3I5BA

Crystal structure of the isolated ggdef domain of wpsr from pseudomonas aeruginosa
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
170
structure length
170
Chain Sequence
ALMNSDGLTGLSNRRHFDEYLEMEWRRSLREQSQLSLLMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGGARLLAEKVRRTVESLQISHDQPRPGSHLTVSIGVSTLVPGGGGQTFRVLIEMADQALYQAKNNGRNQVGLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Determinants for the activation and autoinhibition of the diguanylate cyclase response regulator WspR.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords WspR response regulator
total genus 58
structure length 170
sequence length 170
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3i5bA00
3I0SB 5L1KA 3V4IA 2FJVA 4IOBA 1J5OA 2OPPA 4MK8A 4QWEA 4NLPA 3H5YA 3V6KA 4K4TA 2FLNA 2ATLA 3DRSA 4G1QB 2IAJA 3DLKA 3SI8A 3MEGA 2BR0A 1TL3A 3PJWA 1RTDA 2WB4A 3MEEA 2D7SA 3T19A 4WZQA 3DMJB 1XR6A 3PHEA 4RW6B 3DI6B 4NYZA 1QE1B 3MECB 4K4YA 2V4QA 2YKMB 2VG5B 5KFOA 3RB3A 2BANA 2HNDB 1DTQB 3BSAA 5KG0A 3GV8B 1N56A 2FVPA 4IFYB 3T5KA 1HQEA 4IR1A 1RTIA 3DRSB 2AGQA 5DLFA 4MK7A 4F4XA 1FKOB 4DL2A 4IDKB 5J2MA 5FDLB 5HROA 3T5JA 1IKVA 1TKTB 3ICLA 4EYHB 2IM0A 1JLCB 4J9NA 4ED8A 2BQ3A 2ASLA 1MU2A 4LSLB 2V4RA 4KHMA 4YP3A 3PR5B 2AQ4A 1KHVA 3G86A 4LQ9A 5K14A 4IRKA 3CDUA 4M95A 3I5BA 2IA6A 1HYSB 1N4LA 1N5YB 1S1VB 1W25A 5I42A 1ZETA 3RB0A 1RTHA 2ZE2B 3QIDA 3H4DA 1S1XA 3CJ3A 4F4YA 2C2EA 4H4MA 4Q8EA 1C2PA 1RT6B 2FVRA 5EWFA 4URSA 5KFTA 2WK4A 3BGRB 1K1SA 1C0UB 4K4VA 2YNGB 3NAHA 2IC3A 1C0UA 1S6PA 2D3ZA 4H54A 3SFGA 1XR7A 1S1TA 3D5MA 4LQ3A 4YR2A 2OPSB 2UVUA 4ZHRB 2CJQA 3TAMB 3HKWA 2JEGA 1S1XB 5KT3A 5L1IA 4ECTA 5KG6A 4RW4A 3KHHA 1HYSA 2WOMA 3V6HA 1T94A 5I3UA 5CYQA 4PWDB 1RTJA 2IJFA 3MR2A 1TV6A 1DTTB 5F8NA 5DLGA 3BR9A 4LSLA 3KMSA 3CO9A 4G3IA 4TY9A 4ECWA 1REVA 5HP1A 2OH2A 2W9CA 1T03B 2JEIA 4ZP8A 3KJVB 3NBPB 4J9KA 3OSNA 5I42B 1N48A 1S1VA 3DLGA 4KFBA 4EBDA 2HNZA 3PW2A 1IM4A 4KAIA 1S9EB 5KG1A 4TYBA 3KLEB 1EETA 1C1BA 3HVTB 3TVKA 1I6JA 2V9WA 3PW4A 2WRMA 4RW6A 1HARA 4ZPBA 3PW7A 2R8KA 3KOAA 1HNIA 3DYAA 3MR6A 3V6JA 1LW2B 4J9PA 1S10A 2BE2B 3JYTA 3DLKB 5F8HA 4ED1A 4QPXA 4J9MA 5F8MA 3FQLA 2FLPA 4QWDA 2ZD1B 5F8IA 2RF2B 5KT4A 4R5PA 5J2QB 4PUOB 5HBMA 2OPPB 4WXWA 3CJ2A 1MMLA 3GIJA 1J5OB 5J2NA 1MU2B 5KFFA 3MECA 5J2NB 3H5XA 3ISND 4R8UA 4RNNA 3M9OB 2WONA 1SH0A 2D41A 3MF5A 1SUQB 4RW9B 1RT3B 2C2DA 2IBKA 3GV7B 2W9BA 4YR0A 4ECXA 3DRPA 3LP2B 4K4ZA 3CJ4A 4RW7B 4ECUA 1HMVA 1QE1A 5F8JA 4WE1A 5C42A 1GX6A 3GIMA 2I5JA 2DPJA 2UUTA 4R0EA 4F4WA 2I1RA 4J9LA 3MR3A 2JC0A 3CDEA 4FS2A 1JIHA 3GV5B 1D1UA 1UWBB 2RF2A 1HQUB 4LSNB 3BSOA 1RT7A 5C24A 3BSCA 1FKPB 4RUAA 4IFVA 1S1UA 3H40A 4K4SA 4QWAA 2IM3A 2ALZA 5L1LA 4Y34A 5KFSA 3Q8QB 2C22A 3IS9B 2HMIA 3PR4A 4Y2CA 3ITHA 1N6QA 2BRKA 1RDRA 1S6PB 1RT2B 1S48A 4TLRA 2R8JA 2RDJA 4Q44A 1JLAA 2GIQA 5J2PA 3KK3A 3LANA 3DDKA 2XCAA 3OLBA 3KNAA 2JLEA 4MKBA 4WYLA 2R8HA 1BQNA 3MR5A 1REVB 5F8LA 1JLFB 1WNEA 4Q45A 1JLQA 3H5UA 1RYRA 3QGIA 4I2QB 2XWYA 4JV2A 1IKWB 1IKXB 1C0TB 4TQRA 3PW5A 1RTJB 1IKWA 3FQKA 4NLDA 3Q8PB 4I7FB 3LP1B 2VG7A 2IJNA 5KFYA 5DQIA 4H4MB 5KFKA 5L1JA 1T05B 1FK9B 4ID5A 3DOKA 3QO9B 1JLGA 4NCGB 4NZ0A 1N5YA 2BRLA 4QWBA 3CDWA 1RT2A 2W9BB 1TKZA 1TL1B 2IM2A 4EBEA 1S9FA 3DRRA 5KG4A 5HLFA 3LAKA 2BANB 4NLQA 2VG5A 3LAMA 2XGPA 4KBIA 3KK1A 2QE5A 4DL5A 1QAIA 1VRTA 2YNFB 5J1EA 3CIZA 4QWCA 4Q0BA 3NKYA 4IDKA 5J2MB 4GC7A 3MEGB 2FVQA 4EEYA 2DPIA 5KFHA 3DRPB 3LP2A 2YKNB 2E9TA 4Y2AA 4ZPDA 3BSNA 5D3GA 4F4ZA 1JLBA 2YKMA 2ZKUA 5KFQA 4FBUA 4RNOA 1RA6A 1RYSA 3DOLA 2I5JB 4R8UB 3DOLB 2OPRB 2XC9A 1RT4B 3C6UA 4ECVA 2HNZB 3BREA 3MTKA 5DG9A 3QLHB 5KFEA 3DLGB 4KFBB 5FDLA 3SFUA 5HROB 2JEJA 4NRUA 3CJ0A 4MK9A 4OL8A 4MIBA 2YNIB 1HPZA 5KG7A 2OPRA 2R2TA 4M94A 4Y3CA 4RZRA 1LWEB 5CYMB 1SV5B 4KV8A 4K4UA 2W9AA 4ZP7A 4ECQA 3MEEB 1T3NA 4RW7A 2YKNA 4IG3B 4KB7A 2VA2A 5KG2A 4O3OA 4WFXA 2R2RA 4O3SA 5C5JA 1HNIB 3DYAB 1SUQA 4MKAA 2EC0A 2YNFA 2B6AB 2AX1A 3QIPB 1JKHA 3M8QB 4I2PB 4TYAA 3KK2A 3GQCA 1IKVB 3H4BA 2GIRA 4R5PB 2B5JA 1HNVB 5J2QA 5L9XA 3RBDA 1C1CA 1TL1A 4PUOA 1BQMA 1RT6A 4JUZA 2W9CB 5KFVA 2JC1A 4WYWA 3VQSA 1BQNB 3JYTB 2FJXA 2E9RX 2R2SA 3UR0A 3KK1B 2J6UA 4KE5A 4J9SA 4DL7A 2W8KA 1CSJA 3NGDA 3JSMA 1C1BB 3HVTA 5KFPA 4ECYA 3CWJA 3H5SA 3OL8A 3EPGA 4PWDA 1TKZB 4I7FA 1S0NA 1HNVA 1S9GA 5KFBA 1SH3A 5EWGA 1DLOB 5KFXA 1T05A 4I2QA 1T03A 2B6AA 2VG6B 3QIPA 1S49A 3MEDB 3G6VA 2XGQA 2GC8A 2VG6A 1IKYA 4RW8A 1S1TB 1FKOA 1HQUA 1DTTA 4LSNA 2RDIA 2B5JB 5KG3A 4ZP6A 2B43A 3FFIA 1SH2A 3DLEB 4ZPCA 1JLQB 3IN5A 4FBTA 5KT5A 5T14A 2E9ZA 1S6QB 1TVRB 4NLSA 4NLOA 4WFYA 1TL3B 1RTDB 3HVWA 2WTFA 4NLTA 1RT7B 4HYKA 5JUMA 1S97A 3BQ1A 1ZTTA 3M8PB 4U6PA 2F8EX 1DTQA 4IH7A 4RUCA 3RAXA 3RB4A 5DG8A 3KK2B 1RT4A 2AGPA 4JV1A 3BQ2A 4WZMA 4PQUB 3KLFB 3V6DB 1TKTA 2W7PA 5KFLA 1HMVB 2ZD1A 1RTHB 2ZE2A 4EO6A 3OL9A 2IMWP 3OSPA 4ZVHA 4O3PA 3RAQA 2HNDA 3C6UB 4EYIB 3KHGA 4Q0BB 3MFIA 1LWEA 2WHOA 1VRTB 4XPEA 2XI2A 4DEZA 4TQSA 4B3OA 3ISNC 3IG1A 4FS1A 4TY8B 4EO8A 3PW0A 5D3GB 2ASJA 1NNDA 2YNIA 2XCPA 1RT1B 4NLGA 4O3NA 4ICLA 3KLHA 1RTIB 4YR3A 1S1WA 5KT7A 3IGNA 4ECZA 2WONB 5HP1B 2C2RA 4ID5B 3KHLA 4X2BA 3RB6A 4O4GA 3G6YA 1LW0A 4KO0B 5KFNA 3V81B 4ED3A 4WXOA 3DM2A 1TV6B 4O3QA 5HBMB 3DRRB 3DMJA 3GYNA 2VG7B 3FSIA 4J9RA 1JLBB 4TXSA 2VA3A 4EBCA 1JLEB 4ZVGA 4TN2A 5KFDA 1RT5B 3I5AA 1FK9A 1R0AA 1LW2A 4U7CA 4ECSA 4ZVFA 3KJVA 3I0RA 1KHWA 4ZPAA 1S0OA 2OPSA 3CJ5A 3FRZA 2R2UA 3LP0A 4K4WA 3LP1A 3V4IB 1S9EA 4IRCA 3KK3B 3LALA 4HKQA 1JLAB 5J2PB 4XO0A 1KLMA 2ASDA 4J9OA 1LWCA 4MFBB 4NLRA 3UPFA 2WOMB 4J9QA 1JKHB 2R8GA 5KFWA 2HMIB 2AGOA 1JLFA 3IS9A 4YMEA 3MEDA 3KLVA 4DL6A 3N6LA 3KLIA 3I0RB 1LW0B 4IG0B 4ED6A 4IH5A 3KLIB 4ZP9A 2HWIA 4QW8A 5F9LA 1S9GB 4XPCA 4IG3A 2AX0A 4ICLB 3KLHB 1RT1A 1BQMB 1RA7A 3HVAA 3N6MA 5K14B 1Z4UA 3E51A 2ILYA 4IR9A 3I5CA 1NHVA 4Q43A 1U09A 3V81A 2V0NA 3BJYA 2UUWA 3PJXA 4I2PA 5F9NA 1JLCA 4B3OB 4NLVA 2UVVA 5EDWA 2W8LA 4DL3A 5EUHA 5DQHA 1GX5A 5KFRA 4NLYA 1NHUA 1C1CB 2FVCA 4IH6A 1RT5A 2XI3A 3CVKA 3H98A 4IFYA 4KKOA 1LWFB 1EP4B 2RKIA 4O4RA 5JXSA 3BGRA 5KFAA 2HWHA 3KLGB 3GIKA 5DG7A 1TQLA 3OL7A 1QUVA 2R8IA 4RW9A 3M8QA 5KG5A 1N6QB 3OLAA 3IGVA 4KV8B 4NLUA 4O44B 3V6DA 3DM2B 1YVFA 4O44A 2HNYB 2UVWA 1JX4A 4KO0A 5DQGA 4QW9A 3T5LA 5KT6A 4IFVB 4RNMA 3M8PA 1FKPA 2AWZA 4RNHA 4GC6A 4ZVEA 4ED2A 4DG1B 5KFMA 4KKOB 5KFCA 4K50A 3IRXA 1RT3A 1XR5A 3QGGA 3QZ7A 3D28A 4KHRA 1HQEB 3Q8RB 1SV5A 2UVRA 5J1EB 3KLFA 4KSEB 4NLWA 4TY8A 3IG1B 3I0SA 2C28A 2W7OA 3TQ1A 4ED7A 3DI6A 5HLFB 4IRDA 4NLXA 4ECRA 2J6TA 1EETB 3GIIA 3T1AA 3HHKA 3FFIB 4DG1A 5KFGA 1VRUB 2YNHA 1EP4A 3E01B 3KLGA 3MFHA 2FVSA 2IAJB 1JLGB 1VRUA 2YNHB 3E01A 3NMAA 1K1QA 1S4FA 2BE2A 4O3RA 2FJWA 1S6QA 1IKYB 1TVRA 2HNYA 5KFUA 4ED0A 3UQSA 3KLEA 2BQRA 3N6NA 2D3UA 4WFZA 1DLOA 5F8GA 3OHBA 1KLMB 1LWFA 2RKIB 4G1QA 4ZMMA 3NBPA 3IRXB 4RNFA 5CYQB 3H59A 5C25B 4RW8B 2BQUA 3JSMB 4YQWA 3BQ0A 3C6TB 4RU9A 3EPIA 2JEFA 4F50A 3OL6A 4H4OA 3NL0A 3M9NB 1ZTWA 5EWEA 4MIAA 3Q8SB 3DLEA 4IQXA 4DL4A 2HAIA 4JV0A 2OPQB 1TKXB 4URGA 3ITHB 3T5HA 5DGBA 4RW4B 4MH8A 1IKXA 1C0TA 3DOKB 3QO9A 4NCGA 1RAJA 4O4GB 4IG0A 1S0MA 3RBEA 5KT2A 3C6TA 3TAMA 3G6XA 4Q8FA 4ZHRA 1QAJA 3UDLA 2ILZA 5C24B 3OHAA 3GILA 2J6SA 5KFIA 1R0AB 3M9MB 1OS5A 3FDSA 3KHRA 2QV6A 2IC3B 5KFJA 2YNGA 4IKAA 3PVXA 2OPQA 3H2LA 5I3UB 3LP0B 2O5DA 3QGHA 2CKWA 4NRTA 3PZPA 3QZ8A 5DGAA 4WE1B 5C42B 4H4OB 1D0EA 2IM1A 3QYYA 1S1UB 3EZUA 4K4XA 1TP7A 1HPZB 3NAIA 1S1WB 1JLEA 1TKXA 2FLLA 3KMQA 5C25A 1LWCB 4MFBA 1UWBA 5KFZA 4URQU 5CYMA 3QLHA 2AU0A 1JXLA 4PQUA 2WCXA
chains in the Genus database with same CATH superfamily
3I0SB 3V4IA 2P2CB 4IOBA 5AJ3F 3PIOQ 2FJVA 1J5OA 1UVIA 4QWEA 2J9EA 2EXUA 2AEJA 2FLNA 2ATLA 1HNZF 2Z58B 1SIWB 2BEFA 4P72A 3SI8A 2ZHOA 3H7HB 2ZH5A 2FLOA 1RTDA 3Q22A 4F8RA 4PXDA 5U47A 2EI5A 1XR6A 2GGPB 3D0IE 4LF6J 3R5BA 1FFGB 1QJHA 2A10A 2PT0A 3BZQA 3DI6B 3NGSA 4J9UE 3VZIA 4K4YA 2V4QA 3CD0A 3QT7A 2YKMB 4FZVA 1AB8A 1WORA 3BSAA 5ETTA 1DTQB 1HBMB 3A8JA 3D3CJ 3HT3A 3RB3A 4JI6F 4X4QA 3TUPA 1WKKA 3DRSB 2CJBA 1H74A 5T41A 3PM9A 5HROA 1RK8A 3KG1A 3ICLA 2N3OA 3HO1A 1JLCB 3QSYB 2XNQA 3TEGA 3NS7B 5K8MA 1Y5IB 1VLYA 2V4RA 1KQKA 5B0EA 1UL3A 4KHMA 3PR5B 1JJ4A 2AQ4A 2DNYA 1S7HA 1YIJS 5E7OB 1QY7A 1URRA 1U2CA 2APOA 3NWGA 4YUDA 3HVRA 5DO2A 3FGVA 4A8WA 1S1VB 7FDRA 1DHMA 2ZJQQ 2R7UA 3PEHA 5K20B 1LNQA 2FJDB 4C98A 1RTHA 2ZE2B 3QIDA 1OO0B 3RBXA 2UU9F 2NXNA 2K8GA 3CC4S 4C8ZA 3NCPA 5EWFA 5KFTA 5IT0A 3QFWA 4K4VA 1NJIT 3MXHP 4OYIA 5GMKa 2RRBA 1S6PA 3SFGA 3J7ZT 1S1TA 3JAMU 4USUA 1KLNA 2CQDA 1RBOB 1GAOA 2HBRB 1Y9OA 1O6XA 3D66A 3QT6A 5CH7B 3VVTA 2OELA 2YX1A 3BO3A 5L1IA 1TK5A 5HMXA 4ECTA 4X66J 5IS2A 4FKYA 2O66A 3PY8A 3C3LA 4LRAA 3K5PA 5KG6A 1F6TA 2MQPA 5HVFA 2G4BA 3OQ2A 3RU0A 2WOMA 4JI7F 4I67A 1HYSA 1VGYA 4F3OA 3HF5A 2B9WA 1D8ZA 1R0CB 2IJFA 4OHZA 1PC4A 3MR2A 4XK8C 4RU2A 1FFSB 2B7CB 3MM5A 2DHHA 3HJFA 4RL1A 1WOPA 4TY9A 3MPDA 4OX7A 5DJBA 4ETZA 5HP1A 2XO7A 2W9CA 2QLFB 1BQXA 4A8SA 2JEIA 2AP6A 3TVZA 3NBPB 1HR0J 4NXNJ 1N48A 2AJ2A 3D6MB 3DLGA 3FNNA 3NGTA 3OR2A 3VF0B 3PX4A 1FVSA 1GH8A 1ZBTA 2DGQA 1K47A 1U1LA 4KAIA 4A8KA 2F9DA 2K06A 2V9WA 3I9ZA 1R8CA 2F4FA 2D1CA 3KDOA 1XTZA 2MY7A 5M2PA 3K58A 1S0VA 3MOZA 4QIWD 3KOAA 1QLNA 4J9PA 1PBAA 1F5AA 3KDNA 1J5EF 1Q4RA 2B4PA 2XLKA 2ZOMA 4HTIA 4QPXA 3B4DA 3DU5A 2GJ2A 1VQKS 3D0HE 2ZD1B 5F8IA 4N5SA 2OSRA 2NSBA 4C48A 5I4MA 4PUOB 1B0TA 3DRXA 1Q8LA 1HLWA 2ACYA 4LF2A 3TAPA 4M5GA 1MU2B 4DV5F 3EWGA 4GKKJ 2Y1RI 3WIVA 1ACMB 2Y0SD 4ZN1A 3K5MA 4BDPA 1WSRA 3JQKA 3UR3C 2ZHBA 1SH0A 2D41A 4HH1A 1SL1A 2GQQA 1SUQB 2Y9HA 1HNZJ 5A0YA 2IBKA 4DPOA 2HHVA 1Y5NB 2W4CA 3R5CA 4P7TA 3NGUA 4UF4A 4CLSA 3THTA 2W9BA 3EYZA 4ECXA 1NKCA 1EHWA 2YWHA 1FD2A 3CJ4A 1PG5B 2HBYB 4L75A 4V19J 2P6TA 1A0OB 3M7VA 2XMUA 3GIMA 3TVYA 1KKHA 2DPJA 2UUTA 1NBEB 2FPHX 4F4WA 5G0RA 1HR0F 2ZH7A 2JC0A 2YKPA 3KUGA 3R97A 3SSRA 4FS2A 1UVNA 1Y3KA 1TK8A 1D1UA 3X3UA 4OYPA 2A3JA 1UWBB 2RF2A 1FXRA 2HURA 3ULHA 1V6HA 2J5AA 4K7QA 1PSDA 2Z4PA 5C24A 2GAGC 3MPWA 3HMJG 4RUAA 1DZ5A 1CQMA 1WWHA 3OR1A 2HFUA 4K4SA 2IM3A 2NYIA 5GAEI 1M5KC 5L1LA 3PRBA 4ZPTR 5KFSA 1MLAA 5IV4A 5FIIA 3ITHA 1N6QA 2BRKA 3FZ2A 1RDRA 3TO8A 1S6PB 2B8QA 2H48B 2IDEA 3R27A 3CIMA 5LJ3Y 3OV7A 3MWBA 3ISZA 4Q44A 3AY0A 3PKMA 4DUTA 3LANA 5B0DA 2XCAA 3T3FA 5D0HA 4LIRA 4TU7A 1RJJA 4WYLA 3HHLC 1UFLA 1REVB 4UUXA 5F3ZA 5D78A 5F8LA 2DVIA 2E7WA 3THPA 4UOHA 2WW8A 1RYRA 3VCDA 2DEIA 1OSCA 2AYGA 4NCBA 4JV2A 4RO0A 1IKXB 1HWIA 3MHYA 3PYFA 2W4PA 3AXKA 3Q2SC 4FXVA 4NLDA 3SCLE 6FD1A 1YJVA 3Q8PB 1KOOA 4B3MJ 4K0KJ 3LP1B 3I82A 5CAAA 3IC1A 2QSWA 4LR9A 4J91A 1XEZA 5CQGA 3UD4P 1FO1A 4HLBA 3MUMP 1T05B 2BJDA 4LF9J 2QGFB 4DUYJ 4ID5A 4NZ0A 3P6YC 1JLGA 3BO2A 1AYEA 5E41A 3VGSA 2CWKA 4ZCKA 1RT2A 2H3EB 1TKZA 1AW0A 2POKA 1S9FA 4IYQA 2AKWB 2E44A 3DRRA 5KG4A 3VZHA 2OI2A 4LJMA 3R6GB 1SKSA 3W65A 3LAKA 2BANB 4NLQA 2Q43A 3VAGA 1Q16B 1WKJA 3KK1A 4I6YA 1Z2LA 2V94A 4DMZA 3BN7A 5IQQA 4CP5A 1R43A 5DDOC 1FDNA 4OJHA 1KQSR 2FZKB 3NKYA 4Q0BA 4I69A 3UDCA 4DUZJ 5E3AA 2UV8G 2V2VA 3DLBA 4MAKA 4UY8T 1I5OB 2E5HA 3MGJA 4DV6F 5AXKA 1YJWS 4ZPDA 2CNOB 2ZKUA 2YKMA 3DU6A 4RNOA 1RA6A 1RYSA 4E2FB 2H65B 3HZGA 2CQ1A 2MSSA 1TELA 3QAEA 3I31A 3BV8A 2CZVC 4ECVA 3QPIA 2CPHA 2HNZB 5FD1A 3BREA 3MTKA 2ATCB 2G0JA 1UKUA 2KT5A 2C3OA 2AMCB 3HD2A 3BH6B 4M5DB 5FDLA 2G13A 3UDEA 1KP6A 2WVBA 2KXNB 1MW7A 2K1RA 3A3PB 3W3SA 4DR6J 4MIBA 2VKRA 2KJWA 1FJCA 3VAMA 3HHNB 3QSIA 4XIUA 2BV3A 1GXUA 3POTB 1QTNB 4DR6F 3JXOA 1ZAVA 2DNQA 4Y3CA 2ZH3A 4N41A 1LWEB 1RAEB 2DNNA 2RRNA 2W9AA 1GFWB 3TI0A 2M7SA 2OSQA 3H8YA 2LFVA 2DK2A 3LO3A 5DZ7A 4PRFA 1MSWD 2JFKA 4K59A 4DFJA 1MG7A 5B0BA 2DGOA 3SQGB 3GFYA 2NZ4A 4DSEA 4K2XA 2DKOB 4KY3A 1B64A 1SJ1A 4CO0A 2RQMA 4F25A 2B6AB 5HJXA 4ZITA 5EGYA 2MSTA 5KTQA 2ZBCA 2YX7A 4EGLA 2Y1LB 1X4HA 3GQCA 2DJWA 4U8VA 3K8VA 2EPIA 5LT5A 2GIRA 2KG0A 5J2QA 1TL1A 3W64A 1BQMA 3KJFB 2NREA 2E1CA 1BWEA 1YJTA 2HG4A 5GMDA 4JUZA 4D3HA 2CQ0A 5KFVA 4UT4A 4L74A 1BQNB 3JYTB 1HWUA 2GA7A 2GHWA 2KL8A 1U48A 2WBRA 1N52B 4J9SA 2YVSA 2B9YA 4DR2J 3JTPA 4FKXA 2A0FB 4JI8F 5LXYA 3CD7A 5GAEU 1TKZB 3EZ5A 2GS8A 3VGVA 3MMAA 4ZA1A 3PRDA 3Q83A 5L38A 1KVIA 1T05A 1C4CA 1HHTP 4BCAA 5H9FK 2KXHA 1YJRA 2B6AA 2VC0A 3GE9A 1T7PA 2UUBJ 2GC8A 1Y0HA 2VG6A 2Q66A 3LWLA 2JRSA 2HS0A 2QA2A 4LRDA 4RW8A 1FKOA 4ECSA 1V5IB 4UQTA 5D0RA 2QMUB 2XS5A 1E6VB 2KDOA 4LSNA 2RDIA 2B5JB 2GMLA 3PACA 4CWBA 5KG3A 3MOJB 2B43A 1NU4A 2FHMA 2LLZA 2WBMA 3M32B 2KVQE 2D9PA 1JLQB 3DC2A 4KQZA 2QL9B 1YKWA 3PV8A 1N32F 1RUSA 1RAIB 3EGWB 1U47A 1Q8IA 5T14A 2LU1A 1VDHA 3QT8A 3OFHA 1RTDB 1HFEL 1KDNA 3KWMA 1FX4A 1T9TA 2ZUGA 1WACA 2HS4A 2RB7A 1RACB 4L73A 4AQYJ 1SQFA 4BLGA 1RWOB 1VYAA 4ES1A 2E5GA 2HBZB 2V69A 1DARA 3UDVA 3BQ1A 1SKWA 3FEZA 3M8PB 1KSPA 2F8EX 2QYGA 3MM6B 1AA1B 2BJ7A 2HVDA 2ZC4A 2V67A 3RB4A 1EKSA 2FHKA 4FXWA 1RWMB 3DN9A 4A8XA 1RSCA 2XYHB 3KLFB 3D2WA 2K1RB 2W25A 2Z2LA 4KGZB 4EO6A 3OL9A 3CNQP 1PJ6A 2OD6A 2LMIA 3DHXA 3K7RA 4OYBA 3TZXA 4FPIA 4ZVHA 3VR1A 1XWLA 4EYIB 3IP0A 3MFIA 4GVBA 3PJ9A 2FGOA 3ZZZA 5DG9A 4B3OA 1FERA 2YBVA 3ISNC 1N0VC 1SJ3P 4IQXA 4ETXA 1WJ9A 3RAMA 2DNPA 3JQMA 3DKDA 2ZWOA 3ZNJ1 2HLTA 1CPZA 1NB2A 2NQPA 2B4OA 1WC6A 5EX0A 4DS4A 4DZDA 2CQBA 1S1WA 2V2QA 3IGNA 4ZCIA 3O5TB 3S1TA 2C2RA 1YHQS 2C3MA 4O4GA 4DUZF 5HMZA 2MZJA 5KFNA 3A4TA 2LQ9A 5L8RC 3TUJC 1NK4A 3E2EA 3FMWA 3FSIA 3AODA 4J9RA 1NB7A 1JLBB 2IDLA 3VAIA 4EBCA 1ULRA 4C8LA 2HHQA 1PAUB 1PJ5A 1SCJB 2ERRA 3D3BJ 2RHQB 2M2BA 2P9GA 2U1AA 2KRRA 3JTNA 3NCRA 4HI1A 5C7PA 4YB1P 2Z2YB 2RQKA 4LSZB 2R4FA 3C15B 1RU1A 3T6BA 3D0GE 5F0UA 3V4IB 3LP1A 1S9EA 2K3KA 3D67A 1A9NB 1W2IA 2Y8YA 4RWXA 1JLAB 5IT9Y 2M9KA 2PFDA 3QGPA 4UZBA 4ILLA 3RBZA 1FJGF 4Y0FA 4CLPA 3UE2A 4RLEA 2WOMB 4QIEA 1IR1A 2MMYA 2R8GA 4EWTA 3HXMA 3MEDA 3W61A 2NZCA 1RHUB 3EGVA 3KLIA 3I0RB 4DN9A 4IG0B 2KG1A 2E1RA 5D0EA 4OX9J 2GX8A 1Y00A 2M4MA 2PMHA 3KLIB 3MM5B 2FZGB 4L6V3 1RWVB 3G2XA 4QW8A 2MQOA 1S9GB 5H1SV 4XPCA 3NNAA 4AE5A 1BMQB 4ICLB 1CQNA 4F02A 4IR9A 3N6MA 1VC0A 4FYVB 3H25A 3R6LB 2HFOA 2PMWA 3M8YA 2Q6CA 1PCAA 4Q43A 4I2PA 1YJ9S 2H5JB 2JDJA 1VC6A 3G4SS 2UVVA 3CMQA 4QCLA 4MYUA 2BJ1A 4DWIA 5LOQA 3G9CA 1ITPA 2H51B 4NLYA 1C1CB 2FVCA 1Z1ZA 3G82A 2XI3A 3H98A 1ZPWX 4IFYA 2VA2A 1LWFB 2RKIA 3KLGB 5E3QA 4E98A 5HJYA 1M5SA 4U95A 2R8IA 3ILOA 2PA3A 2NXJA 4DFPA 3RW6A 3DXSX 1U24A 4KV8B 4Y00A 4O44A 2UVWA 3BM7A 5DQGA 4B02A 3J7AN 3BKTA 4AYBD 4C2MA 2ZM6J 3E3XA 2EFVA 4DV7F 4IFVB 5HI7A 4ED2A 2NXUA 2QEXS 1LK5A 4DG1B 2AIRB 5A0YB 1KTQA 2UVRA 4KHRA 1OMSA 1CBKA 1SV5A 4W4MA 3G71S 3KYLA 3K17A 1JJ2R 5BYSA 1S6OA 2IVYA 1T11A 1QVFR 2YQ1A 1IWGA 3TX8A 4PABA 3EGZA 3DI6A 3THVA 4B9UA 4NLXA 4B3SF 1CJUB 3ENWA 3OTOJ 1WG5A 2FJBB 1U6ZA 2LXIA 2OMOA 1JMTA 2J8SA 3M2UA 5CD4A 4AL6A 2HFNA 4DG1A 1VRUB 3E01B 3KLGA 2MKCA 2Q1LA 1UTAA 2IAJB 3OBIA 1NK9A 1S4FA 5MLCV 1GXLA 1SVDA 2BACA 3D9BA 5DM6Q 3M8WA 5E0OA 4ELUA 3TYTA 1S6QA 2IVMA 1HKAA 1UAWA 4AFFA 1TL5A 1ZOTA 2MQLA 2FUG9 2GMHA 3N4WA 2BQRA 3M6UA 5KOWA 1UETA 1CS4A 1N5QA 1CC8A 4X4SA 3I56S 1Q7YT 4C4WA 1BD6A 1AZSB 4DX7A 4F2RA 4G1QA 3PHTA 4HT5A 3W9IA 2XG8A 2VBXA 5C25B 1K0VA 3GR0A 3KNGA 4UOFA 4OZJA 4ES2A 3KUHA 3RGIA 2VQEF 4TU8A 2MJUA 3BS9A 3OL6A 4LF4J 2AW0A 1ZAWA 3M9NB 2F4VJ 1KC8T 4F36A 3PW4A 3C14B 4MIAA 2LXFA 2VHGA 2BOAA 4C3MA 2CQIA 2ZZNA 5IFMA 1M90T 4URGA 3T5HA 1R89A 2F3JA 3KJQB 4LBHA 1C0TA 4RW4B 4NCGA 3N5FA 4AXJA 4Y2MA 4B3RJ 4B9MA 1T9YA 4P2MA 4IG0A 1N34J 5FJ4A 1EQ0A 1PBUA 5KT2A 1Y11A 3C6TA 4BWMA 4X62J 1IR0A 3CCES 4JI7J 1P1TA 3Q8YA 4FXDA 3QAUA 5HATA 3OHAA 2HRYA 2CPXA 2QYCA 4X66F 3GILA 4C0HA 4CO4A 2DNOA 3DXBA 5DS7A 4ZVTB 5KFIA 2Y0BB 2MXYA 4TVAB 2QA4G 4IKAA 2L48A 2OPQA 1RADB 3GIRA 4IOCQ 3SSSA 4BHQA 4LVNP 2ZITA 5IXUA 3QGHA 2CKWA 1M5HA 2PO4A 5D6GA 3WX4A 1YZ7A 3OVBA 1Q1KA 4FP9A 5DGAA 3CEDA 1ZAXA 3TJ9A 2QO3A 3ILJA 1AFIA 4LFBJ 3UN2A 3EZUA 4A8OA 4K4XA 3MMBA 1HPZB 3NAIA 3NNCA 4ED5A 4DV7J 2UUBF 1PYTA 2X51A 2IHR1 4LRBA 4TNOA 4F7VA 1KD1T 4CT8A 4LF9F 2XS7A 2CUYA 1HA1A 1NLKL 2B51A 2OEJA 3QLHA 2ZDOA 5CCLA 3J7YI 3SV4A 1KFDA 1JXLA 5D4OA 1RP5A 5CXTA 1T0TV 2PEBA 4Y65A 2WVFA 2VQFJ 1UJ6A 2OPPA 4MK8A 1G3OA 4TLQA 3B78A 1UZHA 2FYXA 1R31A 1RHRB 4FF3A 4QU6A 3L7OA 4OI4A 3O6QA 3DRSA 2LEPA 3P8BB 4ITSA 2XNRA 3I87A 1H38A 3IMQJ 5ETPA 1TL3A 3UNGC 1JXVA 3J7Z5 1Q53A 1UJ5A 3K5OA 3PHEA 1JJHA 4JI6J 5M2RA 2GGPA 1J2VA 2GVZB 5KFOA 5KG0A 3GV8B 1N56A 3NGKA 1FFWB 1R6YA 2FVPA 4IR1A 2AGQA 3JSYA 1WI6A 1NH8A 3DHWC 4F4XA 4OI2A 2ZDPA 3T5JA 4DPYA 2KZMA 4CLFA 1NJZA 1VQ9S 4J9NA 1HBNA 3MAQA 3ETOA 1VQ7S 2ASLA 3P4UB 1P6TA 1VQLS 4YHHJ 1U6BA 2ZH1A 3MM6A 5FLXU 4YP3A 1KHVA 1UMJA 3G86A 2F4VF 1Y5LB 3I5BA 4P52A 3IBCB 2HQCA 2J9DA 4RUBA 4Y2KA 3RTVA 1HYSB 2PC6A 3C16A 3SDEB 1W25A 4OHWA 4FF4A 3RB0A 1G6BA 1Q82T 3H4DA 3FUYA 4C11B 3AXMA 1RLDA 1YG0A 2DXFA 4H4MA 4X4RA 3HK2A 1UCNA 4ILMA 3CJQA 4NXMF 1QAYA 4ZVPB 3TUZC 1SBRA 1Q79A 3BGRB 1C0UB 3R7BB 2ZH4A 3AAWB 2IC3A 2HLUA 3FSXA 4LBIA 4W98A 2IVFB 5BR8J 4F2SA 2FHJA 2D3ZA 2JHEA 1WF2A 4H54A 3BN4A 1YJNS 4NCAA 4OHVA 4LQ3A 2AEFA 4ZHRB 2QA4S 1UVJA 1RWXB 4ES3A 4HT7A 1E6YA 2JEGA 5KT3A 3I9V9 2QMXA 3QBCA 4LIWA 2HFZA 2LU2A 3A3NB 4BWJA 3OTOF 1HD1A 4B17A 5HSPA 5AE1A 1XNRF 2VDIA 3KHHA 4UQGA 5CZXA 2DCUB 2RUSA 4CH7A 1JWWA 1T94A 5CYQA 2MKHA 1TUVA 4CYUA 3ZZUA 5K8NA 1TV6A 2QC3A 2MZSA 3MPUB 3HULA 5BYRA 1I94F 5CD4H 3UVJB 3VGUA 3CJSA 4FF2A 1NDLA 4G3IA 1E6YB 1L3VA 1REVA 3RZAA 2OH2A 3TW0A 4GO5X 1YX2A 3L7PA 4P74A 4J9KA 1VBZA 5I42B 1X4CA 1RLCL 1XBWA 4KGXB 2QA1A 2HVHA 1WI8A 4DR4J 1JB0C 3PW2A 2DR5A 5KG1A 3WBZA 5LXRA 3TARA 1VQNS 1EETA 3HVTB 2VOOA 3TVKA 1FNOA 4LF7J 3D1QA 2WRMA 4PPDA 2HRUA 3PW7A 2OIHA 1MWYA 2NPIA 2OEKA 1FHTA 2XSFA 3MR6A 1S10A 1FRIA 2BE2B 3H0PA 2MZQA 2A6OA 1T02A 3I55S 2NCKL 1TL4A 4UUWA 1O5JA 2KHCA 2RF2B 2F1FA 1H2UX 1TMJA 5HBMA 3CJ2A 3NEKA 3N28A 1K8AT 1CS4B 5J2NA 3J7A1 5J1PA 5J2NB 5G0RB 1KONA 5HN0A 3PX0A 4DSLA 3FSYA 2C2DA 5E3CA 1PYSB 4EZ9A 4ALZA 4DLEA 2QSFA 4X84A 1SB6A 3W62A 4YR0A 4K4ZA 8ATCB 4CI0B 1PC5A 2IYGA 4RW7B 1HMVA 3HX9A 4C8KA 2ZWPA 4WE1A 1GTHA 1VJQA 2G2OA 1REGX 2HQDA 4R0EA 3VTIA 2W7AA 3M8SA 3FBBA 3LPEA 4F3MA 3CDEA 1JIHA 2DNLA 2J9DE 3GV5B 4M5JA 3VAHA 2CG4A 3CULA 2B0GA 3HHEA 2RS2A 4PCQA 4C3LA 5A8WA 3IRWP 4CO5A 1Y3JA 1RT7A 1HBUB 3BSCA 1U4BA 5A2QU 3UCUP 4F67A 1S1UA 2B56A 3SBMA 3GFXA 4QWAA 2F40A 4AT1B 4X65J 1CVJA 1PILA 1RWNB 1FRKA 2AZ3A 2P5VA 4Y34A 3ZO7A 3GJTB 3IS9B 4Z37A 5LMNJ 2HMIA 4Y2CA 1ZM3A 1EJ7L 2DXEA 3CJTA 3GJRB 2VZ9A 1RT2B 2QX0A 2R8JA 3GYXB 1HI8A 2RDJA 4LRCA 2YQ3A 2CNLB 2EC2A 2BBEA 3KUEA 2V8PA 4RKUC 3OLBA 1D8YA 2X7IA 4K8RA 1RHQB 1BQNA 3MR5A 1WNEA 3BB5A 2GFFA 2CVEA 3H5UA 4USJC 3K59A 4ZPVR 2XWYA 3W8GA 4DL5A 4TQRA 3TA0A 2DO4A 1RBAA 1V3ZA 1FTRA 2QMWA 5HVHA 3NWRA 4D3GA 3HFVA 3Q86A 2VG7A 2IJNA 3UI3A 5LMUF 4YB7A 1A7GE 4UZCA 5DQIA 3PX6A 5F8NA 2HPUA 3Q8VA 3SCIE 1W2BR 3IAS9 5KFKA 2XLIA 1FVQA 3P45B 5L1JA 2I2YA 1LEOA 1SJRA 3MM8A 4P10A 3CSKA 4OX6A 4NCGB 5HVGA 3HPOA 4ELVA 3R5AA 1N5YA 3CDWA 5IZHA 3J80U 2IM2A 3U02A 2HRTA 1EB0A 1JXEA 1P8GA 1M1KT 1N54B 3NY0A 5ETVA 2HBQB 2L08A 2LDIA 2X3DA 3LAMA 4KBIA 2A6MA 2QE5A 3FKBA 3POTA 4OYAA 4WFAQ 1QAIA 1VRTA 2JH3A 5J1EA 3CIZA 3F0NA 3I96A 2AYEA 4LREA 4OZ2A 1OPIA 2M52A 4ER8A 1Q5YA 1KFSA 2R42A 4M5MA 3TRGA 5B08A 3LP2A 3Q89A 2YKNB 5DDQC 4O0IA 3BSNA 1SXLA 1JLBA 2RIJA 2KM8B 2K3IA 1RAHB 2JSXA 1GXTA 3DOLA 2PSZA 1VK3A 2I5JB 3V2UC 3ZTOA 3GJQB 1H3DA 3DDNA 4V1Ak 3R9LA 4R8UB 2DGSA 2XWXA 1NUEA 2DR6A 4NA3A 2KT2A 2KFZA 3JTOA 4KFBB 3OW2R 2XMKA 4YDDB 5HROB 2JEJA 3CJ0A 3M2UB 4OZ1A 1ZS6A 2MKYA 1WDTA 2D9OA 2MZRA 1HPZA 4MK9A 4OL8A 2DGXA 1QSSA 4DSJA 1TFWA 4QU7A 1D9AA 2ZH9A 1VI7A 3HD1A 1OPZA 2R2TA 4RZRA 4LF8F 1ZA1B 5CYMB 1NJYA 1S76D 3BDEA 4K4UA 1HI1A 4CYUB 3MUVP 2F8HA 2ROPA 4RW7A 4WU3A 1H2VZ 2JX2A 4IG3B 1T9UA 1N5SA 1R27B 3L09A 3P96A 4KB7A 3WX8A 1ZH5A 4DR1J 2R2RA 2ROEA 2XGPA 4MKAA 3KKFA 2QLWA 5GADU 2YNFA 3W7BA 2VPYB 2HW3A 2C3PA 1S59A 1JKHA 3HSZA 4I2PB 2ACMA 2HVIA 2NSCA 2YWGA 3HDSA 2V8VA 4R5PB 4PYAA 5L9XA 3RBDA 2B7BB 1M1HA 6AT1B 2W24A 4WK1A 2KVIA 1V3RA 2PMZD 2W9CB 1G1XA 1GQEA 3R1HA 2JC1A 4I0WA 2RE1A 1X8DA 5IC4B 1JNZB 4OHXA 3UO0A 4U67Q 1U1MA 3IWXA 2XO6A 1X5TA 2W8KA 2QT7A 3J80Y 4CLKA 4ZJOA 3NGDA 3JSMA 1C1BB 1UA1A 2EW9A 3CWJA 3H5SA 5GVQA 3EPGA 2UXCF 1S0NA 1YBTA 1GK8A 1HNVA 3M2VB 2FQQB 5KFBA 3R2CJ 5IQ6A 5EWGA 1DLOB 5KFXA 5DDRC 2QFJA 5LMUJ 4Z2XA 2XZDB 2CJ9A 1V3SA 3G87A 1S49A 3MEDB 5K5MA 3EDRB 4ZIVA 1KEKA 2EKNA 3BO4A 3NGRA 3ZZOA 1IXKA 4E0DA 2KKHA 3RUBL 4KJIA 3OVAA 2UXDF 1UW4A 1KN6A 1WTBA 2IYIA 1SH2A 2V68A 4DV5J 2UP1A 4FBTA 1WHWA 3PDNA 2AJ4A 1NSQA 2HZVA 5H9EK 4DCOB 1TVRB 1U02A 1FCAA 1TL3B 1VLOA 3FBFA 2QFIA 4RPFA 2K2PA 1RT7B 4HYKA 1U1RA 2EBEA 1VBXA 5IM0B 5ETKA 1LOUA 3TUIC 4JI3F 3EVWA 2VKZG 2RILA 4IH7A 2JNJA 4RUCA 3NMRA 3PG9A 2GCFA 2WSCC 3MMJA 5DG8A 1BLUA 4Y6IA 3P49B 4CO3A 4XTTA 4PQUB 4ZLNA 2CAJA 3B54A 2BJ3A 3HT0A 2CG8A 5KFLA 4CM2A 1HMVB 4ZK7M 3W2VA 2ZM6F 3N0VA 4P7VA 2MJNA 4USHA 2G1DA 2V8HA 1CG2A 2NPFA 3MURP 4DQIA 4QYZK 1LQ9A 2CNKB 1VIOA 2HNDA 4CTAB 4F4KA 2BMBA 1LWEA 3SIPB 5BXIA 1YWXA 2NUUG 2XI2A 4WK3A 2PEHA 4TY8B 3GFHA 4EO8A 2CQCA 3PW0A 3LTOA 5D3GB 2ASJA 4KGKA 2DIUA 2WVCA 3FCWA 2XY7A 1FA0A 4CLTA 4CLYA 2OP5A 1FDAA 1RT1B 2DD8S 4ICLA 4NLGA 1RTIB 3O1LA 5HP1B 2WONB 1IBLJ 2DR8A 3VHQA 1N88A 3MR7A 1QM9A 1RGVA 1IJFB 2AJFE 2RNEA 3G6YA 3VAFA 3JQJA 4H4KA 2N4DA 4J7CA 5H9EJ 4ED4A 2JFDA 4DL0C 3PTWA 3DMJA 1SC3B 2PA8D 2VG7B 3I6PA 1P9QC 3AT1B 3G8SA 3UCGA 2EFQA 4C0BA 2YWWA 1TK0A 5I3QA 4B9SA 5KFDA 3I5AA 1FK9A 4M5NA 1R0AA 3MM8B 1LW2A 4U7CA 4ZVFA 1RAOA 4CH1A 2AV5A 3I0RA 1MN9A 1XMQJ 1SKUB 4CIOA 4JI2F 1AFJA 2JOQA 4DBQA 3CJ5A 3FRZA 2R2UA 2QL7B 2VFVA 4Q7AA 5J2PB 2RVJA 3MMAB 1F3FA 1KLMA 1WC0A 4J9OA 4S0MA 5LSOA 1GNKA 3UPFA 2XHWA 4NE9C 2XMMA 2CQ2A 1RTZA 2M88A 4X64F 1JLFA 4J9QA 2HMIB 3C2PA 4G6VB 3KLVA 1XNQF 2C42A 1LW0B 2E29A 1FWPA 3UVJA 4DF4A 4CO1A 3CCJS 2ASYA 2W2OP 2VV5A 4NOHA 5F9LA 2IFXA 2MQQA 2FIUA 3OFFA 1WOSA 2B8PA 1X5OA 3IM9A 1RA7A 2VBWA 1DQAA 4YDXA 1Z4UA 2KB2A 2XMJA 1ZYQA 1NK5A 3CJRA 3I5CA 1I51B 1RI7A 2AT1B 1U09A 4LF1A 3BJYA 5F9NA 4OFZA 2MQNA 4HHHA 2VJVA 1JLCA 4B3OB 4CQ1A 1UW9A 4MIWA 5CYJA 4DR5F 3AJ2A 4DPTA 4DL3A 1APSA 5DQHA 2F65A 1GX5A 3MAAA 2KM8C 1NHUA 5LM7E 3MD3A 1RT5A 4PG4A 3BBBA 3CVKA 4R0JA 3BQ0A 1U8SA 2BJ8A 4O4RA 2D69A 3ET6B 2WB1D 1KS2A 3W60A 1N6QB 3E8OA 5A6WA 2CPZA 2VOPA 3IGVA 4NLUA 2L41A 3DM2B 4QR1A 4I4BA 1YVFA 3CW2C 2HNYB 1K73T 1JX4A 4KO0A 2ZNZA 4NZ6A 1L3KA 3SSQA 3K5NA 1GT8A 4QW9A 2FY1A 3CC7S 1TL7A 1FWLA 4GC6A 3M8PA 1FKPA 2C2NA 3FMBA 4ZVEA 1X31C 3L7UA 1CJTB 2QZ8A 4KKOB 1WTFA 5KFCA 3RRHA 2F9JA 3QZ7A 1XR5A 4K50A 3SXLA 3D28A 4OI0A 3Q8RB 3ONQA 1UA0A 1S72S 1FNMA 3KLFA 2KXFA 1U7LA 3ZZPA 4CLZA 4TY8A 4C9DA 1VISA 3I0SA 1N33J 3TQ1A 1SPBP 3JSRA 5A6PA 4IRDA 3DOMA 1UEKA 2W2QP 2FJEB 3T1AA 4YFUA 4DN0A 1WOOA 3UD3P 2BE9B 2IRUA 2JJ4D 3FFIB 2M70A 4CDIA 1EP4A 5JMNA 4FN5A 4EK2A 1VRUA 1NO8A 3BPSP 3E01A 3EE3A 4I64A 3NMAA 3NNHA 2FY8A 4DR1F 2NXCA 2ZHAA 4EFAC 2HNYA 2HHHJ 1CULA 2KFYA 3CJKA 4JYAF 4Q5VA 1HHQA 5ETQA 1EKRA 5F8GA 4KPYA 2CPJA 3OHBA 1TKDA 5RUBA 4DUYF 4ZMMA 1NM2A 3GP9A 3GYGA 5CYQB 4RNFA 3QJLA 2JZ5A 9RUBA 2MTLA 4RW8B 4IUFA 4L3KA 3W5XA 4W92B 2F7VA 4RU9A 2R7RA 3QRPA 4K0KF 2MZ1A 2Z2ZA 5EN1A 1ZTWA 1F5BA 2OUGA 3ETMA 3VALA 3A1YG 3NG8A 1OJ4A 2FJAB 1GMUA 2EKYA 3NP5A 3Q8SB 2B4VA 1Q8KA 1T9VA 2X1AA 2ZH8A 4OIXA 1RQ0A 3BEGB 4USVA 3C19A 1RWWB 2OPQB 4JV0A 2KH9A 4DSKA 4ZLLA 2AEMA 1DRZA 1IKXA 5AE2A 3DOKB 3QO9A 4ILRA 1XMOJ 1S0MA 3RBEA 4GVLA 3LGNA 4MJKA 1AROP 3G6XA 1EZZB 2M0GB 2HZAA 3IWLA 4FNIA 5C2CA 2I6WA 1QAJA 4KTQA 3GG0A 3SQOP 3M9MB 3FDSA 2IC3B 1YSJA 2HIYA 2YNGA 4ZVOB 3ZFVA 1I1GA 2C2MB 3HCXA 2VC1A 4IO1A 3PVXA 2DGUA 1AXQA 2A2DA 4OJ1A 5I3PA 5I3UB 3HKZD 3LP0B 2J0QD 1VC5A 2P9CA 1RAGB 4NRTA 1B7FA 3ZTSA 3PZPA 3QJPA 2C3UA 2OTLS 5AT1B 5C42B 1Q7LB 1HHSA 2OTJS 3QYYA 2VU5A 3GPAA 4NXMJ 5CHCB 1Q95G 2CYYA 3RJMB 1N36F 2QN6B 2GVDB 4DV2F 1JLEA 2KO1A 2PN6A 2Z0GA 2XMTA 1YQHA 2DHXA 2V8DA 3HLUA 4NI2A 5C25A 5DM7Q 2KU7A 1UWBA 2ZFHA 2AU0A 2RMLA 3AA9A 1IKVA 4GKJF 2OAUA 5L1KA 2EG1A 5K8PA 2UXCJ 2GVZA 4X4OA 1HBNB 3QQCD 1F1BB 4DCJB 3CXCR 2ZOGA 3H5YA 5E3RA 3V6KA 4E8UA 1N36J 4K4TA 4PXBA 3CCSS 5A8KA 2G0CA 2HHPA 1UPPA 2OKQA 5MAOA 1ZM2A 2IAJA 2ZZTA 4G1QB 3W9JA 3DLKA 1UVLA 3AJ1A 4AL5A 4JI4F 1RE1B 3PJWA 1H73A 1XERA 2DB1A 3KG4A 3T19A 2D7SA 1X4FA 2AJ1A 1FJEB 1XN9A 3HSDA 2A1BA 2G2ZA 2LKZA 4NYZA 2ROGA 3GONA 1QE1B 3ENVA 4OI3A 4DFMA 1DY3A 4J37A 4NPOA 2JEFA 1B0VA 2BANA 2C1EB 2HEKA 2HNDB 2KI2A 4CTAA 1HNXJ 2PI4A 1HQEA 1HW9A 1RAAB 3K2YA 5JVHQ 4MK7A 2MQMA 4AD6A 1FKOB 4DL2A 4IDKB 1DJ0A 1MROA 3U7JA 3CCRS 1P1LA 1TKTB 3TAQA 1NK8A 2IM0A 1RHMB 1VQMS 4ED8A 2GO8A 1G2EA 3HHLA 2UZAA 1MU2A 3HHDA 3K0JA 1L5UA 2EEYA 1UEVA 1URNA 1RWUA 3SCKE 2IY5B 1BUXA 4OMFG 1FF2A 2Z30B 4LQ9A 4JB8B 1NKEA 2B3TB 2AHOB 2M8DB 4P2FA 4LFCF 1X60A 4NXNF 2IA6A 3CJ8A 3OR2B 3ELHA 4DOZA 2B4UA 2V34A 4N8OA 4DQSA 1WSVA 1ZM4A 3CJ3A 4JI1J 2VIHA 2YXLA 1C2PA 1YRXA 3LUYA 2FVRA 1V9OA 4X4NA 4YY3J 4URSA 3U1MA 2WK4A 2XM3A 1K1SA 3NAHA 3N5BA 4FDFA 1ELOA 3QFHA 1C0UA 4GRSA 3CCVS 3OXLA 1P9YA 2JVRA 1KQGB 2MKJA 3CCLS 3FJ2A 4JI1F 1XR7A 2HSEB 3D5MA 2Q79A 4L72B 5J1NA 1YITS 2OPSB 3HHLD 5F41A 3C14A 4BBYA 3HKWA 1S1XB 3NOGA 3OTEA 3PYDA 3ILLA 1BE4A 1R8AA 3SQGA 4RW4A 3T41A 2UUCF 4NYPA 2VASA 3V6HA 5I3UA 1BY9A 3HI9A 4I56A 3CCMS 2KJVA 1H2TZ 1NPKA 5A8RA 3ZNUA 2DR7A 1D9FA 1OY9A 1S77D 4PWDB 2XYPB 1DTTB 3PFEA 4DX5A 5DLGA 3BR9A 3EXCX 4LSLA 3C8YA 2Y1JA 3KMSA 5DZ6A 2RU3A 3FC9A 4I6AA 1U25A 4A47A 2QTWA 2UXBF 1ROFA 4U7UK 4ZP8A 6FDRA 3KJVB 8AT1B 1U2FA 2KT3A 5IT9U 1RWPB 4F4AA 2VQEJ 1S1VA 4EBDA 3OUYB 3QRQA 1FD8A 2HNZA 2B9EA 4NMXA 3CCTA 3W1YC 1S9EB 3WQPA 1B4SA 4K5RA 4TYBA 1CJUA 5HQ8A 2U2FA 1NZ8A 4RW6A 1HARA 2V5HG 1Q78A 4PZVA 1LFPA 2LVWA 4QJVA 4ZPBA 3N79A 4KGVB 2CIMA 1NPPA 2XTJP 3V6JA 1VR6A 3JYTA 5KOXA 3MCSA 4LUBA 5F8HA 4J9MA 5F8MA 1M1GA 2N4CA 2FLPA 3CGIA 4ZCMA 5SZTA 4QWDA 5KT4A 5L46A 5J2QB 4ID8A 1J27A 1S5ZA 2H4YB 2OPPB 4WXWA 1VQ5S 2FJWA 4NEYA 4NYOA 2XS2A 3T6JA 3O8WA 3ISND 1OY8A 4R8UA 4CNYA 3MUTP 3OJSA 2LEBA 2PI5A 3I4PA 1DQ9A 4RW9B 3BBFA 4XDCA 1VK8A 1GEHA 3BGLA 2PFFB 3LP2B 1WHYA 3SMZA 4RUHA 4Q2LA 1H98A 3ZZTA 4RBVA 5M2UA 1IBKF 2IJRA 2CPYA 1QE1A 5F8JA 1GX6A 2I0XA 5HAOA 1KNZA 2I5JA 5E33A 1QVGR 3A13A 2I1RA 2WAQD 4J9LA 3AD7C 4EMDA 1NPRA 1N8RT 4JI5F 1N5TA 5CABA 1Y7PA 1N5VA 1NDKA 2DYAA 3MM9A 1OQ6A 3O44A 3W9HA 1HQUB 1LXJA 3BSOA 1RKIA 4HH0A 4DR3J 4FF1A 2Y3YA 3OPKA 4UTGA 1B3TA 1FKPB 1D9DA 2DNMA 2LQ5A 3DGPA 4PG7A 2DHSA 3P5TL 4PG6A 4YEAA 4ZVQB 3H40A 2JLGA 1QAXA 4NEZA 2XMAA 3OFGA 4AQYF 2ALZA 2UUCJ 3L9ZA 4MMOA 3TZYA 5ETRA 2YPZA 4C7QA 1DURA 3ZZYA 2ZBPA 2HHTA 2KTQA 4USIA 3UW1A 1EIYB 5L9NA 1JLAA 2GIQA 1PKUA 2E1MC 3DDKA 3TQEA 2O1PA 1FRXA 1WEZA 2JLEA 4QZVB 4CM0A 2HGMA 3BGOP 2LDYA 2R8HA 1FESA 1FEEA 3PNIA 4Q45A 2YWEA 1JLQA 3T1YF 1SQEA 4HDHA 4I2QB 2HQIA 2Z57B 3HSGA 4RBUA 1W26A 5F3TA 2X1FA 1IKWB 3SV3A 3SZ2A 3PW5A 1RTJB 3KFWX 3FQKA 1WHXA 4N7TA 3W2WB 2CJKA 2AD9A 3MEKA 2GQCA 2VD3A 1P27B 3FZBA 1UFWA 1DFDA 2HHXA 2H5IB 1CEZA 1IR2A 3FBEA 3UCZP 2H54B 1YBUA 3GB0A 1CJVA 3DOKA 3QO9B 4DI6A 1VIXA 2BRLA 2VICA 4QWBA 2W9BB 5A8WB 1TL1B 3TJAA 2D3O1 2IA0A 1KBRA 4DJBA 1U2RA 3AHPA 4JI3J 3FEXB 3A8KA 1K9MT 1SIZA 4WBFA 2CZ4A 2A2CA 2CWXA 3RYLA 3OVSA 2WSEC 3JSBA 4IDKA 4X4TA 3DCAA 4GC7A 1NCLA 3IFEA 3F41A 5LSRA 3DRPB 5KFHA 2E9TA 4Y2AA 4LF6F 2QG9B 3WIUA 5JVGQ 2CJAA 1SL2A 1T9WA 2D3OR 2E5JA 1LFWA 4KGMA 1HWJA 2JWNA 2QLJB 2OPRB 3DOLB 4WCEQ 3NLCA 4DV3F 2YKOA 3IR5B 3LQVA 3DLGB 3MDFA 1VBKA 2D74B 3EM1A 3R3TA 1IQTA 4ELTA 2E1AA 4NRUA 1KWMA 3S7RA 1IQZA 3Q24A 3B6BA 3T9ZA 1PO6A 3OTDA 3U1LA 5KG7A 2HQGA 3U1NA 3OXGA 4W90B 3ENAA 1ZZNA 1FI4A 4CT9A 3GMGA 3R8YA 2OPRA 3AB2B 4M94A 2DNRA 1DAXA 4DV3J 4NA1A 2K7KA 2CXEA 3MEEB 4WJBA 4ECQA 1U1QA 1T3NA 1RAFB 1X9SA 2HQ3A 3D7SB 4DDFA 4CLUA 1U1KA 5ETNA 4QYRA 1T95A 3MCOA 2BDPA 5KG2A 1WDDA 4WFXA 4KPCA 4O3SA 5G4DA 1HNIB 3DFEA 1SUQA 3DYAB 5C5JA 3PO4A 2EC0A 4YOEA 1NEEA 4N77A 4DV6J 1X4EA 1QSYA 2AX1A 3QIPB 4TYAA 3FK4A 1Y10A 3IO1A 3KK2A 2DY1A 2F63A 2GQ2A 5ETMA 3TZWA 3M6XA 2CQGA 2VPXB 4TU9A 1FRJA 3PCOB 4QBUA 1IBCB 2B5JA 5LMNF 1QDUB 1O0PA 1M5OC 2DR9A 4PUOA 3I32A 2BXJA 2HWTA 2FGCA 4M5LA 4AXIA 4X65F 2XY5A 3CD5A 3GJSB 3KXDA 4FVCA 4WYWA 3VQSA 2V8GA 2FJXA 2E9RX 3HP6A 3UN5A 2R2SA 3KK1B 4FYWB 2I8EA 2O3DA 1WC5A 4X64J 4JV5F 2ZUAA 2YTCA 4KE5A 2L9WA 4LRFA 3KJNB 4M5IA 3GLJA 5KFPA 4ECYA 4G65A 1BXNA 3VAKA 2MYFA 5EX3A 4V19X 3IXQA 2EFGA 3PO5A 4Q2MA 3LA0A 2L3MA 4I2QA 2BVZA 1VMBA 3RW7A 3QIPA 2CPFA 4BC7A 1H72C 5HL7Q 2ZJPQ 1WC3A 1IKYA 3M2RA 3R2DJ 3N01A 3BPDA 2XY6A 4X4UA 4J90A 2VBYA 1DTTA 1TAQA 4U9RA 1BC6A 4B9LA 5K9FA 2GHPA 4ZP6A 3BBCA 1UEUA 2G0IA 4KR0B 3FFIA 4F26A 5IOLA 4PG8A 2BX6A 1YJUA 4PYDA 4GVBB 4NWBA 2E9ZA 2DT9A 4NLSA 4WFYA 2RDDA 3M05A 4NMLA 3Q8UA 2WTFA 2CNNB 2WVEA 2ZOFA 4NLTA 1NJWA 3W66A 4CLWA 1XJWB 1S97A 3S8SA 2R7OA 1FNXH 4XDDA 3PKYA 2VBZA 4OYOA 4PKDB 3VV2B 3J7YU 1NAQA 3GU0A 1X0PA 3QNWB 4ZLPA 3RAXA 4LF5F 4JV5J 1NK7A 2AGPA 4WKRA 3MD1A 3BF4A 3PYEA 5A2QY 1WEXA 3BQ2A 4WZMA 2R7WA 3OXFA 3V6DB 2W7PA 4HHUA 1NK0A 1TUWA 1RTHB 2ZE2A 2IMWP 3A12A 4OZ0A 1W7WA 1ZA2B 4P6QA 3OSPA 3M1VB 2DNZA 4I1TA 4O3PA 5D4NA 4C0OC 5HANA 4DPUA 2IRXA 2G2YA 3MMCB 4Q0BB 4PWWA 4H4KC 4XPEA 5E2QA 3G96A 3Q0AA 2QJ3A 5C2GA 3IG1A 1B99A 2MY8A 3D1OA 1FTCA 1YZ6A 1PGZA 4DS5A 2YNIA 4TKTA 3D6HB 1H6KX 5JJBA 1SC6A 1X4DA 2BUNA 3KTQA 4YR3A 5KT7A 4ECZA 1HBMA 4ID5B 4YB6A 4KHPJ 3KHLA 1GMWA 3RB6A 1LW0A 1TR0A 2BABA 2KRBA 1IUJA 1YRTA 4WXOA 4ED3A 1TV6B 5IWAJ 3DRRB 3GYNA 2OEMA 2MHNA 1NJXA 4F04B 4WTYA 5IM0A 3AFGA 4QIGA 4TXSA 4HEA9 4PWUA 2ZJRQ 2VA3A 2YH1A 2J7KA 4U7UD 2PGCA 4DQPA 1HL6A 1RWKB 2N7YA 1R6VA 4DHVA 4CZCA 3KJVA 2NR0A 3QATA 3C46A 3NS5A 4OJ3A 5HO4A 2HYIB 4K4WA 1BHNA 1I3OB 5SUHA 1SJ4P 3AD8C 3HFZB 1IBMJ 3LALA 2ZZMA 2GJIA 2OLWA 1OYDA 3OTCA 5LL6d 2M5YA 4ZPWR 1H7WA 4NLRA 3UN3A 3QJJA 1KVJA 1WELA 3B82A 4F0MA 1IBMF 4YMEA 2DEJA 2LYVA 5EHHA 1FDDA 4GMKA 4UY85 4IH5A 1BWVA 1SI9A 2XZTB 1CJKA 2CVIA 1YGYA 2HWIA 4OZ3A 3UNYA 1QSLA 1KVKA 4CLLA 2FC9A 2YX4A 3R1LA 3CMES 3KLHB 1MMNA 1RT1A 5D0GA 5K14B 5T7LA 4USWA 4RBTA 1LXNA 4HVZA 1X5SA 1FRLA 1IBLF 3CDBA 3V81A 2V0NA 2UUWA 4OI1A 3EMTA 1VRQC 2XHCA 4NLVA 4EU0A 1NDCA 3TR5A 5D15A 1R3NA 2E7XA 4WP3A 2V4JA 1CJTA 4KKOA 4IH6A 1WHVA 4NL5A 1OY6A 3VAJA 1L3UA 4ANDA 1NSPA 1AZSA 2MDAA 4OYXA 5KFAA 2X1GA 3TEHB 2COLA 2HWHA 3W5YA 2CQHA 3CC2S 1TQLA 5DRKA 3OL7A 1QUVA 4RW9A 2VH7A 3BR8A 3M8QA 3MI7X 5KG5A 4LR7A 2R7TA 2Z2MA 2N3LA 3BGFA 3B4MA 4MT1A 1VQ4S 2HK2A 2ZNYA 5CA5A 3T5LA 3EDQB 1QTMA 4O0NA 3A8EA 4DR2F 3CCUS 4RNHA 2BW2A 2AWZA 4FNHA 1C4AA 2OGUA 2QRRA 3TP2A 4A46A 4OX8A 2DBBA 4DPXA 4WP8A 3QGGA 3R5JB 2XQCA 3G6ES 1HQEB 1X4GA 2W1BA 1VS3A 2AZ1A 3WZ0A 1AUDA 3AA8A 2ZH6A 1NHKL 4QIVA 2HKEA 1OQ3A 2J0WA 4WIQA 2DNHA 3LF0A 3R7NB 3IG1B 2MLZA 3J81Y 4IOAQ 2W7OA 1TAUA 4ED7A 1WC1A 3CUNA 4B9VA 4ECRA 3JB9k 3GIIA 1SKRA 1HBOA 2HGLA 2PIIA 4GO7X 4DV1J 3HHKA 1RBLA 2FC8A 4USTA 5KFGA 2YNHA 2FVSA 3MFHA 3MMBB 1JLGB 1K1QA 4O3RA 1B0PA 2DIVA 2BE7D 2FHJD 1TVRA 4OZLA 1NH7A 5BR8F 3J81U 2OD4A 2C2ZB 5HQLA 4B3RF 2UXDJ 2R7XA 1RHJB 2LQBA 1F2GA 2Z56B 2LA6A 4WFZA 2DRAA 1DLOA 1F9HA 2DGTA 2VFRA 3ZTQA 4A8QA 1KLMB 1LWFA 2RKIB 3NS6A 2FZCB 5B09A 1CC7A 1EX8A 3NBPA 3QRRA 2GZOA 1NZAA 3IRXB 3H59A 2BKOA 1UZDA 1RCOB 4N56A 4WP9A 2BQUA 3JSMB 3G8QA 4YQWA 2R7VA 3C6TB 2BKNA 4ZJQA 2CPDA 3P5BP 1KRPA 2VPZB 4I6WA 4IO9Q 4DV2J 3OD2A 2HAFA 2XYGB 1RHKB 4DZ6A 5B7WA 2RRAA 2CQ3A 2UV8A 4OYWA 4Z7CA 5D8HB 1FXLA 3W63A 3ITHB 3L3CA 4MH8A 5ETOA 1IJEB 4FYXB 1RAJA 4CRJA 1MWQA 3UD5A 4C8MA 2DGWA 2DO0A 4QIFA 2PE8A 4ZS6A 2ILZA 2XBPA 3UDLA 3V5RA 2RH3A 5C24B 4U8YA 2KN4A 3A3OB 1MMDA 1YBAA 2QLXA 4KC5A 1OIAA 2CDQA 4OI6A 3FEYB 3Q23A 3H2LA 4C3KA 1SL0A 2O5DA 4ZDNA 3J81j 2J9CA 2FB0A 3M30A 5B0AA 4H4OB 2VJUA 2ZBQA 1D0EA 2IM1A 2SXLA 2YKAA 1M5PC 1WG1A 2NLWA 1S1UB 1HQ2A 2YKQA 3L4BC 4ZCLA 4WF9Q 2DH8A 1S1WB 4KH1B 2GW8A 4LFAF 1TKXA 2FLLA 4CCHA 1LWCB 4K5SA 4MFBA 1WF0A 5L39A 1MWZA 5CYMA 1AUSL 3MPVA 1EQMA 4PQUA 4EZ6A 3NXZA 2WCXA 5HMYA 2HQFA 5GAHU 3HHLB 1B70B 3IM8A 3CJKB 4JI8J 1X9WA 4NLPA 2V2ZA 2XEXA 2UUAJ 3MM7A 3MMCA 1FRMA 1TTHB 4PPZA 3DLHA 4MKYA 3CD6S 1XK8A 2HHHF 4N47A 3ILIA 3MEGA 2BR0A 1Q86T 2BJ9A 2WB4A 3MEEA 2R3VA 3PRVA 4G1PA 3DMJB 4WZQA 3F44A 3DOMB 3GCWP 2DNKA 2HGNA 4RW6B 1RKJA 3HFKA 5B0FA 3MECB 3D1HA 3TA1A 2VG5B 2PD1A 5BYQA 1RZMA 3K89A 4IFYB 4X62F 1RTIA 3T5KA 5DLFA 1RU2A 1V5VA 3ZXWA 4OX9F 5J2MA 3O2IA 4ZOSA 5FDLB 4EYHB 3GCXP 3GSDA 2BQ3A 1H0HB 2CA9A 2VONA 4IQMA 1FT8A 2J0XA 4LSLB 3MPYA 1T9XA 1WF1A 4PXEA 1Q0NA 1TMMA 2JLFA 2ZH2A 5K14A 5T7LB 3CDUA 3M32A 1U1NA 4IRKA 4JI5J 4M95A 3QWUA 2JVOA 4GKJJ 3UFCX 1N4LA 1N5YB 5I42A 2Y1IA 1ZETA 1CJKB 1VOMA 2AJ0A 5CCMA 3W2VB 5IV3A 1S1XA 3BYPA 4F4YA 3C66A 2X1BA 3TJ8A 3UWTA 2C2EA 4Q8EA 1X4AA 1RT6B 4A8YA 2MGZB 2DISA 4OLPA 2RU9A 3TNVA 2MLYA 4CH0S 4DV0J 2O67A 2YNGB 1XNRJ 4DXLA 1FX2A 1YRUA 3SYZA 1MN7A 4YR2A 2UVUA 2CJQA 1SC1B 3TAMB 4KHPF 3IR6B 2YY3A 3DLJA 4DF8A 4PQAA 4L76A 4DV1F 3H42A 2JL9A 3BKUA 4KRWA 1GTEA 4J5OA 5CZVA 7AT1B 1D3WA 1RXOB 2EK1A 1J5EJ 5K8OA 2AF6A 1XNQJ 1RTJA 1UJ4A 2RUGA 2ZBIA 5HK4A 5D4LA 2V9KA 3CO9A 1NSKL 4ECWA 2ALYB 3TANA 4B9NA 2P6SA 3TX0A 1T03B 1S99A 1NMEB 2HHWA 4WU2A 1S79A 1LK7A 2KYXA 2LQ8A 2H9ZA 5THWA 3OSNA 4B9TA 4KFBA 3BKFA 4JI2J 2CJYB 3LWMA 1R8BA 1IM4A 4X4VA 3KLEB 1C1BA 3CCZA 1I6JA 3GSIA 5GMEA 4C8NA 5D4PA 2GHVC 4KT0C 2R8KA 1FXDA 3FRYA 3OT9A 3IBFB 1HNIA 3DYAA 4N8NA 3G8TA 1LW2B 2LCWA 3DNCA 2CADA 2HS3A 2I9SA 1WEYA 2FTRA 2VFSA 2DY9A 2W2NP 3DLKB 3M6WA 1ZZFA 2EK6A 3IR7B 3NOCA 2C3YA 3SEOA 4UOGA 4ED1A 1R8PA 3FQLA 3JS9A 3PYGA 1NKBA 3EICA 1U0SA 3AB4B 4EUVA 4F0HA 4R5PA 2HHUA 4M5DA 2BZ2A 4F0KA 3GIJA 1MMLA 2YH0A 4LVOP 1J5OB 3K8WA 3M6VA 3DLLQ 5KFFA 2KFNA 1G4CA 3MECA 3H5XA 2RQ4A 2BW7A 2BKPA 3GR1A 3MAHA 2WONA 1LKZA 4RR5A 3MF5A 4RNNA 3M9OB 4DR5J 1IBKJ 4A8FA 1RT3B 2F5GA 3FCVA 3GV7B 4DFKA 4PAAA 5GAGI 1WD6A 3DRPA 4HR2A 1UWAA 2RSQA 4PR6A 4QPTA 3ZZ0A 4LF7F 2XB2D 1TZ0A 2QLBB 4ECUA 4B08A 4DX6A 2LECA 2AJQA 5C42A 4ERDA 2HFSA 1FJGJ 4OV1A 1DQ8A 3TWZA 2CRLA 3ET6A 1X4BA 4YB5A 3MR3A 2LP4A 4DQRA 1E6VA 2YWKA 4LSNB 2DH7A 3MAAB 1I94J 2MKSA 4IFVA 3K5LA 1VQOS 2N82B 3ADAC 4HI2A 4DSFA 2CQ4A 1F60B 1HWKA 2YWFA 4DX8H 1S4EA 4MKVA 3W5ZA 1YDLA 5IWAF 3Q8QB 3PR4A 2C22A 1HW8A 4I68A 2RAQA 2FD2A 2VF3A 1S48A 4TLRA 3W2WA 3OUYA 3AOBA 5J2PA 3KK3A 1FE0A 3KNAA 4DR7F 4X4PA 3MCNA 2ZVIA 2CFXA 3D54A 1UFKA 4MKBA 2MGZA 1CLFA 3O3LA 1JLFB 1UPMB 5H9FJ 4ANCA 4DV0F 3QGIA 2CJXB 2WVDA 1C0TB 3PFOA 1K0TA 2AYBA 1NXIA 2BM1A 1FRHA 1IKWA 1U6FA 4ZVSB 2V6AA 4I7FB 3BGUA 5D77A 4LF4F 1RABB 2RHSB 4WFBQ 2RQCA 1KOHA 5KFYA 4JBCA 4XAKA 4H4MB 4PXCA 3IA0A 2LQJA 3OTBA 3EUNA 1X9MA 2E66A 3GTYX 4M1KA 1FK9B 1Q5VA 3EGNA 3TOQA 3GG1A 2W4DA 2CPIA 3SDEA 1PYOB 1L3SA 4P9SA 1XMQF 2Y8WA 1OWXA 3WC0A 4LF5J 4EBEA 4FYDA 3H2VE 4DU7A 5HLFA 3CB4A 1VBYA 2VG5A 1OYEA 4P2XA 1KR4A 4ZVUB 2E5IA 3GWCA 3U27A 1LV5A 3D6FB 1IN0A 3CF5Q 2YNFB 4OLOA 1Q8BA 3FBCA 4QWCA 2BYCA 4PEOA 5J2MB 3MEGB 1BGXT 4KYZA 2E5LF 2YPYA 4EEYA 2DPIA 2FVQA 4B3SJ 1TL7B 2O01C 2PDAA 5D3GA 4F4ZA 4WKYA 4FBUA 3X1LB 5KFQA 5LJ5Y 1HBOB 4UOCA 3BH7B 4EI2A 5GADI 1GMWD 3H90A 1WC4A 4ATNA 1VQ6S 3NCQA 2XC9A 1RT4B 3MCMA 3C6UA 4YY3F 4NA2A 4QR0A 4PG5A 2VODA 1KTVA 3HJVA 3KG0A 3LH2S 3QLHB 3DDIA 4MYTA 2VB6A 1KQFB 1MROB 3SFUA 3WHIA 2J76E 2Z8QA 4OJGA 4ZVRB 2RS8A 1HNWF 2C2KB 2NS1B 5HQMA 3D4JA 4NZ7A 2YNIB 3R7SB 1FE4A 2IBOA 4HL9A 1O51A 4R25A 4CNZA 4CO2A 2IPOB 2GIFA 1UP1A 3N9UC 1IVZA 4LFCJ 1IWAA 2HVZA 1T3OA 2VFUA 1SV5B 4KV8A 3D68A 3EX7B 3RR7A 2HFVA 3AOAA 4ZP7A 2DNGA 3T1YJ 2XULA 3S6EA 3RRGA 2YKNA 4Y28C 1VQ8S 5ITHA 4P73A 3G82B 5IT4A 1VQSA 2EBGA 2V4JB 4O3OA 1FEHA 1VHFA 5A8KB 1NK6A 2OHDA 2QIFA 2MQ8A 3F56A 2LEAA 2KHDA 2VDHA 2I38A 3V4MA 1Q81T 2WW4A 2E5LJ 3M8QB 4Z7YA 1OSDA 3QMQA 1IKVB 3H4BA 1NDPA 3F73A 1D09B 1WG4A 5ADZA 5DDPC 1HNVB 3M2VA 4M8LA 1C1CA 3BYRA 4KH0B 2G1HA 4HDGA 3LGMA 1N33F 3VGTA 2XMWA 1TUGB 4YS2A 3CCQS 1RT6A 1U1OA 5AE3A 1RB0A 3UR0A 1R7IA 2R9LA 1X5PA 8RUCA 2J6UA 2IMOA 1NSAA 4DL7A 3CTRA 1CSJA 2M8HA 1U0HA 3HVTA 1LWXA 5A8RB 4PWDA 3OL8A 2NUHA 4DQQA 4B3TF 4I7FA 2HIQA 2MEWA 1S9GA 1SH3A 2EFOA 3AQOA 3CMAS 1YJ7A 3D6TB 5FLXY 4B3TJ 1T03A 3T9NA 1YI2S 2DITA 2CQPA 2VG6B 3LOUA 3G6VA 2XGQA 4F3QA 4WPAA 1TFYA 1S1TB 2F8MA 3DRYA 2HVEA 3RR8A 1HQUA 1XMBA 3CDAA 2W01A 2MKKA 2HZCA 3ZTRA 4ZN3A 4DR7J 2IIHA 3DLEB 4ZPCA 5A76A 3IN5A 2MZTA 9ATCB 3IWNC 5KT5A 4ENOA 1S6QB 4QOTA 2V50A 4NLOA 4LBPA 4NASA 1RISA 3HVWA 3VVUA 1S12A 2DCLA 3CT9A 4P71A 5JUMA 2X3GA 4U96A 3ZTPA 3PEJA 1TU0B 3MM7B 1M0SA 1WKLA 4OQJA 1ZTTA 2QL5B 1UVMA 1VQYA 4U6PA 1DTQA 2BA9A 4DU8A 1SJQA 4N76A 2DHGA 3KK2B 1HD0A 1RT4A 1HI0P 4JV1A 2EVZA 1XQIA 1PAEX 1TKTA 4A48A 4USKA 2J7WA 3AOCA 2BJEA 1Y4ZB 1WUUA 2OFGX 2LXUA 2ZD1A 2L9DA 3S01A 2G9OA 1VCTA 2ZVSA 3TZZA 2UXBJ 3RAQA 4ZIWA 3NRBA 3AD9C 3C6UB 1U49A 4O23A 3KHGA 3QWPA 4NX9A 1HNWJ 2EFNA 2P8IA 2WHOA 1VRTB 2OFHX 2DRBA 2ZC3A 4DEZA 4TQSA 1SJFA 1U8WA 1L3TA 3ZZRA 1F0XA 5DETA 4HACB 1A6LA 5KFEA 4FS1A 1U1PA 4JYAJ 2GO9A 1NNDA 2W2MP 2BOPA 2ADCA 2XCPA 4LFBF 2R7QA 4O3NA 3KLHA 4C8OA 3VWSA 3PIPQ 4YN3B 4AUKA 4FPRA 2DXDA 1N32J 1HWLA 4X2BA 2CDRB 2Q6BA 4KO0B 2J7UA 1S7IA 2C2OB 2OMLA 4OYZA 4WIIA 3V81B 3DM2A 4O3QA 3IAM9 5GAGU 5HBMB 4AL7A 4ANEA 2KYZA 3CPWR 3R5DA 3P3DA 2GV1A 5GAHI 3OFEA 1JLEB 2WZ1A 4ZVGA 2GVDA 4TN2A 2OO4A 1R8HA 2OJ3A 1RT5B 4RWWA 4OV6A 3LW5C 2V2KA 4QYZJ 1ICEB 2UU9J 1JJCB 1JNRB 2Q3PA 3EZOA 2VL1A 3C15A 4J9VA 1KHWA 1N0UA 1YLXA 2V63A 1F2HA 2OPSA 4ZPAA 4DLGA 1S0OA 3LP0A 3ENQA 4KIAA 2A18A 4M63A 4USMA 4IRCA 4JI0F 2EWHA 3KK3B 4A8MP 3HSJA 4HKQA 5IC6B 4XO0A 2ASDA 3WDOA 2MHEA 1HIYA 1LWCA 2FDNA 4MFBB 4OZNA 1VFJA 4RX6A 1VJWA 5KAKA 1JKHB 3M8RA 5KFWA 3EVMA 2AGOA 4BC9A 3IS9A 4MTPA 1XIQA 4DL6A 1CJVB 3N6LA 1QD1A 2ABYA 4C6AA 5BJRA 2XZWA 4ED6A 4BS2A 4A4JA 1Z2ZA 4ZP9A 2L9NA 3M30B 3OJUA 1HNXF 2N7CA 3BDPA 4IG3A 2AX0A 3CCWA 4FYYB 3WC2A 1YK9A 1EAYC 4GKKF 1JQGA 1DBDA 1BQMB 1FDBA 4ZJLA 3K57A 3HM9A 3HVAA 3Q2TC 3E51A 2ILYA 3FCHA 4ZLJA 1O8BA 1NHVA 1MNEA 2H1YA 2YQ0A 3CO0P 3FVYA 4C97A 3PJXA 2LA4A 4JI4J 4G1IA 5EDWA 2W8LA 5AXMA 5EUHA 4C11A 2R7SA 2HK3A 5KFRA 4C8YA 3MTJA 2RJZA 2EFPA 2ADBA 1S57A 2AYMA 2DHAA 1EP4B 5JXSA 5DG7A 5AJ3J 3BGRA 3M8ZA 3GIKA 1FWKA 1ZPVA 1S6UA 1B7YB 1QUPA 3RRKA 3ZC4A 3M4XA 2DGVA 3OLAA 4O44B 2GNKA 2XMVA 3V6DA 2EG2A 3AJDA 2MPUA 2VPWB 3I4HX 3T1HJ 4JI0J 1NRKA 2RD5C 1X7VA 5F0WA 4JP8A 5KT6A 3M1VA 4RNMA 1X0FA 2J8AA 4JOUA 5KFMA 4YHHF 3EJMA 2NXEA 1RT3A 3IRXA 2H5EA 4HTJA 1FKAF 5J1EB 2BM0A 2ZBRA 2GMJA 4KSEB 4NLWA 2XSJB 4HACA 4P75A 1H7XA 2C28A 2XSJA 4OYMA 2KZZA 5HLFB 1T8EA 2DH9A 3B8HA 1GMVA 2J6TA 1EARA 1EETB 2ZKTA 1SC4B 4LR8A 4WTOB 4M5HA 4NI2B 4ZKAA 5B0GA 4L3NA 3EVOA 2YNHB 3PXGa 3A8IA 4DV4J 2BE2A 3GZ7A 3GFZA 4LT6A 1XMOF 1VHIA 4LMZA 2ZEJA 4UW2A 1IKYB 3M2RB 5KFUA 3JAMY 1PIEA 2B9XA 1F3VA 2P9EA 2RT3A 2CZ9A 3UQSA 5HMWA 4ED0A 4B3MF 1K44A 3AQPA 4Y2IA 3KLEA 3W8PA 2DRDA 2D3UA 3N6NA 2XLJA 2UUAF 2VUGA 4M5KA 2DTJA 3R5GA 1XC9A 4LF8J 4WFNQ 2CPEA 1F5CA 2H4WB 4DPWA 1G7CB 2MLXA 4DR4F 5E5NA 4DSIA 1AT1B 1F9FA 1ZM9A 3EPIA 4K2JA 4F50A 4H4OA 1M5VC 3NL0A 2VQFF 5AXLA 4LFAJ 5EWEA 3CE8A 1U45A 3DLEA 4DL4A 2HAIA 1U26A 4OZ5A 3MZIA 1TKXB 1RCXB 5DGBA 3L95X 2K7JA 1PJ7A 7FD1A 4FVMA 4HHJA 3US5A 4QQBA 4O4GB 3RG6A 2MB0B 2J0SD 1F9EB 3TAMA 3HZEA 4P2SA 4QR2A 4RJVA 4ZHRA 3IBWA 1YTYA 3SCJE 4Q8FA 1HBUA 2HHSA 2J6SA 1VQPS 5ETLA 5B0CA 3EXYA 5LSLA 2VFTA 5AXNA 1R0AB 1OS5A 3KHRA 2QV6A 3LGHA 5KFJA 3C16B 1SQGA 2WSFC 1N34F 5ETSA 3VQTA 4DV4F 3QT5A 2W2PP 1U0HB 2E7VA 2IRYA 2GAHC 1CULB 4OHYA 1FJ7A 3AH6A 3QZ8A 4WE1B 4DR3F 1UVKA 3OR1B 3DGPB 5E3PA 1R0BG 1TP7A 2NYHA 3H2UB 3LPYA 1JK9B 2M3DA 2MKIA 3H20A 3KMQA 2GJFA 1IM6A 4DCPB 2E1PA 3T1HF 3MM9B 5KFZA 4URQU 4WWSA 3TA2A 2FHOB 3DGVA
chains in the Genus database with same CATH topology
3I0SB 3V4IA 2FJVA 4IOBA 5AJ3F 3PIOQ 1J5OA 1UVIA 4QWEA 2J9EA 2FLNA 2ATLA 1HNZF 1SIWB 3SI8A 2ZHOA 2ZH5A 2FLOA 1RTDA 3Q22A 4F8RA 4PXDA 5U47A 2EI5A 1XR6A 2GGPB 3D0IE 3R5BA 3DI6B 1QJHA 2A10A 2PT0A 3BZQA 3VZIA 4K4YA 2V4QA 3CD0A 4FZVA 2YKMB 3HT3A 3RB3A 3BSAA 1DTQB 1HBMB 4JI6F 4X4QA 3DRSB 2CJBA 5T41A 3PM9A 5HROA 1RK8A 3KG1A 3ICLA 2N3OA 3HO1A 1JLCB 2XNQA 5K8MA 1Y5IB 1VLYA 2V4RA 1KQKA 5B0EA 1UL3A 4KHMA 3PR5B 1JJ4A 2AQ4A 2DNYA 1S7HA 1YIJS 5E7OB 1QY7A 1URRA 2APOA 4YUDA 3NWGA 3HVRA 5DO2A 3FGVA 4A8WA 1S1VB 7FDRA 1DHMA 2ZJQQ 2R7UA 3PEHA 2FJDB 4C98A 1RTHA 2ZE2B 3QIDA 1OO0B 2UU9F 2K8GA 3CC4S 4C8ZA 3NCPA 5EWFA 5KFTA 5IT0A 4K4VA 1NJIT 3MXHP 5GMKa 2RRBA 1S6PA 3SFGA 3J7ZT 1S1TA 1KLNA 2CQDA 1GAOA 1Y9OA 5CH7B 2YX1A 3BO3A 5L1IA 1TK5A 5HMXA 4ECTA 5IS2A 3C3LA 2O66A 3PY8A 3K5PA 5KG6A 2MQPA 2G4BA 3OQ2A 3RU0A 2WOMA 4JI7F 4I67A 1HYSA 1VGYA 4F3OA 3HF5A 2B9WA 1D8ZA 2IJFA 4OHZA 1PC4A 3MR2A 4XK8C 4RU2A 2B7CB 3MM5A 3HJFA 4TY9A 4OX7A 4ETZA 5HP1A 2XO7A 2W9CA 1BQXA 4A8SA 2JEIA 2AP6A 3TVZA 3NBPB 1N48A 3FNNA 3DLGA 3OR2A 3VF0B 3PX4A 1FVSA 1GH8A 1ZBTA 2DGQA 1U1LA 4KAIA 4A8KA 2F9DA 2V9WA 3I9ZA 1R8CA 2D1CA 1XTZA 2MY7A 5M2PA 3K58A 1S0VA 3MOZA 4QIWD 3KOAA 1QLNA 4J9PA 1F5AA 1J5EF 1Q4RA 2B4PA 2XLKA 2ZOMA 4HTIA 4QPXA 3B4DA 3DU5A 2GJ2A 1VQKS 3D0HE 2ZD1B 5F8IA 4N5SA 2OSRA 2NSBA 5I4MA 4PUOB 1B0TA 3DRXA 1Q8LA 2ACYA 3TAPA 4DV5F 1MU2B 2Y1RI 3K5MA 2Y0SD 4BDPA 2ZHBA 3UR3C 1SH0A 2D41A 4HH1A 1SL1A 2GQQA 1SUQB 5A0YA 2IBKA 4DPOA 2HHVA 1Y5NB 2W4CA 3R5CA 4P7TA 2W9BA 3THTA 3EYZA 4ECXA 1NKCA 2YWHA 1FD2A 3CJ4A 4V19J 2P6TA 2XMUA 3GIMA 3TVYA 2DPJA 2UUTA 2FPHX 4F4WA 5G0RA 1HR0F 2ZH7A 2JC0A 2YKPA 3SSRA 4FS2A 1UVNA 1Y3KA 1TK8A 1D1UA 3X3UA 2A3JA 1UWBB 2RF2A 1FXRA 3ULHA 1V6HA 2J5AA 1PSDA 2Z4PA 5C24A 3MPWA 3HMJG 4RUAA 1DZ5A 1CQMA 1WWHA 3OR1A 4K4SA 2IM3A 2NYIA 5GAEI 1M5KC 5L1LA 3PRBA 4ZPTR 5KFSA 5FIIA 3ITHA 1N6QA 2BRKA 3FZ2A 1RDRA 3TO8A 1S6PB 3R27A 5LJ3Y 3CIMA 3OV7A 3MWBA 3ISZA 4Q44A 3AY0A 3PKMA 3LANA 5B0DA 2XCAA 3T3FA 4LIRA 4TU7A 1RJJA 4WYLA 3HHLC 1UFLA 1REVB 4UUXA 5F3ZA 5D78A 5F8LA 2DVIA 2E7WA 3THPA 1RYRA 2WW8A 2AYGA