A 2YNGA 3D1HA 3M8SA 2KYXA 2X1AA 4G6VB 4X2BA 4HDGA 2WHOA 2LU2A 4ECYA 3ET6A 3K17A 1IBKJ 3RR7A 3D68A 4WJBA 1KTVA 5JXSA 4HHUA 3R2DJ 3AA8A 4NASA 3DXBA 2XO7A 1D9DA 5DM7Q 1YWXA 4PWDB 2OPQB 5B0AA 3GR1A 1NB7A 2Y8YA 1YJWS 1NZ8A 1UWAA 1WD6A 2WAQD 4ZA1A 3ZTOA 1JLQA 5HMYA 4Q5VA 2E44A 3HT0A 4UZCA 3P5BP 5M2UA 2J0QD 2DHGA 3EVMA 1LW2A 3I5CA 5IQ6A 4F26A 2CRLA 2LA4A 1YGYA 4C6AA 2H1YA 3O1LA 2L3MA 4L3KA 3OUYB 4ED2A 2C2NA 3MM7A 5AE1A 3NP5A 4DSEA 2DVIA 3I96A 2NYHA 5AXLA 1N32J 3C6TB 4H4OA 4DV2J 4IYQA 2QL9B 5AE2A 1NRKA 2X51A 1XNQJ 4F2SA 5KG6A 1S7IA 1VI7A 3EPGA 2FVRA 5KFKA 4LF6F 1RHQB 5HROA 3Q89A 5K20B 2HMIB 1TL7A 1SIZA 5CA5A 2J9EA 2FJVA 2XNQA 2EFVA 1GX5A 3L4BC 2N7YA 2RF2B 3MAHA 3UO0A 3EGVA 4CIOA 5J2MA 4EGLA 2AD9A 4QW9A 1VRUA 1X4GA 2HS0A 5KFCA 2V67A 4EYHB 4M5KA 2PT0A 2MB0B 1WC4A 3DU6A 2KU7A 5IT9Y 1JLEB 2ROEA 2P6SA 3SFGA 1GMWD 1MMNA 3D0GE 3HHLA 3GQCA 1FRMA 4HLBA 4K4UA 2B5JA 3AOBA 2G4BA 2R8KA 2D41A 1JJ2R 2XHWA 3TR5A 4CO0A 5EWEA 3ADAC 1IKXB 4NA1A 5HBMA 3W2WA 4I4BA 3TUIC 1G2EA 1WOSA 4ANEA 1VBKA 1X4HA 1TK5A 1YBUA 3IN5A 2ERRA 3WX4A 1GH8A 4K5SA 4LRCA 2KT5A 3OUYA 1I3OB 1LWEB 2C3UA 3MAQA 5KG1A 4Y00A 4YDDB 4ZJOA 4URQU 3BKUA 4UW2A 3BQ2A 1VC6A 3MEKA 3NEKA 2I5JA 3CEDA 1IQTA 1UVIA 5ETLA 2HRUA 2JDJA 1FXRA 2JZ5A 1FD2A 3GTYX 4PG6A 1AROP 3NKYA 3CE8A 3N79A 4UZBA 3VV2B 4YOEA 1N5TA 1XQIA 2KRRA 3TAQA 1RBAA 2K3IA 2B9YA 4CLUA 3CJTA 4XPEA 3I9V9 1AZSA 4DX6A 3K5PA 4LMZA 2AYMA 2EFNA 2YNFA 4XAKA 4B9SA 2JOQA 2FJAB 1JNRB 2DRDA 1RE1B 4KC5A 3TA0A 1TAQA 3IRXB 4B3SJ 1V3RA 2VFTA 2VG7B 3J80Y 3JXOA 1D0EA 4O3SA 3QJJA 2CPZA 4QWAA 3W64A 4X66F 1RUSA 3PFEA 1C4AA 4NLQA 4NLRA 3WZ0A 4C8NA 1RHRB 3S01A 1SV5A 5T41A 2DH7A 3HFVA 1OPZA 5B0EA 4NLUA 1U1PA 4NL5A 1NK7A 4FF2A 4ZDNA 5D4NA 5B7WA 1Y10A 1DURA 5K14A 4RNOA 1NJIT 3G4SS 2FC9A 1N34F 2GVZB 5DLFA 4B3OB 4OLOA 4ZN3A 2AT1B 1WC1A 5IV4A 2JLGA 3M7VA 4DUTA 4PYDA 3CULA 3M30B 2Q6BA 2XMJA 4X64J 3JTNA 1R0CB 4CCHA 4CI0B 2W9CB 2VC1A 3VTIA 1M1HA 1KQGB 1LKZA 1BHNA 2E1AA 2XC9A 1VQPS 1EETA 3DLHA 3FCHA 3M6XA 4HTJA 3DOLA 3N28A 5GAGU 4V19J 1BLUA 4ICLB 2PD1A 2ZNYA 4J91A 3NS5A 3NXZA 1NXIA 3H98A 3O8WA 1PAEX 2ZD1A 4OV6A 2HAIA 4OI2A 4BHQA 3VVUA 2ATLA 1R7IA 1RACB 1VBXA 3DYAB 2V8PA 4IKAA 2HK2A 3FBCA 1Q7LB 4DV5F 2HQGA 1TFYA 4HYKA 4OI1A 4WZQA 1B99A 4MYTA 5HVGA 4IQMA 1RAJA 3DNCA 2RHSB 3MM9B 4RUBA 4B3TJ 3TA2A 1J5OB 2C22A 3ELHA 3ILLA 4NXNJ 2KFZA 4G1PA 1GMUA 3DLLQ 1UW4A 4ID5B 5HK4A 3AD7C 2JEGA 2ZOGA 1FERA 1XR6A 4K8RA 3HSZA 2DEJA 2RVJA 2V6AA 5C42A 2GA7A 2R2UA 2ZH5A 4ICLA 2J7KA 3WC2A 4C8LA 2MSTA 2YX4A 4DV6F 3M9OB 5ETOA 3T5KA 2E5LF 4OYOA 1RT7B 2V2KA 1V3SA 3M6UA 4HEA9 2EWHA 2W4PA 3FBFA 4QIFA 4QU6A 2LYVA 2DNYA 5CYJA 2XLIA 2QEXS 1XMBA 2ASJA 4RUHA 5KT7A 4A8WA 2OGUA 1O5JA 2EC2A 2DR8A 1HA1A 3N4WA 2IAJB 2LXFA 4LF1A 2E5HA 4DX5A 3GG0A 3ZFVA 3HXMA 3VAGA 2F4FA 4Y28C 3VAMA 4QWBA 1S1TB 3CJQA 3RYLA 2HHWA 2KKHA 1JK9B 1QUPA 2DNMA 4L76A 3MECB 3PYEA 3GFXA 1EAYC 4EI2A 1ZM4A 2Z8QA 1FFGB 4YS2A 5KFMA 4LSZB 3FFIA 5HL7Q 5FLXU 3KUHA 1FEHA 3KLHB 5HJXA 2CZ4A 3D0IE 1W2IA 1TP7A 4NXMJ 2G2OA 1U1RA 1IR1A 1SBRA 3OVBA 2PMWA 3QQCD 2E7XA 4KHMA 2XO6A 2IRYA 3TUZC 1VQLS 2WVEA 1SJFA 2PFFB 3DLKA 4RU9A 3EXCX 2C1EB 4IH7A 4Z7YA 3NG8A 1FD8A 4LR8A 2IBOA 3R6GB 1G3OA 2G2ZA 3R9LA 4ZVGA 1QLNA 1PG5B 2RU3A 1JMTA 2HFZA 5BYSA 5T7LB 4U6PA 3PIOQ 4J9VA 2PMHA 4WKRA 4P7TA 3W63A 3R1LA 3ICLA 3J7AN 1KOOA 2HHUA 1HWJA 4RKUC 1VFJA 2UXCJ 3GMGA 1C4CA 1HBOA 3C16B 4PQAA 5HVFA 2W2QP 1UW9A 4LRBA 1PC4A 4OIXA 5THWA 3D4JA 4ELTA 4DR1J 2R42A 2CPXA 1D1UA 4DSIA 2XNRA 3KJNB 4IUFA 3MCOA 1WOPA 2RS8A 1VHIA 2MJNA 2DY9A 1LXJA 2XG8A 2ZWPA 2H4YB 3BN4A 2D3O1 1UWBB 4TVAB 3KYLA 2DNHA 2UVRA 4E2FB 4NI2A 4DV7J 4A8SA 4Q7AA 1ZAVA 3GYXB 4ZP8A 3SEOA 1SPBP 2DISA 1APSA 4KO0B 1FRXA 4CLLA 2M70A 2JRSA 2WB4A 4QOTA 2FLOA 3IS9A 1T9YA 4DZDA 2HHSA 5F8JA 2W2PP 3MM6A 4RUAA 2A6MA 2YNGB 5LOQA 5KFPA 4DSFA 2PN6A 2HHTA 3E8OA 1NSAA 1HPZA 3I31A 1N32F 2A18A 1RB0A 1S1WA 4A8YA 2NPIA 1U47A 2RQKA 1VK8A 5J2MB 2RUGA 4ES3A 3M8QA 3OR1B 2CWXA 4DR7F 5ETPA 5E33A 3HF5A 1S99A 1U8SA 3P3DA 1HBNA 3BBFA 2YWEA 3VGVA 2XI3A 1GT8A 3VQTA 1E6YB 3PR5B 2ZH3A 5H1SV 4ZIVA 2MKSA 3KLGA 1Y9OA 4B3TF 1FK9A 1UFLA 1C0TB 2CJXB 4M5DA 1FJEB 4JI3F 1RTDB 1HHSA 1U1OA 1MROA 1Y4ZB 2K7KA 2GAGC 4K5RA 3FGVA 1IKVB 4CH0S 3Q8QB 1U2CA 2ZZMA 2AEFA 1REVB 2CQDA 4USKA 3WIVA 3G82B 4IG3B 2BKNA 2F9DA 2YTCA 2CZVC 4NLSA 4DFMA 1U24A 2YWKA 1FWLA 3BPSP 2BJ8A 1FDDA 1T05A 1FKOB 4LRDA 2M8DB 3PCOB 2ACYA 1Z2LA 4C8MA 5DDPC 2BQUA 1N0VC 4DLEA 3ILOA 4B17A 4CTAA 2VODA 5D3GB 1BWVA 3PX6A 2E9RX 2DD8S 4WK3A 5DQGA 4OZ1A 3Q8SB 2F4VJ 1D8YA 1RYRA 4OMFG 1VQYA 4NCGB 2V8VA 2CQ0A 4Z2XA 5CCMA 2UUTA 5C24B 1BQNA 1FVSA 2NSBA 2C2RA 5G0RA 2CJKA 4ECVA 3ZXWA 3POTA 5T14A 1UJ6A 2DGOA 2MDAA 2BE7D 4DV0F 3KDNA 3MUVP 2JEJA 1P27B 3CD5A 1P9YA 3BGFA 3ITHB 2G0JA 2K1RB 3Q24A 2Y8WA 4C48A 2YX7A 5F8LA 1DFDA 4IO1A 2R2SA 5EWFA 3MEGB 2WK4A 3SDEA 3MR7A 4YY3J 2XMMA 1S79A 3OD2A 4QR0A 3D6HB 4K0KF 1KR4A 2J6TA 4QCLA 1KS2A 1PJ5A 2DBBA 3KNGA 1S59A 4KY3A 2APOA 2P6TA 2BV3A 2CPJA 4ZOSA 1NDKA 2IVMA 3D6MB 2G0CA 3NMRA 1F2GA 2Z2LA 1IKXA 2BKPA 1MN9A 2H4WB 2D7SA 3B54A 4Q8EA 4UF4A 3JQKA 1CQMA 5CAAA 3MR6A 5LMUF 2AX1A 5AJ3J 1CPZA 4GC6A 2KT2A 4CLFA 1Q79A 5KFUA 2GMLA 3J81j 2W9BB 2YBVA 2VDIA 1WC6A 4IOBA 5DDRC 2C2KB 1VC5A 5D0EA 3DLGA 1RWPB 1NJYA 3P96A 4UY8T 3KTQA 4C4WA 4M5JA 5H9EJ 1DQ9A 2V50A 2G1HA 1CJUA 2QLBB 4NEYA 3LF0A 3RB0A 4B9VA 3FSYA 3OL6A 3DLKB 1UFWA 1YJTA 3BO2A 2J8SA 2M2BA 2M5YA 2AU0A 3IWLA 2DHHA 2C2EA 1IR0A 1XWLA 1BGXT 2BABA 3AD8C 3EZUA 3M8QB 3OR1A 4ZMMA 5KT3A 3EICA 5B0DA 2HPUA 4CO3A 4X62J 1C1BA 4FZVA 2XLKA 2HVZA 3KDOA 3N6LA 4CO2A 2M52A 2E9TA 2NR0A 1K0VA 1TVRA 2EFOA 4NE9C 3CUNA 1ZZNA 3PM9A 3GJTB 1X8DA 2PA8D 3GFYA 4Y0FA 4P75A 1HBMB 3AOAA 3MMJA 3NL0A 2MQNA 2W24A 3CT9A 3N01A 4RLEA 1YK9A 4DX7A 3DKDA 2AYBA 1FK9B 3V5RA 3C6UA 1X4FA 4Y6IA 1FJGF 2BDPA 2D69A 4N47A 2DO4A 2E9ZA 3P8BB 1H3DA 1TU0B 3PNIA 3OHAA 1KLNA 2Z58B 2FC8A 3A12A 3CDWA 3A13A 5D78A 9RUBA 3THVA 3N9UC 4CLPA 4K2XA 1C0UA 3R7SB 2HWIA 2JNJA 2OMLA 3D2WA 3CJKA 3J81Y 3CMES 1VYAA 1KOHA 1NSKL 4HH1A 5KOXA 2F40A 3HHEA 5A8RB 4FS2A 2IMOA 2UUBF 1V6HA 1RA7A 2GW8A 4L74A 4WIQA 4WFYA 5EX3A 5EGYA 1F3VA 3KMQA 1WWHA 2HFNA 3NMAA 2DNZA 3PRVA 1Y5LB 1R89A 2AJ0A 2VG5B 1F3FA 3O3LA 3W7BA 5A76A 4IO9Q 1N0UA 2RILA 4J9UE 2RHQB 1YLXA 4LT6A 1WKKA 2QT7A 3MM6B 4WFAQ 3TQ1A 3NNAA 1TL3B 3LP1B 1AUDA 2MHNA 3HHKA 3TX0A 4A4JA 2HRYA 1EIYB 4DFPA 1SC1B 2KN4A 2ZBCA 1HW8A 4USWA 3LAKA 4HDHA 3UWTA 2NXNA 5C25B 3M32A 3MR3A 4HKQA 2B56A 2FVSA 1SUQB 1GTEA 2WW8A 3TQEA 3WBZA 1EETB 5DG9A 4NPOA 4I2PA 2RAQA 3OTEA 1QE1B 3ZO7A 2W9CA 1OIAA 2J9DE 1WG1A 5KFTA 2XEXA 3BH7B 3IGVA 3QIDA 1AA1B 3AFGA 4LF8J 2J7WA 3H20A 4I2QB 4PPZA 4QR1A 1FHTA 3QLHB 2YWWA 3TO8A 2Z2MA 3FEZA 3MPYA 4F3MA 3KUGA 1S76D 2UV8G 2AHOB 2UVWA 3O44A 2DTJA 4A47A 3DGPA 3BQ0A 3IG1B 1NPRA 2VG7A 3HD2A 2HNDA 3MWBA 5HMXA 2CYYA 4OX6A 5KFDA 3CDUA 3JAMU 4TU7A 4DUZJ 2ADBA 1VRTA 2J6UA 1W2BR 4KGVB 5H9FJ 3LANA 3KMSA 3DDKA 3OR2A 4DI6A 1HD1A 4JI7F 1K44A 1SCJB 4PR6A 4CO1A 1WC0A 2QIFA 1XNRF 1SJQA 4O0NA 1X4EA 4X4SA 1HMVB 4URSA 4EFAC 4F4WA 2IM2A 2BJ1A 3CJKB 1HI0P 5LSRA 1AT1B 4Q45A 3G6VA 1XR5A 2MTLA 2ZDOA 4LRAA 4U95A 1A7GE 4RUCA 3MPVA 4DBQA 1LWCB 2I5JB 4J9SA 3TZYA 3PKMA 1SC3B 3UR0A 3VGUA 2MLZA 4L72B 2H3EB 4NYOA 1NH8A 1KP6A 1QAXA 3ZZRA 2JVOA 4AYBD 4J7CA 3KK1A 2VJUA 3KLIA 2PC6A 3AQOA 5IXUA 3H59A 1FE4A 3F56A 4X64F 3QNWB 4IG0B 3J81U 4DG1A 3T1YF 2IJFA 3B4DA 1RAGB 5DJBA 3KJQB 5HLFB 4ZVQB 1UAWA 4DU7A 3I0RB 2IJRA 2FJDB 1UTAA 4ZCMA 3J7YU 4OHVA 1M5PC 1PYSB 2VV5A 2OH2A 3W62A 3CB4A 3MGJA 3T6JA 3SZ2A 3IAS9 5L1IA 2HHHF 2BA9A 5GMKa 3EGZA 1U0SA 3ISNC 2QO3A 4RW8A 5RUBA 4JYAJ 4IOCQ 3D1QA 3EYZA 2HVDA 3DDIA 5E3PA 2NYIA 1EP4A 5GADU 4LF9J 1G1XA 5AXNA 1L3UA 3O6QA 3SV3A 1HNXJ 3GYGA 1LXNA 2DR7A 4IR9A 4MH8A 1YZ6A 2VPWB 4EEYA 1X9WA 4DWIA 2XWXA 4OJGA 1F5AA 1S1XB 1JXVA 2QX0A 1GMVA 1OY8A 2GHVC 2KT3A 2J9CA 3O2IA 2VONA 1PKUA 1RLCL 3TP2A 1FRHA 2RQMA 3SCIE 3ZTPA 4W90B 3NGRA 1NBEB 2DNRA 2WVFA 4RNMA 2GAHC 1Q8LA 4FKYA 4P7VA 4ES1A 3L3CA 3PHEA 3CIZA 2JFDA 2OFGX 4M63A 4MTPA 3ZTRA 1YDLA 3DRXA 1CG2A 3IR7B 5L39A 3AOCA 3W3SA 3FMBA 3OLAA 1UJ5A 4GKKJ 3I0SA 4DUYJ 1WSVA 5DQIA 2BJDA 2CQGA 5IM0B 2Z4PA 3MM5B 2HNZB 4J90A 1YJ9S 2ALZA 1S1XA 3HFZB 3PACA 1QD1A 2RQ4A 4FVCA 3RGIA 2HURA 4FF3A 2HZCA 3K59A 3UVJB 3CC2S 1R27B 3W5ZA 2AGPA 1TZ0A 3N5FA 1KFDA 4U8VA 3F44A 3VQSA 2EVZA 5DDQC 1S4EA 1T9UA 2ZEJA 1LWEA 5CQGA 2LDYA 3CPWR 1VQOS 1R6YA 3W2VB 1U45A 3DXSX 3LPYA 2GJ2A 2RUSA 3NGSA 4NEZA 1UVMA 4TY9A 1NNDA 2Z0GA 2HKEA 4I1TA 1SH3A 2XY7A 2I1RA 2JC0A 2QMUB 3I0RA 4DPOA 2VZ9A 2DPJA 3V81B 3PIPQ 3KG4A 4NX9A 5KFEA 1FFSB 2WVBA 5LJ5Y 3JYTA 1Q95G 1HI8A 2FJEB 2LA6A 5F9NA 2ZM6F 1LEOA 2CWKA 1PJ6A 4C0OC 4ZCIA 4OX9J 1RBOB 1IM4A 4C8ZA 5DG7A 3GB0A 3F0NA 3FVYA 2VFSA 3LP1A 3BGRA 5A8RA 1CSJA 5HP1B 2FHKA 3CJ0A 3POTB 2DPIA 4N76A 3SMZA 1XNQF 1NKBA 2I2YA 1G7CB 2MMYA 3W5YA 1HWIA 2ZBIA 1H72C 4KYZA 4DQPA 4OHYA 2B6AB 2RRNA 1MMLA 3OPKA 1UP1A 4OJ1A 4OL8A 2MZ1A 2CVEA 3IA0A 3BREA 6FD1A 2OPSB 1HBUB 2YPYA 2CJYB 2QRRA 4UUXA 5LMUJ 2ZH7A 4LFAJ 5C7PA 2RF2A 3EZ5A 1KSPA 1IBLF 2AYGA 2XS5A 2VDHA 1C0TA 4UTGA 2LXUA 4F3OA 4UOHA 3N5BA 2HYIB 4USVA 2NXEA 4K0KJ 4GVBB 1DAXA 4U7UK 5ETNA 4X4RA 4KH1B 2DGSA 2EPIA 1QM9A 1UJ4A 3MEEB 3R5BA 3CCZA 4ZVUB 2YNIB 1TUGB 2DNGA 4DS5A 2XSJB 2PMZD 1ZAXA 3MDFA 2GZOA 1YRTA 2YWGA 2GX8A 2Y0BB 5KFRA 3TW0A 5CH7B 4C11B 4GC7A 1IBKF 4LFCF 1X4BA 2ROPA 3KLFA 4ZVRB 3FCWA 2QLXA 4MKVA 4DL0C 3GV8B 1N4LA 3IM9A 3JSRA 1YIJS 3MMCB 3SQGB 2XZTB 5E3CA 3MUMP 2VKRA 4HVZA 4Y3CA 4OYBA 3U1MA 4WYLA 1ZTTA 1T9WA 1QAYA 4ZJQA 4KFBA 2KXNB 3RAXA 4HACA 4RZRA 3TI0A 3KJVB 1Q7YT 3F41A 1FNOA 4Q44A 2YKNB 4X4OA 2OKQA 1HW9A 2OMOA 3AD9C 4YR2A 1C1CA 1S6OA 4DL3A 1GMWA 3A8EA 1DTQA 2AW0A 3HHLD 5M2PA 3SQOP 2AQ4A 1GK8A 3IBFB 3BO3A 1JJ4A 1TL7B 2BE9B 2HEKA 7FD1A 4USJC 4LF5J 4N7TA 2OEKA 2R7UA 4ZHRB 3GJRB 4U67Q 3MZIA 3U7JA 3EWGA 3I55S 1IR2A 4OX8A 4LJMA 4MJKA 1F1BB 1TV6A 4WKYA 3J7YI 3VALA 4DL5A 4NYZA 1YJNS 3CMQA 3PG9A 2VHGA 1WDDA 2FTRA 2HGMA 3NS7B 2RRAA 4OZJA 3H2VE 1SKRA 1BQMA 4CWBA 2Z57B 3PTWA 3Q23A 4YR3A 1GFWB 1HBOB 3C16A 2A1BA 1JLFB 3Q8PB 3ETMA 3MTJA 2JFKA 3PX0A 2AZ3A 3GSDA 2KZMA 2ZVIA 1SJ4P 4NLWA 2HHXA 1AYEA 5I42B 4DL7A 1N5YB 4C9DA 5A8KB 1OSDA 2FZKB 2BQ3A 4DR7J 4EWTA 2UU9J 5G0RB 2AJ1A 1D3WA 2XMVA 3Q86A 2HVIA 1RA6A 2YKQA 1FI4A 4NWBA 4B3RF 1PIEA 1YRUA 2OEJA 3M8ZA 3LGMA 2BUNA 4UOCA 2ZOMA 3OFFA 4WPAA 3QIPA 1Q8BA 2JC1A 4DQRA 1Y5NB 1CS4A 2IC3A 3HD1A 3CWJA 2HNDB 2K8GA 3TA1A 3RB6A 1R8CA 3LQVA 3PZPA 4LSNB 4CT8A 2ZOFA 1FX2A 2QFJA 4IH6A 3VWSA 2OAUA 5AT1B 4R5PB 5HMZA 2Y9HA 5H9FK 2MKIA 5F8HA 2LU1A 4UUWA 3BQ1A 3KK2A 1LK5A 2WSEC 1FKOA 3RB4A 1S6QB 4GKJF 4C11A 3BKFA 2PIIA 4QJVA 4R0JA 2W2NP 2UV8A 2GFFA 1CJTA 2MLYA 4O3OA 1DRZA 5JVHQ 5D4PA 5A8WB 1LNQA 4PEOA 2KL8A 3FSIA 3EMTA 4HHHA 3VGSA 1P6TA 3HVAA 2WONA 1S48A 3CCRS 4H4OB 3CJ3A 3GLJA 2DNPA 7FDRA 5HROB 2OEMA 1SJ3P 4M5DB 2L08A 2R7RA 2D9PA 2LQ8A 4C8KA 4ZPBA 4ID8A 4JI2F 3ZNJ1 2IM1A 5KFNA 3OW2R 4MK8A 3KK1B 2W7PA 4WF9Q 2DO0A 2WCXA 3KWMA 2AJ4A 1I6JA 4MKAA 1MN7A 1S9GA 3M8WA 2Z30B 3L7UA 2UXCF 2HQDA 2V8GA 1M0SA 3V4IB 4DR4F 1KTQA 2MKCA 2NLWA 3WX8A 4LF9F 4HT7A 1R8BA 2VG5A 4I6WA 4F67A 4LQ9A 2BEFA 1RBLA 2CDRB 4DZ6A 1LOUA 3BV8A 3U1LA 5J1EB 2HZAA 4LF7F 1EP4B 3R27A 3LAMA 4A8QA 4WXOA 1HNZJ 2OPPB 5F41A 1YBTA 1KHVA 1TFWA 2B3TB 3OR2B 3UDCA 3MAAB 4AT1B 3IMQJ 5D4OA 1ZA1B 2MPUA 3WC0A 3CW2C 3B8HA 5F3ZA 1S57A 2EK1A 1BUXA 2HBQB 2JL9A 2OELA 3D6FB 3JYTB 1XIQA 3V4IA 1MWYA 3K5LA 2E5LJ 4FP9A 2H65B 3K89A 3EUNA 4CP5A 1O8BA 4FN5A 4ED4A 3I56S 2CQ2A 3M8YA 2N3OA 3ZZ0A 3TJ8A 2LFVA 1XEZA 2CQ1A 4K4ZA 2GJFA 4NI2B 1RWWB 1EZZB 1NSQA 1RT3B 2J0XA 1M5VC 2QLWA 1I94J 2NUUG 1F60B 1HBMA 3B82A 3X3UA 4DPYA 1OWXA 2PFDA 1XMQJ 3NGUA 4F2RA 2AV5A 1D9AA 5GAEU 3JSMA 2CADA 2CFXA 4YUDA 3HVWA 4I6AA 1Q8KA 5MAOA 1Z4UA 4PYAA 2R7SA 3DRYA 5K8NA 1WUUA 1OO0B 1X4DA 2IYGA 3OL7A 1U48A 1H0HB 2LCWA 2YNHB 3HX9A 1VCTA 3CCWA 4NMLA 3K5OA 5LXRA 5KFAA 4DV4F 4M5HA 5ETKA 3SCKE 4DCJB 2GIRA 3H8YA 2DNQA 2L48A 4GO7X 2DH9A 1RWOB 2B8QA 2WZ1A 3EE3A 1N5QA 4KT0C 1NCLA 4P9SA 3VCDA 5HVHA 1TMMA 1TL3A 2HRTA 3H2UB 3NAHA 1E6YA 2DGVA 4FYXB 4KE5A 2VUGA 2B4VA 1SIWB 4RL1A 3TNVA 2ROGA 2FJWA 1RTHB 3QGHA 2RE1A 4RW4B 1QJHA 2LEAA 1SC6A 4RX6A 2JH3A 8ATCB 3LWMA 3FK4A 4DV5J 4X4UA 3M2VB 2FHJD 4O4RA 2FVCA 4I2QA 5AXKA 2KZZA 2HIQA 1XNRJ 3MFHA 1YJUA 5J1EA 1U4BA 4OI0A 4O3NA 1SL2A 2ALYB 3P4UB 3OT9A 3DRSA 5GVQA 5DZ7A 1VC0A 4JV5F 1HPZB 5F8GA 2RSQA 2RJZA 1HQUA 4JI5J 1QVFR 4DR3F 3FMWA 3A8JA 3MOZA 5CZVA 4PABA 2FVQA 1U2FA 4ZVPB 2J7UA 4ZCKA 4C0BA 2P5VA 3NGTA 3DOKA 5B08A 3IRWP 1K8AT 1JLGA 2O1PA 1A6LA 2OLWA 4KGXB 2XCPA 4ED0A 2YKPA 1Q1KA 2XHCA 1VLYA 1F2HA 3A8IA 5E5NA 3ITHA 3MR5A 1N5VA 2X1BA 3NOGA 1IWGA 2RDDA 2BXJA 4P6QA 3Q8VA 1M5OC 2WTFA 5CXTA 2DNOA 4LF8F 2F8MA 2HQFA 5ETMA 1S6PB 1QUVA 1ZM3A 3B4MA 1ZPVA 3D0HE 5GAHU 3MUTP 4ZVSB 3TRGA 4LFCJ 4C3KA 1RKIA 3QMQA 1YRXA 1S6QA 4O44A 2W01A 4M1KA 2MQQA 1RGVA 2HFOA 1MWQA 1PSDA 2MHEA 2LMIA 4MK9A 4NOHA 4JUZA 3TZXA 4YB1P 1REGX 5IWAJ 4EYIB 4DPXA 1KFSA 3IWNC 4CYUA 2CQIA 4WU2A 4R5PA 3UW1A 4ZPDA 2X1FA 2P9EA 3LOUA 2CPIA 1SQEA 3G82A 4IG3A 1UKUA 4ZVHA 2VC0A 2M8HA 3ENAA 3BO4A 2LECA 3IFEA 3NRBA 1IKVA 4H4KA 3PW2A 3HJVA 2R2RA 1IQZA 2QJ3A 1RAFB 3CDEA 4PXCA 1UETA 4XK8C 3GP9A 1S7HA 3KLEB 2FUG9 2W9BA 4ECXA 4DR4J 2CPYA 2NREA 1B7YB 3QRQA 2V4JA 4TNOA 4WE1B 2C3OA 3BB5A 3KNAA 5KFGA 1H74A 4Y34A 2CJQA 2DXEA 2CQPA 2A10A 4WFBQ 2Q66A 1U7LA 2GVZA 2C2DA 2OD4A 1JLFA 1SUQA 1GTHA 2D3UA 4AQYJ 1JLCB 2OPRB 4ZPTR 2GCFA 1VISA 4MIAA 3U1NA 2FVPA 3UPFA 1RZMA 1S10A 1S1UA 5E41A 3HHLC 1Y7PA 4ITSA 3M2UB 4YB5A 1U09A 3NBPB 3P5TL 4BBYA 2B6AA 4X62F 2V94A 2E1CA 1RJJA 2HIYA 3CVKA 1FKAF 5GMEA 1ICEB 1RYSA 3GIIA 1FCAA 3PJXA 2XBPA 1S9EB 4PQUB 2ZNZA 4JV2A 2BRLA 3EJMA 1S0NA 2VF3A 1J2VA 3V4MA 1WOOA 3GR0A 2FQQB 4UQTA 1HHTP 3CMAS 5KT5A 2PI5A 2ZFHA 4IRCA 5DO2A 1I5OB 2BRKA 4JBCA 3SV4A 5L9XA 1RHUB 1T9VA 2DEIA 3IGNA 1LWFB 1KRPA 4CT9A 4OFZA 1PC5A 1NMEB 2LQBA 3P45B 4QQBA 1FNMA 2MGZA 4XPCA 2CKWA 2DGTA 3WHIA 5A2QY 2KFYA 2EC0A 2I9SA 1FNXH 5BR8J 4ED6A 2B4PA 3GCXP 1UZDA 1WTFA 5E3AA 2K3KA 1IKYB 4YHHJ 2ZKUA 2BM1A 1X4AA 3GIKA 1ZTWA 1QDUB 3BGLA 3G86A 3GIRA 2E1RA 3BM7A 2B51A 2QTWA 3OTDA 3MEGA 4WFXA 3W9HA 1UFKA 5L8RC 5IFMA 1YJVA 4DV2F 4KTQA 4J5OA 4B02A 4ED7A 2HS4A 2OP5A 3ZZPA 1NHVA 1NDCA 4IH5A 4GMKA 4LR9A 4OHZA 2HWHA 5HQMA 1B3TA 1PCAA 1VIXA 2QA1A 4YY3F 3D28A 3QJLA 5HMWA 1YG0A 1DQAA 3MM5A 2X7IA 3AH6A 1LQ9A 5K5MA 1BY9A 3QO9A 4C98A 4K4VA 2ZH9A 2ASYA 2HHHJ 4Y65A 4PRFA 1RWKB 4HTIA 3TVKA 3PW5A 4ZS6A 3TZZA 2UXBF 2ZJRQ 1BC6A 2AX0A 2WSFC 2YKNA 2JX2A 3QGPA 4J9NA 3PEHA 1Q86T 4O44B 1HQEA 5CABA 4JV1A 4MK7A 4ZPWR 4FYWB 1IBMJ 4OV1A 4NLOA 3MECA 3CO9A 2B4UA 2PDAA 4CYUB 4I56A 4P2FA 2BX6A 3VHQA 5HP1A 3DLGB 1UEVA 2B7BB 5A0YA 3KHGA 1PYOB 4DR3J 2QA4G 4IOAQ 4JI5F 1IVZA 3M8PA 2GC8A 3RRHA 3LALA 3HO1A 3M2RB 3QO9B 1ZA2B 4ZVOB 3K5MA 2JEIA 1AFJA 1FJ7A 2V68A 3OXGA 2W2MP 4AXJA 3ETOA 4I7FB 4ILMA 4G1QB 1ZYQA 1CBKA 4DV1F 1K1QA 1S4FA 2H48B 3VR1A 3HLUA 1CC8A 2WVCA 3L7OA 4OHWA 5CHCB 4K4WA 3FDSA 1JQGA 1RU2A 4WXWA 4DU8A 2OPRA 3CCES 3VAJA 1L3SA 1H2VZ 2HQ3A 5KT6A 3HFKA 1UEUA 3TVZA 2YWHA 3UVJA 2OD6A 3QWUA 2LP4A 5J2QA 2ZHAA 4I7FA 2DR6A 4LFAF 3VZIA 2ZDPA 4OYMA 5KFJA 1JJCB 3BGRB 3DI6B 5KFZA 3LP2A 2NXCA 4O4GA 4OI4A 1WF1A 3Q8RB 3PR4A 1M5HA 4M5IA 1BQXA 1R43A 2HVEA 2O67A 1YHQS 3DN9A 4K4SA 4ANDA 4E98A 1UVKA 1XMQF 1CJVB 2KB2A 4HHJA 3Q22A 1I94F 2IDEA 3IG1A 2CJAA 2GJIA 3I5BA 3IWXA 1JWWA 2GV1A 5D15A 4F3QA 1VIOA 4NZ6A 4EO6A 4QWDA 3H5XA 1MWZA 2ZM6J 1NH7A 2M3DA 4M95A 4JV0A 4A8FA 3GG1A 1S1TA 5KFQA 1SQGA 4ECSA 3OSPA 3OTCA 2QFIA 4OYXA 3PJWA 2OJ3A 4NLDA 3C3LA 1JB0C 4P71A 3RBXA 4CO5A 4DOZA 3EVWA 2XSJA 3AA9A 2GNKA 5HO4A 4QWEA 3IP0A 3W61A 2QA4S 4DF8A 3P49B 2KXFA 4DS4A 3MEEA 1Z2ZA 2F5GA 4FPRA 4RU2A 2IMWP 4WE1A 2GVDB 4YN3B 4NXMF 4FKXA 3S6EA 2E5GA 3I0SB 2HFSA 3MR2A 2DGXA 2GMJA 2R3VA 2XZDB 4ZP9A 4WTOB 2KRBA 5KG4A 3I82A 4RNNA 3KLIB 2W8KA 4W4MA 5FIIA 3AT1B 3BR8A 2EI5A 3T5JA 1RHMB 1QSLA 2OPSA 5J2PB 1RCXB 3US5A 1IKYA 1P1LA 1O0PA 1YJ7A 2UUCJ 1S1WB 4QYZK 1FRLA 4PG5A 2A2DA 4BWJA 8RUCA 3RJMB 1KBRA 2EFQA 2YVSA 1TKTB 4HI2A 2RD5C 5CZXA 3RW7A 2IRUA 5IV3A 1LFPA 2N7CA 4WCEQ 2KG0A 3W60A 2VPXB 4L75A 4PZVA 4C2MA 5L1JA 3DYAA 4QZVB 1A9NB 1RWMB 5J2NB 2M9KA 1J5EF 5E7OB 1BMQB 2O66A 2DRAA 1R0BG 4ZVTB 3TOQA 4EUVA 2RS2A 1KVJA 1VHFA 4QU7A 3F73A 3DOMB 2YQ1A 2QMWA 1SI9A 2MLXA 1C0UB 3EM1A 4ED8A 1S9EA 4DQSA 4PQUA 1RLDA 4UOGA 2V2ZA 4BC7A 1S9GB 1MMDA 3EDRB 1M5SA 2ZH8A 4AD6A 1ULRA 1T3NA 2HBYB 3BN7A 2AEJA 3K7RA 2ZHOA 3M30A 4CLSA 4YFUA 2NPFA 2NS1B 3MD3A 1ZBTA 1J27A 1WC3A 2O3DA 3KFWX 1PO6A 4B3OA 2GQCA 2C3MA 3OHBA 4CRJA 1JLEA 5U47A 1KC8T 5C5JA 5H9EK 3T1YJ 4ZVEA 1SV5B 2DGQA 2CQBA 1U26A 2YX1A 1TMJA 2AMCB 6FDRA 1HNWJ 1U0HB 2A0FB 2BJ3A 2MQMA 2P9GA 4EK2A 1OYEA 2W8LA 3H40A 2Q43A 2J5AA 2L9WA 1VOMA 2IC3B 5DS7A 4FS1A 1KKHA 4IRDA 5SZTA 1JKHA 3UCZP 3QT5A 5C2GA 1VQMS 1K73T 4X4NA 4A8MP 1VS3A 4PPDA 4QIWD 4DSKA 1JNZB 3FEYB 1RT6B 5K8PA 2AJFE 2HGLA 3JQJA 5HJYA 2AGQA 3D67A 3J80U 4JI7J 3MXHP 3BBBA 2IJNA 3CDBA 3C6TA 4USHA 2H54B 1Q82T 1T95A 2EFGA 2ZC4A 4H4MB 2YQ0A 4F4YA 4DV1J 1N54B 1IKWA 3A3OB 1VJWA 1JLBA 1EQ0A 3PYDA 4OYZA 4LIRA 4GRSA 1H38A 5B0BA 3NNHA 2CNOB 4RNFA 3J7ZT 3ILJA 3R2CJ 5I42A 1ROFA 2ZITA 1D9FA 3R6LB 2EEYA 1WI6A 5HI7A 2IPOB 2A6OA 1FTCA 1X9SA 3A8KA 2PGCA 5DGBA 1X9MA 4QWCA 2F63A 2KJWA 1KDNA 2P2CB 3IRXA 3RBEA 3M32B 1IWAA 4NCBA 2OTJS 2GHWA 3HHDA 3M2RA 2AJQA 1AZSB 4C8OA 3BBCA 2BM0A 1DTQB 1DTTA 2JVRA 1D09B 3D5MA 4NLPA 5ETTA 4F50A 3T1AA 4EU0A 3SXLA 3GPAA 4F04B 3DI6A 3FUYA 2WONB 4DEZA 3KG0A 4AE5A 1VK3A 3Q83A 3GZ7A 2VH7A 3AJ1A 1JJHA 2BOPA 1FXDA 1R31A 3DRSB 2HGNA 4ZJLA 2H51B 1PYTA 3G8TA 5DGAA 4J9KA 4B3MJ 1FVQA 1HQ2A 3TVYA 4ETXA 2R7TA 3GWCA 4LUBA 1W25A 4A48A 1RQ0A 2GS8A 1X5SA 2V34A 3KLFB 3HJFA 3GCWP 3PVXA 5I3UB 2GGPB 5IC4B 4LBPA 2UUBJ 2MSSA 3ILIA 3MCNA 1VQ7S 3OXFA 4QPTA 4NLGA 5MLCV 3OSNA 1IUJA 2CNNB 2DYAA 3B6BA 4QIVA 4DCOB 4DXLA 4ECTA 1S97A 3I4HX 3W9JA 2YXLA 1HL6A 3H4DA 3MEDB 1RAOA 1JIHA 2JLFA 5EN1A 1S0VA 4Z7CA 3LWLA 2OIHA 1FRJA 4LSLA 2M7SA 3HKWA 3FJ2A 3TAMB 2CNLB 5ETRA 2XWYA 3SIPB 3W8GA 4K4XA 1Q81T 4R8UA 4TQSA 1RAHB 5GADI 5KFXA 4C8YA 2XYHB 4KKOB 4CLTA 4IR1A 4KPCA 2DCUB 3C15A 1I1GA 2CQHA 3OBIA 3WDOA 4CLYA 4J9PA 3GV5B 2VQEJ 4OLPA 2C2ZB 1HBUA 2MQPA 4XIUA 3Q0AA 2GQ2A 5LL6d 2M4MA 4TYBA 3QGIA 4EBDA 1RT1A 1V5VA 5F9LA 1YITS 1CVJA 2VJVA 4P52A 4O3RA 1K1SA 3G6YA 1Q5VA 5F3TA 1X7VA 2I0XA 2F1FA 2G0IA 2RU9A 3FQLA 5I4MA 1OY9A 3M4XA 1YI2S 1NK5A 4LIWA 3K5NA 2FLPA 1K9MT 4EBEA 4LF6J 1EKSA 3LP2B 4H54A 3DRRB 2MQ8A 1T03A 2Q79A 1PGZA 2K7JA 1URRA 5F0WA 4AFFA 1F5BA 4FYYB 5HN0A 4UQGA 2R9LA 1FT8A 2VU5A 3UQSA 2FZGB 3V81A 2RQCA 2BJ7A 1MU2A 2VG6A 3LP0A 4DUYF 1SJRA 4KB7A 4B9TA 2O5DA 3K0JA 3H5UA 4I6YA 2QG9B 3DRPA 2XY5A 1VGYA 3QYYA 4B3RJ 3FBEA 2B9WA 3MCSA 5KFBA 1WDTA 3RB3A 2IBKA 2V4JB 1KQFB 3EGNA 2JSXA 5KFIA 3IBCB 4PXBA 4CM2A 1BQMB 3R8YA 3NWRA 4FPIA 2W2OP 1LK7A 3MEDA 4QW8A 4KIAA 4MKYA 1XTZA 3OVAA 1YBAA 3NS6A 4B3MF 2M88A 3KLEA 3U02A 5T7LA 3HK2A 1RTHA 3UNGC 1IJEB 4OX7A 2DRBA 4IFVB 4RJVA 3OFHA 4PCQA 3OL9A 4YMEA 4BDPA 1N36F 2IY5B 3I5AA 2MQOA 1H73A 2E5IA 3QJPA 4Y2AA 3BSAA 4RPFA 3CCMS 3I9ZA 2KYZA 2LXIA 3PO4A 2KVIA 4IRKA 3JAMY 4KV8B 4CTAB 4D3HA 2FD2A 1QSYA 5D4LA 3MPDA 3KJVA 2RIJA 3DMJB 1L3TA 4LF5F 3JSYA 4FYDA 1BWEA 4KBIA 2BQRA 3D1OA 2MZQA 4O0IA 4CDIA 2V5HG 4ZPVR 1GNKA 1B64A 2I8EA 2YPZA 7AT1B 2ABYA 4NZ7A 2H9ZA 2HS3A 2ZHBA 3PYGA 3UN5A 4CH7A 4KJIA 3PX4A 3W66A 3GILA 1NAQA 4JV5J 3HVRA 1S12A 3KLVA 4LF4F 2LLZA 3BH6B 4RW9B 2I6WA 1TK8A 1VQ6S 2G13A 2MKYA 4NLTA 3M05A 4MAKA 1RI7A 4JI8F 3VVTA 5IS2A 5DDOC 1LW2B 2FYXA 2WSCC 2GHPA 4CNZA 3FBBA 3MCMA 4NA3A 4USUA 4IQXA 2VA3A 3G96A 1ZPWX 4ELUA 3DHWC 2FDNA 2KFNA 3DGVA 3K2YA 2R8HA 3J7A1 1WELA 2LQ5A 4MIWA 3FZ2A 3M8RA 1NKEA 3G87A 1JLBB 2R4FA 3OXLA 5E3QA 4LBIA 1GQEA 5DRKA 3M2VA 4X65J 3QT7A 8AT1B 2QL5B 3KK3A 2V9WA 1RTJA 1HNWF 4OYIA 3GYNA 2K1RA 2MZRA 3BSCA 1AW0A 4K50A 4HT5A 1N6QB 4QYRA 2P8IA 1R0AB 4M5NA 1WEZA 2UUAF 1WHXA 2D3ZA 4KGKA 1LW0A 4Y2IA 5L9NA 3KG1A 3E01A 3OVSA 2XZWA 2AEMA 3CGIA 1DTTB 1TR0A 3A1YG 3QBCA 1RCOB 1KHWA 2C2OB 3QATA 1NPPA 5G4DA 1N52B 5LMNF 4WP9A 4CH1A 4USMA 1RAAB 3THTA 3KLHA 1PBAA 2MEWA 1T05B 2CVIA 2ZWOA 1XMOF 2VBWA 1RKJA 3HKZD 3DGPB 3ONQA 4U8YA 4DV7F 1U8WA 1NJZA 2QE5A 1S1UB 4M8LA 3H2LA 3CC7S 1Q0NA 2EG2A 1DLOA 1WG5A 1R8PA 3Q2TC 1OY6A 1IKWB 4ILLA 1SQFA 1YVFA 2BANA 2LVWA 5KFSA 5KFHA 1MSWD 4DPWA 2JWNA 3NWGA 1U1QA 3CNQP 4FNIA 4N56A 2YH0A 5J1NA 3KKFA 3DLJA 3I4PA 2LQ9A 4I64A 3QZ8A 2IYIA 4L73A 3UFCX 1OS5A 4ECWA 1CJVA 1Q5YA 2IA0A 4N5SA 1SC4B 1VQ4S 3C66A 3GONA 1RADB 3CJ5A 3UI3A 1BE4A 3ENWA 2R7XA 1I51B 4WBFA 9ATCB 1H6KX 4JI6F 5J2NA 1DBDA 1TAUA 1X31C 2VASA 4WIIA 1G4CA 2NZCA 5CD4A 2Q6CA 1HARA 1N6QA 4JI2J 4DFJA 1Y00A 2VOOA 1VQSA 1S6PA 3T41A 1F9EB 1RTJB 3MM9A 3T5HA 1HMVA 1OJ4A 2G9OA 4TKTA 1RHJB 2HSEB 3L09A 2YKMA 1FX4A 2WVDA 4NYPA 4MT1A 1X0PA 2JHEA 1P9QC 4X4QA 2XGQA 3VZHA 2VPYB 5HATA 4I0WA 2PA3A 4BC9A 1FXLA 4ZPAA 1WF0A 2V63A 3OTBA 4LR7A 3JSBA 3MURP 3G8SA 3K57A 5FDLB 4I69A 1HNXF 4GKJJ 1TV6B 3OFEA 1MLAA 3PEJA 4OZ3A 1XN9A 1HYSB 5L1KA 2PE8A 2C2MB 1PJ7A 4F0HA 3P6YC 4Q0BA 4LRFA 4DG1B 2FY1A 5IT0A 2L41A 1KWMA 2CUYA 2RH3A 4L6V3 1MW7A 5L46A 3UD4P 1LV5A 1SJ1A 2XYPB 1JLGB 3ISND 4KQZA 2MY7A 1ZZFA 1T94A 4IDKA 1TTHB 2ZZNA 1TKXA 3MMAB 3SCLE 2ASLA 2JJ4D 2AJ2A 3PJ9A 2RKIB 1QTMA 3W65A 3PKYA 1SXLA 1TVRB 1H98A 4CLZA 2ZUGA 1WORA 3MOJB 1RT6A 1Y3JA 3DMJA 3D9BA 3ZZUA 5KG7A 4X65F 5GAGI 3HP6A 1QTNB 3SI8A 4A8XA 4NCAA 2F8EX 1VRQC 2V8DA 3DU5A 1VJQA 3QIPB 2KM8C 3I87A 3RAMA 1NK8A 2DHXA 4U7CA 2MKHA 5BYQA 5IC6B 3V6HA 2F9JA 2NXJA 4X4VA 3BSNA 1FKPB 4P2MA 4NA2A 1S77D 2HBZB 3BZQA 4ED3A 3FRZA 3IXQA 1MG7A 1AUSL 5EUHA 4ECQA 1NU4A 2HQIA 4ZP7A 4DQQA 5EX0A 4GVBA 4R0EA 4XTTA 1S9FA 2UVUA 4Y2KA 3CD7A 4FBTA 1Q4RA 3MI7X 4ELVA 4EZ9A 2XGPA 1HHQA 4DSJA 5BJRA 4E8UA 2AWZA 2GO9A 2E5JA 4AUKA 1VBZA 1TELA 3BJYA 4LF4J 4U96A 3DRPB 1KVKA 4DV4J 2OUGA 4WYWA 5D6GA 4F4ZA 2DGUA 2X1GA 3N0VA 3JB9k 3LP0B 4PXDA 4CO4A 2HW3A 2UUCF 1RT2A 4M94A 2MKKA 4OJ3A 5LM7E 1Q78A 4IG0A 2NQPA 2VQFF 1HLWA 4OZLA 4ZLPA 3BDPA 3MMBB 2XMTA 4OZ2A 1U2RA 4OZ0A 3M8PB 1UMJA 2RT3A 2MKJA 3CJSA 3SCJE 5KAKA 3HSJA 4ECZA 5IT9U 4N8OA 2ILZA 2YKMB 1S5ZA 3IR5B 5D0RA 3DC2A 3SBMA 4QR2A 2N3LA 4C0HA 3C14A 4ECUA 1JLAB 1HD0A 1C2PA 1RTIB 1BQNB 1NUEA 5IZHA 1NK0A 2O01C 2G2YA 2D1CA 1RT1B 2OSQA 3TEGA 4QYZJ 1N33J 3EX7B 2QYGA 3QRRA 2OPPA 3UD5A 3H4BA 5K8MA 1WI8A 2DIUA 3R5CA 1N36J 3QRPA 3HZEA 3K8WA 3KHRA 1NZAA 3RTVA 2HNYB 5CYMB 3S8SA 3UN3A 1MNEA 2CQ3A 1ZM2A 2E1PA 3CCUS 2DNKA 3OJSA 1NK6A 1VRTB 2RDIA 3T3FA 2FPHX 2FZCB 2YNIA 2RNEA 3ENVA 4M5MA 1T3OA 3LO3A 4LSLB 4RBTA 3VAIA 1T9XA 3ZZZA 4UT4A 5A8WA 1NB2A 4B9UA 3BF4A 2QL7B 5SUHA 3TEHB 4TLRA 2HAFA 4TYAA 4C3LA 4TQRA 3TARA 2DCLA 2QGFB 3QT8A 2B8PA 3RR8A 1HBNB 3QAUA 2OSRA 1TUVA 1WHYA 2HNYA 5CYMA 5ETQA 2CA9A 2BOAA 2E66A 1CULA 3B78A 3CDAA 4Z37A 1FF2A 2ZBRA 3CCVS 1OSCA 1XK8A 3H7HB 1RISA 4PWWA 2BVZA 2IRXA 2BJEA 4JB8B 3THPA 2IHR1 4P73A 2HHPA 2XYGB 1HWLA 2IVYA 4ZKAA 4M5LA 1RXOB 1HNIB 3IR6B 4M5GA 2HQCA 1WHWA 3IO1A 5CYQB 3KK2B 1UL3A 3K58A 3VAKA 4FXVA 4ERDA 3IS9B 3LA0A 4KHRA 2KI2A 2MY8A 5A6WA 2VB6A 4EO8A 3GSIA 3U27A 3S1TA 1AB8A 4J9OA 1EB0A 3PXGa 1T8EA 1EARA 1GX6A 1LW0B 1Y11A 4KH0B 4Q0BB 2QMXA 4ZLNA 2AKWB 4U9RA 4XDDA 4DR5F 4N8NA 4TLQA 4RR5A 3RRGA 5JUMA 2BMBA 1N5YA 3MPWA 4RW6A 4TU9A 1ZOTA 1Z1ZA 4OYAA 3MM8B 4WU3A 2SXLA 3RUBL 3S7RA 1HFEL 3CTRA 2IFXA 3HMJG 1E6VB 2VICA 2LEBA 4KGMA 1NK4A 5F8NA 1PAUB 4PAAA 1SL0A 1AFIA 4RBUA 1T0TV 2GIQA 2QYCA 1HQUB 1HIYA 2H5IB 2W4CA 3JS9A 4KKOA 3DLEA 3LUYA 4DSLA 4JOUA 4G1QA 5DG8A 1TUWA 2V0NA 3QPIA 5IQQA 5KG3A 4KRWA 3C46A 1RTZA 4Q2LA 2FGOA 3EDQB 4WP8A 3CJRA 4XDCA 3SDEB 1MROB 2V4RA 2AF6A 2V9KA 2UP1A 3UR3C 2ZZTA 2GO8A 3EGWB 2H5JB 1HNVA 5KFLA 1B4SA 1RT4A 4A46A 4RW6B 5KT4A 5A2QU 4YHHF 3TX8A 3G6XA 5KFYA 1N8RT 4E0DA 2AZ1A 2MZJA 3A4TA 3R5JB 2D3OR 1T9TA 1U1MA 5FJ4A 3PW4A 4YB6A 4ED1A 3AB4B 3QGGA 5FLXY 4ZIWA 2R7VA 5EWGA 4EBCA 3T19A 4JYAF 5LSOA 2J8AA 2JEFA 1HQEB 2GGPA 3R97A 1RABB 1H7XA 1YSJA 2K2PA 3AAWB 3IM8A 1M1KT 2DGWA 4PWUA 2DK2A 5D3GA 2R7WA 4X4PA 3V2UC 1WKJA 3D3CJ 1UPMB 1Q53A 2LEPA 5BYRA 1KLMA 3QT6A 3OLBA 4DV6J 3OL8A 2ZBPA 3NCPA 1HR0J 4ZLLA 1NSPA 2W25A 5GMDA 3R7NB 4BS2A 1U6BA 1FWKA 2VQFJ 2CJ9A 4N77A 1M1GA 4W98A 5LT5A 1ZETA 2NZ4A 5EHHA 3H5SA 1HWKA 1FA0A 3LGHA 4ENOA 5DQHA 1X0FA 1RT5A 2X3DA 4LFBF 4LF2A 4FDFA 1S72S 1X5PA 4KO0A 1IBMF 2Q1LA 2Y0SD 2E29A 3K8VA 2HBRB 3A3NB 3TAPA 4DN0A 3I6PA 1VR6A 2EW9A 3CIMA 1TKZB 1TL1B 2RDJA 3SSQA 3NLCA 1YKWA 5DLGA 2L9DA 2KDOA 4DX8H 2KTQA 4UOFA 1CQNA 4ER8A 2XQCA 2VD3A 3AJ2A 3CD0A 2IDLA 5FDLA 4I68A 3DOMA 1CEZA 4Y2CA 3C14B 3ENQA 3SSRA 2ADCA 4DR2F 4IFYB 4WTYA 3MM8A 2HHVA 3HM9A 4DDFA 1L3VA 3LTOA 3MMBA 4OQJA 3TJ9A 1VQ8S 4J9RA 1NJXA 2DKOB 3CO0P 5BXIA 1RP5A 2ZBQA 4YB7A 3V6DB 4HL9A 5HSPA 4V1Ak 5C24A 4XO0A 1QSSA 3IAM9 3QFWA 4JI0J 3ULHA 1QY7A 4C7QA 2FLLA 3DHXA 3C2PA 2ZD1B 4QBUA 1TL4A 3D66A 3OV7A 3V6KA 1RWXB 4KR0B 1EQMA 4BWMA 2EG1A 2PI4A 1F0XA 2FLNA 4X66J 1EX8A 2WW4A 4FVMA 4NLXA 1RWNB 1GEHA 2R8IA 2DNNA 4DL6A 2Z2ZA 2E7VA 2VIHA 1TKDA 3MF5A 4PG8A 4F4KA 1ZH5A 5C2CA 3T9ZA 3H5YA 1KNZA 1SH2A 2CPHA 2WBRA 1UA0A 5D8HB 1REVA 3D7SB 3VGTA 4AXIA 2LQJA 3QSIA 5LSLA 5IM0A 4DV3F 3UCUP 2OTLS 4G1IA 1W7WA 2FHMA 4NLYA 3M9NB 3H0PA 2YNFB 4B9NA 2BE2B 3CSKA 2M0GB 2XI2A 4BLGA 3EPIA 1S6UA 2B9XA 4YR0A 1UEKA 3OTOF 3HT3A 1B7FA 1RU1A 4G3IA 2FGCA 3E01B 3RBDA 1HNZF 1RSCA 2Z56B 4JI1J 1FO1A 3SSSA 4OJHA 3UDVA 3RW6A 3DM2B 3MPUB 1F5CA 1NLKL 1R3NA 4L3NA 5DM6Q 1VQ9S 3CF5Q 4DL2A 1F9FA 5E0OA 1OPIA 3T1HJ 1JKHB 3R5AA 1FTRA 1NHUA 1WC5A 2QLFB 2VFVA 4IFYA 2YKOA 2CPFA 2E1MC 3EZOA 3L7PA 2CG8A 2LKZA 4LBHA 4MFBA 4JI6J 1OMSA 1UCNA 1UVNA 4JI4J 5A8KA 3AY0A 2VBXA 5DZ6A 1KONA 2W1BA 1F6TA 1CC7A 2B4OA 1HYSA 2BW7A 3L9ZA 1UPPA 2H5EA 2KHDA 3GJSB 4HI1A 1OYDA 2MZSA 4IDKB 4DMZA 4CQ1A 2NCKL 1TK0A 3FRYA 2A2CA 2CIMA 2IAJA 3ISZA 3CCJS 5D0GA 2QV6A 3RU0A 2XMAA 2AIRB 2WOMB 1XMOJ 3G2XA 2IA6A 1GXUA 5IWAF 1NJWA 1Y3KA 2PEBA 5HQ8A 4CLKA 3HHLB 4PG4A 4ZP6A 2ZKTA 1RAIB 3W2WB 5JMNA 2HLUA 5LMNJ 4J37A 5FD1A 2VA2A 3PO5A 1N48A 1G6BA 4Y2MA 2FY8A 5C42B 5ITHA 1NDPA 2UVVA 3Q8YA 2N4CA 2IM0A 2DT9A 2R8JA 2JLEA 4F36A 4ID5A 2W7OA 3TWZA 2KM8B 3KJFB 2NSCA 4RWXA 1FE0A 5B0CA 1Y5IB 4H4MA 2CQ4A 3TUPA 3M1VB 4FYVB 2QA2A 3UE2A 2HFVA 4MKBA 5KFFA 3KOAA 1HNIA 4OZ5A 2FJBB 4LVOP 4F4AA 4R8UB 3GJQB 3PW7A 5I3PA 2BR0A 2W9AA 5KG2A 1FKPA 5J2PA 4Q8FA 3FEXB 3FC9A 1KEKA 4ZPCA 3ZZTA 3QZ7A 2XTJP 2OFHX 2CJBA 3ZZYA 4NXNF 1TKZA 1TL1A 2QLJB 2HZVA 4OYWA 3OFGA 2CQCA 1SVDA 2Y3YA 1VLOA 3SYZA 5D0HA 3D3BJ 3NY0A 3CC4S 1VBYA 3NCQA 4U7UD 1RT5B 3FZBA 3GIJA 5D77A 1YZ7A 1UZHA 2YNHA 4RO0A 3QSYB 1DLOB 3X1LB 3AB2B 3WQPA 4HR2A 4YDXA 4Q43A 2I38A 3FQKA 2XB2D 1SH0A 1PBUA 4I2PB 3T6BA 5HANA 2J0WA 3I32A 1FDAA 1NO8A 2EBEA 1U6ZA 1V3ZA 3TZWA 4LFBJ 4KHPF 1K0TA 2BANB 3CJ8A 1XERA 5B0FA 4DV0J 1QAJA 4JI8J 4AL5A 4G65A 2BACA 4ZK7M 4NRUA 4F4XA 4H4KC 4QIEA 4JP8A 3RG6A 1KQKA 3DLBA 2FB0A 1H7WA 1N34J 1R8AA 5KOWA 1RT7A 4BCAA 1EHWA 2C3PA 4PG7A 1JLAA 5KT2A 3DFEA 2UXDF 2DXFA 1NDLA 2W4DA 3IC1A 4K2JA 5IOLA 2XLJA 4I67A 3HPOA 4KHPJ 2DHAA 1YQHA 1LWFA 2CXEA 2PSZA 4O3QA 1RT4B 1HNVB 3VF0B 1U02A 1C1CB 3TYTA 4UY85 4O4GB 1SKUB 1JX4A 5A0YB 3MFIA 5CD4H 3FKBA 3T9NA 2F3JA 2BJ9A 3L95X 1K47A 3C15B 3BPDA 5F8IA 2UXBJ 1S49A 3N6MA 1VQNS 2HVHA 1L5UA 1Y0HA 3NBPA 1UA1A 5AXMA 5I3QA 3G71S 3HVTB 1RAEB 4ALZA 1SKSA 1KD1T 3TAMA 2Y1LB 2B7CB 2EXUA 2QSFA 4J9LA 3W8PA 2J0SD 3IBWA 3HDSA 3HULA 4P72A 4ANCA 3NGDA 1CULB 3HSDA 1B70B 4NZ0A 3EXYA 5KFVA 3W5XA 2OHDA 4DN9A 1RTDA 1FESA 5J1PA 3AHPA 1Q16B 1SB6A 1SKWA 1QAIA 1D8ZA 2XMKA 3BGUA 3Q2SC 3DCAA 3KHLA 1JXLA 2Y1IA 4URGA 4LF7J 1N88A 3LPEA 2L9NA 4WFNQ 2HNZA 2ZUAA 3W1YC 3AODA 2ZH6A 4B9LA 4F02A 2KH9A 4X4TA 3ZZOA 3CCQS 2J76E 4NLVA 4JI3J 2KVQE 2XMWA 3CJ4A 2B5JB 3FSXA 3JTOA 4OX9F 2CPEA 5BR8F 2XY6A 2YH1A 5I3UA 2NXUA 4YQWA 3TUJC 4P74A 2XS7A 3BEGB 4F0MA 4OZNA 3UNYA 2ZH2A 3AJDA 1AXQA 1ACMB 3KUEA 2XSFA 5KTQA 1U0HA 3BYRA 2ZE2B 4TY8A 1CJUB 4LSNA 3PV8A 1SL1A 3D54A 2CG4A 2QZ8A 3MMCA 3SQGA 3M1VA 3W9IA 1CS4B 1FRIA 4AQYF 2X3GA 4DR5J 1TKXB 3MMAA 2Y1RI 2WBMA 3QAEA 4KV8A 4ZITA 2RRBA 2V2QA 5B09A 4J9QA 4NRTA 1YX2A 2CPDA 1N56A 5GAHI 2R7OA 4FF4A 5ETSA 2VQEF 4PXEA 1U6FA 1YJRA 2DY1A 1BXNA 3SFUA 3UN2A 4TU8A 3QWPA 2BKOA 5HLFA 1NHKL 4LREA 3CCLS 3BDEA 3T1HF 2W7AA 3BKTA 4DQIA 1MU2B 1V9OA 5ETVA 2BYCA 4ZLJA 4FXDA 4F8RA 2KXHA 3BGOP 2EK6A 2KHCA 2BW2A 4OYPA 1HI1A 2XULA 4JI1F 2V8HA 2CNKB 1OQ6A 4USIA 3T5LA
chains in the Genus database with same CATH topology
2D9OA 4TXSA 2G1DA 1J5OA 2GQQA 3PDNA 5AJ3F 3G6ES 2UU9F 2DB1A 2C42A 3DRRA 3FNNA 1T03B 1H2UX 4DR6F 1DHMA 4K59A 3GIMA 3NAIA 4DLGA 1M5KC 4CNYA 1UWBA 4KSEB 5CYQA 3DM2A 4DHVA 1IXKA 1RT2B 3UDLA 3DOLB 2NREA 4KFBB 4R25A 5DETA 2ZE2A 4TY8B 3H25A 1NKCA 5A6PA 1DZ5A 2POKA 3NNCA 2U2FA 2VBZA 2RKIA 3MHYA 2IVFB 3W2VA 2DH8A 2QSWA 1JLCA 1QVGR 3LH2S 3MTKA 2FIUA 5E2QA 4ZCLA 3JTPA 3CCTA 2CDQA 3PRBA 1WEYA 1FJCA 1DARA 3OQ2A 2YKAA 3R3TA 3PFOA 5GAEI 3GFZA 2PEHA 2ZJQQ 2VBYA 2R8GA 3KHHA 2ZH1A 1FDNA 2YY3A 1ZAWA 3VAHA 1U1KA 3M6WA 1T7PA 4WK1A 4YEAA 2BZ2A 1O51A 3E51A 2WOMA 2ILYA 2DR9A 1RDRA 4C3MA 1S1VB 4DUZF 1R8HA 4B9MA 4EZ6A 4FXWA 1X5OA 2HG4A 1KN6A 2FHJA 2KG1A 2VFRA 3HVTA 4PUOA 3G9CA 2B0GA 3UCGA 1R0AA 5LXYA 1FDBA 1U1LA 2DHSA 1UVJA 4KAIA 2N82B 2DR5A 4FF1A 4MYUA 1Q8IA 4PWDA 3GE9A 4QIGA 3GFHA 4ATNA 3UD3P 2FHOB 2P9CA 1S1VA 4OHXA 4RW8B 4MIBA 5F0UA 4RWWA 4ILRA 4RW4A 5CCLA 4YP3A 2KJVA 3OJUA 4AL7A 2V4QA 4PUOB 2XMUA 4LVNP 2AYEA 5HBMB 4GO5X 3BR9A 2J6SA 2J9DA 3M2UA 1WACA 3PY8A 3N6NA 2BBEA 2BE2A 1DJ0A 1RK8A 2ZJPQ 2C3YA 4RBVA 1FEEA 1X5TA 3HHNB 2YQ3A 1DQ8A 1U25A 1BD6A 1WF2A 4A8KA 4B3SF 2NUHA 1N5SA 4WFZA 3RZAA 2LDIA 4N41A 1UVLA 2N4DA 4DJBA 2F8HA 1C1BB 1X4CA 4O3PA 1XR7A 4MFBB 1RT3A 1M90T 3LW5C 1VQ5S 3GV7B 5C25A 2HLTA 4JI4F 4DR1F 1L3KA 5LJ3Y 2MXYA 1KVIA 5F8MA 2B43A 3E2EA 4ED5A 2F7VA 3FFIB 4DFKA 1WHVA 4ES2A 1ZM9A 2FJXA 3E3XA 4IFVA 4W92B 3C8YA 5KG0A 2WB1D 1TL5A 1IJFB 4ZVFA 4K4YA 1NK9A 2E7WA 2EKYA 3CXCR 3KK3B 5K9FA 3QLHA 3NGKA 5KFOA 3HZGA 5K14B 1U1NA 4OI3A 3RAQA 1U49A 3PW0A 4GKKF 1WG4A 3M6VA 1S0OA 4LQ3A 4WZMA 4PKDB 1WNEA 5J2QB 2XCAA 1NEEA 3DLEB 1JLQB 4RW7A 1T02A 5L38A 2VG6B 4ECRA 3V6JA 3CD6S 2EBGA 3KLGB 4B08A 2DIVA 2RMLA 5EDWA 2MGZB 4P2SA 2HHQA 1GXTA 2OPQA 3R5DA 3M9MB 3R1HA 4RW9A 1KQSR 3O5TB 2UZAA 2VFUA 2ZC3A 3C6UB 4ETZA 5IT4A 3DOKB 4TN2A 1HWUA 2GMHA 3LGNA 1IN0A 5JJBA 2U1AA 1B0PA 4RW7B 1LWCA 2VKZG 3CJ2A 5JVGQ 4O23A 1TKTA 4ZHRA 1WTBA 2MYFA 4D3GA 2AGOA 4HH0A 4NCGA 1PILA 2ASDA 1LFWA 1VRUB 2Q3PA 2RB7A 2R2TA 4JI0F 2PO4A 2DITA 5KG5A 2MQLA 2VL1A 1FRKA 1XBWA 5K8OA 4J9MA 4KPYA 1TQLA 4C97A 2Y1JA 2ZVSA 2HMIA